3ZC9A

Crystal structure of murraya koenigii miraculin-like protein at 2.2 a resolution at ph 4.6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
DPLLDINGNVVEASRDYYLVSVIGGAGGGGLTLYRGRNELCPLDVIQLSPDLHKGTRLRFAAYNNTSIIHEAVDLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQGTYEIVHCPSVCKSCVFLCNDVGVSYDYRRRLALTAGNERVFGVVIVPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN INHIBITOR
publication title Structural Insights Into the Aggregation Behavior of Murraya Koenigii Miraculin-Like Protein Below Ph 7.5.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 38
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3zc9A00
4ISQA 1DFQA 3BA7A 1BASA 4D8HA 1BFCA 2IWTB 3RTIB 2D23A 2WRYA 3VSFA 1S0CA 5G00A 1PC8B 1RG8A 2AXMA 2X2TA 2FO1A 1HCEA 3BB2A 3RMXA 1FV2A 3FJAA 4CJMA 2RQ9A 4G6MA 3CA0A 3LLPA 1K5UA 3I29B 1HWMB 4KEKA 5B2HA 4JKXB 4I4OA 2X2SA 4DCKC 3EF2A 1XZZA 1JT7A 3O3QA 3ZXDA 2DS0A 2Y9FA 3FJFA 3NBNA 4I4YA 3WO2A 3LTQA 4OWKA 4XFSA 6I1BA 4LO1C 1FN0A 1QXMA 4EB2B 1BLAA 1RMLA 2D7RA 9ILBA 3FJCA 1IT0A 3BA4A 4IZXA 3BX1C 3AH4A 1DFCA 2R9KB 3NBDA 1G9CA 4X37A 4J23B 3P6IA 1SZ6B 1S0LA 1YXWA 1Z2VA 4EFRA 3BTAA 2ESUA 5BQUA 3AH2A 3P53A 3V0BB 2VUAA 1JY0A 2ET2A 3HMYA 4AN6A 1L2HA 5FNWA 4I4UA 4PC4A 3F62B 2F2FA 3CA3A 3O44A 3ZC9A 4J2KA 1TFMB 1YBIA 4X3AA 2I1BA 4ZLBB 3N0KA 3FJDA 4YOLA 5F8WA 1WD4A 1HIBA 2KI4A 3BAUA 2D43A 3OGFA 2LIEA 3VSZA 3R4SA 2NTDA 3FGMA 3N7LA 1KNMA 4QBVA 2KKIA 3JRRA 2MC2A 4I4VA 1S0GA 2QYIB 3AZWA 3FJBA 3NBCA 2L5XA 2AFGA 4LO7C 1AVXB 4I2SA 3H6RA 2NVHA 4Z9WB 1FQ9A 3QR5A 1EV2A 4G6JA 2AAIB 3AJ6A 4F34A 1ISXA 3W9TA 4TLPA 4A7ZA 2ZR1B 4OWJA 3IAGC 4KEIA 3WMUA 3CRHA 5BP5A 3V0AB 3PMEA 3BAVA 4OEGA 1S0DA 4QO3A 3ZC8A 4LO8B 3C9ZA 3VT2A 5EG6C 4Q9GA 5JLVA 1R8OA 3O5WB 3BAOA 1EVTA 3OJ2A 4P0LA 3CRIA 1DJSB 1JT5A 4R6UB 1BFGA 4GP3A 1JLYA 2KLLA 4I4QA 2NM1A 1ILR1 3SNVA 3O49A 3FJ9A 3MPPG 3CA6A 3HOMA 2GO2A 1II4A 3CA5A 4A7KA 4EEEB 4DEPA 1VCLA 3CA1A 3CRGA 3RSJA 1G82A 1EYLA 1YYNA 4LO1A 3K1XA 4P0JA 3OGGA 2VSEA 3UDAA 3UJ0A 2AQZA 4KEJA 2Z49A 5BVPI 4I37A 1HWPB 5DVHA 1V6UA 2KI6B 2DRZA 2D22A 2M49A 4IYBA 1XYFA 4X39A 3UD8A 2Y9GA 2WBCA 4WBCA 4ZFWB 4I1BA 1J0SA 3P6JA 1E0OA 4I4XA 3WMVA 5E24E 1ONKB 5FZYA 1V6VA 2HWAA 5BOWA 4I1EA 3FJIA 2IHOA 4ZBVB 3V79C 1IJTA 1R8NA 4FGFA 1A8DA 2NP0A 4JRAA 5BXPA 3WA1A 3BA5A 2D20A 3H6SE 3IM6A 3IM5A 1PWAA 31BIA 3BAHA 2VU9A 2E4MC 3VUOA 3PHZA 1TWMA 3AZVA 3AJ5A 1IOBA 5D61A 4ZOTA 2F8XC 1UPSA 4I3NA 3ZXGA 1S0BA 4ZKTB 1ABRB 1D0HA 4J2SA 4USPA 3T8SA 3ILAA 3OBTA 2RSTA 3CA4A 3N7JA 4IY8A 2BFHA 5DZUA 5EHAA 3AKHA 4DENA 2QN4A 3FJHA 3S8KA 2MIBA 5BXTA 2K43A 3A21A 1ISWA 4LO0C 5F90A 1BLDA 1IRPA 1BARA 4G9MA 1FWVA 4A7YA 3BAQA 4FVVA 1IILA 3UD9A 4QC4A 3A22A 2Y9WC 1W3FA 2FGFA 3MALA 3E8LC 5EC5A 4IQPA 1W3GA 4HR6C 5HPZA 4LO3C 3IIRA 1FGAA 5F8YA 1AXMA 1G9AA 4II0A 5GAQA 2Z48A 2ZQOA 1YTOA 1AVWB 2D44A 3JUTA 3S8JA 2XOAA 1Z0HA 4IONA 1CE7B 4IZEA 1TWEA 1JTCA 1GGPB 1I1EA 3HALA 4X38A 1BA7A 3IM7A 2D7IA 4JKQA 1Z4SA 1AVUA 3RMYA 4QD2B 3CQAA 1NUNA 5BXSA 1DZDA 1TOOA 4ZFUB 3V0AA 4G1RA 3WO3A 3UD7A 5FZZA 3WINC 1JT4A 4D0ZA 4GOYA 2NZ9A 5FZUA 3VEQA 4IY9A 4USOA 1P63A 1ISVA 2NYYA 4F83A 3HSMA 3FFZA 1TIEA 3H6QA 4L4HA 2KH2A 3PG0A 4H9WA 3BADA 3N7MA 4ZA3B 1WBAA 2E4MA 2K8RA 1XHBA 3HBWA 4IHZA 2UUSA 1FV3A 4I4RA 3CAHA 3TC2A 1ITBA 4HA2A 5BXRA 3NBEA 5FNXA 3QYDA 4XFUA 1PUUB 5DUYA 4QKSA 2K4AB 1MD6A 5I1BA 1TP0A 4QKRA 4LO7B 3FUOA 4EKXB 1IHKA 2HZ9A 2BEBA 1T9FA 3FJKA 3AH1A 1QQLA 3OJMA 4XFTA 1NZKA 2VLCA 3BAGA 1DQGA 1F31A 1DZCA 3UJ4A 1M16A 1AVAC 3F1RA 4G9NA 3FJEA 2D1ZA 3OJVA 4LO0A 1RZOB 4I8MA 1SR4C 4I6IA 1W3AA 4HJJA 4I96A 1IRAX 4Z8SB 4LO2C 3VT0A 2HW9A 2Y9XE 1DQOA 3O4BA 2J3PA 2P23A 2P39A 1OQLB 4QBCA 4Q9PA 4I4SA 4LO3A 3H6RB 1WBCA 4ZGRB 3BRDA 1QQKA 4JAWA 4EFPA 2VXRA 5F8SA 4AN7B 1JLXA 1Q1UA 2GZBA 1N4KA 3POKA 3Q7XA 4H04A 4QD2C 1BFFA 1K5VA 3VWCA 3O4AA 4OEFA 2Q9XA 3FUQA 3O4DA 4OUJA 1HCDA 3OBRA 1FMZA 41BIA 1RY7A 4OWLA 4OEEA 3O4CA 4GOVA 3O4OA 1AF9A 2RG9B 1PZZA 3WINA 5DSSB 3AKIA 4KC3A 1V6WA 1Q04A 3BRGC 5D63A 1DIWA 2DREA 3FJJA 3BRFA 3HN1A 2DRYA 2LIQA 4JP0A 3A23A 4I7IA 1M2TB 2FDBM 1JQZA 2D24A 3VT1A 2YUGA 3I2AA 1MC9A 1CVSA 3ZX7A 3N7KA 2ZQNA 3RTJB 1T4QA 1YF8B 2FFUA 21BIA 1PUMB 5BQUC 3KMVA 4QALA 3V0BA 4I0YA 2VXTI 2Q3NB 1S0EA 3R4UA 3PUBA 4GP0A 1FWUA 4JQ0A 1G9DA 3AKFA 4L4IA 1AFCA 2ERMA 3Q7YA 4P6AA 7I1BA 4ISRA 2F2FC 4J2XA 1S0FA 1WD3A 3Q7WA 1V6XA 4I4PA 1XG6A 4GAIA 1ISZA 1Q03A 4ENDA 5JMCA 3I2XA 1ISYA 3WO4A 2FFVA 4J2YA 1EPWA 2MLLB 3A07A 4XKIA 4GAFA 5D62A 8I1BA 1SR4A 1JT3A 1I1BA 4ZFYB 4D0TA 1TTUA 1DLLA 4LO2A 3B9UA 3CU1B 3D7WB 4JPZA 3FJ8A 3NJ5A 4EFQA 1HKNA 3AKGA 1G9BA 1FMMS 2HWMA 1HWOB 4OW4A 2BEAA 1BFBA 4KBBA 4P0KA 4Q91A 1HWNB 5BP5C 2VSAA
chains in the Genus database with same CATH superfamily
4ISQA 1DFQA 3BA7A 1BASA 4D8HA 1BFCA 2IWTB 3RTIB 2D23A 2WRYA 3VSFA 1S0CA 5G00A 1PC8B 1RG8A 2AXMA 2X2TA 2FO1A 1HCEA 3BB2A 3RMXA 1FV2A 3FJAA 4CJMA 2RQ9A 4G6MA 3CA0A 3LLPA 1K5UA 3I29B 1HWMB 4KEKA 5B2HA 4JKXB 4I4OA 2X2SA 4DCKC 3EF2A 1XZZA 1JT7A 3O3QA 3ZXDA 2DS0A 2Y9FA 3FJFA 4UY4A 3NBNA 4MZGB 4I4YA 3WO2A 3LTQA 4OWKA 4XFSA 6I1BA 4LO1C 1FN0A 1QXMA 4EB2B 1BLAA 1RMLA 2D7RA 9ILBA 3FJCA 1IT0A 3BA4A 4IZXA 3BX1C 3AH4A 1DFCA 2R9KB 3NBDA 1G9CA 4X37A 4J23B 3P6IA 1SZ6B 1S0LA 1YXWA 1Z2VA 4EFRA 3BTAA 2ESUA 5BQUA 3AH2A 3P53A 3V0BB 2VUAA 1JY0A 2ET2A 3HMYA 4AN6A 1L2HA 5FNWA 4I4UA 4PC4A 3F62B 2F2FA 3CA3A 3O44A 3ZC9A 4J2KA 1TFMB 1YBIA 4X3AA 2I1BA 4ZLBB 3N0KA 3FJDA 4YOLA 5F8WA 1WD4A 1HIBA 2KI4A 3BAUA 2D43A 3OGFA 2LIEA 3VSZA 3R4SA 2NTDA 3FGMA 3N7LA 1KNMA 4QBVA 2KKIA 3JRRA 2MC2A 4I4VA 1S0GA 2QYIB 3AZWA 3FJBA 3NBCA 2L5XA 2AFGA 4LO7C 1AVXB 4I2SA 3H6RA 2NVHA 4Z9WB 1FQ9A 3QR5A 1EV2A 4G6JA 2AAIB 3AJ6A 4F34A 1ISXA 3W9TA 4TLPA 4A7ZA 2ZR1B 4OWJA 3IAGC 4KEIA 3WMUA 3CRHA 5BP5A 3V0AB 3PMEA 3BAVA 4OEGA 1S0DA 4QO3A 3ZC8A 4LO8B 3C9ZA 3VT2A 5EG6C 4Q9GA 5JLVA 1R8OA 3O5WB 3BAOA 1EVTA 3OJ2A 4P0LA 3CRIA 1DJSB 1JT5A 4R6UB 1BFGA 4GP3A 1JLYA 2KLLA 4I4QA 2NM1A 1ILR1 3SNVA 3O49A 3FJ9A 3MPPG 3CA6A 3HOMA 2GO2A 1II4A 3CA5A 4A7KA 4EEEB 4MZFB 4DEPA 1VCLA 3CA1A 3CRGA 3RSJA 1G82A 1EYLA 1YYNA 4LO1A 3K1XA 4P0JA 3OGGA 2VSEA 3UDAA 3UJ0A 2AQZA 4KEJA 2Z49A 5BVPI 4I37A 1HWPB 5DVHA 1V6UA 2KI6B 4H75A 2DRZA 2D22A 2M49A 4IYBA 1XYFA 4X39A 3UD8A 2Y9GA 2WBCA 4WBCA 4ZFWB 4I1BA 1J0SA 3P6JA 1E0OA 4I4XA 3WMVA 5E24E 1ONKB 5FZYA 1V6VA 2HWAA 5BOWA 4I1EA 3FJIA 2IHOA 4ZBVB 3V79C 1IJTA 1R8NA 4FGFA 1A8DA 2NP0A 4JRAA 5BXPA 3WA1A 3BA5A 2D20A 3H6SE 3IM6A 3IM5A 1PWAA 31BIA 3BAHA 2VU9A 2E4MC 3VUOA 3PHZA 1TWMA 3AZVA 3AJ5A 1IOBA 5D61A 4ZOTA 2F8XC 1UPSA 4I3NA 3ZXGA 1S0BA 4ZKTB 1ABRB 1D0HA 4J2SA 4USPA 3T8SA 3ILAA 3OBTA 2RSTA 3CA4A 3N7JA 4IY8A 2BFHA 5DZUA 5EHAA 3AKHA 4DENA 2QN4A 3FJHA 3S8KA 2MIBA 5BXTA 2K43A 3A21A 1ISWA 4LO0C 5F90A 1BLDA 1IRPA 1BARA 4G9MA 1FWVA 4A7YA 3BAQA 4FVVA 1IILA 3UD9A 4QC4A 3A22A 2Y9WC 1W3FA 2FGFA 3MALA 3E8LC 5EC5A 4IQPA 1W3GA 4HR6C 5HPZA 4LO3C 3IIRA 1FGAA 5F8YA 1AXMA 1G9AA 4II0A 5GAQA 2Z48A 2ZQOA 1YTOA 1AVWB 2D44A 3JUTA 3S8JA 2XOAA 1Z0HA 4IONA 1CE7B 4IZEA 1TWEA 1JTCA 1GGPB 1I1EA 3HALA 4X38A 1BA7A 3IM7A 2D7IA 4JKQA 1Z4SA 1AVUA 3RMYA 4QD2B 3CQAA 1NUNA 5BXSA 1DZDA 1TOOA 4ZFUB 3V0AA 4G1RA 3WO3A 3UD7A 5FZZA 3WINC 1JT4A 4D0ZA 4GOYA 2NZ9A 5FZUA 3VEQA 4IY9A 4USOA 1P63A 1ISVA 2NYYA 4F83A 3HSMA 3FFZA 1TIEA 3H6QA 4L4HA 2KH2A 3PG0A 4H9WA 3BADA 3N7MA 4ZA3B 1WBAA 2E4MA 2K8RA 1XHBA 3HBWA 4IHZA 2UUSA 1FV3A 4I4RA 2NS2A 3CAHA 1ITBA 3TC2A 4HA2A 5BXRA 3NBEA 5FNXA 3QYDA 4XFUA 1PUUB 5DUYA 4QKSA 2K4AB 1MD6A 5I1BA 1TP0A 4QKRA 4LO7B 3FUOA 4EKXB 1IHKA 2HZ9A 2BEBA 1T9FA 3FJKA 3AH1A 1QQLA 3OJMA 4XFTA 1NZKA 2VLCA 3BAGA 1DQGA 1F31A 1DZCA 3UJ4A 1M16A 1AVAC 3F1RA 4G9NA 3FJEA 2D1ZA 3OJVA 4LO0A 1RZOB 4I8MA 1SR4C 4I6IA 1W3AA 4HJJA 4I96A 1IRAX 4Z8SB 4LO2C 3VT0A 2HW9A 2Y9XE 1DQOA 3O4BA 2J3PA 2P23A 2P39A 1OQLB 4QBCA 4Q9PA 4I4SA 4LO3A 3H6RB 1WBCA 4ZGRB 3BRDA 1QQKA 4JAWA 4EFPA 2VXRA 5F8SA 4AN7B 1JLXA 1Q1UA 2GZBA 1N4KA 3POKA 3Q7XA 4H04A 4QD2C 1BFFA 1K5VA 3VWCA 3O4AA 4OEFA 2Q9XA 3FUQA 3O4DA 4OUJA 1HCDA 3OBRA 1FMZA 41BIA 1RY7A 4MZHA 4OWLA 4OEEA 3O4CA 4GOVA 3O4OA 1AF9A 2RG9B 1PZZA 3WINA 5DSSB 3AKIA 4KC3A 1V6WA 1Q04A 3BRGC 5D63A 1DIWA 2DREA 3FJJA 3BRFA 3HN1A 2DRYA 2LIQA 4JP0A 3A23A 4I7IA 1M2TB 2FDBM 1JQZA 2D24A 3VT1A 2YUGA 3I2AA 1MC9A 1CVSA 3ZX7A 3N7KA 2ZQNA 3RTJB 1T4QA 1YF8B 2FFUA 21BIA 1PUMB 5BQUC 3KMVA 4QALA 3V0BA 4I0YA 2VXTI 2Q3NB 1S0EA 3R4UA 3PUBA 4GP0A 1FWUA 4JQ0A 1G9DA 3AKFA 4L4IA 1AFCA 2ERMA 3Q7YA 4P6AA 7I1BA 4ISRA 2F2FC 4J2XA 1S0FA 1WD3A 3Q7WA 1V6XA 4I4PA 1XG6A 4GAIA 1ISZA 1Q03A 4ENDA 5JMCA 3I2XA 1ISYA 3WO4A 2FFVA 4J2YA 1EPWA 2MLLB 3A07A 4XKIA 4GAFA 5D62A 8I1BA 1SR4A 1JT3A 1I1BA 4ZFYB 4D0TA 1TTUA 1DLLA 4LO2A 3B9UA 3CU1B 3D7WB 4JPZA 3FJ8A 3NJ5A 4EFQA 1HKNA 3AKGA 1G9BA 1FMMS 2HWMA 1HWOB 4OW4A 2BEAA 1BFBA 4KBBA 4P0KA 4Q91A 1HWNB 5BP5C 2VSAA
chains in the Genus database with same CATH topology
4ISQA 1DFQA 3BA7A 1BASA 4D8HA 1BFCA 2IWTB 3RTIB 2D23A 2WRYA 3VSFA 1S0CA 5G00A 1PC8B 1RG8A 2AXMA 2X2TA 2FO1A 1HCEA 3BB2A 3RMXA 1FV2A 3FJAA 4CJMA 2RQ9A 4G6MA 3CA0A 3LLPA 1K5UA 3I29B 1HWMB 4KEKA 5B2HA 4JKXB 4I4OA 2X2SA 4DCKC 3EF2A 1XZZA 1JT7A 3O3QA 3ZXDA 2DS0A 2Y9FA 3FJFA 4UY4A 3NBNA 4MZGB 4I4YA 3WO2A 3LTQA 4OWKA 4XFSA 6I1BA 4LO1C 1FN0A 1QXMA 4EB2B 1BLAA 1RMLA 2D7RA 9ILBA 3FJCA 1IT0A 3BA4A 4IZXA 3BX1C 3AH4A 1DFCA 2R9KB 3NBDA 1G9CA 4X37A 4J23B 3P6IA 1SZ6B 1S0LA 1YXWA 1Z2VA 4EFRA 3BTAA 2ESUA 5BQUA 3AH2A 3P53A 3V0BB 2VUAA 1JY0A 2ET2A 3HMYA 4AN6A 1L2HA 5FNWA 4I4UA 4PC4A 3F62B 2F2FA 3CA3A 3O44A 3ZC9A 4J2KA 1TFMB 1YBIA 4X3AA 2I1BA 4ZLBB 3N0KA 3FJDA 4YOLA 5F8WA 1WD4A 1HIBA 2KI4A 3BAUA 2D43A 3OGFA 2LIEA 3VSZA 3R4SA 2NTDA 3FGMA 3N7LA 1KNMA 4QBVA 2KKIA 3JRRA 2MC2A 4I4VA 1S0GA 2QYIB 3AZWA 3FJBA 3NBCA 2L5XA 2AFGA 4LO7C 1AVXB 4I2SA 3H6RA 2NVHA 4Z9WB 1FQ9A 3QR5A 1EV2A 4G6JA 2AAIB 3AJ6A 4F34A 1ISXA 3W9TA 4TLPA 4A7ZA 2ZR1B 4OWJA 3IAGC 4KEIA 3WMUA 3CRHA 5BP5A 3V0AB 3PMEA 3BAVA 4OEGA 1S0DA 4QO3A 3ZC8A 4LO8B 3C9ZA 3VT2A 5EG6C 4Q9GA 5JLVA 1R8OA 3O5WB 3BAOA 1EVTA 3OJ2A 4P0LA 3CRIA 1DJSB 1JT5A 4R6UB 1BFGA 4GP3A 1JLYA 2KLLA 4I4QA 2NM1A 1ILR1 3SNVA 3O49A 3FJ9A 3MPPG 3CA6A 3HOMA 2GO2A 1II4A 3CA5A 4A7KA 4EEEB 4MZFB 4DEPA 1VCLA 3CA1A 3CRGA 3RSJA 1G82A 1EYLA 1YYNA 4LO1A 3K1XA 4P0JA 3OGGA 2VSEA 3UDAA 3UJ0A 2AQZA 4KEJA 2Z49A 5BVPI 4I37A 1HWPB 5DVHA 1V6UA 2KI6B 4H75A 2DRZA 2D22A 2M49A 4IYBA 1XYFA 4X39A 3UD8A 2Y9GA 2WBCA 4WBCA 4ZFWB 4I1BA 1J0SA 3P6JA 1E0OA 4I4XA 3WMVA 5E24E 1ONKB 5FZYA 1V6VA 2HWAA 5BOWA 4I1EA 3FJIA 2IHOA 4ZBVB 3V79C 1IJTA 1R8NA 4FGFA 1A8DA 2NP0A 4JRAA 5BXPA 3WA1A 3BA5A 2D20A 3H6SE 3IM6A 3IM5A 1PWAA 31BIA 3BAHA 2VU9A 2E4MC 3VUOA 3PHZA 1TWMA 3AZVA 3AJ5A 1IOBA 5D61A 4ZOTA 2F8XC 1UPSA 4I3NA 3ZXGA 1S0BA 4ZKTB 1ABRB 1D0HA 4J2SA 4USPA 3T8SA 3ILAA 3OBTA 2RSTA 3CA4A 3N7JA 4IY8A 2BFHA 5DZUA 5EHAA 3AKHA 4DENA 2QN4A 3FJHA 3S8KA 2MIBA 5BXTA 2K43A 3A21A 1ISWA 4LO0C 5F90A 1BLDA 1IRPA 1BARA 4G9MA 1FWVA 4A7YA 3BAQA 4FVVA 1IILA 3UD9A 4QC4A 3A22A 2Y9WC 1W3FA 2FGFA 3MALA 3E8LC 5EC5A 4IQPA 1W3GA 4HR6C 5HPZA 4LO3C 3IIRA 1FGAA 5F8YA 1AXMA 1G9AA 4II0A 5GAQA 2Z48A 2ZQOA 1YTOA 1AVWB 2D44A 3JUTA 3S8JA 2XOAA 1Z0HA 4IONA 1CE7B 4IZEA 1TWEA 1JTCA 1GGPB 1I1EA 3HALA 4X38A 1BA7A 3IM7A 2D7IA 4JKQA 1Z4SA 1AVUA 3RMYA 4QD2B 3CQAA 1NUNA 5BXSA 1DZDA 1TOOA 4ZFUB 3V0AA 4G1RA 3WO3A 3UD7A 5FZZA 3WINC 1JT4A 4D0ZA 4GOYA 2NZ9A 5FZUA 3VEQA 4IY9A 4USOA 1P63A 1ISVA 2NYYA 4F83A 3HSMA 3FFZA 1TIEA 3H6QA 4L4HA 2KH2A 3PG0A 4H9WA 3BADA 3N7MA 4ZA3B 1WBAA 2E4MA 2K8RA 1XHBA 3HBWA 4IHZA 2UUSA 1FV3A 4I4RA 2NS2A 3CAHA 1ITBA 3TC2A 4HA2A 5BXRA 3NBEA 5FNXA 3QYDA 4XFUA 1PUUB 5DUYA 4QKSA 2K4AB 1MD6A 5I1BA 1TP0A 4QKRA 4LO7B 3FUOA 4EKXB 1IHKA 2HZ9A 2BEBA 1T9FA 3FJKA 3AH1A 1QQLA 3OJMA 4XFTA 1NZKA 2VLCA 3BAGA 1DQGA 1F31A 1DZCA 3UJ4A 1M16A 1AVAC 3F1RA 4G9NA 3FJEA 2D1ZA 3OJVA 4LO0A 1RZOB 4I8MA 1SR4C 4I6IA 1W3AA 4HJJA 4I96A 1IRAX 4Z8SB 4LO2C 3VT0A 2HW9A 2Y9XE 1DQOA 3O4BA 2J3PA 2P23A 2P39A 1OQLB 4QBCA 4Q9PA 4I4SA 4LO3A 3H6RB 1WBCA 4ZGRB 3BRDA 1QQKA 4JAWA 4EFPA 2VXRA 5F8SA 4AN7B 1JLXA 1Q1UA 2GZBA 1N4KA 3POKA 3Q7XA 4H04A 4QD2C 1BFFA 1K5VA 3VWCA 3O4AA 4OEFA 2Q9XA 3FUQA 3O4DA 4OUJA 1HCDA 3OBRA 1FMZA 41BIA 1RY7A 4MZHA 4OWLA 4OEEA 3O4CA 4GOVA 3O4OA 1AF9A 2RG9B 1PZZA 3WINA 5DSSB 3AKIA 4KC3A 1V6WA 1Q04A 3BRGC 5D63A 1DIWA 2DREA 3FJJA 3BRFA 3HN1A 2DRYA 2LIQA 4JP0A 3A23A 4I7IA 1M2TB 2FDBM 1JQZA 2D24A 3VT1A 2YUGA 3I2AA 1MC9A 1CVSA 3ZX7A 3N7KA 2ZQNA 3RTJB 1T4QA 1YF8B 2FFUA 21BIA 1PUMB 5BQUC 3KMVA 4QALA 3V0BA 4I0YA 2VXTI 2Q3NB 1S0EA 3R4UA 3PUBA 4GP0A 1FWUA 4JQ0A 1G9DA 3AKFA 4L4IA 1AFCA 2ERMA 3Q7YA 4P6AA 7I1BA 4ISRA 2F2FC 4J2XA 1S0FA 1WD3A 3Q7WA 1V6XA 4I4PA 1XG6A 4GAIA 1ISZA 1Q03A 4ENDA 5JMCA 3I2XA 1ISYA 3WO4A 2FFVA 4J2YA 1EPWA 2MLLB 3A07A 4XKIA 4GAFA 5D62A 8I1BA 1SR4A 1JT3A 1I1BA 4ZFYB 4D0TA 1TTUA 1DLLA 4LO2A 3B9UA 3CU1B 3D7WB 4JPZA 3FJ8A 3NJ5A 4EFQA 1HKNA 3AKGA 1G9BA 1FMMS 2HWMA 1HWOB 4OW4A 2BEAA 1BFBA 4KBBA 4P0KA 4Q91A 1HWNB 5BP5C 2VSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISQ A;  1DFQ A;  3BA7 A;  1BAS A;  4D8H A;  1BFC A;  2IWT B;  3RTI B;  2D23 A;  2WRY A;  3VSF A;  1S0C A;  5G00 A;  1PC8 B;  1RG8 A;  2AXM A;  2X2T A;  2FO1 A;  1HCE A;  3BB2 A;  3RMX A;  1FV2 A;  3FJA A;  4CJM A;  2RQ9 A;  4G6M A;  3CA0 A;  3LLP A;  1K5U A;  3I29 B;  1HWM B;  4KEK A;  5B2H A;  4JKX B;  4I4O A;  2X2S A;  4DCK C;  3EF2 A;  1XZZ A;  1JT7 A;  3O3Q A;  3ZXD A;  2DS0 A;  2Y9F A;  3FJF A;  3NBN A;  4I4Y A;  3WO2 A;  3LTQ A;  4OWK A;  4XFS A;  6I1B A;  4LO1 C;  1FN0 A;  1QXM A;  4EB2 B;  1BLA A;  1RML A;  2D7R A;  9ILB A;  3FJC A;  1IT0 A;  3BA4 A;  4IZX A;  3BX1 C;  3AH4 A;  1DFC A;  2R9K B;  3NBD A;  1G9C A;  4X37 A;  4J23 B;  3P6I A;  1SZ6 B;  1S0L A;  1YXW A;  1Z2V A;  4EFR A;  3BTA A;  2ESU A;  5BQU A;  3AH2 A;  3P53 A;  3V0B B;  2VUA A;  1JY0 A;  2ET2 A;  3HMY A;  4AN6 A;  1L2H A;  5FNW A;  4I4U A;  4PC4 A;  3F62 B;  2F2F A;  3CA3 A;  3O44 A;  3ZC9 A;  4J2K A;  1TFM B;  1YBI A;  4X3A A;  2I1B A;  4ZLB B;  3N0K A;  3FJD A;  4YOL A;  5F8W A;  1WD4 A;  1HIB A;  2KI4 A;  3BAU A;  2D43 A;  3OGF A;  2LIE A;  3VSZ A;  3R4S A;  2NTD A;  3FGM A;  3N7L A;  1KNM A;  4QBV A;  2KKI A;  3JRR A;  2MC2 A;  4I4V A;  1S0G A;  2QYI B;  3AZW A;  3FJB A;  3NBC A;  2L5X A;  2AFG A;  4LO7 C;  1AVX B;  4I2S A;  3H6R A;  2NVH A;  4Z9W B;  1FQ9 A;  3QR5 A;  1EV2 A;  4G6J A;  2AAI B;  3AJ6 A;  4F34 A;  1ISX A;  3W9T A;  4TLP A;  4A7Z A;  2ZR1 B;  4OWJ A;  3IAG C;  4KEI A;  3WMU A;  3CRH A;  5BP5 A;  3V0A B;  3PME A;  3BAV A;  4OEG A;  1S0D A;  4QO3 A;  3ZC8 A;  4LO8 B;  3C9Z A;  3VT2 A;  5EG6 C;  4Q9G A;  5JLV A;  1R8O A;  3O5W B;  3BAO A;  1EVT A;  3OJ2 A;  4P0L A;  3CRI A;  1DJS B;  1JT5 A;  4R6U B;  1BFG A;  4GP3 A;  1JLY A;  2KLL A;  4I4Q A;  2NM1 A;  1ILR 1;  3SNV A;  3O49 A;  3FJ9 A;  3MPP G;  3CA6 A;  3HOM A;  2GO2 A;  1II4 A;  3CA5 A;  4A7K A;  4EEE B;  4DEP A;  1VCL A;  3CA1 A;  3CRG A;  3RSJ A;  1G82 A;  1EYL A;  1YYN A;  4LO1 A;  3K1X A;  4P0J A;  3OGG A;  2VSE A;  3UDA A;  3UJ0 A;  2AQZ A;  4KEJ A;  2Z49 A;  5BVP I;  4I37 A;  1HWP B;  5DVH A;  1V6U A;  2KI6 B;  2DRZ A;  2D22 A;  2M49 A;  4IYB A;  1XYF A;  4X39 A;  3UD8 A;  2Y9G A;  2WBC A;  4WBC A;  4ZFW B;  4I1B A;  1J0S A;  3P6J A;  1E0O A;  4I4X A;  3WMV A;  5E24 E;  1ONK B;  5FZY A;  1V6V A;  2HWA A;  5BOW A;  4I1E A;  3FJI A;  2IHO A;  4ZBV B;  3V79 C;  1IJT A;  1R8N A;  4FGF A;  1A8D A;  2NP0 A;  4JRA A;  5BXP A;  3WA1 A;  3BA5 A;  2D20 A;  3H6S E;  3IM6 A;  3IM5 A;  1PWA A;  31BI A;  3BAH A;  2VU9 A;  2E4M C;  3VUO A;  3PHZ A;  1TWM A;  3AZV A;  3AJ5 A;  1IOB A;  5D61 A;  4ZOT A;  2F8X C;  1UPS A;  4I3N A;  3ZXG A;  1S0B A;  4ZKT B;  1ABR B;  1D0H A;  4J2S A;  4USP A;  3T8S A;  3ILA A;  3OBT A;  2RST A;  3CA4 A;  3N7J A;  4IY8 A;  2BFH A;  5DZU A;  5EHA A;  3AKH A;  4DEN A;  2QN4 A;  3FJH A;  3S8K A;  2MIB A;  5BXT A;  2K43 A;  3A21 A;  1ISW A;  4LO0 C;  5F90 A;  1BLD A;  1IRP A;  1BAR A;  4G9M A;  1FWV A;  4A7Y A;  3BAQ A;  4FVV A;  1IIL A;  3UD9 A;  4QC4 A;  3A22 A;  2Y9W C;  1W3F A;  2FGF A;  3MAL A;  3E8L C;  5EC5 A;  4IQP A;  1W3G A;  4HR6 C;  5HPZ A;  4LO3 C;  3IIR A;  1FGA A;  5F8Y A;  1AXM A;  1G9A A;  4II0 A;  5GAQ A;  2Z48 A;  2ZQO A;  1YTO A;  1AVW B;  2D44 A;  3JUT A;  3S8J A;  2XOA A;  1Z0H A;  4ION A;  1CE7 B;  4IZE A;  1TWE A;  1JTC A;  1GGP B;  1I1E A;  3HAL A;  4X38 A;  1BA7 A;  3IM7 A;  2D7I A;  4JKQ A;  1Z4S A;  1AVU A;  3RMY A;  4QD2 B;  3CQA A;  1NUN A;  5BXS A;  1DZD A;  1TOO A;  4ZFU B;  3V0A A;  4G1R A;  3WO3 A;  3UD7 A;  5FZZ A;  3WIN C;  1JT4 A;  4D0Z A;  4GOY A;  2NZ9 A;  5FZU A;  3VEQ A;  4IY9 A;  4USO A;  1P63 A;  1ISV A;  2NYY A;  4F83 A;  3HSM A;  3FFZ A;  1TIE A;  3H6Q A;  4L4H A;  2KH2 A;  3PG0 A;  4H9W A;  3BAD A;  3N7M A;  4ZA3 B;  1WBA A;  2E4M A;  2K8R A;  1XHB A;  3HBW A;  4IHZ A;  2UUS A;  1FV3 A;  4I4R A;  3CAH A;  3TC2 A;  1ITB A;  4HA2 A;  5BXR A;  3NBE A;  5FNX A;  3QYD A;  4XFU A;  1PUU B;  5DUY A;  4QKS A;  2K4A B;  1MD6 A;  5I1B A;  1TP0 A;  4QKR A;  4LO7 B;  3FUO A;  4EKX B;  1IHK A;  2HZ9 A;  2BEB A;  1T9F A;  3FJK A;  3AH1 A;  1QQL A;  3OJM A;  4XFT A;  1NZK A;  2VLC A;  3BAG A;  1DQG A;  1F31 A;  1DZC A;  3UJ4 A;  1M16 A;  1AVA C;  3F1R A;  4G9N A;  3FJE A;  2D1Z A;  3OJV A;  4LO0 A;  1RZO B;  4I8M A;  1SR4 C;  4I6I A;  1W3A A;  4HJJ A;  4I96 A;  1IRA X;  4Z8S B;  4LO2 C;  3VT0 A;  2HW9 A;  2Y9X E;  1DQO A;  3O4B A;  2J3P A;  2P23 A;  2P39 A;  1OQL B;  4QBC A;  4Q9P A;  4I4S A;  4LO3 A;  3H6R B;  1WBC A;  4ZGR B;  3BRD A;  1QQK A;  4JAW A;  4EFP A;  2VXR A;  5F8S A;  4AN7 B;  1JLX A;  1Q1U A;  2GZB A;  1N4K A;  3POK A;  3Q7X A;  4H04 A;  4QD2 C;  1BFF A;  1K5V A;  3VWC A;  3O4A A;  4OEF A;  2Q9X A;  3FUQ A;  3O4D A;  4OUJ A;  1HCD A;  3OBR A;  1FMZ A;  41BI A;  1RY7 A;  4OWL A;  4OEE A;  3O4C A;  4GOV A;  3O4O A;  1AF9 A;  2RG9 B;  1PZZ A;  3WIN A;  5DSS B;  3AKI A;  4KC3 A;  1V6W A;  1Q04 A;  3BRG C;  5D63 A;  1DIW A;  2DRE A;  3FJJ A;  3BRF A;  3HN1 A;  2DRY A;  2LIQ A;  4JP0 A;  3A23 A;  4I7I A;  1M2T B;  2FDB M;  1JQZ A;  2D24 A;  3VT1 A;  2YUG A;  3I2A A;  1MC9 A;  1CVS A;  3ZX7 A;  3N7K A;  2ZQN A;  3RTJ B;  1T4Q A;  1YF8 B;  2FFU A;  21BI A;  1PUM B;  5BQU C;  3KMV A;  4QAL A;  3V0B A;  4I0Y A;  2VXT I;  2Q3N B;  1S0E A;  3R4U A;  3PUB A;  4GP0 A;  1FWU A;  4JQ0 A;  1G9D A;  3AKF A;  4L4I A;  1AFC A;  2ERM A;  3Q7Y A;  4P6A A;  7I1B A;  4ISR A;  2F2F C;  4J2X A;  1S0F A;  1WD3 A;  3Q7W A;  1V6X A;  4I4P A;  1XG6 A;  4GAI A;  1ISZ A;  1Q03 A;  4END A;  5JMC A;  3I2X A;  1ISY A;  3WO4 A;  2FFV A;  4J2Y A;  1EPW A;  2MLL B;  3A07 A;  4XKI A;  4GAF A;  5D62 A;  8I1B A;  1SR4 A;  1JT3 A;  1I1B A;  4ZFY B;  4D0T A;  1TTU A;  1DLL A;  4LO2 A;  3B9U A;  3CU1 B;  3D7W B;  4JPZ A;  3FJ8 A;  3NJ5 A;  4EFQ A;  1HKN A;  3AKG A;  1G9B A;  1FMM S;  2HWM A;  1HWO B;  4OW4 A;  2BEA A;  1BFB A;  4KBB A;  4P0K A;  4Q91 A;  1HWN B;  5BP5 C;  2VSA A; 
#chains in the Genus database with same CATH topology
 4ISQ A;  1DFQ A;  3BA7 A;  1BAS A;  4D8H A;  1BFC A;  2IWT B;  3RTI B;  2D23 A;  2WRY A;  3VSF A;  1S0C A;  5G00 A;  1PC8 B;  1RG8 A;  2AXM A;  2X2T A;  2FO1 A;  1HCE A;  3BB2 A;  3RMX A;  1FV2 A;  3FJA A;  4CJM A;  2RQ9 A;  4G6M A;  3CA0 A;  3LLP A;  1K5U A;  3I29 B;  1HWM B;  4KEK A;  5B2H A;  4JKX B;  4I4O A;  2X2S A;  4DCK C;  3EF2 A;  1XZZ A;  1JT7 A;  3O3Q A;  3ZXD A;  2DS0 A;  2Y9F A;  3FJF A;  4UY4 A;  3NBN A;  4MZG B;  4I4Y A;  3WO2 A;  3LTQ A;  4OWK A;  4XFS A;  6I1B A;  4LO1 C;  1FN0 A;  1QXM A;  4EB2 B;  1BLA A;  1RML A;  2D7R A;  9ILB A;  3FJC A;  1IT0 A;  3BA4 A;  4IZX A;  3BX1 C;  3AH4 A;  1DFC A;  2R9K B;  3NBD A;  1G9C A;  4X37 A;  4J23 B;  3P6I A;  1SZ6 B;  1S0L A;  1YXW A;  1Z2V A;  4EFR A;  3BTA A;  2ESU A;  5BQU A;  3AH2 A;  3P53 A;  3V0B B;  2VUA A;  1JY0 A;  2ET2 A;  3HMY A;  4AN6 A;  1L2H A;  5FNW A;  4I4U A;  4PC4 A;  3F62 B;  2F2F A;  3CA3 A;  3O44 A;  3ZC9 A;  4J2K A;  1TFM B;  1YBI A;  4X3A A;  2I1B A;  4ZLB B;  3N0K A;  3FJD A;  4YOL A;  5F8W A;  1WD4 A;  1HIB A;  2KI4 A;  3BAU A;  2D43 A;  3OGF A;  2LIE A;  3VSZ A;  3R4S A;  2NTD A;  3FGM A;  3N7L A;  1KNM A;  4QBV A;  2KKI A;  3JRR A;  2MC2 A;  4I4V A;  1S0G A;  2QYI B;  3AZW A;  3FJB A;  3NBC A;  2L5X A;  2AFG A;  4LO7 C;  1AVX B;  4I2S A;  3H6R A;  2NVH A;  4Z9W B;  1FQ9 A;  3QR5 A;  1EV2 A;  4G6J A;  2AAI B;  3AJ6 A;  4F34 A;  1ISX A;  3W9T A;  4TLP A;  4A7Z A;  2ZR1 B;  4OWJ A;  3IAG C;  4KEI A;  3WMU A;  3CRH A;  5BP5 A;  3V0A B;  3PME A;  3BAV A;  4OEG A;  1S0D A;  4QO3 A;  3ZC8 A;  4LO8 B;  3C9Z A;  3VT2 A;  5EG6 C;  4Q9G A;  5JLV A;  1R8O A;  3O5W B;  3BAO A;  1EVT A;  3OJ2 A;  4P0L A;  3CRI A;  1DJS B;  1JT5 A;  4R6U B;  1BFG A;  4GP3 A;  1JLY A;  2KLL A;  4I4Q A;  2NM1 A;  1ILR 1;  3SNV A;  3O49 A;  3FJ9 A;  3MPP G;  3CA6 A;  3HOM A;  2GO2 A;  1II4 A;  3CA5 A;  4A7K A;  4EEE B;  4MZF B;  4DEP A;  1VCL A;  3CA1 A;  3CRG A;  3RSJ A;  1G82 A;  1EYL A;  1YYN A;  4LO1 A;  3K1X A;  4P0J A;  3OGG A;  2VSE A;  3UDA A;  3UJ0 A;  2AQZ A;  4KEJ A;  2Z49 A;  5BVP I;  4I37 A;  1HWP B;  5DVH A;  1V6U A;  2KI6 B;  4H75 A;  2DRZ A;  2D22 A;  2M49 A;  4IYB A;  1XYF A;  4X39 A;  3UD8 A;  2Y9G A;  2WBC A;  4WBC A;  4ZFW B;  4I1B A;  1J0S A;  3P6J A;  1E0O A;  4I4X A;  3WMV A;  5E24 E;  1ONK B;  5FZY A;  1V6V A;  2HWA A;  5BOW A;  4I1E A;  3FJI A;  2IHO A;  4ZBV B;  3V79 C;  1IJT A;  1R8N A;  4FGF A;  1A8D A;  2NP0 A;  4JRA A;  5BXP A;  3WA1 A;  3BA5 A;  2D20 A;  3H6S E;  3IM6 A;  3IM5 A;  1PWA A;  31BI A;  3BAH A;  2VU9 A;  2E4M C;  3VUO A;  3PHZ A;  1TWM A;  3AZV A;  3AJ5 A;  1IOB A;  5D61 A;  4ZOT A;  2F8X C;  1UPS A;  4I3N A;  3ZXG A;  1S0B A;  4ZKT B;  1ABR B;  1D0H A;  4J2S A;  4USP A;  3T8S A;  3ILA A;  3OBT A;  2RST A;  3CA4 A;  3N7J A;  4IY8 A;  2BFH A;  5DZU A;  5EHA A;  3AKH A;  4DEN A;  2QN4 A;  3FJH A;  3S8K A;  2MIB A;  5BXT A;  2K43 A;  3A21 A;  1ISW A;  4LO0 C;  5F90 A;  1BLD A;  1IRP A;  1BAR A;  4G9M A;  1FWV A;  4A7Y A;  3BAQ A;  4FVV A;  1IIL A;  3UD9 A;  4QC4 A;  3A22 A;  2Y9W C;  1W3F A;  2FGF A;  3MAL A;  3E8L C;  5EC5 A;  4IQP A;  1W3G A;  4HR6 C;  5HPZ A;  4LO3 C;  3IIR A;  1FGA A;  5F8Y A;  1AXM A;  1G9A A;  4II0 A;  5GAQ A;  2Z48 A;  2ZQO A;  1YTO A;  1AVW B;  2D44 A;  3JUT A;  3S8J A;  2XOA A;  1Z0H A;  4ION A;  1CE7 B;  4IZE A;  1TWE A;  1JTC A;  1GGP B;  1I1E A;  3HAL A;  4X38 A;  1BA7 A;  3IM7 A;  2D7I A;  4JKQ A;  1Z4S A;  1AVU A;  3RMY A;  4QD2 B;  3CQA A;  1NUN A;  5BXS A;  1DZD A;  1TOO A;  4ZFU B;  3V0A A;  4G1R A;  3WO3 A;  3UD7 A;  5FZZ A;  3WIN C;  1JT4 A;  4D0Z A;  4GOY A;  2NZ9 A;  5FZU A;  3VEQ A;  4IY9 A;  4USO A;  1P63 A;  1ISV A;  2NYY A;  4F83 A;  3HSM A;  3FFZ A;  1TIE A;  3H6Q A;  4L4H A;  2KH2 A;  3PG0 A;  4H9W A;  3BAD A;  3N7M A;  4ZA3 B;  1WBA A;  2E4M A;  2K8R A;  1XHB A;  3HBW A;  4IHZ A;  2UUS A;  1FV3 A;  4I4R A;  2NS2 A;  3CAH A;  1ITB A;  3TC2 A;  4HA2 A;  5BXR A;  3NBE A;  5FNX A;  3QYD A;  4XFU A;  1PUU B;  5DUY A;  4QKS A;  2K4A B;  1MD6 A;  5I1B A;  1TP0 A;  4QKR A;  4LO7 B;  3FUO A;  4EKX B;  1IHK A;  2HZ9 A;  2BEB A;  1T9F A;  3FJK A;  3AH1 A;  1QQL A;  3OJM A;  4XFT A;  1NZK A;  2VLC A;  3BAG A;  1DQG A;  1F31 A;  1DZC A;  3UJ4 A;  1M16 A;  1AVA C;  3F1R A;  4G9N A;  3FJE A;  2D1Z A;  3OJV A;  4LO0 A;  1RZO B;  4I8M A;  1SR4 C;  4I6I A;  1W3A A;  4HJJ A;  4I96 A;  1IRA X;  4Z8S B;  4LO2 C;  3VT0 A;  2HW9 A;  2Y9X E;  1DQO A;  3O4B A;  2J3P A;  2P23 A;  2P39 A;  1OQL B;  4QBC A;  4Q9P A;  4I4S A;  4LO3 A;  3H6R B;  1WBC A;  4ZGR B;  3BRD A;  1QQK A;  4JAW A;  4EFP A;  2VXR A;  5F8S A;  4AN7 B;  1JLX A;  1Q1U A;  2GZB A;  1N4K A;  3POK A;  3Q7X A;  4H04 A;  4QD2 C;  1BFF A;  1K5V A;  3VWC A;  3O4A A;  4OEF A;  2Q9X A;  3FUQ A;  3O4D A;  4OUJ A;  1HCD A;  3OBR A;  1FMZ A;  41BI A;  1RY7 A;  4MZH A;  4OWL A;  4OEE A;  3O4C A;  4GOV A;  3O4O A;  1AF9 A;  2RG9 B;  1PZZ A;  3WIN A;  5DSS B;  3AKI A;  4KC3 A;  1V6W A;  1Q04 A;  3BRG C;  5D63 A;  1DIW A;  2DRE A;  3FJJ A;  3BRF A;  3HN1 A;  2DRY A;  2LIQ A;  4JP0 A;  3A23 A;  4I7I A;  1M2T B;  2FDB M;  1JQZ A;  2D24 A;  3VT1 A;  2YUG A;  3I2A A;  1MC9 A;  1CVS A;  3ZX7 A;  3N7K A;  2ZQN A;  3RTJ B;  1T4Q A;  1YF8 B;  2FFU A;  21BI A;  1PUM B;  5BQU C;  3KMV A;  4QAL A;  3V0B A;  4I0Y A;  2VXT I;  2Q3N B;  1S0E A;  3R4U A;  3PUB A;  4GP0 A;  1FWU A;  4JQ0 A;  1G9D A;  3AKF A;  4L4I A;  1AFC A;  2ERM A;  3Q7Y A;  4P6A A;  7I1B A;  4ISR A;  2F2F C;  4J2X A;  1S0F A;  1WD3 A;  3Q7W A;  1V6X A;  4I4P A;  1XG6 A;  4GAI A;  1ISZ A;  1Q03 A;  4END A;  5JMC A;  3I2X A;  1ISY A;  3WO4 A;  2FFV A;  4J2Y A;  1EPW A;  2MLL B;  3A07 A;  4XKI A;  4GAF A;  5D62 A;  8I1B A;  1SR4 A;  1JT3 A;  1I1B A;  4ZFY B;  4D0T A;  1TTU A;  1DLL A;  4LO2 A;  3B9U A;  3CU1 B;  3D7W B;  4JPZ A;  3FJ8 A;  3NJ5 A;  4EFQ A;  1HKN A;  3AKG A;  1G9B A;  1FMM S;  2HWM A;  1HWO B;  4OW4 A;  2BEA A;  1BFB A;  4KBB A;  4P0K A;  4Q91 A;  1HWN B;  5BP5 C;  2VSA A; 
#chains in the Genus database with same CATH homology
 4ISQ A;  1DFQ A;  3BA7 A;  1BAS A;  4D8H A;  1BFC A;  2IWT B;  3RTI B;  2D23 A;  2WRY A;  3VSF A;  1S0C A;  5G00 A;  1PC8 B;  1RG8 A;  2AXM A;  2X2T A;  2FO1 A;  1HCE A;  3BB2 A;  3RMX A;  1FV2 A;  3FJA A;  4CJM A;  2RQ9 A;  4G6M A;  3CA0 A;  3LLP A;  1K5U A;  3I29 B;  1HWM B;  4KEK A;  5B2H A;  4JKX B;  4I4O A;  2X2S A;  4DCK C;  3EF2 A;  1XZZ A;  1JT7 A;  3O3Q A;  3ZXD A;  2DS0 A;  2Y9F A;  3FJF A;  4UY4 A;  3NBN A;  4MZG B;  4I4Y A;  3WO2 A;  3LTQ A;  4OWK A;  4XFS A;  6I1B A;  4LO1 C;  1FN0 A;  1QXM A;  4EB2 B;  1BLA A;  1RML A;  2D7R A;  9ILB A;  3FJC A;  1IT0 A;  3BA4 A;  4IZX A;  3BX1 C;  3AH4 A;  1DFC A;  2R9K B;  3NBD A;  1G9C A;  4X37 A;  4J23 B;  3P6I A;  1SZ6 B;  1S0L A;  1YXW A;  1Z2V A;  4EFR A;  3BTA A;  2ESU A;  5BQU A;  3AH2 A;  3P53 A;  3V0B B;  2VUA A;  1JY0 A;  2ET2 A;  3HMY A;  4AN6 A;  1L2H A;  5FNW A;  4I4U A;  4PC4 A;  3F62 B;  2F2F A;  3CA3 A;  3O44 A;  3ZC9 A;  4J2K A;  1TFM B;  1YBI A;  4X3A A;  2I1B A;  4ZLB B;  3N0K A;  3FJD A;  4YOL A;  5F8W A;  1WD4 A;  1HIB A;  2KI4 A;  3BAU A;  2D43 A;  3OGF A;  2LIE A;  3VSZ A;  3R4S A;  2NTD A;  3FGM A;  3N7L A;  1KNM A;  4QBV A;  2KKI A;  3JRR A;  2MC2 A;  4I4V A;  1S0G A;  2QYI B;  3AZW A;  3FJB A;  3NBC A;  2L5X A;  2AFG A;  4LO7 C;  1AVX B;  4I2S A;  3H6R A;  2NVH A;  4Z9W B;  1FQ9 A;  3QR5 A;  1EV2 A;  4G6J A;  2AAI B;  3AJ6 A;  4F34 A;  1ISX A;  3W9T A;  4TLP A;  4A7Z A;  2ZR1 B;  4OWJ A;  3IAG C;  4KEI A;  3WMU A;  3CRH A;  5BP5 A;  3V0A B;  3PME A;  3BAV A;  4OEG A;  1S0D A;  4QO3 A;  3ZC8 A;  4LO8 B;  3C9Z A;  3VT2 A;  5EG6 C;  4Q9G A;  5JLV A;  1R8O A;  3O5W B;  3BAO A;  1EVT A;  3OJ2 A;  4P0L A;  3CRI A;  1DJS B;  1JT5 A;  4R6U B;  1BFG A;  4GP3 A;  1JLY A;  2KLL A;  4I4Q A;  2NM1 A;  1ILR 1;  3SNV A;  3O49 A;  3FJ9 A;  3MPP G;  3CA6 A;  3HOM A;  2GO2 A;  1II4 A;  3CA5 A;  4A7K A;  4EEE B;  4MZF B;  4DEP A;  1VCL A;  3CA1 A;  3CRG A;  3RSJ A;  1G82 A;  1EYL A;  1YYN A;  4LO1 A;  3K1X A;  4P0J A;  3OGG A;  2VSE A;  3UDA A;  3UJ0 A;  2AQZ A;  4KEJ A;  2Z49 A;  5BVP I;  4I37 A;  1HWP B;  5DVH A;  1V6U A;  2KI6 B;  4H75 A;  2DRZ A;  2D22 A;  2M49 A;  4IYB A;  1XYF A;  4X39 A;  3UD8 A;  2Y9G A;  2WBC A;  4WBC A;  4ZFW B;  4I1B A;  1J0S A;  3P6J A;  1E0O A;  4I4X A;  3WMV A;  5E24 E;  1ONK B;  5FZY A;  1V6V A;  2HWA A;  5BOW A;  4I1E A;  3FJI A;  2IHO A;  4ZBV B;  3V79 C;  1IJT A;  1R8N A;  4FGF A;  1A8D A;  2NP0 A;  4JRA A;  5BXP A;  3WA1 A;  3BA5 A;  2D20 A;  3H6S E;  3IM6 A;  3IM5 A;  1PWA A;  31BI A;  3BAH A;  2VU9 A;  2E4M C;  3VUO A;  3PHZ A;  1TWM A;  3AZV A;  3AJ5 A;  1IOB A;  5D61 A;  4ZOT A;  2F8X C;  1UPS A;  4I3N A;  3ZXG A;  1S0B A;  4ZKT B;  1ABR B;  1D0H A;  4J2S A;  4USP A;  3T8S A;  3ILA A;  3OBT A;  2RST A;  3CA4 A;  3N7J A;  4IY8 A;  2BFH A;  5DZU A;  5EHA A;  3AKH A;  4DEN A;  2QN4 A;  3FJH A;  3S8K A;  2MIB A;  5BXT A;  2K43 A;  3A21 A;  1ISW A;  4LO0 C;  5F90 A;  1BLD A;  1IRP A;  1BAR A;  4G9M A;  1FWV A;  4A7Y A;  3BAQ A;  4FVV A;  1IIL A;  3UD9 A;  4QC4 A;  3A22 A;  2Y9W C;  1W3F A;  2FGF A;  3MAL A;  3E8L C;  5EC5 A;  4IQP A;  1W3G A;  4HR6 C;  5HPZ A;  4LO3 C;  3IIR A;  1FGA A;  5F8Y A;  1AXM A;  1G9A A;  4II0 A;  5GAQ A;  2Z48 A;  2ZQO A;  1YTO A;  1AVW B;  2D44 A;  3JUT A;  3S8J A;  2XOA A;  1Z0H A;  4ION A;  1CE7 B;  4IZE A;  1TWE A;  1JTC A;  1GGP B;  1I1E A;  3HAL A;  4X38 A;  1BA7 A;  3IM7 A;  2D7I A;  4JKQ A;  1Z4S A;  1AVU A;  3RMY A;  4QD2 B;  3CQA A;  1NUN A;  5BXS A;  1DZD A;  1TOO A;  4ZFU B;  3V0A A;  4G1R A;  3WO3 A;  3UD7 A;  5FZZ A;  3WIN C;  1JT4 A;  4D0Z A;  4GOY A;  2NZ9 A;  5FZU A;  3VEQ A;  4IY9 A;  4USO A;  1P63 A;  1ISV A;  2NYY A;  4F83 A;  3HSM A;  3FFZ A;  1TIE A;  3H6Q A;  4L4H A;  2KH2 A;  3PG0 A;  4H9W A;  3BAD A;  3N7M A;  4ZA3 B;  1WBA A;  2E4M A;  2K8R A;  1XHB A;  3HBW A;  4IHZ A;  2UUS A;  1FV3 A;  4I4R A;  2NS2 A;  3CAH A;  1ITB A;  3TC2 A;  4HA2 A;  5BXR A;  3NBE A;  5FNX A;  3QYD A;  4XFU A;  1PUU B;  5DUY A;  4QKS A;  2K4A B;  1MD6 A;  5I1B A;  1TP0 A;  4QKR A;  4LO7 B;  3FUO A;  4EKX B;  1IHK A;  2HZ9 A;  2BEB A;  1T9F A;  3FJK A;  3AH1 A;  1QQL A;  3OJM A;  4XFT A;  1NZK A;  2VLC A;  3BAG A;  1DQG A;  1F31 A;  1DZC A;  3UJ4 A;  1M16 A;  1AVA C;  3F1R A;  4G9N A;  3FJE A;  2D1Z A;  3OJV A;  4LO0 A;  1RZO B;  4I8M A;  1SR4 C;  4I6I A;  1W3A A;  4HJJ A;  4I96 A;  1IRA X;  4Z8S B;  4LO2 C;  3VT0 A;  2HW9 A;  2Y9X E;  1DQO A;  3O4B A;  2J3P A;  2P23 A;  2P39 A;  1OQL B;  4QBC A;  4Q9P A;  4I4S A;  4LO3 A;  3H6R B;  1WBC A;  4ZGR B;  3BRD A;  1QQK A;  4JAW A;  4EFP A;  2VXR A;  5F8S A;  4AN7 B;  1JLX A;  1Q1U A;  2GZB A;  1N4K A;  3POK A;  3Q7X A;  4H04 A;  4QD2 C;  1BFF A;  1K5V A;  3VWC A;  3O4A A;  4OEF A;  2Q9X A;  3FUQ A;  3O4D A;  4OUJ A;  1HCD A;  3OBR A;  1FMZ A;  41BI A;  1RY7 A;  4MZH A;  4OWL A;  4OEE A;  3O4C A;  4GOV A;  3O4O A;  1AF9 A;  2RG9 B;  1PZZ A;  3WIN A;  5DSS B;  3AKI A;  4KC3 A;  1V6W A;  1Q04 A;  3BRG C;  5D63 A;  1DIW A;  2DRE A;  3FJJ A;  3BRF A;  3HN1 A;  2DRY A;  2LIQ A;  4JP0 A;  3A23 A;  4I7I A;  1M2T B;  2FDB M;  1JQZ A;  2D24 A;  3VT1 A;  2YUG A;  3I2A A;  1MC9 A;  1CVS A;  3ZX7 A;  3N7K A;  2ZQN A;  3RTJ B;  1T4Q A;  1YF8 B;  2FFU A;  21BI A;  1PUM B;  5BQU C;  3KMV A;  4QAL A;  3V0B A;  4I0Y A;  2VXT I;  2Q3N B;  1S0E A;  3R4U A;  3PUB A;  4GP0 A;  1FWU A;  4JQ0 A;  1G9D A;  3AKF A;  4L4I A;  1AFC A;  2ERM A;  3Q7Y A;  4P6A A;  7I1B A;  4ISR A;  2F2F C;  4J2X A;  1S0F A;  1WD3 A;  3Q7W A;  1V6X A;  4I4P A;  1XG6 A;  4GAI A;  1ISZ A;  1Q03 A;  4END A;  5JMC A;  3I2X A;  1ISY A;  3WO4 A;  2FFV A;  4J2Y A;  1EPW A;  2MLL B;  3A07 A;  4XKI A;  4GAF A;  5D62 A;  8I1B A;  1SR4 A;  1JT3 A;  1I1B A;  4ZFY B;  4D0T A;  1TTU A;  1DLL A;  4LO2 A;  3B9U A;  3CU1 B;  3D7W B;  4JPZ A;  3FJ8 A;  3NJ5 A;  4EFQ A;  1HKN A;  3AKG A;  1G9B A;  1FMM S;  2HWM A;  1HWO B;  4OW4 A;  2BEA A;  1BFB A;  4KBB A;  4P0K A;  4Q91 A;  1HWN B;  5BP5 C;  2VSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...