3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
b'VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3ZCBB 3SHGB 3ZC7B
chains in the Genus database with same CATH superfamily
2DWNA 3GLHB 1GO5A 1NNUC 3R8FA 3FTFA 1H6UA 1J7KA 2VDBB 4IBBA 1DO0A 1IN5A 1QZMA 3I4VA 3GPPA 1IXSA 3C58A 1C7YA 4WURA 5EXXA 3J7AS 1VEGA 4LJ8A 3SMPA 3SARA 2QBYA 1DGHB 1IN4A 4AI6A 4HLQA 4LGYA 4GKJM 2LVNC 3E4RA 2JZ0A 1R2YA 4XGIA 3GQ3A 2LXEA 1HT2E 1IM2A 5ITXA 3AJIB 3MJ5A 3U6LA 2Z7JA 3GRYA 3H4JA 4AG5A 2DZLA 3U6EA 1G41A 5FTKA 4OU7A 4IBIA 4XBOA 3M0EA 1D0KA 3U6PA 3HGIA 2CUZA 2XZUA 3TWMA 1XB2B 2EJSA 3VDUA 1SXJE 2FS1A 2X8AA 3KP1E 2VF7A 4F1IA 3VK7A 3GRRA 1NY6A 2E5LM 3C3DA 1V34A 1GKIA 4ZPXA 3AV0A 3FUTA 5ITYA 3U6OA 2OOAA 1NV8A 4M9ZA 2R6FA 2DAIA 4P16A 3T38A 3KOXE 1G8PA 2HWJA 1XHBA 2D7EA 3WHKA 3GQ4A 1K3WA 2MH8A 1DGBA 3D8LA 3HZJA 2HL7A 3L28A 5FTMA 2XZFA 4GKKM 4MB7A 1MX0A 3GLGA 3AOEA 2G5GX 3SFZA 2YNMD 3TWLA 1N36M 3FD9A 4DV1M 3CTWB 4ANRA 3TL4X 4L78A 3HHZA 1LTMA 4D82A 1SXJB 4IBJA 4HL4A 1V33A 4X66M 2KRUA 3IHPA 2F5PA 4G3OA 3MK6A 4G4NA 4KO8A 5KPZA 2KHHA 4CIZA 1L1TA 3DOAA 1ZMWA 2JP7A 1GJSA 2J7NA 1ORYB 4MM3B 3PXGA 5ITUA 4JI2M 4LRSA 3GP1A 4I8OA 2CP8A 3U5ZB 1ZAEA 3IG8A 5LMNM 3L25A 1OJLA 2KW0A 2XF3A 4LCBA 2XH9A 3I4YA 5ITXE 3U6DA 1VG5A 2I7NA 2OO9A 1D2NA 5KQ8A 3SMSA 4RNAA 1Q39A 4EIWA 3F92A 2XEPA 2HCBA 1JB0F 1QDTA 2UXCM 1R5LA 2XLJA 2JUJA 1Q02A 3GRUA 1Y8GA 3KP0E 4Z6YA 1IXSB 1VDDA 2DVWB 3UK6A 1OFHA 2R46A 3FTDA 3K8ZA 4PDIA 3FUWA 3AKZA 2FOIC 2L7HA 1HNXM 2JNHA 3FRHA 3SASA 1N34M 2YFQA 1PJTA 1R6BX 4FCWA 4GRIA 4IJEA 4AW4A 4BLCA 4GH9A 2QBYB 1LV7A 1PJQA 1L2BA 3TPZA 4FWDA 3FUUA 3NWLA 4NC6A 3GPXA 4OX9M 4DR6M 1C1KA 4FVMA 3L2AA 4JI0M 5FLXS 4YHHM 1QZEA 4REZA 1EFUB 1SG9A 2YQZA 3HU3A 2UUBM 2CHQA 5IREB 3W0FA 1QAMA 3PFIA 3GLGE 4PT5A 1NNJA 4JI4M 4WW0A 4NSOB 1TGUA 2UXBM 1QAOA 1MU5A 2KXEA 2W82A 3EIEA 2MR9A 5BR8M 3L26A 4AKIA 3FRIA 1XXHA 1EIJA 3AFHA 2UXDM 3B74A 4PDGA 3VLFB 3CF6E 2V6ZM 4GHLA 2LBCA 3J2PB 4GC9A 4GITA 2XSZD 2JA2A 3B7NA 4QOSA 3LQQA 4PD2A 3FKEA 1G3IA 2QZ4A 3HHXA 2QSFX 5JI3E 4DBGB 3SAUA 4IBCA 2C99A 4L6V6 1TH3A 2JXNA 3KS4A 5EJCA 3H4MA 3DZDA 4B7GA 3QYBA 1V92A 1HR0M 3GO8A 1SXJD 2LHCA 2DNAA 1NO1A 4L4UA 5FTNA 4F2LA 3UJNA 1HJPA 2Y20A 3HY5A 3GLGB 2VQFM 3KOZE 2DXIA 3Q8GA 3CGWA 4DR4M 1GABA 4KODA 5ITTA 3OTOM 4LF5M 4LF8M 2C9OA 3IECA 3I51A 4OW0A 3AOGA 1JQJC 3FUXA 4GC5A 4AZFA 3HHYA 3T6PA 4B7FA 4LJ6A 5IWAM 1CUKA 2DWMA 2CV2A 1IY0A 4OVZA 1YSYA 2BJVA 2HHHM 4XK8F 4M9XA 3J81S 3HJQA 2OQ4A 2KA6B 5DYGA 5FTLA 7CATA 3LW5F 2OPFA 3RGPA 2QPAA 2L2DA 5EP1A 1XNQM 3KS8A 3R9XB 4DV6M 2UUAM 4DR1M 4GIPA 4KHPM 2V1UA 3QYEA 2BJWA 2AHMA 4AKGA 2DAKA 3I04M 3KSJA 1KFVA 2RRUA 3DA1A 4X65M 1IQPA 1Z59A 4M9SA 1IN7A 2KNAA 2L4EA 1MJGM 5KQDA 3JR5A 1XC8A 2LNHC 4IJFA 1R7RA 1KYIA 4IBEA 1HT1E 2L6OA 3K2LA 1XXHE 1IY1A 1E9SA 2K0BX 2R18A 3ZCBB 1ZQ9A 4LGMA 4MGYE 3D8BA 4DUZM 2A5YB 4FCTA 4RF0A 4G6ZA 4FW9A 1G59A 1IN6A 3T1YM 3FTCA 4LF7M 4JYAM 1K3XA 2Y0QA 2LVQD 4JI5M 2WZJA 5C1BA 2Z4SA 4LJ9A 4BB9A 4LF6M 4NXMM 1XMOM 4KT0F 5EQTA 3I01M 3SYKA 4LZZA 1WIVA 2DHYA 2JWSA 1DGFA 2M60A 4LY6A 3SBJA 1X37A 1Z5BA 5DNYA 4YY3M 2EA0A 3C3EA 3PVSA 4DV5M 3LVVA 1FNNA 4CJ6A 4X62M 2FNAA 1TH2A 2KRKA 1K82A 1NV9A 1QQWA 1VEKA 3HX3A 2JY7A 2K6BA 1AIPC 2UU9M 4AQYM 1XXHB 4S12A 1R4GA 4DR7M 5GKNA 3ZC7B 2KNZA 4GEWA 5C18A 2CWBA 5L8RF 1N77A 3KOWE 3GPYA 2C9CA 4AG6A 2RKOA 4QHTA 3W68A 3UMMA 2R65A 1Z6TA 1OTRA 2MROB 3QWLA 2CRUA 4CGYB 3NBIA 1AUAA 4DR3M 3J27B 2OOBA 3IG5A 4MH0E 1WR1B 4QOZC 4II7A 3J7BA 4GMQA 2ZANA 4MGIE 2CV0A 2GNOA 1GL6A 4DV2M 2MGWA 4I5SA 4G4RA 4IBDA 2APLA 1T3TA 2K9DA 3M7GA 1N33M 1OQYA 3GQ5A 1GVNA 3BOSA 4UN2B 3VKHA 3GRVA 3ZH9B 4JI3M 1UFZA 2Z3XA 4GHAA 1OIZA 1IY2A 2KEBA 1OAIA 2DENA 3B7QA 1W5SA 4CHTB 4B3RM 2CFOA 2R4EA 4OVZB 4NXNM 3BXWA 1WGLA 5EXSA 3KXEC 1TF0B 3DFZA 1NHWC 2C5RA 4NRVA 2J5YA 4KLNA 1VEJA 2EKKA 2QCUA 3VKGA 2KZUA 1NJGA 1PJSA 2JZ1A 1Q3BA 2ERCA 1QAQA 2GQFA 2XFSA 1EE8A 3K1JA 3K9OA 3THGA 3A98B 2CV1A 3W0LB 3U6MA 1ZMUA 4DV3M 1A5TA 1D0MA 3TQSA 2LVPC 3LMMA 3CF2A 4D81A 4RF1A 3RGSA 2M5ZA 4IBKA 5A2QS 1P3QQ 4BBAA 5E6JA 2LVAA 3UGJA 4DR2M 4FWHA 1OKSA 3K9PA 1XMQM 3RE8A 3JAMS 2ZAMA 4IBFA 4L15A 2D7HA 1IN8A 3E46A 1WGNA 1DV0A 1I4WA 1WHCA 3MHVC 5IZ7D 5FTJA 3KVWA 1TTEA 3HU2A 4M0DA 3VFDA 3W67A 4LRTA 4G4OA 4Y28F 3U6CA 2F5SA 2Z8YM 4D80A 2VF8A 3GLIA 4B3SM 2DZOB 5FSWA 4DV4M 1IFYA 1PM5A 4DV7M 1E9RA 3HU1A 3FE3A 1WXQA 4JI1M 4MGHA 1TR8A 2QNJA 5KPRA 3J80S 4JI7M 1L8QA 2C98A 4JI8M 3SC3A 4X64M 2LVOC 1L2DA 3ZQJA 3TE6A 3JR4A 3E21A 1JR3A 2O01F 2XGNA 1QUSA 1XWIA 3PNVA 4NOOB 5DFLA 4R71A 2WSEF 2DHRA 4NL4H 3RFWA 5EP2A 3SHFA 3LCUA 4LJ5A 8CATA 4M0WA 5EP3A 4I81A 2VIIA 3GLFA 1ZV1A 5ITRA 4LJ4A 1QANA 1F4IA 5IT9S 4Z8XA 3FYCA 4R7GA 3U61A 4JN6A 2QP9X 3FUVA 3KW6A 2UUCM 2EO2A 1L1ZA 3T1HM 4B3MM 2C96A 4FWGA 2YR0A 4G4QA 2JY6B 3TWKA 3VDPA 4WP2A 3KDSE 3LCVB 3AL0C 1DGGA 3U60A 5LMUM 3A46A 2Z4RA 4DR5M 4B3TM 2RGOA 4B08A 3E9SA 1YLAA 1Z5CA 4ITQA 4HEOA 3A45A 2K47A 1HQYE 4JI6M 1VQ1A 2BWBA 3LVWA 4IIWA 4P17A 1J5EM 1GL7A 4QNMA 4MGKE 4LF4M 3SAWA 1TH4A 2HAKA 2ZBKB 2DAEA 1JR3D 1NVMA 1QYRA 1Z5AA 2CHGA 3HWSA 1SXJC 3M6AA 3K92A 1IBLM 1NJFA 1G71A 3GLHA 5JI2E 1N32M 3HJSA 2R4JA 4B7HA 1N78A 2N35A 2L7IA 4TUWA 1PJIA 3B89A 3SHGB 5BPVA 2CHVA 2L09A 4L8RC 1GJTA 1QDRA 4Q7JA 4LFAM 1TDZA 1VDLA 4CISA 4FD2A 2B3TA 2Q2EB 3GLIE 3SYLA 3HKPA 1MN3A 2EKFA 1Q3CA 1I94M 1E32A 2H5XA 1D0LA 3PNYA 1NSFA 2QHOB 1DGHA 3V76A 1XNRM 1L2CA 2QQ8A 1IXRC 2R62A 3L27A 4MGZE 3WHLA 3QAUA 3Q8XA 4PCZA 3C9PA 1YE9A 1DO2A 3L29A 4DV0M 2KZSA 1FJGM 2F4VM 1JR3E 3VK8A 2JY5A 2NQ8C 4LF9M 2MJ5B 1GLNA 4NSRA 2CEAA 2G3QA 2R45A 1ZMVA 3SATA 1KSFX 3HJ8A 2O25A 4LZJA 2F5OA 3GLFE 3U6SA 3KSXA 1T6OA 2BWEA 2JY8A 2LHGA 1W5TA 2X4AA 1T43A 3FYDA 1OAOC 3ILKA 4LFCM 3A42A 1QUTA 2O5RA 4QHSA 3GLIB 3CF0A 1PGYA 2R0IA 2WSCF 5F3WA 1HNWM 2F5QA 2ZTCA 2VQEM 5DYIA 2L4FA 4JXJA 3SAVA 1QVRA 2LH0A 2ZTDA 3B9PA 1RU3A 1G4AE 2F5NA 3B7ZA 4AKHA 1TDHA 1BVSA 4LFBM 1NY5A 3MMPA 3BBZA 4LG2A 2XSZA 3FTEA 2HKJA 2FH0A 2BNKA 4K0KM 2KNVA 4R3DA 1PJJA 1IXZA 2H1RA 2KDLA 4I4LA 4RKUF 2DZNB 2V1CA 3GLHE 1OFIA 3U6QA 2ZAOA 4LJ7A 3GLFB 2RGHA 2WSFF 2DWLA 4IBGA 5KPTA 2DI0A 2FE8A 1HNZM 2Y21A 2DWZB 1WJ7A 2I7PA 4LJAA 3T15A 3UZUA 1NHGC 1SXJA 3U61B 5EP4A 2P5TA 5H37D 2QENA 3GPUA 4NRWA 4JV5M 2DKLA 3EIHA 2DAMA 2D7GA 2EUCA 2G8LA 3HHWA 4DUYM 2CE7A 4A3VB 3U60B 1E94E 1UM8A 2XFTA 4W5WA 2R44A 2Y0TA 1J09A 3NBXX 4L16A 2J7OA 1R2ZA 3KFUG 5E26A 4FCVA 5KO3A 1HQCA 1PRBA 1S3SA 1YUBA 1OIPA 3LQRA 1IBKM 3AOEC 3U5ZA 1IBMM 2FFJA 2X49A 5ITQA 5EXTA 2LTUA 2LWXA 2ZM6M 1N75A 4QNRA 5EXPA 2DAGA 3KOYE
chains in the Genus database with same CATH topology
2DWNA 3GLHB 1NNUC 3R8FA 1H6UA 1J7KA 4IBBA 1DO0A 1IN5A 1QZMA 3I4VA 3GPPA 3C58A 4WURA 5EXXA 3J7AS 4LJ8A 3SMPA 3SARA 2QBYA 1DGHB 1IN4A 4AI6A 4HLQA 4LGYA 4GKJM 3E4RA 1R2YA 4XGIA 3GQ3A 2LXEA 1HT2E 1IM2A 5ITXA 3AJIB 3MJ5A 3U6LA 2Z7JA 3GRYA 4AG5A 3U6EA 1G41A 5FTKA 4OU7A 4IBIA 4XBOA 3M0EA 3U6PA 3HGIA 2CUZA 2XZUA 3TWMA 3VDUA 1SXJE 2X8AA 3KP1E 3VK7A 3GRRA 1NY6A 2E5LM 1GKIA 4ZPXA 3AV0A 3FUTA 5ITYA 3U6OA 4M9ZA 4P16A 3T38A 3WHKA 3KOXE 1G8PA 1K3WA 1XHBA 2D7EA 3GQ4A 1DGBA 3D8LA 2HL7A 3L28A 5FTMA 2XZFA 4GKKM 4MB7A 1MX0A 3GLGA 3AOEA 2G5GX 3SFZA 2YNMD 3TWLA 1N36M 3FD9A 4DV1M 3CTWB 3TL4X 4L78A 3HHZA 4D82A 1SXJB 4IBJA 4HL4A 4X66M 2KRUA 2F5PA 3MK6A 4G4NA 4KO8A 5KPZA 1L1TA 3DOAA 2J7NA 1ORYB 4MM3B 3PXGA 5ITUA 4JI2M 4LRSA 3GP1A 4I8OA 3U5ZB 1ZAEA 3IG8A 5LMNM 3L25A 1OJLA 2KW0A 2XF3A 4LCBA 2XH9A 3I4YA 5ITXE 3U6DA 2I7NA 5KQ8A 1D2NA 3SMSA 4RNAA 1Q39A 4EIWA 2XEPA 2HCBA 2UXCM 2XLJA 3GRUA 3KP0E 4Z6YA 1IXSB 1VDDA 2DVWB 3UK6A 1OFHA 2R46A 3FTDA 3K8ZA 4PDIA 3FUWA 3AKZA 2FOIC 2L7HA 1HNXM 3SASA 1N34M 2YFQA 4GRIA 1R6BX 4FCWA 4IJEA 4AW4A 4BLCA 2QBYB 4GH9A 1LV7A 1L2BA 3TPZA 4FWDA 3FUUA 3NWLA 3GPXA 4OX9M 4DR6M 1C1KA 4FVMA 3L2AA 4JI0M 5FLXS 4YHHM 4REZA 2YQZA 3HU3A 2UUBM 2CHQA 5IREB 3W0FA 1QAMA 3PFIA 1NNJA 4PT5A 4JI4M 4WW0A 4NSOB 1TGUA 2UXBM 1QAOA 1MU5A 2KXEA 2W82A 3EIEA 5BR8M 3L26A 4AKIA 1XXHA 3AFHA 2UXDM 4PDGA 3VLFB 3CF6E 2V6ZM 4GHLA 3J2PB 4GC9A 4GITA 2XSZD 2JA2A 4QOSA 3LQQA 4PD2A 3FKEA 1G3IA 2QZ4A 3HHXA 5JI3E 3SAUA 4IBCA 2C99A 1TH3A 3KS4A 5EJCA 3H4MA 3DZDA 4B7GA 1HR0M 3GO8A 1SXJD 3UJNA 4L4UA 5FTNA 2Y20A 3GLGB 2VQFM 2DXIA 3KOZE 4DR4M 4KODA 5ITTA 3OTOM 4LF5M 4LF8M 2C9OA 3I51A 4OW0A 3AOGA 1JQJC 3FUXA 4GC5A 4AZFA 3HHYA 4B7FA 5IWAM 4LJ6A 2DWMA 2CV2A 1IY0A 4OVZA 1YSYA 2BJVA 2HHHM 4M9XA 3J81S 3HJQA 2OQ4A 2KA6B 5DYGA 5FTLA 7CATA 2OPFA 1XNQM 3RGPA 2QPAA 3KS8A 5EP1A 3R9XB 4DV6M 2UUAM 4DR1M 4GIPA 4KHPM 2V1UA 2BJWA 2AHMA 4AKGA 3KSJA 1KFVA 3DA1A 4X65M 1IQPA 1Z59A 4M9SA 1IN7A 5KQDA 3JR5A 1XC8A 2LNHC 4IJFA 1R7RA 1KYIA 4IBEA 1HT1E 2L6OA 3K2LA 1IY1A 1E9SA 2R18A 3ZCBB 1ZQ9A 4LGMA 4MGYE 3D8BA 4DUZM 2A5YB 4FCTA 4RF0A 4G6ZA 4FW9A 1G59A 1IN6A 3T1YM 3FTCA 4LF7M 4JYAM 1K3XA 2Y0QA 4JI5M 5C1BA 2Z4SA 4LJ9A 4BB9A 4LF6M 4NXMM 1XMOM 5EQTA 3SYKA 4LZZA 1DGFA 2M60A 4LY6A 3SBJA 1X37A 1Z5BA 5DNYA 4YY3M 2EA0A 3PVSA 4DV5M 3LVVA 1FNNA 4X62M 1K82A 2FNAA 1TH2A 2KRKA 1QQWA 2UU9M 4AQYM 1XXHB 4S12A 4DR7M 5GKNA 3ZC7B 5C18A 1N77A 3KOWE 3GPYA 2C9CA 4AG6A 2RKOA 4QHTA 3UMMA 2R65A 1Z6TA 3QWLA 4CGYB 3NBIA 4DR3M 3J27B 3IG5A 4MH0E 4QOZC 4II7A 3J7BA 4GMQA 2ZANA 4MGIE 2CV0A 1GL6A 4DV2M 4I5SA 4G4RA 4IBDA 1T3TA 3M7GA 1N33M 3GQ5A 1GVNA 3BOSA 3VKHA 3GRVA 3ZH9B 4JI3M 2Z3XA 4GHAA 1IY2A 2KEBA 4CHTB 1W5SA 4B3RM 2CFOA 2R4EA 4OVZB 4NXNM 5EXSA 3KXEC 3DFZA 1NHWC 2C5RA 4NRVA 4KLNA 2QCUA 3VKGA 2KZUA 1NJGA 1Q3BA 2ERCA 1QAQA 2XFSA 1EE8A 3K1JA 3THGA 3A98B 2CV1A 3W0LB 3U6MA 4DV3M 3TQSA 3LMMA 3CF2A 4D81A 4RF1A 3RGSA 2M5ZA 4IBKA 5A2QS 4BBAA 5E6JA 4DR2M 3UGJA 4FWHA 1XMQM 3RE8A 3JAMS 2ZAMA 4IBFA 4L15A 2D7HA 1IN8A 1I4WA 3MHVC 5IZ7D 5FTJA 3KVWA 4M0DA 3HU2A 3VFDA 4G4OA 3FTFA 4LRTA 3U6CA 2F5SA 4D80A 3GLIA 4B3SM 2DZOB 5FSWA 4DV4M 1PM5A 4DV7M 1E9RA 3HU1A 1WXQA 4JI1M 4MGHA 5KPRA 3J80S 4JI7M 1L8QA 2C98A 4JI8M 3SC3A 4X64M 1L2DA 3JR4A 3TE6A 1JR3A 2XGNA 1XWIA 3PNVA 4NOOB 2DHRA 4NL4H 3RFWA 5EP2A 3SHFA 4LJ5A 8CATA 4M0WA 5EP3A 4I81A 2VIIA 3GLFA 5ITRA 4LJ4A 1QANA 5IT9S 4Z8XA 3FYCA 4R7GA 3U61A 4JN6A 2QP9X 3FUVA 3KW6A 2UUCM 2EO2A 1L1ZA 3T1HM 4B3MM 2C96A 4FWGA 2YR0A 4G4QA 3VDPA 3TWKA 3KDSE 3AL0C 1DGGA 3U60A 5LMUM 3A46A 2Z4RA 4DR5M 4B3TM 2RGOA 4B08A 3E9SA 1Z5CA 4ITQA 3A45A 2K47A 1HQYE 4JI6M 1J5EM 3LVWA 4IIWA 1GL7A 4QNMA 4MGKE 4LF4M 3SAWA 1TH4A 2ZBKB 1JR3D 1NVMA 1QYRA 1Z5AA 2CHGA 3HWSA 1SXJC 3M6AA 3K92A 1IBLM 1NJFA 3GLHA 5JI2E 1N32M 3HJSA 2R4JA 4B7HA 1N78A 2L7IA 4TUWA 1PJIA 3SHGB 5BPVA 2CHVA 2L09A 4L8RC 4CISA 4LFAM 1TDZA 4FD2A 2Q2EB 3SYLA 3HKPA 1Q3CA 1I94M 1E32A 3PNYA 1NSFA 1DGHA 1XNRM 1L2CA 1IXRC 2R62A 3L27A 4MGZE 3WHLA 3QAUA 3Q8XA 4PCZA 4DV0M 1YE9A 1DO2A 3L29A 1FJGM 2KZSA 2F4VM 3VK8A 2NQ8C 4LF9M 1GLNA 4NSRA 2CEAA 2R45A 3SATA 1KSFX 3HJ8A 2F5OA 4LZJA 3U6SA 3KSXA 3ILKA 4LFCM 1W5TA 2X4AA 3FYDA 3A42A 2O5RA 4QHSA 3GLIB 3CF0A 5F3WA 1HNWM 2F5QA 2VQEM 5DYIA 4JXJA 3SAVA 1QVRA 2LH0A 3B9PA 2F5NA 1G4AE 4AKHA 1TDHA 4LFBM 1NY5A 4LG2A 2XSZA 3FTEA 2HKJA 2BNKA 4K0KM 4R3DA 1PJJA 1IXZA 2H1RA 4I4LA 2DZNB 2V1CA 1OFIA 3U6QA 2ZAOA 4LJ7A 3GLFB 2RGHA 2DWLA 4IBGA 5KPTA 2FE8A 1HNZM 2Y21A 2DWZB 2I7PA 4LJAA 3T15A 3UZUA 3U61B 1NHGC 1SXJA 5EP4A 2P5TA 5H37D 2QENA 3GPUA 4NRWA 4JV5M 3EIHA 2D7GA 2EUCA 2G8LA 3HHWA 4DUYM 2CE7A 4A3VB 3U60B 1E94E 1UM8A 2XFTA 4W5WA 2Y0TA 1J09A 4L16A 1R2ZA 2J7OA 3KFUG 5E26A 4FCVA 5KO3A 1HQCA 1YUBA 1S3SA 3LQRA 1IBKM 3AOEC 3U5ZA 1IBMM 2FFJA 2X49A 5ITQA 5EXTA 2LWXA 2ZM6M 1N75A 4QNRA 5EXPA 3KOYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCB B;  3SHG B;  3ZC7 B; 
#chains in the Genus database with same CATH topology
 2DWN A;  3GLH B;  1GO5 A;  1NNU C;  3R8F A;  3FTF A;  1H6U A;  1J7K A;  2VDB B;  4IBB A;  1DO0 A;  1IN5 A;  1QZM A;  3I4V A;  3GPP A;  1IXS A;  3C58 A;  1C7Y A;  4WUR A;  5EXX A;  3J7A S;  1VEG A;  4LJ8 A;  3SMP A;  3SAR A;  2QBY A;  1DGH B;  1IN4 A;  4AI6 A;  4HLQ A;  4LGY A;  4GKJ M;  2LVN C;  3E4R A;  2JZ0 A;  1R2Y A;  4XGI A;  3GQ3 A;  2LXE A;  1HT2 E;  1IM2 A;  5ITX A;  3AJI B;  3MJ5 A;  3U6L A;  2Z7J A;  3GRY A;  3H4J A;  4AG5 A;  2DZL A;  3U6E A;  1G41 A;  5FTK A;  4OU7 A;  4IBI A;  4XBO A;  3M0E A;  1D0K A;  3U6P A;  3HGI A;  2CUZ A;  2XZU A;  3TWM A;  1XB2 B;  2EJS A;  3VDU A;  1SXJ E;  2FS1 A;  2X8A A;  3KP1 E;  2VF7 A;  4F1I A;  3VK7 A;  3GRR A;  1NY6 A;  2E5L M;  3C3D A;  1V34 A;  1GKI A;  4ZPX A;  3AV0 A;  3FUT A;  5ITY A;  3U6O A;  2OOA A;  1NV8 A;  4M9Z A;  2R6F A;  2DAI A;  4P16 A;  3T38 A;  3KOX E;  1G8P A;  2HWJ A;  1XHB A;  2D7E A;  3WHK A;  3GQ4 A;  1K3W A;  2MH8 A;  1DGB A;  3D8L A;  3HZJ A;  2HL7 A;  3L28 A;  5FTM A;  2XZF A;  4GKK M;  4MB7 A;  1MX0 A;  3GLG A;  3AOE A;  2G5G X;  3SFZ A;  2YNM D;  3TWL A;  1N36 M;  3FD9 A;  4DV1 M;  3CTW B;  4ANR A;  3TL4 X;  4L78 A;  3HHZ A;  1LTM A;  4D82 A;  1SXJ B;  4IBJ A;  4HL4 A;  1V33 A;  4X66 M;  2KRU A;  3IHP A;  2F5P A;  4G3O A;  3MK6 A;  4G4N A;  4KO8 A;  5KPZ A;  2KHH A;  4CIZ A;  1L1T A;  3DOA A;  1ZMW A;  2JP7 A;  1GJS A;  2J7N A;  1ORY B;  4MM3 B;  3PXG A;  5ITU A;  4JI2 M;  4LRS A;  3GP1 A;  4I8O A;  2CP8 A;  3U5Z B;  1ZAE A;  3IG8 A;  5LMN M;  3L25 A;  1OJL A;  2KW0 A;  2XF3 A;  4LCB A;  2XH9 A;  3I4Y A;  5ITX E;  3U6D A;  1VG5 A;  2I7N A;  2OO9 A;  1D2N A;  5KQ8 A;  3SMS A;  4RNA A;  1Q39 A;  4EIW A;  3F92 A;  2XEP A;  2HCB A;  1JB0 F;  1QDT A;  2UXC M;  1R5L A;  2XLJ A;  2JUJ A;  1Q02 A;  3GRU A;  1Y8G A;  3KP0 E;  4Z6Y A;  1IXS B;  1VDD A;  2DVW B;  3UK6 A;  1OFH A;  2R46 A;  3FTD A;  3K8Z A;  4PDI A;  3FUW A;  3AKZ A;  2FOI C;  2L7H A;  1HNX M;  2JNH A;  3FRH A;  3SAS A;  1N34 M;  2YFQ A;  1PJT A;  1R6B X;  4FCW A;  4GRI A;  4IJE A;  4AW4 A;  4BLC A;  4GH9 A;  2QBY B;  1LV7 A;  1PJQ A;  1L2B A;  3TPZ A;  4FWD A;  3FUU A;  3NWL A;  4NC6 A;  3GPX A;  4OX9 M;  4DR6 M;  1C1K A;  4FVM A;  3L2A A;  4JI0 M;  5FLX S;  4YHH M;  1QZE A;  4REZ A;  1EFU B;  1SG9 A;  2YQZ A;  3HU3 A;  2UUB M;  2CHQ A;  5IRE B;  3W0F A;  1QAM A;  3PFI A;  3GLG E;  4PT5 A;  1NNJ A;  4JI4 M;  4WW0 A;  4NSO B;  1TGU A;  2UXB M;  1QAO A;  1MU5 A;  2KXE A;  2W82 A;  3EIE A;  2MR9 A;  5BR8 M;  3L26 A;  4AKI A;  3FRI A;  1XXH A;  1EIJ A;  3AFH A;  2UXD M;  3B74 A;  4PDG A;  3VLF B;  3CF6 E;  2V6Z M;  4GHL A;  2LBC A;  3J2P B;  4GC9 A;  4GIT A;  2XSZ D;  2JA2 A;  3B7N A;  4QOS A;  3LQQ A;  4PD2 A;  3FKE A;  1G3I A;  2QZ4 A;  3HHX A;  2QSF X;  5JI3 E;  4DBG B;  3SAU A;  4IBC A;  2C99 A;  4L6V 6;  1TH3 A;  2JXN A;  3KS4 A;  5EJC A;  3H4M A;  3DZD A;  4B7G A;  3QYB A;  1V92 A;  1HR0 M;  3GO8 A;  1SXJ D;  2LHC A;  2DNA A;  1NO1 A;  4L4U A;  5FTN A;  4F2L A;  3UJN A;  1HJP A;  2Y20 A;  3HY5 A;  3GLG B;  2VQF M;  3KOZ E;  2DXI A;  3Q8G A;  3CGW A;  4DR4 M;  1GAB A;  4KOD A;  5ITT A;  3OTO M;  4LF5 M;  4LF8 M;  2C9O A;  3IEC A;  3I51 A;  4OW0 A;  3AOG A;  1JQJ C;  3FUX A;  4GC5 A;  4AZF A;  3HHY A;  3T6P A;  4B7F A;  4LJ6 A;  5IWA M;  1CUK A;  2DWM A;  2CV2 A;  1IY0 A;  4OVZ A;  1YSY A;  2BJV A;  2HHH M;  4XK8 F;  4M9X A;  3J81 S;  3HJQ A;  2OQ4 A;  2KA6 B;  5DYG A;  5FTL A;  7CAT A;  3LW5 F;  2OPF A;  3RGP A;  2QPA A;  2L2D A;  5EP1 A;  1XNQ M;  3KS8 A;  3R9X B;  4DV6 M;  2UUA M;  4DR1 M;  4GIP A;  4KHP M;  2V1U A;  3QYE A;  2BJW A;  2AHM A;  4AKG A;  2DAK A;  3I04 M;  3KSJ A;  1KFV A;  2RRU A;  3DA1 A;  4X65 M;  1IQP A;  1Z59 A;  4M9S A;  1IN7 A;  2KNA A;  2L4E A;  1MJG M;  5KQD A;  3JR5 A;  1XC8 A;  2LNH C;  4IJF A;  1R7R A;  1KYI A;  4IBE A;  1HT1 E;  2L6O A;  3K2L A;  1XXH E;  1IY1 A;  1E9S A;  2K0B X;  2R18 A;  3ZCB B;  1ZQ9 A;  4LGM A;  4MGY E;  3D8B A;  4DUZ M;  2A5Y B;  4FCT A;  4RF0 A;  4G6Z A;  4FW9 A;  1G59 A;  1IN6 A;  3T1Y M;  3FTC A;  4LF7 M;  4JYA M;  1K3X A;  2Y0Q A;  2LVQ D;  4JI5 M;  2WZJ A;  5C1B A;  2Z4S A;  4LJ9 A;  4BB9 A;  4LF6 M;  4NXM M;  1XMO M;  4KT0 F;  5EQT A;  3I01 M;  3SYK A;  4LZZ A;  1WIV A;  2DHY A;  2JWS A;  1DGF A;  2M60 A;  4LY6 A;  3SBJ A;  1X37 A;  1Z5B A;  5DNY A;  4YY3 M;  2EA0 A;  3C3E A;  3PVS A;  4DV5 M;  3LVV A;  1FNN A;  4CJ6 A;  4X62 M;  2FNA A;  1TH2 A;  2KRK A;  1K82 A;  1NV9 A;  1QQW A;  1VEK A;  3HX3 A;  2JY7 A;  2K6B A;  1AIP C;  2UU9 M;  4AQY M;  1XXH B;  4S12 A;  1R4G A;  4DR7 M;  5GKN A;  3ZC7 B;  2KNZ A;  4GEW A;  5C18 A;  2CWB A;  5L8R F;  1N77 A;  3KOW E;  3GPY A;  2C9C A;  4AG6 A;  2RKO A;  4QHT A;  3W68 A;  3UMM A;  2R65 A;  1Z6T A;  1OTR A;  2MRO B;  3QWL A;  2CRU A;  4CGY B;  3NBI A;  1AUA A;  4DR3 M;  3J27 B;  2OOB A;  3IG5 A;  4MH0 E;  1WR1 B;  4QOZ C;  4II7 A;  3J7B A;  4GMQ A;  2ZAN A;  4MGI E;  2CV0 A;  2GNO A;  1GL6 A;  4DV2 M;  2MGW A;  4I5S A;  4G4R A;  4IBD A;  2APL A;  1T3T A;  2K9D A;  3M7G A;  1N33 M;  1OQY A;  3GQ5 A;  1GVN A;  3BOS A;  4UN2 B;  3VKH A;  3GRV A;  3ZH9 B;  4JI3 M;  1UFZ A;  2Z3X A;  4GHA A;  1OIZ A;  1IY2 A;  2KEB A;  1OAI A;  2DEN A;  3B7Q A;  1W5S A;  4CHT B;  4B3R M;  2CFO A;  2R4E A;  4OVZ B;  4NXN M;  3BXW A;  1WGL A;  5EXS A;  3KXE C;  1TF0 B;  3DFZ A;  1NHW C;  2C5R A;  4NRV A;  2J5Y A;  4KLN A;  1VEJ A;  2EKK A;  2QCU A;  3VKG A;  2KZU A;  1NJG A;  1PJS A;  2JZ1 A;  1Q3B A;  2ERC A;  1QAQ A;  2GQF A;  2XFS A;  1EE8 A;  3K1J A;  3K9O A;  3THG A;  3A98 B;  2CV1 A;  3W0L B;  3U6M A;  1ZMU A;  4DV3 M;  1A5T A;  1D0M A;  3TQS A;  2LVP C;  3LMM A;  3CF2 A;  4D81 A;  4RF1 A;  3RGS A;  2M5Z A;  4IBK A;  5A2Q S;  1P3Q Q;  4BBA A;  5E6J A;  2LVA A;  3UGJ A;  4DR2 M;  4FWH A;  1OKS A;  3K9P A;  1XMQ M;  3RE8 A;  3JAM S;  2ZAM A;  4IBF A;  4L15 A;  2D7H A;  1IN8 A;  3E46 A;  1WGN A;  1DV0 A;  1I4W A;  1WHC A;  3MHV C;  5IZ7 D;  5FTJ A;  3KVW A;  1TTE A;  3HU2 A;  4M0D A;  3VFD A;  3W67 A;  4LRT A;  4G4O A;  4Y28 F;  3U6C A;  2F5S A;  2Z8Y M;  4D80 A;  2VF8 A;  3GLI A;  4B3S M;  2DZO B;  5FSW A;  4DV4 M;  1IFY A;  1PM5 A;  4DV7 M;  1E9R A;  3HU1 A;  3FE3 A;  1WXQ A;  4JI1 M;  4MGH A;  1TR8 A;  2QNJ A;  5KPR A;  3J80 S;  4JI7 M;  1L8Q A;  2C98 A;  4JI8 M;  3SC3 A;  4X64 M;  2LVO C;  1L2D A;  3ZQJ A;  3TE6 A;  3JR4 A;  3E21 A;  1JR3 A;  2O01 F;  2XGN A;  1QUS A;  1XWI A;  3PNV A;  4NOO B;  5DFL A;  4R71 A;  2WSE F;  2DHR A;  4NL4 H;  3RFW A;  5EP2 A;  3SHF A;  3LCU A;  4LJ5 A;  8CAT A;  4M0W A;  5EP3 A;  4I81 A;  2VII A;  3GLF A;  1ZV1 A;  5ITR A;  4LJ4 A;  1QAN A;  1F4I A;  5IT9 S;  4Z8X A;  3FYC A;  4R7G A;  3U61 A;  4JN6 A;  2QP9 X;  3FUV A;  3KW6 A;  2UUC M;  2EO2 A;  1L1Z A;  3T1H M;  4B3M M;  2C96 A;  4FWG A;  2YR0 A;  4G4Q A;  2JY6 B;  3TWK A;  3VDP A;  4WP2 A;  3KDS E;  3LCV B;  3AL0 C;  1DGG A;  3U60 A;  5LMU M;  3A46 A;  2Z4R A;  4DR5 M;  4B3T M;  2RGO A;  4B08 A;  3E9S A;  1YLA A;  1Z5C A;  4ITQ A;  4HEO A;  3A45 A;  2K47 A;  1HQY E;  4JI6 M;  1VQ1 A;  2BWB A;  3LVW A;  4IIW A;  4P17 A;  1J5E M;  1GL7 A;  4QNM A;  4MGK E;  4LF4 M;  3SAW A;  1TH4 A;  2HAK A;  2ZBK B;  2DAE A;  1JR3 D;  1NVM A;  1QYR A;  1Z5A A;  2CHG A;  3HWS A;  1SXJ C;  3M6A A;  3K92 A;  1IBL M;  1NJF A;  1G71 A;  3GLH A;  5JI2 E;  1N32 M;  3HJS A;  2R4J A;  4B7H A;  1N78 A;  2N35 A;  2L7I A;  4TUW A;  1PJI A;  3B89 A;  3SHG B;  5BPV A;  2CHV A;  2L09 A;  4L8R C;  1GJT A;  1QDR A;  4Q7J A;  4LFA M;  1TDZ A;  1VDL A;  4CIS A;  4FD2 A;  2B3T A;  2Q2E B;  3GLI E;  3SYL A;  3HKP A;  1MN3 A;  2EKF A;  1Q3C A;  1I94 M;  1E32 A;  2H5X A;  1D0L A;  3PNY A;  1NSF A;  2QHO B;  1DGH A;  3V76 A;  1XNR M;  1L2C A;  2QQ8 A;  1IXR C;  2R62 A;  3L27 A;  4MGZ E;  3WHL A;  3QAU A;  3Q8X A;  4PCZ A;  3C9P A;  1YE9 A;  1DO2 A;  3L29 A;  4DV0 M;  2KZS A;  1FJG M;  2F4V M;  1JR3 E;  3VK8 A;  2JY5 A;  2NQ8 C;  4LF9 M;  2MJ5 B;  1GLN A;  4NSR A;  2CEA A;  2G3Q A;  2R45 A;  1ZMV A;  3SAT A;  1KSF X;  3HJ8 A;  2O25 A;  4LZJ A;  2F5O A;  3GLF E;  3U6S A;  3KSX A;  1T6O A;  2BWE A;  2JY8 A;  2LHG A;  1W5T A;  2X4A A;  1T43 A;  3FYD A;  1OAO C;  3ILK A;  4LFC M;  3A42 A;  1QUT A;  2O5R A;  4QHS A;  3GLI B;  3CF0 A;  1PGY A;  2R0I A;  2WSC F;  5F3W A;  1HNW M;  2F5Q A;  2ZTC A;  2VQE M;  5DYI A;  2L4F A;  4JXJ A;  3SAV A;  1QVR A;  2LH0 A;  2ZTD A;  3B9P A;  1RU3 A;  1G4A E;  2F5N A;  3B7Z A;  4AKH A;  1TDH A;  1BVS A;  4LFB M;  1NY5 A;  3MMP A;  3BBZ A;  4LG2 A;  2XSZ A;  3FTE A;  2HKJ A;  2FH0 A;  2BNK A;  4K0K M;  2KNV A;  4R3D A;  1PJJ A;  1IXZ A;  2H1R A;  2KDL A;  4I4L A;  4RKU F;  2DZN B;  2V1C A;  3GLH E;  1OFI A;  3U6Q A;  2ZAO A;  4LJ7 A;  3GLF B;  2RGH A;  2WSF F;  2DWL A;  4IBG A;  5KPT A;  2DI0 A;  2FE8 A;  1HNZ M;  2Y21 A;  2DWZ B;  1WJ7 A;  2I7P A;  4LJA A;  3T15 A;  3UZU A;  1NHG C;  1SXJ A;  3U61 B;  5EP4 A;  2P5T A;  5H37 D;  2QEN A;  3GPU A;  4NRW A;  4JV5 M;  2DKL A;  3EIH A;  2DAM A;  2D7G A;  2EUC A;  2G8L A;  3HHW A;  4DUY M;  2CE7 A;  4A3V B;  3U60 B;  1E94 E;  1UM8 A;  2XFT A;  4W5W A;  2R44 A;  2Y0T A;  1J09 A;  3NBX X;  4L16 A;  2J7O A;  1R2Z A;  3KFU G;  5E26 A;  4FCV A;  5KO3 A;  1HQC A;  1PRB A;  1S3S A;  1YUB A;  1OIP A;  3LQR A;  1IBK M;  3AOE C;  3U5Z A;  1IBM M;  2FFJ A;  2X49 A;  5ITQ A;  5EXT A;  2LTU A;  2LWX A;  2ZM6 M;  1N75 A;  4QNR A;  5EXP A;  2DAG A;  3KOY E; 
#chains in the Genus database with same CATH homology
 2DWN A;  3GLH B;  1NNU C;  3R8F A;  1H6U A;  1J7K A;  4IBB A;  1DO0 A;  1IN5 A;  1QZM A;  3I4V A;  3GPP A;  3C58 A;  4WUR A;  5EXX A;  3J7A S;  4LJ8 A;  3SMP A;  3SAR A;  2QBY A;  1DGH B;  1IN4 A;  4AI6 A;  4HLQ A;  4LGY A;  4GKJ M;  3E4R A;  1R2Y A;  4XGI A;  3GQ3 A;  2LXE A;  1HT2 E;  1IM2 A;  5ITX A;  3AJI B;  3MJ5 A;  3U6L A;  2Z7J A;  3GRY A;  4AG5 A;  3U6E A;  1G41 A;  5FTK A;  4OU7 A;  4IBI A;  4XBO A;  3M0E A;  3U6P A;  3HGI A;  2CUZ A;  2XZU A;  3TWM A;  3VDU A;  1SXJ E;  2X8A A;  3KP1 E;  3VK7 A;  3GRR A;  1NY6 A;  2E5L M;  1GKI A;  4ZPX A;  3AV0 A;  3FUT A;  5ITY A;  3U6O A;  4M9Z A;  4P16 A;  3T38 A;  3WHK A;  3KOX E;  1G8P A;  1K3W A;  1XHB A;  2D7E A;  3GQ4 A;  1DGB A;  3D8L A;  2HL7 A;  3L28 A;  5FTM A;  2XZF A;  4GKK M;  4MB7 A;  1MX0 A;  3GLG A;  3AOE A;  2G5G X;  3SFZ A;  2YNM D;  3TWL A;  1N36 M;  3FD9 A;  4DV1 M;  3CTW B;  3TL4 X;  4L78 A;  3HHZ A;  4D82 A;  1SXJ B;  4IBJ A;  4HL4 A;  4X66 M;  2KRU A;  2F5P A;  3MK6 A;  4G4N A;  4KO8 A;  5KPZ A;  1L1T A;  3DOA A;  2J7N A;  1ORY B;  4MM3 B;  3PXG A;  5ITU A;  4JI2 M;  4LRS A;  3GP1 A;  4I8O A;  3U5Z B;  1ZAE A;  3IG8 A;  5LMN M;  3L25 A;  1OJL A;  2KW0 A;  2XF3 A;  4LCB A;  2XH9 A;  3I4Y A;  5ITX E;  3U6D A;  2I7N A;  5KQ8 A;  1D2N A;  3SMS A;  4RNA A;  1Q39 A;  4EIW A;  2XEP A;  2HCB A;  2UXC M;  2XLJ A;  3GRU A;  3KP0 E;  4Z6Y A;  1IXS B;  1VDD A;  2DVW B;  3UK6 A;  1OFH A;  2R46 A;  3FTD A;  3K8Z A;  4PDI A;  3FUW A;  3AKZ A;  2FOI C;  2L7H A;  1HNX M;  3SAS A;  1N34 M;  2YFQ A;  4GRI A;  1R6B X;  4FCW A;  4IJE A;  4AW4 A;  4BLC A;  2QBY B;  4GH9 A;  1LV7 A;  1L2B A;  3TPZ A;  4FWD A;  3FUU A;  3NWL A;  3GPX A;  4OX9 M;  4DR6 M;  1C1K A;  4FVM A;  3L2A A;  4JI0 M;  5FLX S;  4YHH M;  4REZ A;  2YQZ A;  3HU3 A;  2UUB M;  2CHQ A;  5IRE B;  3W0F A;  1QAM A;  3PFI A;  1NNJ A;  4PT5 A;  4JI4 M;  4WW0 A;  4NSO B;  1TGU A;  2UXB M;  1QAO A;  1MU5 A;  2KXE A;  2W82 A;  3EIE A;  5BR8 M;  3L26 A;  4AKI A;  1XXH A;  3AFH A;  2UXD M;  4PDG A;  3VLF B;  3CF6 E;  2V6Z M;  4GHL A;  3J2P B;  4GC9 A;  4GIT A;  2XSZ D;  2JA2 A;  4QOS A;  3LQQ A;  4PD2 A;  3FKE A;  1G3I A;  2QZ4 A;  3HHX A;  5JI3 E;  3SAU A;  4IBC A;  2C99 A;  1TH3 A;  3KS4 A;  5EJC A;  3H4M A;  3DZD A;  4B7G A;  1HR0 M;  3GO8 A;  1SXJ D;  3UJN A;  4L4U A;  5FTN A;  2Y20 A;  3GLG B;  2VQF M;  2DXI A;  3KOZ E;  4DR4 M;  4KOD A;  5ITT A;  3OTO M;  4LF5 M;  4LF8 M;  2C9O A;  3I51 A;  4OW0 A;  3AOG A;  1JQJ C;  3FUX A;  4GC5 A;  4AZF A;  3HHY A;  4B7F A;  5IWA M;  4LJ6 A;  2DWM A;  2CV2 A;  1IY0 A;  4OVZ A;  1YSY A;  2BJV A;  2HHH M;  4M9X A;  3J81 S;  3HJQ A;  2OQ4 A;  2KA6 B;  5DYG A;  5FTL A;  7CAT A;  2OPF A;  1XNQ M;  3RGP A;  2QPA A;  3KS8 A;  5EP1 A;  3R9X B;  4DV6 M;  2UUA M;  4DR1 M;  4GIP A;  4KHP M;  2V1U A;  2BJW A;  2AHM A;  4AKG A;  3KSJ A;  1KFV A;  3DA1 A;  4X65 M;  1IQP A;  1Z59 A;  4M9S A;  1IN7 A;  5KQD A;  3JR5 A;  1XC8 A;  2LNH C;  4IJF A;  1R7R A;  1KYI A;  4IBE A;  1HT1 E;  2L6O A;  3K2L A;  1IY1 A;  1E9S A;  2R18 A;  3ZCB B;  1ZQ9 A;  4LGM A;  4MGY E;  3D8B A;  4DUZ M;  2A5Y B;  4FCT A;  4RF0 A;  4G6Z A;  4FW9 A;  1G59 A;  1IN6 A;  3T1Y M;  3FTC A;  4LF7 M;  4JYA M;  1K3X A;  2Y0Q A;  4JI5 M;  5C1B A;  2Z4S A;  4LJ9 A;  4BB9 A;  4LF6 M;  4NXM M;  1XMO M;  5EQT A;  3SYK A;  4LZZ A;  1DGF A;  2M60 A;  4LY6 A;  3SBJ A;  1X37 A;  1Z5B A;  5DNY A;  4YY3 M;  2EA0 A;  3PVS A;  4DV5 M;  3LVV A;  1FNN A;  4X62 M;  1K82 A;  2FNA A;  1TH2 A;  2KRK A;  1QQW A;  2UU9 M;  4AQY M;  1XXH B;  4S12 A;  4DR7 M;  5GKN A;  3ZC7 B;  5C18 A;  1N77 A;  3KOW E;  3GPY A;  2C9C A;  4AG6 A;  2RKO A;  4QHT A;  3UMM A;  2R65 A;  1Z6T A;  3QWL A;  4CGY B;  3NBI A;  4DR3 M;  3J27 B;  3IG5 A;  4MH0 E;  4QOZ C;  4II7 A;  3J7B A;  4GMQ A;  2ZAN A;  4MGI E;  2CV0 A;  1GL6 A;  4DV2 M;  4I5S A;  4G4R A;  4IBD A;  1T3T A;  3M7G A;  1N33 M;  3GQ5 A;  1GVN A;  3BOS A;  3VKH A;  3GRV A;  3ZH9 B;  4JI3 M;  2Z3X A;  4GHA A;  1IY2 A;  2KEB A;  4CHT B;  1W5S A;  4B3R M;  2CFO A;  2R4E A;  4OVZ B;  4NXN M;  5EXS A;  3KXE C;  3DFZ A;  1NHW C;  2C5R A;  4NRV A;  4KLN A;  2QCU A;  3VKG A;  2KZU A;  1NJG A;  1Q3B A;  2ERC A;  1QAQ A;  2XFS A;  1EE8 A;  3K1J A;  3THG A;  3A98 B;  2CV1 A;  3W0L B;  3U6M A;  4DV3 M;  3TQS A;  3LMM A;  3CF2 A;  4D81 A;  4RF1 A;  3RGS A;  2M5Z A;  4IBK A;  5A2Q S;  4BBA A;  5E6J A;  4DR2 M;  3UGJ A;  4FWH A;  1XMQ M;  3RE8 A;  3JAM S;  2ZAM A;  4IBF A;  4L15 A;  2D7H A;  1IN8 A;  1I4W A;  3MHV C;  5IZ7 D;  5FTJ A;  3KVW A;  4M0D A;  3HU2 A;  3VFD A;  4G4O A;  3FTF A;  4LRT A;  3U6C A;  2F5S A;  4D80 A;  3GLI A;  4B3S M;  2DZO B;  5FSW A;  4DV4 M;  1PM5 A;  4DV7 M;  1E9R A;  3HU1 A;  1WXQ A;  4JI1 M;  4MGH A;  5KPR A;  3J80 S;  4JI7 M;  1L8Q A;  2C98 A;  4JI8 M;  3SC3 A;  4X64 M;  1L2D A;  3JR4 A;  3TE6 A;  1JR3 A;  2XGN A;  1XWI A;  3PNV A;  4NOO B;  2DHR A;  4NL4 H;  3RFW A;  5EP2 A;  3SHF A;  4LJ5 A;  8CAT A;  4M0W A;  5EP3 A;  4I81 A;  2VII A;  3GLF A;  5ITR A;  4LJ4 A;  1QAN A;  5IT9 S;  4Z8X A;  3FYC A;  4R7G A;  3U61 A;  4JN6 A;  2QP9 X;  3FUV A;  3KW6 A;  2UUC M;  2EO2 A;  1L1Z A;  3T1H M;  4B3M M;  2C96 A;  4FWG A;  2YR0 A;  4G4Q A;  3VDP A;  3TWK A;  3KDS E;  3AL0 C;  1DGG A;  3U60 A;  5LMU M;  3A46 A;  2Z4R A;  4DR5 M;  4B3T M;  2RGO A;  4B08 A;  3E9S A;  1Z5C A;  4ITQ A;  3A45 A;  2K47 A;  1HQY E;  4JI6 M;  1J5E M;  3LVW A;  4IIW A;  1GL7 A;  4QNM A;  4MGK E;  4LF4 M;  3SAW A;  1TH4 A;  2ZBK B;  1JR3 D;  1NVM A;  1QYR A;  1Z5A A;  2CHG A;  3HWS A;  1SXJ C;  3M6A A;  3K92 A;  1IBL M;  1NJF A;  3GLH A;  5JI2 E;  1N32 M;  3HJS A;  2R4J A;  4B7H A;  1N78 A;  2L7I A;  4TUW A;  1PJI A;  3SHG B;  5BPV A;  2CHV A;  2L09 A;  4L8R C;  4CIS A;  4LFA M;  1TDZ A;  4FD2 A;  2Q2E B;  3SYL A;  3HKP A;  1Q3C A;  1I94 M;  1E32 A;  3PNY A;  1NSF A;  1DGH A;  1XNR M;  1L2C A;  1IXR C;  2R62 A;  3L27 A;  4MGZ E;  3WHL A;  3QAU A;  3Q8X A;  4PCZ A;  4DV0 M;  1YE9 A;  1DO2 A;  3L29 A;  1FJG M;  2KZS A;  2F4V M;  3VK8 A;  2NQ8 C;  4LF9 M;  1GLN A;  4NSR A;  2CEA A;  2R45 A;  3SAT A;  1KSF X;  3HJ8 A;  2F5O A;  4LZJ A;  3U6S A;  3KSX A;  3ILK A;  4LFC M;  1W5T A;  2X4A A;  3FYD A;  3A42 A;  2O5R A;  4QHS A;  3GLI B;  3CF0 A;  5F3W A;  1HNW M;  2F5Q A;  2VQE M;  5DYI A;  4JXJ A;  3SAV A;  1QVR A;  2LH0 A;  3B9P A;  2F5N A;  1G4A E;  4AKH A;  1TDH A;  4LFB M;  1NY5 A;  4LG2 A;  2XSZ A;  3FTE A;  2HKJ A;  2BNK A;  4K0K M;  4R3D A;  1PJJ A;  1IXZ A;  2H1R A;  4I4L A;  2DZN B;  2V1C A;  1OFI A;  3U6Q A;  2ZAO A;  4LJ7 A;  3GLF B;  2RGH A;  2DWL A;  4IBG A;  5KPT A;  2FE8 A;  1HNZ M;  2Y21 A;  2DWZ B;  2I7P A;  4LJA A;  3T15 A;  3UZU A;  3U61 B;  1NHG C;  1SXJ A;  5EP4 A;  2P5T A;  5H37 D;  2QEN A;  3GPU A;  4NRW A;  4JV5 M;  3EIH A;  2D7G A;  2EUC A;  2G8L A;  3HHW A;  4DUY M;  2CE7 A;  4A3V B;  3U60 B;  1E94 E;  1UM8 A;  2XFT A;  4W5W A;  2Y0T A;  1J09 A;  4L16 A;  1R2Z A;  2J7O A;  3KFU G;  5E26 A;  4FCV A;  5KO3 A;  1HQC A;  1YUB A;  1S3S A;  3LQR A;  1IBK M;  3AOE C;  3U5Z A;  1IBM M;  2FFJ A;  2X49 A;  5ITQ A;  5EXT A;  2LWX A;  2ZM6 M;  1N75 A;  4QNR A;  5EXP A;  3KOY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...