3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3SHGB 3ZCBB 3ZC7B
chains in the Genus database with same CATH superfamily
2OOBA 4LY6A 1N32M 2CUZA 4QHTA 2LH0A 2G5GX 4FVMA 3VDPA 4QOZC 2XSZA 2J7NA 1C1KA 3IG5A 3GPPA 3U6OA 1TR8A 4IBIA 3MJ5A 2L09A 4DV6M 2DAGA 3H4JA 3HU3A 4AKHA 4MGKE 1Q3BA 3GRUA 2DENA 4RNAA 4DUZM 1PJTA 2D7EA 1R6BX 4LG2A 1K3XA 3B7ZA 3KOZE 4D81A 3GLGA 4G4RA 1IN7A 4IIWA 1RU3A 2O5RA 4OVZB 3PXGA 4IBDA 4FWGA 1N36M 3Q8GA 5EP1A 2L4FA 1PJJA 5KO3A 1G8PA 3MHVC 1XXHB 1V33A 2X49A 3VKGA 1NO1A 1I94M 2KZUA 3Q8XA 3U61A 3GLFA 2HKJA 1QDTA 3A98B 3TPZA 3KFUG 1C7YA 1OQYA 3L2AA 4IJFA 3TWLA 5C1BA 3R8FA 4JV5M 2ZAOA 4ANRA 2XFSA 3L26A 1HNWM 3KOYE 5DYIA 3VLFB 1IXZA 2Y21A 2F5SA 3KP1E 5IZ7D 4WP2A 3U6MA 4OX9M 2CV2A 3SAVA 3FTDA 1X37A 3QYBA 4LF4M 3HHXA 4L4UA 4PD2A 1QQWA 1QDRA 5FTKA 5LMNM 2DAIA 2EKKA 4I4LA 3UK6A 2QSFX 2KXEA 3ZH9B 1ZMUA 4AW4A 4B08A 4X65M 3QWLA 4DBGB 4LRSA 4LJ4A 4ZPXA 4M0WA 4UN2B 4GEWA 1ZQ9A 2XSZD 4IBJA 2LVOC 3HHWA 1IN8A 2VF7A 5BPVA 2L4EA 1E9SA 4AG6A 3GPXA 2ZM6M 4M9XA 3VKHA 2APLA 2DI0A 4LCBA 1MU5A 2JZ0A 3FTCA 3QYEA 2WSCF 2O01F 4LJ6A 1DGBA 3LW5F 1YUBA 4G4NA 4KLNA 3UGJA 4LFAM 4D82A 2LVPC 2F5QA 1PJSA 4LJ8A 4XBOA 1QAQA 3QAUA 3U6CA 3B9PA 3T15A 2KA6B 4NSRA 3A46A 2I7PA 4LF5M 1QYRA 1VEKA 4LGMA 2JY7A 3SYKA 2F5PA 4WURA 1TH2A 4CISA 4MM3B 1F4IA 3CTWB 1L2CA 1N33M 2DAMA 2G8LA 4FW9A 1HT2E 1VEJA 3PFIA 4L8RC 3B7NA 5ITQA 2MR9A 3U6LA 4GC9A 1GL7A 1GABA 1EFUB 4PT5A 3L28A 3GP1A 3UMMA 1IXSA 1XXHE 4K0KM 2VIIA 4JI1M 5KPRA 4B3MM 3T1HM 5EXPA 2C96A 2F5NA 1DGHA 5FTMA 1D2NA 5FSWA 2DAKA 5EXXA 3W67A 4JYAM 1WXQA 2DVWB 2MH8A 4JN6A 3THGA 3U60A 4AZFA 1D0MA 2KRKA 1E32A 1VG5A 5DYGA 2AHMA 1DO0A 5FLXS 4DR5M 1EIJA 4QOSA 5LMUM 4GKKM 1PJIA 2C98A 4G4OA 3E46A 1K3WA 1PM5A 3TL4X 1ZV1A 1T43A 2Z3XA 2CHQA 2XGNA 3K8ZA 2CP8A 3MMPA 1UM8A 1QANA 1PJQA 1BVSA 3AOGA 4OU7A 2Z4SA 1SXJD 2RGOA 5KQ8A 4DR2M 2UUCM 1DGFA 2QBYB 2EA0A 1AIPC 3FUTA 4LFBM 4LJ5A 4A3VB 1A5TA 3AJIB 1NNJA 2EJSA 3LQRA 3FUUA 4PCZA 2LTUA 2C99A 3FRHA 1HNZM 2CV1A 2I7NA 2LBCA 2JP7A 2UUAM 4G4QA 2P5TA 2Z8YM 1QVRA 4YY3M 2LXEA 4I81A 3CF6E 2BJWA 3GLIB 2WSFF 3VFDA 2XZUA 5EP2A 3J2PB 3L29A 3HZJA 2EKFA 2C9OA 4FCTA 3WHKA 4AKGA 1NJGA 2LVQD 3GPUA 2QBYA 2VF8A 1GJTA 5FTLA 3KW6A 4JI4M 3U60B 1NV9A 2FNAA 4DV3M 3GLFB 2XLJA 1D0KA 2DNAA 5EP4A 1D0LA 5ITXA 4B7FA 1WHCA 3KOWE 2UU9M 2HAKA 4NL4H 3TWKA 4BBAA 4YHHM 5BR8M 1G4AE 1G3IA 1JQJC 1NHWC 5EQTA 1XNQM 1IFYA 1IBMM 1OFIA 3FUWA 3FTEA 1KYIA 1HQYE 3IHPA 1Q39A 1QUTA 1GVNA 3H4MA 4LGYA 3SAUA 3GLHB 4P16A 3FUVA 4F1IA 1IY0A 5IWAM 3KSXA 3SHGB 2J5YA 2JWSA 3K1JA 4FWHA 5KQDA 3I4YA 1I4WA 3LCUA 3U6PA 4Z6YA 1VEGA 2FH0A 4IBCA 3GRRA 2VQEM 3RE8A 1OIPA 5E26A 1K82A 3L27A 2UXDM 2DWZB 3LMMA 4MGIE 1HJPA 2DKLA 2JY5A 3FD9A 3VDUA 3GLGE 4B7GA 1J5EM 1SG9A 3K9PA 4LJ9A 1HT1E 1E9RA 2Z4RA 4X66M 2LVAA 3DA1A 1NVMA 3JAMS 3FTFA 3U6DA 2L2DA 3FYDA 2DXIA 2Z7JA 3FE3A 1ZMVA 4AI6A 2VQFM 2VDBB 3K2LA 5EXSA 1PGYA 2MJ5B 4FCWA 1H6UA 4RF1A 4L6V6 1R4GA 2HWJA 3FYCA 4R3DA 4DV4M 2EUCA 1N75A 1V34A 1FNNA 2R62A 4GHAA 3HJ8A 1R2YA 4QNMA 4ITQA 3ILKA 1Z5AA 1Z59A 3GLHE 2JY6B 3IECA 2R4JA 4GH9A 3MK6A 1JR3D 4II7A 3LCVB 3K9OA 4RKUF 3SC3A 1OKSA 3HHYA 2WSEF 3WHLA 3T6PA 3U6SA 1WGNA 2RRUA 3T38A 4GIPA 1VDLA 2FE8A 2OOAA 3SHFA 3HU2A 3R9XB 3HJSA 4NXMM 4OW0A 3SASA 2HL7A 5IT9S 5ITUA 5EP3A 4CJ6A 2FS1A 3HHZA 3I04M 2KEBA 4F2LA 2QP9X 2QQ8A 4EIWA 1XC8A 4M9SA 3JR5A 3D8LA 2K47A 3ZCBB 4KT0F 3GLIA 3NBIA 4Q7JA 4JXJA 3W0LB 3HX3A 1TGUA 4JI2M 1DGHB 4JI0M 4CHTB 1V92A 2V6ZM 4KODA 5KPZA 1TH3A 2QENA 1Y8GA 1IXSB 3KSJA 3L25A 2V1UA 1G71A 3VK7A 4MGYE 4NRWA 4LZJA 4MH0E 4JI3M 3EIEA 1YSYA 4R71A 1IXRC 3C9PA 3ZC7B 2A5YB 2XFTA 1N34M 4DR1M 5A2QS 3SBJA 1CUKA 1PRBA 3E4RA 2GNOA 2D7HA 4PDGA 1IM2A 4IBFA 1XXHA 4MGHA 4I8OA 2W82A 3HKPA 1QAOA 4TUWA 2CRUA 1IN5A 2QZ4A 1LV7A 3FKEA 3U6QA 3AV0A 3F92A 2YFQA 4LJAA 3EIHA 4REZA 2KRUA 4AQYM 1GO5A 4QHSA 4X62M 1QZMA 2QHOB 3KOXE 3GLHA 3TE6A 2NQ8C 5ITYA 1L2BA 1ZAEA 1IY2A 1NV8A 1R5LA 4LRTA 4M9ZA 4MB7A 4MGZE 5F3WA 1IBLM 1ORYB 2CHGA 2EO2A 1IBKM 1G41A 1VQ1A 3M0EA 3HWSA 1T3TA 3GRVA 3FUXA 5GKNA 3BOSA 1GL6A 2BJVA 2CEAA 3KXEC 3CF0A 3CF2A 3PVSA 3JR4A 4DV7M 1L8QA 3NBXX 4NOOB 3C3DA 3AFHA 2BWBA 4DR3M 4FD2A 4BB9A 2JUJA 1HR0M 2JNHA 8CATA 1OIZA 4JI7M 1DO2A 1SXJB 3I01M 2M5ZA 2XH9A 3HU1A 4DR7M 3U5ZB 1GKIA 2R46A 3A45A 3PNVA 1MJGM 2KZSA 3KVWA 2J7OA 3GQ4A 2LVNC 3U61B 3RGPA 2ZTCA 2B3TA 4L16A 4NSOB 2KHHA 4OVZA 2DWLA 3SATA 4PDIA 1NY6A 1IN4A 3GO8A 5EJCA 3GLGB 4GKJM 5ITTA 2YR0A 1G59A 3ZQJA 4XK8F 1YE9A 1DV0A 1YLAA 1W5SA 3GPYA 2XF3A 4X64M 1Q3CA 3RFWA 1EE8A 1XB2B 4G6ZA 2CV0A 4CGYB 1WIVA 1TDHA 2FOIC 2QPAA 1IY1A 2KNZA 3J7BA 3GLFE 3DFZA 1Z5CA 1L1TA 2L7HA 1N77A 3VK8A 4L15A 3SARA 2BWEA 4L78A 5FTJA 2DWNA 4D80A 2OQ4A 1NNUC 1UFZA 3GQ3A 1TTEA 2K9DA 3KDSE 4IBGA 2C5RA 2LHGA 2MROB 3BBZA 1Z5BA 2CWBA 2F4VM 2R44A 1OFHA 3NWLA 3UJNA 3DOAA 2GQFA 5H37D 1SXJA 3UZUA 3SMSA 4BLCA 2ZAMA 1DGGA 3W0FA 3E21A 4IBBA 2BNKA 3KP0E 4LF9M 2HCBA 3M6AA 4Z8XA 3GLIE 1J09A 2ZTDA 4G3OA 3B7QA 4S12A 2CHVA 3SYLA 3KS4A 2YQZA 4DV1M 1XMOM 4IBEA 2DZOB 2L7IA 1MN3A 2JA2A 4R7GA 1J7KA 1SXJC 3PNYA 3IG8A 3U6EA 3KS8A 1Z6TA 1NY5A 2KW0A 4LF6M 3I4VA 4JI5M 2XZFA 2UUBM 4LFCM 1KFVA 3SMPA 1R2ZA 4B3SM 2DZNB 2F5OA 3LVWA 3GRYA 3BXWA 1S3SA 2LHCA 4AG5A 2R6FA 4LF8M 4HEOA 3V76A 4WW0A 5JI3E 5ITRA 1QZEA 2N35A 2WZJA 4KHPM 3AL0C 5EXTA 4JI8M 5C18A 2KNAA 4LJ7A 2O25A 4NXNM 4GRIA 4CIZA 2K0BX 4GITA 3M7GA 4P17A 2LNHC 2D7GA 2HHHM 1JR3E 3LVVA 1NJFA 2FFJA 5FTNA 1TH4A 2RGHA 4FCVA 2R4EA 3AOEC 4AKIA 1IQPA 1FJGM 1ZMWA 2E5LM 2OO9A 1XNRM 1GLNA 1OAOC 4DV5M 3T1YM 3E9SA 2JXNA 3GQ5A 3C3EA 4B3TM 3AKZA 1WGLA 1XHBA 2H1RA 2R0IA 2Y0TA 2DAEA 2M60A 3FRIA 3D8BA 4I5SA 4IJEA 7CATA 4B3RM 1E94E 3J80S 1LTMA 1TDZA 1Q02A 2ERCA 3J27B 2UXBM 2QCUA 2RKOA 2UXCM 1SXJE 2JY8A 5KPTA 3U5ZA 1HQCA 3HJQA 4Y28F 2ZANA 1R7RA 4RF0A 2R18A 4DUYM 5DFLA 3LQQA 1T6OA 2KDLA 3C58A 3AOEA 2H5XA 2Y0QA 5JI2E 2CFOA 1OJLA 4M0DA 2R65A 4KO8A 4DR4M 2G3QA 4W5WA 4DR6M 3DZDA 3W68A 3SFZA 4IBKA 1IN6A 2KNVA 4HL4A 1WJ7A 1JB0F 4JI6M 1NSFA 2DHYA 1QUSA 5ITXE 2Y20A 2ZBKB 1XWIA 2LWXA 3CGWA 1JR3A 3I51A 4LZZA 2CE7A 1L1ZA 5E6JA 2DHRA 3HY5A 1KSFX 3K92A 1XMQM 1P3QQ 4DV0M 4LF7M 1OAIA 4NRVA 5IREB 1HNXM 2X4AA 3B74A 2K6BA 3HGIA 4B7HA 1QAMA 2XEPA 4NC6A 2QNJA 3TWMA 3TQSA 1OTRA 3SAWA 2V1CA 3J7AS 1W5TA 2YNMD 4GMQA 1N78A 2JZ1A 3A42A 4HLQA 3OTOM 1WR1B 5DNYA 1L2DA 1GJSA 1VDDA 3B89A 2C9CA 2Q2EB 4GC5A 5L8RF 1MX0A 1AUAA 2DZLA 2MGWA 4FWDA 3RGSA 2DWMA 4GHLA 2R45A 4XGIA 3J81S 1TF0B 2L6OA 1NHGC 4DV2M 4QNRA 2X8AA 2OPFA
chains in the Genus database with same CATH topology
4LY6A 1N32M 2CUZA 4QHTA 2LH0A 2G5GX 4FVMA 3VDPA 4QOZC 2XSZA 2J7NA 1C1KA 3IG5A 3GPPA 3U6OA 4IBIA 3MJ5A 2L09A 4DV6M 4AKHA 3HU3A 4MGKE 1Q3BA 3GRUA 4RNAA 4DUZM 2D7EA 1R6BX 4LG2A 1K3XA 3KOZE 4D81A 3GLGA 4G4RA 1IN7A 4IIWA 2O5RA 4OVZB 3PXGA 4IBDA 4FWGA 1N36M 5EP1A 1PJJA 5KO3A 1G8PA 3MHVC 1XXHB 3VKGA 2X49A 1I94M 2KZUA 3Q8XA 3U61A 3GLFA 2HKJA 3A98B 3TPZA 3KFUG 4IJFA 3L2AA 3TWLA 5C1BA 3R8FA 4JV5M 2ZAOA 3L26A 2XFSA 1HNWM 3KOYE 5DYIA 3VLFB 1IXZA 2Y21A 2F5SA 3KP1E 5IZ7D 3U6MA 4OX9M 2CV2A 3SAVA 3FTDA 1X37A 4LF4M 3HHXA 4L4UA 4PD2A 1QQWA 5FTKA 5LMNM 4I4LA 3UK6A 2KXEA 3ZH9B 4AW4A 4B08A 4X65M 3QWLA 4LRSA 4LJ4A 4ZPXA 4M0WA 1ZQ9A 2XSZD 4IBJA 3HHWA 1IN8A 5BPVA 1E9SA 4AG6A 3GPXA 2ZM6M 4M9XA 3VKHA 4LCBA 1MU5A 3FTCA 4LJ6A 1DGBA 1YUBA 4G4NA 4KLNA 3UGJA 4LFAM 4D82A 2F5QA 4LJ8A 4XBOA 1QAQA 3QAUA 3U6CA 3B9PA 3T15A 2KA6B 4NSRA 3A46A 2I7PA 4LF5M 1QYRA 4LGMA 2F5PA 3SYKA 4WURA 1TH2A 4CISA 4MM3B 3CTWB 1L2CA 1N33M 2G8LA 4FW9A 1HT2E 3PFIA 4L8RC 5ITQA 3U6LA 4GC9A 1GL7A 4PT5A 3L28A 3GP1A 3UMMA 4K0KM 2VIIA 4JI1M 5KPRA 4B3MM 3T1HM 5EXPA 2C96A 2F5NA 1DGHA 5FTMA 1D2NA 5FSWA 5EXXA 4JYAM 1WXQA 2DVWB 4JN6A 3THGA 3U60A 4AZFA 2KRKA 1E32A 5DYGA 2AHMA 1DO0A 5FLXS 4DR5M 4QOSA 5LMUM 4GKKM 1PJIA 2C98A 4G4OA 1K3WA 1PM5A 3TL4X 2Z3XA 2CHQA 2XGNA 3K8ZA 1UM8A 1QANA 3AOGA 4OU7A 2Z4SA 1SXJD 2RGOA 5KQ8A 4DR2M 2UUCM 1DGFA 2QBYB 2EA0A 3FUTA 4LFBM 4LJ5A 4A3VB 3AJIB 1NNJA 3LQRA 3FUUA 4PCZA 2C99A 1HNZM 2CV1A 2I7NA 2UUAM 4G4QA 2P5TA 1QVRA 4YY3M 2LXEA 4I81A 3CF6E 2BJWA 3GLIB 3VFDA 2XZUA 5EP2A 3J2PB 3L29A 2C9OA 4FCTA 3WHKA 4AKGA 1NJGA 3GPUA 2QBYA 5FTLA 3KW6A 4JI4M 3U60B 2FNAA 4DV3M 3GLFB 2XLJA 5EP4A 5ITXA 4B7FA 3KOWE 2UU9M 4NL4H 3TWKA 4BBAA 4YHHM 5BR8M 1G4AE 1G3IA 1JQJC 1NHWC 5EQTA 1XNQM 1IBMM 1OFIA 3FUWA 3FTEA 1KYIA 1HQYE 1Q39A 1GVNA 3H4MA 4LGYA 3SAUA 3GLHB 4P16A 3FUVA 1IY0A 5IWAM 3KSXA 3SHGB 3K1JA 4FWHA 5KQDA 3I4YA 1I4WA 3U6PA 4Z6YA 4IBCA 3GRRA 2VQEM 3RE8A 5E26A 1K82A 3L27A 2UXDM 2DWZB 3LMMA 4MGIE 3FD9A 3VDUA 4B7GA 1J5EM 4LJ9A 1HT1E 1E9RA 2Z4RA 4X66M 3DA1A 3JAMS 1NVMA 3FTFA 3U6DA 3FYDA 2DXIA 2Z7JA 4AI6A 2VQFM 3K2LA 5EXSA 4FCWA 1H6UA 4RF1A 4R3DA 3FYCA 4DV4M 2EUCA 1N75A 1FNNA 2R62A 4GHAA 3HJ8A 1R2YA 4QNMA 4ITQA 3ILKA 1Z5AA 1Z59A 2R4JA 4GH9A 3MK6A 1JR3D 4II7A 3SC3A 3HHYA 3WHLA 3U6SA 3T38A 4GIPA 2FE8A 3SHFA 3HU2A 3R9XB 3HJSA 4NXMM 4OW0A 3SASA 2HL7A 5IT9S 5ITUA 5EP3A 3HHZA 2KEBA 2QP9X 4EIWA 1XC8A 4M9SA 3JR5A 3D8LA 2K47A 3ZCBB 3GLIA 3NBIA 4JXJA 3W0LB 1TGUA 4JI2M 1DGHB 4JI0M 4CHTB 5KPZA 2V6ZM 4KODA 1TH3A 2QENA 1IXSB 3KSJA 3L25A 2V1UA 3VK7A 4MGYE 4NRWA 4LZJA 4MH0E 4JI3M 3EIEA 1YSYA 1IXRC 3ZC7B 2A5YB 2XFTA 1N34M 4DR1M 5A2QS 3SBJA 3E4RA 2D7HA 4PDGA 1IM2A 4IBFA 1XXHA 4MGHA 4I8OA 2W82A 3HKPA 1QAOA 4TUWA 2QZ4A 1IN5A 1LV7A 3FKEA 3U6QA 3AV0A 2YFQA 4LJAA 3EIHA 4REZA 2KRUA 4AQYM 4QHSA 4X62M 1QZMA 3KOXE 3GLHA 3TE6A 2NQ8C 5ITYA 1L2BA 1ZAEA 1IY2A 4LRTA 4M9ZA 4MB7A 4MGZE 5F3WA 1IBLM 1ORYB 2CHGA 2EO2A 1IBKM 1G41A 3M0EA 3HWSA 1T3TA 3GRVA 3FUXA 5GKNA 3BOSA 1GL6A 2BJVA 2CEAA 3KXEC 3CF0A 3CF2A 3PVSA 3JR4A 4DV7M 1L8QA 4NOOB 3AFHA 4DR3M 4FD2A 4BB9A 1HR0M 8CATA 4JI7M 1DO2A 1SXJB 2M5ZA 2XH9A 3HU1A 4DR7M 3U5ZB 1GKIA 2R46A 3A45A 3PNVA 2KZSA 3KVWA 2J7OA 3GQ4A 3U61B 3RGPA 4NSOB 4L16A 4OVZA 2DWLA 3SATA 4PDIA 1NY6A 1IN4A 3GO8A 5EJCA 3GLGB 4GKJM 5ITTA 2YR0A 1G59A 1YE9A 1W5SA 3GPYA 2XF3A 4X64M 1Q3CA 3RFWA 1EE8A 4G6ZA 2CV0A 4CGYB 1TDHA 2FOIC 2QPAA 1IY1A 1L1TA 3J7BA 3DFZA 1Z5CA 2L7HA 1N77A 3VK8A 4L15A 3SARA 4L78A 5FTJA 2DWNA 4D80A 2OQ4A 1NNUC 3GQ3A 4IBGA 3KDSE 2C5RA 1Z5BA 2F4VM 3UJNA 1OFHA 3NWLA 3DOAA 5H37D 1SXJA 3UZUA 3SMSA 4BLCA 2ZAMA 1DGGA 3W0FA 4IBBA 2BNKA 3KP0E 4LF9M 2HCBA 3M6AA 4Z8XA 1J09A 4S12A 3SYLA 2CHVA 3KS4A 2YQZA 4DV1M 1XMOM 4IBEA 2DZOB 2L7IA 2JA2A 4R7GA 1J7KA 1SXJC 3PNYA 3IG8A 3U6EA 3KS8A 1Z6TA 1NY5A 2KW0A 4LF6M 3I4VA 4JI5M 2XZFA 2UUBM 4LFCM 1KFVA 3SMPA 1R2ZA 4B3SM 2DZNB 2F5OA 3LVWA 3GRYA 1S3SA 4AG5A 4LF8M 4WW0A 5JI3E 5ITRA 4KHPM 3AL0C 5EXTA 4JI8M 5C18A 4LJ7A 4NXNM 4GRIA 4GITA 3M7GA 2LNHC 2D7GA 2HHHM 3LVVA 1NJFA 2FFJA 5FTNA 1TH4A 2RGHA 4FCVA 2R4EA 3AOEC 4AKIA 1IQPA 1FJGM 1XNRM 2E5LM 1GLNA 4DV5M 3T1YM 3E9SA 3GQ5A 4B3TM 3AKZA 1XHBA 2H1RA 2Y0TA 2M60A 4IJEA 3D8BA 4I5SA 7CATA 4B3RM 1E94E 3J80S 1TDZA 3J27B 2ERCA 2UXBM 2QCUA 2RKOA 2UXCM 1SXJE 5KPTA 3U5ZA 1HQCA 3HJQA 2ZANA 1R7RA 4RF0A 2R18A 4DUYM 3LQQA 3C58A 3AOEA 2Y0QA 5JI2E 2CFOA 1OJLA 4M0DA 2R65A 4KO8A 4DR4M 4W5WA 4DR6M 3DZDA 3SFZA 4IBKA 1IN6A 4HL4A 4JI6M 1NSFA 5ITXE 2Y20A 2ZBKB 1XWIA 2LWXA 3I51A 1JR3A 4LZZA 1L1ZA 2CE7A 5E6JA 2DHRA 3K92A 1KSFX 4LF7M 1XMQM 4DV0M 4NRVA 5IREB 1HNXM 2X4AA 3HGIA 4B7HA 1QAMA 2XEPA 3TWMA 3TQSA 3SAWA 2V1CA 3J7AS 1W5TA 2YNMD 4GMQA 1N78A 3A42A 4HLQA 3OTOM 5DNYA 1L2DA 1VDDA 2C9CA 2Q2EB 4GC5A 1MX0A 4FWDA 3RGSA 2DWMA 4GHLA 2R45A 4XGIA 3J81S 2L6OA 1NHGC 4DV2M 4QNRA 2X8AA 2OPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZCB B;  3ZC7 B; 
#chains in the Genus database with same CATH topology
 2OOB A;  4LY6 A;  1N32 M;  2CUZ A;  4QHT A;  2LH0 A;  2G5G X;  4FVM A;  3VDP A;  4QOZ C;  2XSZ A;  2J7N A;  1C1K A;  3IG5 A;  3GPP A;  3U6O A;  1TR8 A;  4IBI A;  3MJ5 A;  2L09 A;  4DV6 M;  2DAG A;  3H4J A;  3HU3 A;  4AKH A;  4MGK E;  1Q3B A;  3GRU A;  2DEN A;  4RNA A;  4DUZ M;  1PJT A;  2D7E A;  1R6B X;  4LG2 A;  1K3X A;  3B7Z A;  3KOZ E;  4D81 A;  3GLG A;  4G4R A;  1IN7 A;  4IIW A;  1RU3 A;  2O5R A;  4OVZ B;  3PXG A;  4IBD A;  4FWG A;  1N36 M;  3Q8G A;  5EP1 A;  2L4F A;  1PJJ A;  5KO3 A;  1G8P A;  3MHV C;  1XXH B;  1V33 A;  2X49 A;  3VKG A;  1NO1 A;  1I94 M;  2KZU A;  3Q8X A;  3U61 A;  3GLF A;  2HKJ A;  1QDT A;  3A98 B;  3TPZ A;  3KFU G;  1C7Y A;  1OQY A;  3L2A A;  4IJF A;  3TWL A;  5C1B A;  3R8F A;  4JV5 M;  2ZAO A;  4ANR A;  2XFS A;  3L26 A;  1HNW M;  3KOY E;  5DYI A;  3VLF B;  1IXZ A;  2Y21 A;  2F5S A;  3KP1 E;  5IZ7 D;  4WP2 A;  3U6M A;  4OX9 M;  2CV2 A;  3SAV A;  3FTD A;  1X37 A;  3QYB A;  4LF4 M;  3HHX A;  4L4U A;  4PD2 A;  1QQW A;  1QDR A;  5FTK A;  5LMN M;  2DAI A;  2EKK A;  4I4L A;  3UK6 A;  2QSF X;  2KXE A;  3ZH9 B;  1ZMU A;  4AW4 A;  4B08 A;  4X65 M;  3QWL A;  4DBG B;  4LRS A;  4LJ4 A;  4ZPX A;  4M0W A;  4UN2 B;  4GEW A;  1ZQ9 A;  2XSZ D;  4IBJ A;  2LVO C;  3HHW A;  1IN8 A;  2VF7 A;  5BPV A;  2L4E A;  1E9S A;  4AG6 A;  3GPX A;  2ZM6 M;  4M9X A;  3VKH A;  2APL A;  2DI0 A;  4LCB A;  1MU5 A;  2JZ0 A;  3FTC A;  3QYE A;  2WSC F;  2O01 F;  4LJ6 A;  1DGB A;  3LW5 F;  1YUB A;  4G4N A;  4KLN A;  3UGJ A;  4LFA M;  4D82 A;  2LVP C;  2F5Q A;  1PJS A;  4LJ8 A;  4XBO A;  1QAQ A;  3QAU A;  3U6C A;  3B9P A;  3T15 A;  2KA6 B;  4NSR A;  3A46 A;  2I7P A;  4LF5 M;  1QYR A;  1VEK A;  4LGM A;  2JY7 A;  3SYK A;  2F5P A;  4WUR A;  1TH2 A;  4CIS A;  4MM3 B;  1F4I A;  3CTW B;  1L2C A;  1N33 M;  2DAM A;  2G8L A;  4FW9 A;  1HT2 E;  1VEJ A;  3PFI A;  4L8R C;  3B7N A;  5ITQ A;  2MR9 A;  3U6L A;  4GC9 A;  1GL7 A;  1GAB A;  1EFU B;  4PT5 A;  3L28 A;  3GP1 A;  3UMM A;  1IXS A;  1XXH E;  4K0K M;  2VII A;  4JI1 M;  5KPR A;  4B3M M;  3T1H M;  5EXP A;  2C96 A;  2F5N A;  1DGH A;  5FTM A;  1D2N A;  5FSW A;  2DAK A;  5EXX A;  3W67 A;  4JYA M;  1WXQ A;  2DVW B;  2MH8 A;  4JN6 A;  3THG A;  3U60 A;  4AZF A;  1D0M A;  2KRK A;  1E32 A;  1VG5 A;  5DYG A;  2AHM A;  1DO0 A;  5FLX S;  4DR5 M;  1EIJ A;  4QOS A;  5LMU M;  4GKK M;  1PJI A;  2C98 A;  4G4O A;  3E46 A;  1K3W A;  1PM5 A;  3TL4 X;  1ZV1 A;  1T43 A;  2Z3X A;  2CHQ A;  2XGN A;  3K8Z A;  2CP8 A;  3MMP A;  1UM8 A;  1QAN A;  1PJQ A;  1BVS A;  3AOG A;  4OU7 A;  2Z4S A;  1SXJ D;  2RGO A;  5KQ8 A;  4DR2 M;  2UUC M;  1DGF A;  2QBY B;  2EA0 A;  1AIP C;  3FUT A;  4LFB M;  4LJ5 A;  4A3V B;  1A5T A;  3AJI B;  1NNJ A;  2EJS A;  3LQR A;  3FUU A;  4PCZ A;  2LTU A;  2C99 A;  3FRH A;  1HNZ M;  2CV1 A;  2I7N A;  2LBC A;  2JP7 A;  2UUA M;  4G4Q A;  2P5T A;  2Z8Y M;  1QVR A;  4YY3 M;  2LXE A;  4I81 A;  3CF6 E;  2BJW A;  3GLI B;  2WSF F;  3VFD A;  2XZU A;  5EP2 A;  3J2P B;  3L29 A;  3HZJ A;  2EKF A;  2C9O A;  4FCT A;  3WHK A;  4AKG A;  1NJG A;  2LVQ D;  3GPU A;  2QBY A;  2VF8 A;  1GJT A;  5FTL A;  3KW6 A;  4JI4 M;  3U60 B;  1NV9 A;  2FNA A;  4DV3 M;  3GLF B;  2XLJ A;  1D0K A;  2DNA A;  5EP4 A;  1D0L A;  5ITX A;  4B7F A;  1WHC A;  3KOW E;  2UU9 M;  2HAK A;  4NL4 H;  3TWK A;  4BBA A;  4YHH M;  5BR8 M;  1G4A E;  1G3I A;  1JQJ C;  1NHW C;  5EQT A;  1XNQ M;  1IFY A;  1IBM M;  1OFI A;  3FUW A;  3FTE A;  1KYI A;  1HQY E;  3IHP A;  1Q39 A;  1QUT A;  1GVN A;  3H4M A;  4LGY A;  3SAU A;  3GLH B;  4P16 A;  3FUV A;  4F1I A;  1IY0 A;  5IWA M;  3KSX A;  3SHG B;  2J5Y A;  2JWS A;  3K1J A;  4FWH A;  5KQD A;  3I4Y A;  1I4W A;  3LCU A;  3U6P A;  4Z6Y A;  1VEG A;  2FH0 A;  4IBC A;  3GRR A;  2VQE M;  3RE8 A;  1OIP A;  5E26 A;  1K82 A;  3L27 A;  2UXD M;  2DWZ B;  3LMM A;  4MGI E;  1HJP A;  2DKL A;  2JY5 A;  3FD9 A;  3VDU A;  3GLG E;  4B7G A;  1J5E M;  1SG9 A;  3K9P A;  4LJ9 A;  1HT1 E;  1E9R A;  2Z4R A;  4X66 M;  2LVA A;  3DA1 A;  1NVM A;  3JAM S;  3FTF A;  3U6D A;  2L2D A;  3FYD A;  2DXI A;  2Z7J A;  3FE3 A;  1ZMV A;  4AI6 A;  2VQF M;  2VDB B;  3K2L A;  5EXS A;  1PGY A;  2MJ5 B;  4FCW A;  1H6U A;  4RF1 A;  4L6V 6;  1R4G A;  2HWJ A;  3FYC A;  4R3D A;  4DV4 M;  2EUC A;  1N75 A;  1V34 A;  1FNN A;  2R62 A;  4GHA A;  3HJ8 A;  1R2Y A;  4QNM A;  4ITQ A;  3ILK A;  1Z5A A;  1Z59 A;  3GLH E;  2JY6 B;  3IEC A;  2R4J A;  4GH9 A;  3MK6 A;  1JR3 D;  4II7 A;  3LCV B;  3K9O A;  4RKU F;  3SC3 A;  1OKS A;  3HHY A;  2WSE F;  3WHL A;  3T6P A;  3U6S A;  1WGN A;  2RRU A;  3T38 A;  4GIP A;  1VDL A;  2FE8 A;  2OOA A;  3SHF A;  3HU2 A;  3R9X B;  3HJS A;  4NXM M;  4OW0 A;  3SAS A;  2HL7 A;  5IT9 S;  5ITU A;  5EP3 A;  4CJ6 A;  2FS1 A;  3HHZ A;  3I04 M;  2KEB A;  4F2L A;  2QP9 X;  2QQ8 A;  4EIW A;  1XC8 A;  4M9S A;  3JR5 A;  3D8L A;  2K47 A;  3ZCB B;  4KT0 F;  3GLI A;  3NBI A;  4Q7J A;  4JXJ A;  3W0L B;  3HX3 A;  1TGU A;  4JI2 M;  1DGH B;  4JI0 M;  4CHT B;  1V92 A;  2V6Z M;  4KOD A;  5KPZ A;  1TH3 A;  2QEN A;  1Y8G A;  1IXS B;  3KSJ A;  3L25 A;  2V1U A;  1G71 A;  3VK7 A;  4MGY E;  4NRW A;  4LZJ A;  4MH0 E;  4JI3 M;  3EIE A;  1YSY A;  4R71 A;  1IXR C;  3C9P A;  3ZC7 B;  2A5Y B;  2XFT A;  1N34 M;  4DR1 M;  5A2Q S;  3SBJ A;  1CUK A;  1PRB A;  3E4R A;  2GNO A;  2D7H A;  4PDG A;  1IM2 A;  4IBF A;  1XXH A;  4MGH A;  4I8O A;  2W82 A;  3HKP A;  1QAO A;  4TUW A;  2CRU A;  1IN5 A;  2QZ4 A;  1LV7 A;  3FKE A;  3U6Q A;  3AV0 A;  3F92 A;  2YFQ A;  4LJA A;  3EIH A;  4REZ A;  2KRU A;  4AQY M;  1GO5 A;  4QHS A;  4X62 M;  1QZM A;  2QHO B;  3KOX E;  3GLH A;  3TE6 A;  2NQ8 C;  5ITY A;  1L2B A;  1ZAE A;  1IY2 A;  1NV8 A;  1R5L A;  4LRT A;  4M9Z A;  4MB7 A;  4MGZ E;  5F3W A;  1IBL M;  1ORY B;  2CHG A;  2EO2 A;  1IBK M;  1G41 A;  1VQ1 A;  3M0E A;  3HWS A;  1T3T A;  3GRV A;  3FUX A;  5GKN A;  3BOS A;  1GL6 A;  2BJV A;  2CEA A;  3KXE C;  3CF0 A;  3CF2 A;  3PVS A;  3JR4 A;  4DV7 M;  1L8Q A;  3NBX X;  4NOO B;  3C3D A;  3AFH A;  2BWB A;  4DR3 M;  4FD2 A;  4BB9 A;  2JUJ A;  1HR0 M;  2JNH A;  8CAT A;  1OIZ A;  4JI7 M;  1DO2 A;  1SXJ B;  3I01 M;  2M5Z A;  2XH9 A;  3HU1 A;  4DR7 M;  3U5Z B;  1GKI A;  2R46 A;  3A45 A;  3PNV A;  1MJG M;  2KZS A;  3KVW A;  2J7O A;  3GQ4 A;  2LVN C;  3U61 B;  3RGP A;  2ZTC A;  2B3T A;  4L16 A;  4NSO B;  2KHH A;  4OVZ A;  2DWL A;  3SAT A;  4PDI A;  1NY6 A;  1IN4 A;  3GO8 A;  5EJC A;  3GLG B;  4GKJ M;  5ITT A;  2YR0 A;  1G59 A;  3ZQJ A;  4XK8 F;  1YE9 A;  1DV0 A;  1YLA A;  1W5S A;  3GPY A;  2XF3 A;  4X64 M;  1Q3C A;  3RFW A;  1EE8 A;  1XB2 B;  4G6Z A;  2CV0 A;  4CGY B;  1WIV A;  1TDH A;  2FOI C;  2QPA A;  1IY1 A;  2KNZ A;  3J7B A;  3GLF E;  3DFZ A;  1Z5C A;  1L1T A;  2L7H A;  1N77 A;  3VK8 A;  4L15 A;  3SAR A;  2BWE A;  4L78 A;  5FTJ A;  2DWN A;  4D80 A;  2OQ4 A;  1NNU C;  1UFZ A;  3GQ3 A;  1TTE A;  2K9D A;  3KDS E;  4IBG A;  2C5R A;  2LHG A;  2MRO B;  3BBZ A;  1Z5B A;  2CWB A;  2F4V M;  2R44 A;  1OFH A;  3NWL A;  3UJN A;  3DOA A;  2GQF A;  5H37 D;  1SXJ A;  3UZU A;  3SMS A;  4BLC A;  2ZAM A;  1DGG A;  3W0F A;  3E21 A;  4IBB A;  2BNK A;  3KP0 E;  4LF9 M;  2HCB A;  3M6A A;  4Z8X A;  3GLI E;  1J09 A;  2ZTD A;  4G3O A;  3B7Q A;  4S12 A;  2CHV A;  3SYL A;  3KS4 A;  2YQZ A;  4DV1 M;  1XMO M;  4IBE A;  2DZO B;  2L7I A;  1MN3 A;  2JA2 A;  4R7G A;  1J7K A;  1SXJ C;  3PNY A;  3IG8 A;  3U6E A;  3KS8 A;  1Z6T A;  1NY5 A;  2KW0 A;  4LF6 M;  3I4V A;  4JI5 M;  2XZF A;  2UUB M;  4LFC M;  1KFV A;  3SMP A;  1R2Z A;  4B3S M;  2DZN B;  2F5O A;  3LVW A;  3GRY A;  3BXW A;  1S3S A;  2LHC A;  4AG5 A;  2R6F A;  4LF8 M;  4HEO A;  3V76 A;  4WW0 A;  5JI3 E;  5ITR A;  1QZE A;  2N35 A;  2WZJ A;  4KHP M;  3AL0 C;  5EXT A;  4JI8 M;  5C18 A;  2KNA A;  4LJ7 A;  2O25 A;  4NXN M;  4GRI A;  4CIZ A;  2K0B X;  4GIT A;  3M7G A;  4P17 A;  2LNH C;  2D7G A;  2HHH M;  1JR3 E;  3LVV A;  1NJF A;  2FFJ A;  5FTN A;  1TH4 A;  2RGH A;  4FCV A;  2R4E A;  3AOE C;  4AKI A;  1IQP A;  1FJG M;  1ZMW A;  2E5L M;  2OO9 A;  1XNR M;  1GLN A;  1OAO C;  4DV5 M;  3T1Y M;  3E9S A;  2JXN A;  3GQ5 A;  3C3E A;  4B3T M;  3AKZ A;  1WGL A;  1XHB A;  2H1R A;  2R0I A;  2Y0T A;  2DAE A;  2M60 A;  3FRI A;  3D8B A;  4I5S A;  4IJE A;  7CAT A;  4B3R M;  1E94 E;  3J80 S;  1LTM A;  1TDZ A;  1Q02 A;  2ERC A;  3J27 B;  2UXB M;  2QCU A;  2RKO A;  2UXC M;  1SXJ E;  2JY8 A;  5KPT A;  3U5Z A;  1HQC A;  3HJQ A;  4Y28 F;  2ZAN A;  1R7R A;  4RF0 A;  2R18 A;  4DUY M;  5DFL A;  3LQQ A;  1T6O A;  2KDL A;  3C58 A;  3AOE A;  2H5X A;  2Y0Q A;  5JI2 E;  2CFO A;  1OJL A;  4M0D A;  2R65 A;  4KO8 A;  4DR4 M;  2G3Q A;  4W5W A;  4DR6 M;  3DZD A;  3W68 A;  3SFZ A;  4IBK A;  1IN6 A;  2KNV A;  4HL4 A;  1WJ7 A;  1JB0 F;  4JI6 M;  1NSF A;  2DHY A;  1QUS A;  5ITX E;  2Y20 A;  2ZBK B;  1XWI A;  2LWX A;  3CGW A;  1JR3 A;  3I51 A;  4LZZ A;  2CE7 A;  1L1Z A;  5E6J A;  2DHR A;  3HY5 A;  1KSF X;  3K92 A;  1XMQ M;  1P3Q Q;  4DV0 M;  4LF7 M;  1OAI A;  4NRV A;  5IRE B;  1HNX M;  2X4A A;  3B74 A;  2K6B A;  3HGI A;  4B7H A;  1QAM A;  2XEP A;  4NC6 A;  2QNJ A;  3TWM A;  3TQS A;  1OTR A;  3SAW A;  2V1C A;  3J7A S;  1W5T A;  2YNM D;  4GMQ A;  1N78 A;  2JZ1 A;  3A42 A;  4HLQ A;  3OTO M;  1WR1 B;  5DNY A;  1L2D A;  1GJS A;  1VDD A;  3B89 A;  2C9C A;  2Q2E B;  4GC5 A;  5L8R F;  1MX0 A;  1AUA A;  2DZL A;  2MGW A;  4FWD A;  3RGS A;  2DWM A;  4GHL A;  2R45 A;  4XGI A;  3J81 S;  1TF0 B;  2L6O A;  1NHG C;  4DV2 M;  4QNR A;  2X8A A;  2OPF A; 
#chains in the Genus database with same CATH homology
 4LY6 A;  1N32 M;  2CUZ A;  4QHT A;  2LH0 A;  2G5G X;  4FVM A;  3VDP A;  4QOZ C;  2XSZ A;  2J7N A;  1C1K A;  3IG5 A;  3GPP A;  3U6O A;  4IBI A;  3MJ5 A;  2L09 A;  4DV6 M;  4AKH A;  3HU3 A;  4MGK E;  1Q3B A;  3GRU A;  4RNA A;  4DUZ M;  2D7E A;  1R6B X;  4LG2 A;  1K3X A;  3KOZ E;  4D81 A;  3GLG A;  4G4R A;  1IN7 A;  4IIW A;  2O5R A;  4OVZ B;  3PXG A;  4IBD A;  4FWG A;  1N36 M;  5EP1 A;  1PJJ A;  5KO3 A;  1G8P A;  3MHV C;  1XXH B;  3VKG A;  2X49 A;  1I94 M;  2KZU A;  3Q8X A;  3U61 A;  3GLF A;  2HKJ A;  3A98 B;  3TPZ A;  3KFU G;  4IJF A;  3L2A A;  3TWL A;  5C1B A;  3R8F A;  4JV5 M;  2ZAO A;  3L26 A;  2XFS A;  1HNW M;  3KOY E;  5DYI A;  3VLF B;  1IXZ A;  2Y21 A;  2F5S A;  3KP1 E;  5IZ7 D;  3U6M A;  4OX9 M;  2CV2 A;  3SAV A;  3FTD A;  1X37 A;  4LF4 M;  3HHX A;  4L4U A;  4PD2 A;  1QQW A;  5FTK A;  5LMN M;  4I4L A;  3UK6 A;  2KXE A;  3ZH9 B;  4AW4 A;  4B08 A;  4X65 M;  3QWL A;  4LRS A;  4LJ4 A;  4ZPX A;  4M0W A;  1ZQ9 A;  2XSZ D;  4IBJ A;  3HHW A;  1IN8 A;  5BPV A;  1E9S A;  4AG6 A;  3GPX A;  2ZM6 M;  4M9X A;  3VKH A;  4LCB A;  1MU5 A;  3FTC A;  4LJ6 A;  1DGB A;  1YUB A;  4G4N A;  4KLN A;  3UGJ A;  4LFA M;  4D82 A;  2F5Q A;  4LJ8 A;  4XBO A;  1QAQ A;  3QAU A;  3U6C A;  3B9P A;  3T15 A;  2KA6 B;  4NSR A;  3A46 A;  2I7P A;  4LF5 M;  1QYR A;  4LGM A;  2F5P A;  3SYK A;  4WUR A;  1TH2 A;  4CIS A;  4MM3 B;  3CTW B;  1L2C A;  1N33 M;  2G8L A;  4FW9 A;  1HT2 E;  3PFI A;  4L8R C;  5ITQ A;  3U6L A;  4GC9 A;  1GL7 A;  4PT5 A;  3L28 A;  3GP1 A;  3UMM A;  4K0K M;  2VII A;  4JI1 M;  5KPR A;  4B3M M;  3T1H M;  5EXP A;  2C96 A;  2F5N A;  1DGH A;  5FTM A;  1D2N A;  5FSW A;  5EXX A;  4JYA M;  1WXQ A;  2DVW B;  4JN6 A;  3THG A;  3U60 A;  4AZF A;  2KRK A;  1E32 A;  5DYG A;  2AHM A;  1DO0 A;  5FLX S;  4DR5 M;  4QOS A;  5LMU M;  4GKK M;  1PJI A;  2C98 A;  4G4O A;  1K3W A;  1PM5 A;  3TL4 X;  2Z3X A;  2CHQ A;  2XGN A;  3K8Z A;  1UM8 A;  1QAN A;  3AOG A;  4OU7 A;  2Z4S A;  1SXJ D;  2RGO A;  5KQ8 A;  4DR2 M;  2UUC M;  1DGF A;  2QBY B;  2EA0 A;  3FUT A;  4LFB M;  4LJ5 A;  4A3V B;  3AJI B;  1NNJ A;  3LQR A;  3FUU A;  4PCZ A;  2C99 A;  1HNZ M;  2CV1 A;  2I7N A;  2UUA M;  4G4Q A;  2P5T A;  1QVR A;  4YY3 M;  2LXE A;  4I81 A;  3CF6 E;  2BJW A;  3GLI B;  3VFD A;  2XZU A;  5EP2 A;  3J2P B;  3L29 A;  2C9O A;  4FCT A;  3WHK A;  4AKG A;  1NJG A;  3GPU A;  2QBY A;  5FTL A;  3KW6 A;  4JI4 M;  3U60 B;  2FNA A;  4DV3 M;  3GLF B;  2XLJ A;  5EP4 A;  5ITX A;  4B7F A;  3KOW E;  2UU9 M;  4NL4 H;  3TWK A;  4BBA A;  4YHH M;  5BR8 M;  1G4A E;  1G3I A;  1JQJ C;  1NHW C;  5EQT A;  1XNQ M;  1IBM M;  1OFI A;  3FUW A;  3FTE A;  1KYI A;  1HQY E;  1Q39 A;  1GVN A;  3H4M A;  4LGY A;  3SAU A;  3GLH B;  4P16 A;  3FUV A;  1IY0 A;  5IWA M;  3KSX A;  3SHG B;  3K1J A;  4FWH A;  5KQD A;  3I4Y A;  1I4W A;  3U6P A;  4Z6Y A;  4IBC A;  3GRR A;  2VQE M;  3RE8 A;  5E26 A;  1K82 A;  3L27 A;  2UXD M;  2DWZ B;  3LMM A;  4MGI E;  3FD9 A;  3VDU A;  4B7G A;  1J5E M;  4LJ9 A;  1HT1 E;  1E9R A;  2Z4R A;  4X66 M;  3DA1 A;  3JAM S;  1NVM A;  3FTF A;  3U6D A;  3FYD A;  2DXI A;  2Z7J A;  4AI6 A;  2VQF M;  3K2L A;  5EXS A;  4FCW A;  1H6U A;  4RF1 A;  4R3D A;  3FYC A;  4DV4 M;  2EUC A;  1N75 A;  1FNN A;  2R62 A;  4GHA A;  3HJ8 A;  1R2Y A;  4QNM A;  4ITQ A;  3ILK A;  1Z5A A;  1Z59 A;  2R4J A;  4GH9 A;  3MK6 A;  1JR3 D;  4II7 A;  3SC3 A;  3HHY A;  3WHL A;  3U6S A;  3T38 A;  4GIP A;  2FE8 A;  3SHF A;  3HU2 A;  3R9X B;  3HJS A;  4NXM M;  4OW0 A;  3SAS A;  2HL7 A;  5IT9 S;  5ITU A;  5EP3 A;  3HHZ A;  2KEB A;  2QP9 X;  4EIW A;  1XC8 A;  4M9S A;  3JR5 A;  3D8L A;  2K47 A;  3ZCB B;  3GLI A;  3NBI A;  4JXJ A;  3W0L B;  1TGU A;  4JI2 M;  1DGH B;  4JI0 M;  4CHT B;  5KPZ A;  2V6Z M;  4KOD A;  1TH3 A;  2QEN A;  1IXS B;  3KSJ A;  3L25 A;  2V1U A;  3VK7 A;  4MGY E;  4NRW A;  4LZJ A;  4MH0 E;  4JI3 M;  3EIE A;  1YSY A;  1IXR C;  3ZC7 B;  2A5Y B;  2XFT A;  1N34 M;  4DR1 M;  5A2Q S;  3SBJ A;  3E4R A;  2D7H A;  4PDG A;  1IM2 A;  4IBF A;  1XXH A;  4MGH A;  4I8O A;  2W82 A;  3HKP A;  1QAO A;  4TUW A;  2QZ4 A;  1IN5 A;  1LV7 A;  3FKE A;  3U6Q A;  3AV0 A;  2YFQ A;  4LJA A;  3EIH A;  4REZ A;  2KRU A;  4AQY M;  4QHS A;  4X62 M;  1QZM A;  3KOX E;  3GLH A;  3TE6 A;  2NQ8 C;  5ITY A;  1L2B A;  1ZAE A;  1IY2 A;  4LRT A;  4M9Z A;  4MB7 A;  4MGZ E;  5F3W A;  1IBL M;  1ORY B;  2CHG A;  2EO2 A;  1IBK M;  1G41 A;  3M0E A;  3HWS A;  1T3T A;  3GRV A;  3FUX A;  5GKN A;  3BOS A;  1GL6 A;  2BJV A;  2CEA A;  3KXE C;  3CF0 A;  3CF2 A;  3PVS A;  3JR4 A;  4DV7 M;  1L8Q A;  4NOO B;  3AFH A;  4DR3 M;  4FD2 A;  4BB9 A;  1HR0 M;  8CAT A;  4JI7 M;  1DO2 A;  1SXJ B;  2M5Z A;  2XH9 A;  3HU1 A;  4DR7 M;  3U5Z B;  1GKI A;  2R46 A;  3A45 A;  3PNV A;  2KZS A;  3KVW A;  2J7O A;  3GQ4 A;  3U61 B;  3RGP A;  4NSO B;  4L16 A;  4OVZ A;  2DWL A;  3SAT A;  4PDI A;  1NY6 A;  1IN4 A;  3GO8 A;  5EJC A;  3GLG B;  4GKJ M;  5ITT A;  2YR0 A;  1G59 A;  1YE9 A;  1W5S A;  3GPY A;  2XF3 A;  4X64 M;  1Q3C A;  3RFW A;  1EE8 A;  4G6Z A;  2CV0 A;  4CGY B;  1TDH A;  2FOI C;  2QPA A;  1IY1 A;  1L1T A;  3J7B A;  3DFZ A;  1Z5C A;  2L7H A;  1N77 A;  3VK8 A;  4L15 A;  3SAR A;  4L78 A;  5FTJ A;  2DWN A;  4D80 A;  2OQ4 A;  1NNU C;  3GQ3 A;  4IBG A;  3KDS E;  2C5R A;  1Z5B A;  2F4V M;  3UJN A;  1OFH A;  3NWL A;  3DOA A;  5H37 D;  1SXJ A;  3UZU A;  3SMS A;  4BLC A;  2ZAM A;  1DGG A;  3W0F A;  4IBB A;  2BNK A;  3KP0 E;  4LF9 M;  2HCB A;  3M6A A;  4Z8X A;  1J09 A;  4S12 A;  3SYL A;  2CHV A;  3KS4 A;  2YQZ A;  4DV1 M;  1XMO M;  4IBE A;  2DZO B;  2L7I A;  2JA2 A;  4R7G A;  1J7K A;  1SXJ C;  3PNY A;  3IG8 A;  3U6E A;  3KS8 A;  1Z6T A;  1NY5 A;  2KW0 A;  4LF6 M;  3I4V A;  4JI5 M;  2XZF A;  2UUB M;  4LFC M;  1KFV A;  3SMP A;  1R2Z A;  4B3S M;  2DZN B;  2F5O A;  3LVW A;  3GRY A;  1S3S A;  4AG5 A;  4LF8 M;  4WW0 A;  5JI3 E;  5ITR A;  4KHP M;  3AL0 C;  5EXT A;  4JI8 M;  5C18 A;  4LJ7 A;  4NXN M;  4GRI A;  4GIT A;  3M7G A;  2LNH C;  2D7G A;  2HHH M;  3LVV A;  1NJF A;  2FFJ A;  5FTN A;  1TH4 A;  2RGH A;  4FCV A;  2R4E A;  3AOE C;  4AKI A;  1IQP A;  1FJG M;  1XNR M;  2E5L M;  1GLN A;  4DV5 M;  3T1Y M;  3E9S A;  3GQ5 A;  4B3T M;  3AKZ A;  1XHB A;  2H1R A;  2Y0T A;  2M60 A;  4IJE A;  3D8B A;  4I5S A;  7CAT A;  4B3R M;  1E94 E;  3J80 S;  1TDZ A;  3J27 B;  2ERC A;  2UXB M;  2QCU A;  2RKO A;  2UXC M;  1SXJ E;  5KPT A;  3U5Z A;  1HQC A;  3HJQ A;  2ZAN A;  1R7R A;  4RF0 A;  2R18 A;  4DUY M;  3LQQ A;  3C58 A;  3AOE A;  2Y0Q A;  5JI2 E;  2CFO A;  1OJL A;  4M0D A;  2R65 A;  4KO8 A;  4DR4 M;  4W5W A;  4DR6 M;  3DZD A;  3SFZ A;  4IBK A;  1IN6 A;  4HL4 A;  4JI6 M;  1NSF A;  5ITX E;  2Y20 A;  2ZBK B;  1XWI A;  2LWX A;  3I51 A;  1JR3 A;  4LZZ A;  1L1Z A;  2CE7 A;  5E6J A;  2DHR A;  3K92 A;  1KSF X;  4LF7 M;  1XMQ M;  4DV0 M;  4NRV A;  5IRE B;  1HNX M;  2X4A A;  3HGI A;  4B7H A;  1QAM A;  2XEP A;  3TWM A;  3TQS A;  3SAW A;  2V1C A;  3J7A S;  1W5T A;  2YNM D;  4GMQ A;  1N78 A;  3A42 A;  4HLQ A;  3OTO M;  5DNY A;  1L2D A;  1VDD A;  2C9C A;  2Q2E B;  4GC5 A;  1MX0 A;  4FWD A;  3RGS A;  2DWM A;  4GHL A;  2R45 A;  4XGI A;  3J81 S;  2L6O A;  1NHG C;  4DV2 M;  4QNR A;  2X8A A;  2OPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...