3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3ZCBB 3ZC7B 3SHGB
chains in the Genus database with same CATH superfamily
1EE8A 3EIEA 2CWBA 3WHKA 3KSJA 3GP1A 4BLCA 4LFAM 1Z6TA 3JAMS 4NRVA 1OAOC 2KRUA 2MR9A 2BJVA 2JZ0A 3GRVA 3W67A 1IXRC 1XNQM 5IT9S 1SXJA 4MM3B 2LNHC 1K82A 1IBKM 2KXEA 3HY5A 2VQFM 1JR3D 4DV3M 4IBIA 4B7HA 5IWAM 2HHHM 2K9DA 4QNMA 5A2QS 1XHBA 5FTKA 2JWSA 3GQ4A 4RF1A 3AKZA 2XEPA 1VEJA 5ITYA 1NV9A 3QYBA 1K3XA 5EP1A 3T38A 3FTDA 2UUBM 3ZCBB 1TGUA 3EIHA 1P3QQ 1TH3A 1XB2B 4FWHA 3C9PA 3GPUA 3SATA 2R44A 3TPZA 3K1JA 3KXEC 3SFZA 2OPFA 1TH4A 2XFSA 3T1HM 4JI5M 3SAVA 4G3OA 5F3WA 2M5ZA 4M9XA 1VDDA 2DI0A 3A98B 4AW4A 1FJGM 3TWKA 2X4AA 3SHFA 1EFUB 1MJGM 1T6OA 1ZMUA 1IN8A 2DXIA 3HU2A 2CHQA 4REZA 3U6MA 3AL0C 5EP4A 1MX0A 1Z5AA 4X62M 1DGHA 2XGNA 5DNYA 2QHOB 3FTEA 3FYDA 3PFIA 2RKOA 2F5NA 3LCUA 1E94E 2QP9X 3GLFA 2XZUA 3SARA 1PGYA 1EIJA 2EUCA 4PDIA 4M9SA 3J27B 3H4MA 3CF2A 5EP3A 1T43A 3UJNA 2R46A 1WR1B 1JB0F 2JP7A 4HL4A 1VEGA 1H6UA 2L7IA 1L8QA 4IBKA 3MHVC 3U6QA 1E9SA 1PJQA 1WHCA 2MROB 4K0KM 4LCBA 1YUBA 1OJLA 4Z8XA 4B7GA 4CHTB 1GABA 3UK6A 1R7RA 4DV1M 4P17A 1OKSA 4R7GA 4AZFA 2KZSA 3VDPA 4LF5M 2APLA 4PCZA 1JR3E 1N77A 2R6FA 3J80S 4AKIA 3GRRA 4LF8M 3BBZA 4KT0F 3U5ZB 1L1TA 4IBBA 4B3SM 2LVPC 3JR5A 3UMMA 3B7ZA 1WGLA 3LW5F 4NSOB 4QOSA 1X37A 1DGBA 2G5GX 4OVZB 3W0FA 2KDLA 4MGIE 4LF6M 4RKUF 3K9PA 1NNJA 4LRSA 2VF7A 4GHLA 3FD9A 5KQ8A 2KNAA 1OAIA 1T3TA 3HJ8A 4GMQA 4KLNA 1OIPA 2DWMA 2KHHA 1IXSA 4GRIA 2KEBA 1QAMA 3D8BA 1VQ1A 1R2YA 2KZUA 1DO2A 5EXPA 3HU3A 3FRHA 4NXNM 4R71A 4L4UA 1ZV1A 2LVNC 2QNJA 1Z5BA 3GPYA 4CIZA 3U6SA 4LJ8A 5FTNA 2HWJA 1N75A 2CV1A 1HNWM 4IJEA 1IQPA 4XBOA 3U5ZA 1D0LA 1YLAA 2L6OA 3HHZA 2GNOA 2X8AA 1L1ZA 4I81A 2E5LM 5E6JA 3R8FA 2V1CA 2RRUA 1N36M 1L2BA 1F4IA 3AFHA 1IM2A 4P16A 4M9ZA 1DGGA 2ERCA 1IY2A 3IG8A 3HHWA 2BWEA 4DV0M 4LZZA 2DWZB 4LJ4A 1D0KA 5BPVA 3GO8A 2X49A 4LF4M 3GLIA 3K92A 1Q39A 3H4JA 1J09A 2OO9A 2F5SA 1L2DA 4WURA 2K0BX 5C18A 1G8PA 3VK7A 2OQ4A 2CHGA 4GC9A 4AI6A 4JV5M 1TDZA 2EKKA 8CATA 3K8ZA 3SAWA 1NV8A 4DUYM 3PNVA 2CE7A 1G4AE 2KA6B 1NY5A 1YSYA 1ZMVA 2ZTDA 1NHWC 1Q02A 2ZBKB 2RGOA 4FVMA 5ITTA 2R62A 1Z59A 4AKHA 4RNAA 2XLJA 2DAKA 4DR7M 4NRWA 2DAMA 5FSWA 3HJQA 2QENA 1RU3A 4QHSA 3W0LB 2OOAA 3FTFA 1NY6A 3E4RA 4MB7A 4GITA 3U6LA 4FCTA 2V1UA 2R45A 5KPTA 1G41A 2K6BA 3I51A 4X64M 1QAQA 3GPPA 4DV7M 2Y0QA 3I01M 1VG5A 1V92A 4IBJA 5KPZA 2F5QA 1LTMA 3VKGA 4S12A 1E32A 2C5RA 3SYKA 3FUWA 2WZJA 2R18A 2QBYA 2G3QA 2LTUA 4GKJM 3L25A 3HJSA 1NHGC 2CHVA 2EJSA 2H1RA 3IHPA 3F92A 4JI3M 1UFZA 2DHRA 1NSFA 2Y0TA 3HZJA 3L26A 1MU5A 1I4WA 2WSFF 3C3EA 3I4YA 2VIIA 4EIWA 2JUJA 2YQZA 4IBCA 3FE3A 4KO8A 4DR4M 4FCWA 4GH9A 2G8LA 2Z8YM 4LJAA 4B3TM 2BWBA 5IZ7D 1IFYA 2WSCF 5L8RF 4JI7M 1G3IA 1AUAA 3MMPA 3U6DA 3Q8XA 1IN5A 1QUTA 5ITQA 3GLHA 3B9PA 2FH0A 2Z7JA 1GVNA 4NSRA 2R4EA 4NOOB 2LXEA 4I5SA 1QDTA 4L15A 4FW9A 2ZANA 3U61A 4WW0A 1R2ZA 1YE9A 4L8RC 4X65M 4JI8M 3J7AS 2LVOC 3K2LA 1QDRA 3HX3A 5EP2A 2QBYB 5FTJA 4FWDA 2D7EA 4LJ5A 4HEOA 1XMQM 2DVWB 3AOGA 4UN2B 4M0WA 3TL4X 4JYAM 3AOEC 4FD2A 3MJ5A 4G4NA 1PJJA 1IN6A 3I4VA 4KODA 4DV5M 3BXWA 3KS4A 3RGSA 3SC3A 3RE8A 3U60B 3GLGE 4QHTA 2UXCM 4IIWA 2C96A 2DAEA 2YFQA 3KOZE 2CUZA 1R4GA 1ZMWA 2JY7A 2QSFX 4LGMA 1J5EM 1QVRA 4JN6A 4RF0A 4M0DA 1IN4A 2KNVA 5LMNM 1WIVA 5ITRA 1IXZA 3OTOM 3IECA 1XXHB 4LGYA 2D7HA 4BB9A 4CJ6A 2BJWA 1CUKA 4CISA 1Y8GA 4X66M 4CGYB 2ZM6M 4PDGA 5IREB 2DAGA 3E9SA 3UGJA 2EO2A 3R9XB 1D2NA 3B89A 1NJFA 3KOYE 4LY6A 3SMSA 1GL7A 2MJ5B 2NQ8C 1AIPC 3SAUA 3FUUA 2DWNA 4LJ6A 3GLGB 2JY6B 4IBGA 3CF0A 4II7A 1PJSA 4AG6A 1ZAEA 4LF9M 2CP8A 4DR5M 3TE6A 1OFHA 4AKGA 4ANRA 4YHHM 3HKPA 4OX9M 1N32M 2L7HA 1OQYA 4AG5A 1TTEA 1XMOM 2CRUA 4A3VB 2XSZA 3E46A 3GLIE 3HHYA 2KNZA 3BOSA 4NL4H 2YNMD 4LJ7A 2A5YB 2R4JA 3GRUA 3DA1A 5DFLA 1XXHA 3QWLA 2R0IA 1GLNA 2L4EA 3M0EA 4L78A 4F1IA 1GL6A 4OU7A 4DR2M 4FWGA 2XFTA 1KSFX 3DFZA 4MGKE 1MN3A 3VLFB 4HLQA 2LBCA 2QZ4A 5FTLA 4LZJA 4R3DA 2DZNB 4PT5A 4JI4M 1N78A 2YR0A 2LWXA 1HT2E 1R5LA 1NVMA 1FNNA 2UUAM 3GRYA 3K9OA 2L2DA 3QAUA 2I7NA 2K47A 3IG5A 2DZOB 3KDSE 1UM8A 2XF3A 2C98A 2QPAA 1Z5CA 1PJTA 2FS1A 4WP2A 2CV0A 2M60A 4MGHA 3NBIA 4DV6M 2W82A 4DR3M 1PJIA 4QOZC 1WGNA 3W68A 1DV0A 5EXTA 2F5OA 2L4FA 1HQCA 1DGHB 3LVVA 3FYCA 3A42A 3KVWA 2JXNA 5EJCA 3DOAA 4LG2A 1QZMA 5ITUA 4KHPM 4YY3M 3TWMA 4OW0A 1GJTA 3LVWA 2Z3XA 1HJPA 1WJ7A 4GC5A 5E26A 3B7QA 2C99A 3KOXE 2ZTCA 3VKHA 3KFUG 1S3SA 4GEWA 1J7KA 3FUVA 4IBDA 4JI0M 3T1YM 4QNRA 1VEKA 3C3DA 4GHAA 1A5TA 1V33A 2CFOA 3SBJA 4I8OA 3GPXA 1OFIA 3A46A 4AQYM 3U6PA 4LFCM 3L29A 3FKEA 2DNAA 2O5RA 3MK6A 1PRBA 5ITXA 3THGA 1C1KA 2V6ZM 4JI1M 3KP1E 3ZH9B 1QANA 2O25A 2P5TA 3AOEA 4MGZE 1K3WA 1SXJB 1C7YA 1JQJC 4D82A 3A45A 1DGFA 1OIZA 1SG9A 2MGWA 3D8LA 3SHGB 2QQ8A 3I04M 3T6PA 4NC6A 4OVZA 2EA0A 3HHXA 3J7BA 1XWIA 2FE8A 5FTMA 3SMPA 5C1BA 4G4RA 5H37D 4GIPA 2HKJA 3GLFE 3ILKA 2H5XA 1HQYE 5EXXA 4NXMM 2FNAA 1IBMM 5BR8M 3KS8A 4DV2M 4MH0E 4DUZM 2CV2A 4JI2M 1IXSB 3U6OA 5KPRA 1ORYB 1SXJC 4LJ9A 4G4OA 1HNXM 1I94M 1L2CA 2VF8A 2VDBB 2LHGA 3B7NA 3FUXA 1WXQA 4IBEA 2XH9A 1SXJE 5DYIA 2RGHA 3J81S 1DO0A 1NJGA 1SXJD 2C9CA 5KQDA 3U60A 4DV4M 1IBLM 2XSZD 1IY1A 1JR3A 1Q3CA 3J2PB 1NNUC 3AJIB 1G71A 5EXSA 4D81A 2JZ1A 3M6AA 2DKLA 3HU1A 3Q8GA 4L6V6 3GLFB 3U6EA 3SASA 3ZQJA 2C9OA 5KO3A 4G4QA 3CTWB 3T15A 1R6BX 5JI2E 1QYRA 2FOIC 2J7NA 2O01F 3CGWA 3FRIA 1LV7A 3KOWE 3SYLA 7CATA 3GQ5A 3VK8A 3UZUA 3GLIB 2Z4SA 1D0MA 2AHMA 4PD2A 1GO5A 1QZEA 2QCUA 3DZDA 4B7FA 2LHCA 1XNRM 4DR6M 5DYGA 2Z4RA 3LQRA 2HCBA 5ITXE 3RGPA 4DBGB 4GKKM 1W5TA 4BBAA 3ZC7B 2FFJA 3VFDA 1QQWA 4Y28F 3VDUA 2LVAA 3GLGA 1QUSA 1TDHA 1V34A 2HAKA 3GLHB 2N35A 3CF6E 3B74A 4JXJA 2JNHA 4F2LA 2UU9M 2KW0A 2UXDM 2GQFA 5JI3E 2CEAA 2DWLA 2WSEF 3WHLA 1XXHE 1TF0B 4Q7JA 1TH2A 3U61B 4G6ZA 2D7GA 2JY8A 3FTCA 1ZQ9A 5LMUM 2I7PA 2XZFA 3KP0E 3L28A 1W5SA 1HT1E 3KW6A 4B08A 2DENA 4XGIA 1HNZM 1TR8A 5GKNA 1IY0A 3TQSA 2VQEM 3FUTA 1HR0M 4Z6YA 2F5PA 1GKIA 2R65A 2KRKA 4LRTA 2MH8A 2ZAOA 4TUWA 2Y21A 3L27A 3QYEA 4XK8F 3PXGA 3JR4A 4B3MM 4B3RM 2JY5A 4LFBM 1OTRA 2J5YA 1QAOA 3M7GA 3PNYA 4IJFA 3RFWA 3GQ3A 3TWLA 4LF7M 2HL7A 5FLXS 2UXBM 3LCVB 2B3TA 3LQQA 3E21A 3HWSA 4JI6M 2EKFA 3V76A 3GLHE 3NBXX 3KSXA 1KYIA 1IN7A 1VDLA 4W5WA 3C58A 1XC8A 1G59A 2DHYA 2Y20A 4ZPXA 2OOBA 3LMMA 3L2AA 1KFVA 4DR1M 5EQTA 4MGYE 1E9RA 1N34M 2BNKA 4I4LA 2L09A 4L16A 2ZAMA 2DZLA 4FCVA 2UUCM 2F4VM 3NWLA 3HGIA 4D80A 2LVQD 3PVSA 4IBFA 1PM5A 2DAIA 1BVSA 2LH0A 3AV0A 1NO1A 1N33M 2J7OA 1GJSA 1Q3BA 2Q2EB 4ITQA 2JA2A 3U6CA
chains in the Genus database with same CATH topology
1EE8A 3EIEA 3WHKA 3KSJA 3GP1A 4BLCA 4LFAM 1Z6TA 3JAMS 4NRVA 2KRUA 2BJVA 3GRVA 1XNQM 1IXRC 5IT9S 1SXJA 4MM3B 2LNHC 1K82A 1IBKM 2KXEA 2VQFM 1JR3D 4DV3M 4IBIA 4B7HA 5IWAM 2HHHM 4QNMA 5A2QS 1XHBA 5FTKA 3GQ4A 4RF1A 3AKZA 2XEPA 5ITYA 1K3XA 5EP1A 3T38A 3FTDA 2UUBM 3ZCBB 1TGUA 3EIHA 1TH3A 4FWHA 3GPUA 3SATA 3TPZA 3K1JA 3KXEC 3SFZA 2OPFA 1TH4A 2XFSA 3T1HM 4JI5M 3SAVA 5F3WA 2M5ZA 4M9XA 1VDDA 3A98B 4AW4A 1FJGM 3TWKA 2X4AA 3SHFA 2DXIA 1IN8A 3HU2A 2CHQA 4REZA 3U6MA 3AL0C 5EP4A 1MX0A 1Z5AA 4X62M 1DGHA 2XGNA 5DNYA 3FYDA 3PFIA 2RKOA 2F5NA 1E94E 2QP9X 3GLFA 2XZUA 3SARA 2EUCA 4PDIA 4M9SA 3J27B 3H4MA 3CF2A 5EP3A 3UJNA 2R46A 4HL4A 1H6UA 2L7IA 1L8QA 4IBKA 3MHVC 3U6QA 1E9SA 4K0KM 4LCBA 1YUBA 1OJLA 4Z8XA 4B7GA 4CHTB 3UK6A 1R7RA 4DV1M 4R7GA 4AZFA 2KZSA 3VDPA 4LF5M 4PCZA 1N77A 3J80S 4AKIA 3GRRA 4LF8M 3U5ZB 1L1TA 4IBBA 4B3SM 3JR5A 3UMMA 4NSOB 4QOSA 1X37A 1DGBA 2G5GX 4OVZB 3W0FA 4MGIE 4LF6M 1NNJA 4LRSA 4GHLA 3FD9A 5KQ8A 3HJ8A 1T3TA 4GMQA 4KLNA 2DWMA 4GRIA 2KEBA 1QAMA 3D8BA 1R2YA 2KZUA 1DO2A 5EXPA 3HU3A 4NXNM 4L4UA 1Z5BA 3GPYA 3U6SA 4LJ8A 5FTNA 1N75A 2CV1A 1HNWM 4IJEA 1IQPA 4XBOA 3U5ZA 2L6OA 3HHZA 2X8AA 1L1ZA 4I81A 2E5LM 5E6JA 3R8FA 2V1CA 1N36M 1L2BA 3AFHA 1IM2A 4P16A 4M9ZA 1DGGA 2ERCA 1IY2A 3IG8A 3HHWA 4DV0M 4LZZA 2DWZB 4LJ4A 5BPVA 3GO8A 4LF4M 2X49A 3GLIA 3K92A 1Q39A 1J09A 2F5SA 1L2DA 4WURA 5C18A 1G8PA 3VK7A 2OQ4A 2CHGA 4GC9A 4AI6A 4JV5M 1TDZA 8CATA 3K8ZA 3SAWA 4DUYM 3PNVA 2CE7A 1G4AE 2KA6B 1NY5A 1YSYA 1NHWC 2ZBKB 2RGOA 4FVMA 5ITTA 2R62A 1Z59A 4AKHA 4RNAA 2XLJA 4DR7M 4NRWA 5FSWA 3HJQA 2QENA 4QHSA 3W0LB 3FTFA 1NY6A 3E4RA 4MB7A 4GITA 3U6LA 4FCTA 2V1UA 2R45A 5KPTA 1G41A 3I51A 4X64M 3GPPA 1QAQA 4DV7M 2Y0QA 4IBJA 5KPZA 2F5QA 3VKGA 4S12A 1E32A 2C5RA 3SYKA 3FUWA 2QBYA 2R18A 4GKJM 3L25A 3HJSA 1NHGC 2CHVA 2H1RA 4JI3M 2DHRA 2Y0TA 1NSFA 3L26A 1MU5A 1I4WA 3I4YA 2VIIA 4EIWA 2YQZA 4IBCA 4KO8A 4DR4M 4FCWA 4GH9A 2G8LA 4B3TM 4LJAA 5IZ7D 4JI7M 1G3IA 3U6DA 3Q8XA 1IN5A 3GLHA 3B9PA 2Z7JA 1GVNA 4NSRA 2R4EA 4NOOB 2LXEA 4I5SA 4L15A 4FW9A 2ZANA 3U61A 4WW0A 1R2ZA 1YE9A 4L8RC 4X65M 4JI8M 3J7AS 3K2LA 2QBYB 5EP2A 5FTJA 4FWDA 2D7EA 4LJ5A 1XMQM 2DVWB 3AOGA 4M0WA 3TL4X 4JYAM 3AOEC 4FD2A 3MJ5A 4G4NA 1PJJA 1IN6A 3I4VA 4KODA 4DV5M 3KS4A 3RGSA 3SC3A 3RE8A 3U60B 4QHTA 2UXCM 4IIWA 2C96A 2YFQA 3KOZE 2CUZA 1J5EM 4LGMA 1QVRA 4JN6A 4RF0A 4M0DA 1IN4A 5LMNM 5ITRA 1IXZA 3OTOM 4LGYA 1XXHB 4BB9A 2D7HA 2BJWA 4CISA 4X66M 4CGYB 2ZM6M 4PDGA 5IREB 3E9SA 3UGJA 2EO2A 3R9XB 1D2NA 1NJFA 3KOYE 4LY6A 3SMSA 1GL7A 2NQ8C 2DWNA 3SAUA 3FUUA 4LJ6A 3GLGB 4IBGA 3CF0A 4II7A 4AG6A 4LF9M 1ZAEA 4DR5M 3TE6A 1OFHA 4AKGA 4YHHM 3HKPA 4OX9M 1N32M 2L7HA 4AG5A 1XMOM 4A3VB 2XSZA 3HHYA 3BOSA 4NL4H 2YNMD 4LJ7A 2A5YB 2R4JA 3GRUA 3DA1A 1XXHA 3QWLA 4L78A 1GLNA 3M0EA 4OU7A 4DR2M 3FTEA 1GL6A 4FWGA 2XFTA 1KSFX 3DFZA 4MGKE 3VLFB 4HLQA 2QZ4A 5FTLA 4LZJA 4R3DA 2DZNB 4PT5A 4JI4M 1N78A 2YR0A 2LWXA 1HT2E 1NVMA 1FNNA 2UUAM 3GRYA 3QAUA 2I7NA 2K47A 3IG5A 2DZOB 3KDSE 1UM8A 2XF3A 2C98A 2QPAA 1Z5CA 2CV0A 2M60A 4MGHA 3NBIA 4DV6M 2W82A 4DR3M 1PJIA 4QOZC 5EXTA 2F5OA 1HQCA 1DGHB 3LVVA 3FYCA 3A42A 3KVWA 5EJCA 3DOAA 4LG2A 1QZMA 5ITUA 4KHPM 4YY3M 3TWMA 4OW0A 3LVWA 2Z3XA 4GC5A 5E26A 2C99A 3KOXE 3VKHA 3KFUG 1S3SA 4IBDA 1J7KA 3FUVA 4JI0M 3T1YM 4QNRA 4GHAA 3SBJA 2CFOA 4I8OA 3GPXA 1OFIA 3A46A 4AQYM 3U6PA 4LFCM 3L29A 3FKEA 2O5RA 3MK6A 5ITXA 3THGA 1C1KA 2V6ZM 4JI1M 3KP1E 3ZH9B 1QANA 2P5TA 3AOEA 4MGZE 1K3WA 1SXJB 1JQJC 4D82A 3A45A 1DGFA 3SHGB 3D8LA 4OVZA 2EA0A 3HHXA 3J7BA 1XWIA 2FE8A 5FTMA 3SMPA 5C1BA 4G4RA 5H37D 4GIPA 2HKJA 3ILKA 1HQYE 5EXXA 4NXMM 2FNAA 1IBMM 5BR8M 3KS8A 4DV2M 4MH0E 4DUZM 2CV2A 4JI2M 1IXSB 3U6OA 5KPRA 1ORYB 1SXJC 4LJ9A 4G4OA 1HNXM 1I94M 1L2CA 3FUXA 4IBEA 1WXQA 2XH9A 1SXJE 5DYIA 2RGHA 3J81S 1DO0A 1NJGA 1SXJD 2C9CA 5KQDA 3U60A 4DV4M 1IBLM 2XSZD 1IY1A 1JR3A 1Q3CA 3J2PB 1NNUC 3AJIB 5EXSA 4D81A 5ITQA 3GLFB 3M6AA 3HU1A 3U6EA 3SASA 2C9OA 5KO3A 4G4QA 3CTWB 3T15A 1R6BX 5JI2E 1QYRA 2FOIC 2J7NA 3SYLA 7CATA 3VK8A 1LV7A 3KOWE 3GQ5A 3UZUA 3GLIB 2Z4SA 2AHMA 4PD2A 2QCUA 3DZDA 4B7FA 1XNRM 4DR6M 5DYGA 2Z4RA 3LQRA 2HCBA 5ITXE 3RGPA 4GKKM 1W5TA 4BBAA 3ZC7B 2FFJA 3VFDA 1QQWA 3VDUA 3GLGA 1TDHA 3GLHB 3CF6E 4JXJA 2UU9M 2KW0A 2UXDM 5JI3E 2CEAA 2DWLA 3WHLA 1TH2A 3U61B 4G6ZA 2D7GA 3FTCA 1ZQ9A 5LMUM 2I7PA 2XZFA 3KP0E 3L28A 1W5SA 1HT1E 3KW6A 4B08A 4XGIA 1HNZM 2VQEM 5GKNA 1IY0A 3TQSA 2F5PA 3FUTA 1HR0M 4Z6YA 1GKIA 2R65A 2KRKA 4LRTA 4TUWA 2ZAOA 2Y21A 3L27A 3PXGA 3JR4A 4B3MM 4B3RM 4LFBM 1QAOA 3M7GA 3PNYA 4IJFA 3RFWA 3GQ3A 3TWLA 4LF7M 2HL7A 5FLXS 2UXBM 3LQQA 3HWSA 4JI6M 3KSXA 1KYIA 1IN7A 4W5WA 3C58A 1XC8A 1G59A 2Y20A 4ZPXA 3LMMA 3L2AA 1KFVA 4DR1M 5EQTA 4MGYE 1E9RA 1N34M 2BNKA 4I4LA 2L09A 4L16A 2ZAMA 4FCVA 2UUCM 2F4VM 3NWLA 3HGIA 4D80A 3PVSA 4IBFA 1PM5A 2LH0A 3AV0A 1N33M 2J7OA 1Q3BA 2Q2EB 4ITQA 2JA2A 3U6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCB B;  3ZC7 B;  3SHG B; 
#chains in the Genus database with same CATH topology
 1EE8 A;  3EIE A;  2CWB A;  3WHK A;  3KSJ A;  3GP1 A;  4BLC A;  4LFA M;  1Z6T A;  3JAM S;  4NRV A;  1OAO C;  2KRU A;  2MR9 A;  2BJV A;  2JZ0 A;  3GRV A;  3W67 A;  1IXR C;  1XNQ M;  5IT9 S;  1SXJ A;  4MM3 B;  2LNH C;  1K82 A;  1IBK M;  2KXE A;  3HY5 A;  2VQF M;  1JR3 D;  4DV3 M;  4IBI A;  4B7H A;  5IWA M;  2HHH M;  2K9D A;  4QNM A;  5A2Q S;  1XHB A;  5FTK A;  2JWS A;  3GQ4 A;  4RF1 A;  3AKZ A;  2XEP A;  1VEJ A;  5ITY A;  1NV9 A;  3QYB A;  1K3X A;  5EP1 A;  3T38 A;  3FTD A;  2UUB M;  3ZCB B;  1TGU A;  3EIH A;  1P3Q Q;  1TH3 A;  1XB2 B;  4FWH A;  3C9P A;  3GPU A;  3SAT A;  2R44 A;  3TPZ A;  3K1J A;  3KXE C;  3SFZ A;  2OPF A;  1TH4 A;  2XFS A;  3T1H M;  4JI5 M;  3SAV A;  4G3O A;  5F3W A;  2M5Z A;  4M9X A;  1VDD A;  2DI0 A;  3A98 B;  4AW4 A;  1FJG M;  3TWK A;  2X4A A;  3SHF A;  1EFU B;  1MJG M;  1T6O A;  1ZMU A;  1IN8 A;  2DXI A;  3HU2 A;  2CHQ A;  4REZ A;  3U6M A;  3AL0 C;  5EP4 A;  1MX0 A;  1Z5A A;  4X62 M;  1DGH A;  2XGN A;  5DNY A;  2QHO B;  3FTE A;  3FYD A;  3PFI A;  2RKO A;  2F5N A;  3LCU A;  1E94 E;  2QP9 X;  3GLF A;  2XZU A;  3SAR A;  1PGY A;  1EIJ A;  2EUC A;  4PDI A;  4M9S A;  3J27 B;  3H4M A;  3CF2 A;  5EP3 A;  1T43 A;  3UJN A;  2R46 A;  1WR1 B;  1JB0 F;  2JP7 A;  4HL4 A;  1VEG A;  1H6U A;  2L7I A;  1L8Q A;  4IBK A;  3MHV C;  3U6Q A;  1E9S A;  1PJQ A;  1WHC A;  2MRO B;  4K0K M;  4LCB A;  1YUB A;  1OJL A;  4Z8X A;  4B7G A;  4CHT B;  1GAB A;  3UK6 A;  1R7R A;  4DV1 M;  4P17 A;  1OKS A;  4R7G A;  4AZF A;  2KZS A;  3VDP A;  4LF5 M;  2APL A;  4PCZ A;  1JR3 E;  1N77 A;  2R6F A;  3J80 S;  4AKI A;  3GRR A;  4LF8 M;  3BBZ A;  4KT0 F;  3U5Z B;  1L1T A;  4IBB A;  4B3S M;  2LVP C;  3JR5 A;  3UMM A;  3B7Z A;  1WGL A;  3LW5 F;  4NSO B;  4QOS A;  1X37 A;  1DGB A;  2G5G X;  4OVZ B;  3W0F A;  2KDL A;  4MGI E;  4LF6 M;  4RKU F;  3K9P A;  1NNJ A;  4LRS A;  2VF7 A;  4GHL A;  3FD9 A;  5KQ8 A;  2KNA A;  1OAI A;  1T3T A;  3HJ8 A;  4GMQ A;  4KLN A;  1OIP A;  2DWM A;  2KHH A;  1IXS A;  4GRI A;  2KEB A;  1QAM A;  3D8B A;  1VQ1 A;  1R2Y A;  2KZU A;  1DO2 A;  5EXP A;  3HU3 A;  3FRH A;  4NXN M;  4R71 A;  4L4U A;  1ZV1 A;  2LVN C;  2QNJ A;  1Z5B A;  3GPY A;  4CIZ A;  3U6S A;  4LJ8 A;  5FTN A;  2HWJ A;  1N75 A;  2CV1 A;  1HNW M;  4IJE A;  1IQP A;  4XBO A;  3U5Z A;  1D0L A;  1YLA A;  2L6O A;  3HHZ A;  2GNO A;  2X8A A;  1L1Z A;  4I81 A;  2E5L M;  5E6J A;  3R8F A;  2V1C A;  2RRU A;  1N36 M;  1L2B A;  1F4I A;  3AFH A;  1IM2 A;  4P16 A;  4M9Z A;  1DGG A;  2ERC A;  1IY2 A;  3IG8 A;  3HHW A;  2BWE A;  4DV0 M;  4LZZ A;  2DWZ B;  4LJ4 A;  1D0K A;  5BPV A;  3GO8 A;  2X49 A;  4LF4 M;  3GLI A;  3K92 A;  1Q39 A;  3H4J A;  1J09 A;  2OO9 A;  2F5S A;  1L2D A;  4WUR A;  2K0B X;  5C18 A;  1G8P A;  3VK7 A;  2OQ4 A;  2CHG A;  4GC9 A;  4AI6 A;  4JV5 M;  1TDZ A;  2EKK A;  8CAT A;  3K8Z A;  3SAW A;  1NV8 A;  4DUY M;  3PNV A;  2CE7 A;  1G4A E;  2KA6 B;  1NY5 A;  1YSY A;  1ZMV A;  2ZTD A;  1NHW C;  1Q02 A;  2ZBK B;  2RGO A;  4FVM A;  5ITT A;  2R62 A;  1Z59 A;  4AKH A;  4RNA A;  2XLJ A;  2DAK A;  4DR7 M;  4NRW A;  2DAM A;  5FSW A;  3HJQ A;  2QEN A;  1RU3 A;  4QHS A;  3W0L B;  2OOA A;  3FTF A;  1NY6 A;  3E4R A;  4MB7 A;  4GIT A;  3U6L A;  4FCT A;  2V1U A;  2R45 A;  5KPT A;  1G41 A;  2K6B A;  3I51 A;  4X64 M;  1QAQ A;  3GPP A;  4DV7 M;  2Y0Q A;  3I01 M;  1VG5 A;  1V92 A;  4IBJ A;  5KPZ A;  2F5Q A;  1LTM A;  3VKG A;  4S12 A;  1E32 A;  2C5R A;  3SYK A;  3FUW A;  2WZJ A;  2R18 A;  2QBY A;  2G3Q A;  2LTU A;  4GKJ M;  3L25 A;  3HJS A;  1NHG C;  2CHV A;  2EJS A;  2H1R A;  3IHP A;  3F92 A;  4JI3 M;  1UFZ A;  2DHR A;  1NSF A;  2Y0T A;  3HZJ A;  3L26 A;  1MU5 A;  1I4W A;  2WSF F;  3C3E A;  3I4Y A;  2VII A;  4EIW A;  2JUJ A;  2YQZ A;  4IBC A;  3FE3 A;  4KO8 A;  4DR4 M;  4FCW A;  4GH9 A;  2G8L A;  2Z8Y M;  4LJA A;  4B3T M;  2BWB A;  5IZ7 D;  1IFY A;  2WSC F;  5L8R F;  4JI7 M;  1G3I A;  1AUA A;  3MMP A;  3U6D A;  3Q8X A;  1IN5 A;  1QUT A;  5ITQ A;  3GLH A;  3B9P A;  2FH0 A;  2Z7J A;  1GVN A;  4NSR A;  2R4E A;  4NOO B;  2LXE A;  4I5S A;  1QDT A;  4L15 A;  4FW9 A;  2ZAN A;  3U61 A;  4WW0 A;  1R2Z A;  1YE9 A;  4L8R C;  4X65 M;  4JI8 M;  3J7A S;  2LVO C;  3K2L A;  1QDR A;  3HX3 A;  5EP2 A;  2QBY B;  5FTJ A;  4FWD A;  2D7E A;  4LJ5 A;  4HEO A;  1XMQ M;  2DVW B;  3AOG A;  4UN2 B;  4M0W A;  3TL4 X;  4JYA M;  3AOE C;  4FD2 A;  3MJ5 A;  4G4N A;  1PJJ A;  1IN6 A;  3I4V A;  4KOD A;  4DV5 M;  3BXW A;  3KS4 A;  3RGS A;  3SC3 A;  3RE8 A;  3U60 B;  3GLG E;  4QHT A;  2UXC M;  4IIW A;  2C96 A;  2DAE A;  2YFQ A;  3KOZ E;  2CUZ A;  1R4G A;  1ZMW A;  2JY7 A;  2QSF X;  4LGM A;  1J5E M;  1QVR A;  4JN6 A;  4RF0 A;  4M0D A;  1IN4 A;  2KNV A;  5LMN M;  1WIV A;  5ITR A;  1IXZ A;  3OTO M;  3IEC A;  1XXH B;  4LGY A;  2D7H A;  4BB9 A;  4CJ6 A;  2BJW A;  1CUK A;  4CIS A;  1Y8G A;  4X66 M;  4CGY B;  2ZM6 M;  4PDG A;  5IRE B;  2DAG A;  3E9S A;  3UGJ A;  2EO2 A;  3R9X B;  1D2N A;  3B89 A;  1NJF A;  3KOY E;  4LY6 A;  3SMS A;  1GL7 A;  2MJ5 B;  2NQ8 C;  1AIP C;  3SAU A;  3FUU A;  2DWN A;  4LJ6 A;  3GLG B;  2JY6 B;  4IBG A;  3CF0 A;  4II7 A;  1PJS A;  4AG6 A;  1ZAE A;  4LF9 M;  2CP8 A;  4DR5 M;  3TE6 A;  1OFH A;  4AKG A;  4ANR A;  4YHH M;  3HKP A;  4OX9 M;  1N32 M;  2L7H A;  1OQY A;  4AG5 A;  1TTE A;  1XMO M;  2CRU A;  4A3V B;  2XSZ A;  3E46 A;  3GLI E;  3HHY A;  2KNZ A;  3BOS A;  4NL4 H;  2YNM D;  4LJ7 A;  2A5Y B;  2R4J A;  3GRU A;  3DA1 A;  5DFL A;  1XXH A;  3QWL A;  2R0I A;  1GLN A;  2L4E A;  3M0E A;  4L78 A;  4F1I A;  1GL6 A;  4OU7 A;  4DR2 M;  4FWG A;  2XFT A;  1KSF X;  3DFZ A;  4MGK E;  1MN3 A;  3VLF B;  4HLQ A;  2LBC A;  2QZ4 A;  5FTL A;  4LZJ A;  4R3D A;  2DZN B;  4PT5 A;  4JI4 M;  1N78 A;  2YR0 A;  2LWX A;  1HT2 E;  1R5L A;  1NVM A;  1FNN A;  2UUA M;  3GRY A;  3K9O A;  2L2D A;  3QAU A;  2I7N A;  2K47 A;  3IG5 A;  2DZO B;  3KDS E;  1UM8 A;  2XF3 A;  2C98 A;  2QPA A;  1Z5C A;  1PJT A;  2FS1 A;  4WP2 A;  2CV0 A;  2M60 A;  4MGH A;  3NBI A;  4DV6 M;  2W82 A;  4DR3 M;  1PJI A;  4QOZ C;  1WGN A;  3W68 A;  1DV0 A;  5EXT A;  2F5O A;  2L4F A;  1HQC A;  1DGH B;  3LVV A;  3FYC A;  3A42 A;  3KVW A;  2JXN A;  5EJC A;  3DOA A;  4LG2 A;  1QZM A;  5ITU A;  4KHP M;  4YY3 M;  3TWM A;  4OW0 A;  1GJT A;  3LVW A;  2Z3X A;  1HJP A;  1WJ7 A;  4GC5 A;  5E26 A;  3B7Q A;  2C99 A;  3KOX E;  2ZTC A;  3VKH A;  3KFU G;  1S3S A;  4GEW A;  1J7K A;  3FUV A;  4IBD A;  4JI0 M;  3T1Y M;  4QNR A;  1VEK A;  3C3D A;  4GHA A;  1A5T A;  1V33 A;  2CFO A;  3SBJ A;  4I8O A;  3GPX A;  1OFI A;  3A46 A;  4AQY M;  3U6P A;  4LFC M;  3L29 A;  3FKE A;  2DNA A;  2O5R A;  3MK6 A;  1PRB A;  5ITX A;  3THG A;  1C1K A;  2V6Z M;  4JI1 M;  3KP1 E;  3ZH9 B;  1QAN A;  2O25 A;  2P5T A;  3AOE A;  4MGZ E;  1K3W A;  1SXJ B;  1C7Y A;  1JQJ C;  4D82 A;  3A45 A;  1DGF A;  1OIZ A;  1SG9 A;  2MGW A;  3D8L A;  3SHG B;  2QQ8 A;  3I04 M;  3T6P A;  4NC6 A;  4OVZ A;  2EA0 A;  3HHX A;  3J7B A;  1XWI A;  2FE8 A;  5FTM A;  3SMP A;  5C1B A;  4G4R A;  5H37 D;  4GIP A;  2HKJ A;  3GLF E;  3ILK A;  2H5X A;  1HQY E;  5EXX A;  4NXM M;  2FNA A;  1IBM M;  5BR8 M;  3KS8 A;  4DV2 M;  4MH0 E;  4DUZ M;  2CV2 A;  4JI2 M;  1IXS B;  3U6O A;  5KPR A;  1ORY B;  1SXJ C;  4LJ9 A;  4G4O A;  1HNX M;  1I94 M;  1L2C A;  2VF8 A;  2VDB B;  2LHG A;  3B7N A;  3FUX A;  1WXQ A;  4IBE A;  2XH9 A;  1SXJ E;  5DYI A;  2RGH A;  3J81 S;  1DO0 A;  1NJG A;  1SXJ D;  2C9C A;  5KQD A;  3U60 A;  4DV4 M;  1IBL M;  2XSZ D;  1IY1 A;  1JR3 A;  1Q3C A;  3J2P B;  1NNU C;  3AJI B;  1G71 A;  5EXS A;  4D81 A;  2JZ1 A;  3M6A A;  2DKL A;  3HU1 A;  3Q8G A;  4L6V 6;  3GLF B;  3U6E A;  3SAS A;  3ZQJ A;  2C9O A;  5KO3 A;  4G4Q A;  3CTW B;  3T15 A;  1R6B X;  5JI2 E;  1QYR A;  2FOI C;  2J7N A;  2O01 F;  3CGW A;  3FRI A;  1LV7 A;  3KOW E;  3SYL A;  7CAT A;  3GQ5 A;  3VK8 A;  3UZU A;  3GLI B;  2Z4S A;  1D0M A;  2AHM A;  4PD2 A;  1GO5 A;  1QZE A;  2QCU A;  3DZD A;  4B7F A;  2LHC A;  1XNR M;  4DR6 M;  5DYG A;  2Z4R A;  3LQR A;  2HCB A;  5ITX E;  3RGP A;  4DBG B;  4GKK M;  1W5T A;  4BBA A;  3ZC7 B;  2FFJ A;  3VFD A;  1QQW A;  4Y28 F;  3VDU A;  2LVA A;  3GLG A;  1QUS A;  1TDH A;  1V34 A;  2HAK A;  3GLH B;  2N35 A;  3CF6 E;  3B74 A;  4JXJ A;  2JNH A;  4F2L A;  2UU9 M;  2KW0 A;  2UXD M;  2GQF A;  5JI3 E;  2CEA A;  2DWL A;  2WSE F;  3WHL A;  1XXH E;  1TF0 B;  4Q7J A;  1TH2 A;  3U61 B;  4G6Z A;  2D7G A;  2JY8 A;  3FTC A;  1ZQ9 A;  5LMU M;  2I7P A;  2XZF A;  3KP0 E;  3L28 A;  1W5S A;  1HT1 E;  3KW6 A;  4B08 A;  2DEN A;  4XGI A;  1HNZ M;  1TR8 A;  5GKN A;  1IY0 A;  3TQS A;  2VQE M;  3FUT A;  1HR0 M;  4Z6Y A;  2F5P A;  1GKI A;  2R65 A;  2KRK A;  4LRT A;  2MH8 A;  2ZAO A;  4TUW A;  2Y21 A;  3L27 A;  3QYE A;  4XK8 F;  3PXG A;  3JR4 A;  4B3M M;  4B3R M;  2JY5 A;  4LFB M;  1OTR A;  2J5Y A;  1QAO A;  3M7G A;  3PNY A;  4IJF A;  3RFW A;  3GQ3 A;  3TWL A;  4LF7 M;  2HL7 A;  5FLX S;  2UXB M;  3LCV B;  2B3T A;  3LQQ A;  3E21 A;  3HWS A;  4JI6 M;  2EKF A;  3V76 A;  3GLH E;  3NBX X;  3KSX A;  1KYI A;  1IN7 A;  1VDL A;  4W5W A;  3C58 A;  1XC8 A;  1G59 A;  2DHY A;  2Y20 A;  4ZPX A;  2OOB A;  3LMM A;  3L2A A;  1KFV A;  4DR1 M;  5EQT A;  4MGY E;  1E9R A;  1N34 M;  2BNK A;  4I4L A;  2L09 A;  4L16 A;  2ZAM A;  2DZL A;  4FCV A;  2UUC M;  2F4V M;  3NWL A;  3HGI A;  4D80 A;  2LVQ D;  3PVS A;  4IBF A;  1PM5 A;  2DAI A;  1BVS A;  2LH0 A;  3AV0 A;  1NO1 A;  1N33 M;  2J7O A;  1GJS A;  1Q3B A;  2Q2E B;  4ITQ A;  2JA2 A;  3U6C A; 
#chains in the Genus database with same CATH homology
 1EE8 A;  3EIE A;  3WHK A;  3KSJ A;  3GP1 A;  4BLC A;  4LFA M;  1Z6T A;  3JAM S;  4NRV A;  2KRU A;  2BJV A;  3GRV A;  1XNQ M;  1IXR C;  5IT9 S;  1SXJ A;  4MM3 B;  2LNH C;  1K82 A;  1IBK M;  2KXE A;  2VQF M;  1JR3 D;  4DV3 M;  4IBI A;  4B7H A;  5IWA M;  2HHH M;  4QNM A;  5A2Q S;  1XHB A;  5FTK A;  3GQ4 A;  4RF1 A;  3AKZ A;  2XEP A;  5ITY A;  1K3X A;  5EP1 A;  3T38 A;  3FTD A;  2UUB M;  3ZCB B;  1TGU A;  3EIH A;  1TH3 A;  4FWH A;  3GPU A;  3SAT A;  3TPZ A;  3K1J A;  3KXE C;  3SFZ A;  2OPF A;  1TH4 A;  2XFS A;  3T1H M;  4JI5 M;  3SAV A;  5F3W A;  2M5Z A;  4M9X A;  1VDD A;  3A98 B;  4AW4 A;  1FJG M;  3TWK A;  2X4A A;  3SHF A;  2DXI A;  1IN8 A;  3HU2 A;  2CHQ A;  4REZ A;  3U6M A;  3AL0 C;  5EP4 A;  1MX0 A;  1Z5A A;  4X62 M;  1DGH A;  2XGN A;  5DNY A;  3FYD A;  3PFI A;  2RKO A;  2F5N A;  1E94 E;  2QP9 X;  3GLF A;  2XZU A;  3SAR A;  2EUC A;  4PDI A;  4M9S A;  3J27 B;  3H4M A;  3CF2 A;  5EP3 A;  3UJN A;  2R46 A;  4HL4 A;  1H6U A;  2L7I A;  1L8Q A;  4IBK A;  3MHV C;  3U6Q A;  1E9S A;  4K0K M;  4LCB A;  1YUB A;  1OJL A;  4Z8X A;  4B7G A;  4CHT B;  3UK6 A;  1R7R A;  4DV1 M;  4R7G A;  4AZF A;  2KZS A;  3VDP A;  4LF5 M;  4PCZ A;  1N77 A;  3J80 S;  4AKI A;  3GRR A;  4LF8 M;  3U5Z B;  1L1T A;  4IBB A;  4B3S M;  3JR5 A;  3UMM A;  4NSO B;  4QOS A;  1X37 A;  1DGB A;  2G5G X;  4OVZ B;  3W0F A;  4MGI E;  4LF6 M;  1NNJ A;  4LRS A;  4GHL A;  3FD9 A;  5KQ8 A;  3HJ8 A;  1T3T A;  4GMQ A;  4KLN A;  2DWM A;  4GRI A;  2KEB A;  1QAM A;  3D8B A;  1R2Y A;  2KZU A;  1DO2 A;  5EXP A;  3HU3 A;  4NXN M;  4L4U A;  1Z5B A;  3GPY A;  3U6S A;  4LJ8 A;  5FTN A;  1N75 A;  2CV1 A;  1HNW M;  4IJE A;  1IQP A;  4XBO A;  3U5Z A;  2L6O A;  3HHZ A;  2X8A A;  1L1Z A;  4I81 A;  2E5L M;  5E6J A;  3R8F A;  2V1C A;  1N36 M;  1L2B A;  3AFH A;  1IM2 A;  4P16 A;  4M9Z A;  1DGG A;  2ERC A;  1IY2 A;  3IG8 A;  3HHW A;  4DV0 M;  4LZZ A;  2DWZ B;  4LJ4 A;  5BPV A;  3GO8 A;  4LF4 M;  2X49 A;  3GLI A;  3K92 A;  1Q39 A;  1J09 A;  2F5S A;  1L2D A;  4WUR A;  5C18 A;  1G8P A;  3VK7 A;  2OQ4 A;  2CHG A;  4GC9 A;  4AI6 A;  4JV5 M;  1TDZ A;  8CAT A;  3K8Z A;  3SAW A;  4DUY M;  3PNV A;  2CE7 A;  1G4A E;  2KA6 B;  1NY5 A;  1YSY A;  1NHW C;  2ZBK B;  2RGO A;  4FVM A;  5ITT A;  2R62 A;  1Z59 A;  4AKH A;  4RNA A;  2XLJ A;  4DR7 M;  4NRW A;  5FSW A;  3HJQ A;  2QEN A;  4QHS A;  3W0L B;  3FTF A;  1NY6 A;  3E4R A;  4MB7 A;  4GIT A;  3U6L A;  4FCT A;  2V1U A;  2R45 A;  5KPT A;  1G41 A;  3I51 A;  4X64 M;  3GPP A;  1QAQ A;  4DV7 M;  2Y0Q A;  4IBJ A;  5KPZ A;  2F5Q A;  3VKG A;  4S12 A;  1E32 A;  2C5R A;  3SYK A;  3FUW A;  2QBY A;  2R18 A;  4GKJ M;  3L25 A;  3HJS A;  1NHG C;  2CHV A;  2H1R A;  4JI3 M;  2DHR A;  2Y0T A;  1NSF A;  3L26 A;  1MU5 A;  1I4W A;  3I4Y A;  2VII A;  4EIW A;  2YQZ A;  4IBC A;  4KO8 A;  4DR4 M;  4FCW A;  4GH9 A;  2G8L A;  4B3T M;  4LJA A;  5IZ7 D;  4JI7 M;  1G3I A;  3U6D A;  3Q8X A;  1IN5 A;  3GLH A;  3B9P A;  2Z7J A;  1GVN A;  4NSR A;  2R4E A;  4NOO B;  2LXE A;  4I5S A;  4L15 A;  4FW9 A;  2ZAN A;  3U61 A;  4WW0 A;  1R2Z A;  1YE9 A;  4L8R C;  4X65 M;  4JI8 M;  3J7A S;  3K2L A;  2QBY B;  5EP2 A;  5FTJ A;  4FWD A;  2D7E A;  4LJ5 A;  1XMQ M;  2DVW B;  3AOG A;  4M0W A;  3TL4 X;  4JYA M;  3AOE C;  4FD2 A;  3MJ5 A;  4G4N A;  1PJJ A;  1IN6 A;  3I4V A;  4KOD A;  4DV5 M;  3KS4 A;  3RGS A;  3SC3 A;  3RE8 A;  3U60 B;  4QHT A;  2UXC M;  4IIW A;  2C96 A;  2YFQ A;  3KOZ E;  2CUZ A;  1J5E M;  4LGM A;  1QVR A;  4JN6 A;  4RF0 A;  4M0D A;  1IN4 A;  5LMN M;  5ITR A;  1IXZ A;  3OTO M;  4LGY A;  1XXH B;  4BB9 A;  2D7H A;  2BJW A;  4CIS A;  4X66 M;  4CGY B;  2ZM6 M;  4PDG A;  5IRE B;  3E9S A;  3UGJ A;  2EO2 A;  3R9X B;  1D2N A;  1NJF A;  3KOY E;  4LY6 A;  3SMS A;  1GL7 A;  2NQ8 C;  2DWN A;  3SAU A;  3FUU A;  4LJ6 A;  3GLG B;  4IBG A;  3CF0 A;  4II7 A;  4AG6 A;  4LF9 M;  1ZAE A;  4DR5 M;  3TE6 A;  1OFH A;  4AKG A;  4YHH M;  3HKP A;  4OX9 M;  1N32 M;  2L7H A;  4AG5 A;  1XMO M;  4A3V B;  2XSZ A;  3HHY A;  3BOS A;  4NL4 H;  2YNM D;  4LJ7 A;  2A5Y B;  2R4J A;  3GRU A;  3DA1 A;  1XXH A;  3QWL A;  4L78 A;  1GLN A;  3M0E A;  4OU7 A;  4DR2 M;  3FTE A;  1GL6 A;  4FWG A;  2XFT A;  1KSF X;  3DFZ A;  4MGK E;  3VLF B;  4HLQ A;  2QZ4 A;  5FTL A;  4LZJ A;  4R3D A;  2DZN B;  4PT5 A;  4JI4 M;  1N78 A;  2YR0 A;  2LWX A;  1HT2 E;  1NVM A;  1FNN A;  2UUA M;  3GRY A;  3QAU A;  2I7N A;  2K47 A;  3IG5 A;  2DZO B;  3KDS E;  1UM8 A;  2XF3 A;  2C98 A;  2QPA A;  1Z5C A;  2CV0 A;  2M60 A;  4MGH A;  3NBI A;  4DV6 M;  2W82 A;  4DR3 M;  1PJI A;  4QOZ C;  5EXT A;  2F5O A;  1HQC A;  1DGH B;  3LVV A;  3FYC A;  3A42 A;  3KVW A;  5EJC A;  3DOA A;  4LG2 A;  1QZM A;  5ITU A;  4KHP M;  4YY3 M;  3TWM A;  4OW0 A;  3LVW A;  2Z3X A;  4GC5 A;  5E26 A;  2C99 A;  3KOX E;  3VKH A;  3KFU G;  1S3S A;  4IBD A;  1J7K A;  3FUV A;  4JI0 M;  3T1Y M;  4QNR A;  4GHA A;  3SBJ A;  2CFO A;  4I8O A;  3GPX A;  1OFI A;  3A46 A;  4AQY M;  3U6P A;  4LFC M;  3L29 A;  3FKE A;  2O5R A;  3MK6 A;  5ITX A;  3THG A;  1C1K A;  2V6Z M;  4JI1 M;  3KP1 E;  3ZH9 B;  1QAN A;  2P5T A;  3AOE A;  4MGZ E;  1K3W A;  1SXJ B;  1JQJ C;  4D82 A;  3A45 A;  1DGF A;  3SHG B;  3D8L A;  4OVZ A;  2EA0 A;  3HHX A;  3J7B A;  1XWI A;  2FE8 A;  5FTM A;  3SMP A;  5C1B A;  4G4R A;  5H37 D;  4GIP A;  2HKJ A;  3ILK A;  1HQY E;  5EXX A;  4NXM M;  2FNA A;  1IBM M;  5BR8 M;  3KS8 A;  4DV2 M;  4MH0 E;  4DUZ M;  2CV2 A;  4JI2 M;  1IXS B;  3U6O A;  5KPR A;  1ORY B;  1SXJ C;  4LJ9 A;  4G4O A;  1HNX M;  1I94 M;  1L2C A;  3FUX A;  4IBE A;  1WXQ A;  2XH9 A;  1SXJ E;  5DYI A;  2RGH A;  3J81 S;  1DO0 A;  1NJG A;  1SXJ D;  2C9C A;  5KQD A;  3U60 A;  4DV4 M;  1IBL M;  2XSZ D;  1IY1 A;  1JR3 A;  1Q3C A;  3J2P B;  1NNU C;  3AJI B;  5EXS A;  4D81 A;  5ITQ A;  3GLF B;  3M6A A;  3HU1 A;  3U6E A;  3SAS A;  2C9O A;  5KO3 A;  4G4Q A;  3CTW B;  3T15 A;  1R6B X;  5JI2 E;  1QYR A;  2FOI C;  2J7N A;  3SYL A;  7CAT A;  3VK8 A;  1LV7 A;  3KOW E;  3GQ5 A;  3UZU A;  3GLI B;  2Z4S A;  2AHM A;  4PD2 A;  2QCU A;  3DZD A;  4B7F A;  1XNR M;  4DR6 M;  5DYG A;  2Z4R A;  3LQR A;  2HCB A;  5ITX E;  3RGP A;  4GKK M;  1W5T A;  4BBA A;  3ZC7 B;  2FFJ A;  3VFD A;  1QQW A;  3VDU A;  3GLG A;  1TDH A;  3GLH B;  3CF6 E;  4JXJ A;  2UU9 M;  2KW0 A;  2UXD M;  5JI3 E;  2CEA A;  2DWL A;  3WHL A;  1TH2 A;  3U61 B;  4G6Z A;  2D7G A;  3FTC A;  1ZQ9 A;  5LMU M;  2I7P A;  2XZF A;  3KP0 E;  3L28 A;  1W5S A;  1HT1 E;  3KW6 A;  4B08 A;  4XGI A;  1HNZ M;  2VQE M;  5GKN A;  1IY0 A;  3TQS A;  2F5P A;  3FUT A;  1HR0 M;  4Z6Y A;  1GKI A;  2R65 A;  2KRK A;  4LRT A;  4TUW A;  2ZAO A;  2Y21 A;  3L27 A;  3PXG A;  3JR4 A;  4B3M M;  4B3R M;  4LFB M;  1QAO A;  3M7G A;  3PNY A;  4IJF A;  3RFW A;  3GQ3 A;  3TWL A;  4LF7 M;  2HL7 A;  5FLX S;  2UXB M;  3LQQ A;  3HWS A;  4JI6 M;  3KSX A;  1KYI A;  1IN7 A;  4W5W A;  3C58 A;  1XC8 A;  1G59 A;  2Y20 A;  4ZPX A;  3LMM A;  3L2A A;  1KFV A;  4DR1 M;  5EQT A;  4MGY E;  1E9R A;  1N34 M;  2BNK A;  4I4L A;  2L09 A;  4L16 A;  2ZAM A;  4FCV A;  2UUC M;  2F4V M;  3NWL A;  3HGI A;  4D80 A;  3PVS A;  4IBF A;  1PM5 A;  2LH0 A;  3AV0 A;  1N33 M;  2J7O A;  1Q3B A;  2Q2E B;  4ITQ A;  2JA2 A;  3U6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...