3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3ZCBB 3SHGB 3ZC7B
chains in the Genus database with same CATH superfamily
1NJGA 4I4LA 5FTLA 4I81A 2OPFA 4MGZE 3DFZA 1XWIA 4MB7A 2G5GX 3FTEA 4BBAA 2V1UA 4NXNM 3LQQA 2DZOB 4LJAA 3SATA 3TWMA 5ITTA 1Z5BA 2D7EA 4X65M 3KSJA 2UUCM 2L7HA 4DR7M 2JY5A 3GLGE 2F5QA 1AUAA 3SAWA 3FUXA 2F5PA 2H1RA 3IHPA 5IT9S 1Q02A 2KRKA 2AHMA 2R18A 2UUBM 1HQYE 1YLAA 1T3TA 1IN4A 4KT0F 3I01M 1ZMVA 2CHQA 2DAGA 2XFSA 3R8FA 1TH2A 1PJIA 2X4AA 1NY5A 2RGOA 5IREB 2CV2A 2EJSA 3D8BA 3GQ5A 1JR3A 1ZV1A 2Z7JA 1IBMM 1Z59A 1C1KA 4DR5M 2EKKA 1Z6TA 5C1BA 4FCVA 2UU9M 2YFQA 4NRVA 3H4JA 4R71A 3J81S 2LVQD 1TDZA 4R7GA 3U5ZB 4XGIA 1Q39A 2L4FA 3T6PA 3AOGA 3B7ZA 3ZQJA 3SYKA 5EP4A 1V92A 3MK6A 2RGHA 1XB2B 2VIIA 3A42A 2O25A 3FE3A 3QYBA 1XXHB 4Z8XA 3AL0C 2L6OA 4P17A 4IJFA 2Z3XA 2JP7A 2EO2A 3GRUA 4DV2M 2D7GA 3BXWA 4LJ7A 1XNQM 1UFZA 4Y28F 1GABA 1X37A 3A45A 3J7BA 3GLIB 3U5ZA 1J09A 2QHOB 4DV0M 1P3QQ 3GLHA 2R45A 4BB9A 5BR8M 4DUZM 3U61A 3UK6A 1IXRC 2VF7A 4FD2A 4JI2M 1NHGC 1GKIA 1VG5A 2FNAA 4JI4M 2DKLA 3U60B 4GC5A 4FWGA 2O5RA 4DUYM 1XNRM 3E46A 4QHTA 4QOSA 4L4UA 2EUCA 2XEPA 2KDLA 4YHHM 4G4NA 4W5WA 5EXXA 2BWBA 3NBIA 3SAVA 2LNHC 4NC6A 3FTCA 3KP1E 4NRWA 3HU2A 1I4WA 1PJSA 4I5SA 3I4VA 3HGIA 1TTEA 2DZLA 5IZ7D 3UZUA 3NWLA 3FRHA 5ITRA 3U6SA 1PGYA 1OAOC 1TF0B 3TE6A 3NBXX 1QDRA 4IJEA 4BLCA 1XMQM 4FWHA 4G4QA 4IBBA 2X49A 1ZMWA 1L2CA 1GL6A 3AKZA 1N75A 2R0IA 2ERCA 1K3WA 1OIPA 1QDTA 5ITXA 1IN8A 1ZMUA 2QCUA 2KW0A 2W82A 3RGPA 1SXJD 4DV7M 4LRSA 1N34M 2APLA 4AG5A 3QWLA 2XF3A 2H5XA 4DV1M 4R3DA 1HJPA 3J7AS 4CJ6A 1QANA 3HHYA 5ITYA 1KYIA 3Q8XA 3BOSA 1G4AE 3J80S 5EXPA 3GLFE 2O01F 3DOAA 2EKFA 4P16A 4X66M 3B9PA 1WIVA 3RFWA 1HNZM 1Z5AA 2C99A 1PJJA 4RNAA 1J5EM 2CFOA 1G59A 1IBLM 1A5TA 3LMMA 3FUWA 1SG9A 4XBOA 5ITUA 3GPXA 3FTDA 1N36M 2DWZB 1VEGA 1IN7A 4D80A 3L28A 1SXJA 2FH0A 5KQ8A 1NY6A 4LF5M 4B3RM 3U6QA 2MROB 3T15A 4PDGA 4IBIA 3LVWA 3LW5F 4UN2B 2KHHA 4PCZA 3VK7A 4JV5M 1SXJC 4OVZA 3F92A 2KZUA 2DNAA 5FTNA 2DHYA 3HKPA 5DNYA 1Q3CA 5FLXS 1YUBA 1NV8A 4LG2A 1TDHA 3HJ8A 3IG5A 1WGLA 4GMQA 1WHCA 4CGYB 2KNVA 1OQYA 2R62A 3HU1A 2JXNA 1NVMA 3RE8A 4IBFA 2RKOA 1JQJC 2QBYB 2LVAA 3CTWB 3FRIA 5EP3A 5FSWA 2VQEM 1R2ZA 4DR2M 2DAEA 2LBCA 4LFCM 4LZZA 5KPRA 3U6MA 3KS8A 4F1IA 2VDBB 4QNRA 3GLFA 3IECA 2I7NA 2JA2A 2R44A 3C58A 3L25A 5LMUM 4GHLA 2E5LM 2CE7A 3M0EA 5KPZA 2JWSA 2M5ZA 3R9XB 4IBCA 3V76A 2L2DA 5JI2E 2XFTA 3SBJA 1SXJB 2BNKA 2HCBA 5KO3A 3THGA 3HU3A 3DA1A 4DV4M 4NOOB 1K82A 2HHHM 1IXZA 2ZTCA 4B7GA 4PDIA 1IY0A 1ZAEA 2JZ1A 5ITXE 4NL4H 3J27B 5EXTA 3TQSA 1H6UA 1HR0M 3B7NA 1OAIA 4A3VB 5F3WA 1KSFX 3E4RA 2N35A 4X64M 1WJ7A 2CRUA 2F5SA 4LY6A 3KOZE 4B08A 1QYRA 3D8LA 3TPZA 3GLIE 4JI8M 3AOEC 1R4GA 1IN5A 3TWLA 1CUKA 1GL7A 2J5YA 3GP1A 2DWMA 4AKGA 3SHFA 2FS1A 2KRUA 5EJCA 5EP1A 2DI0A 4B3SM 2K9DA 3SARA 5EQTA 3L27A 2YR0A 4Q7JA 3SC3A 3A46A 5E6JA 4I8OA 4DR3M 4LFBM 3FUUA 2YQZA 2K0BX 3FD9A 2XSZA 3PXGA 2D7HA 2LHCA 1E94E 1G8PA 2Y21A 2YNMD 1HQCA 4G4OA 2OO9A 3RGSA 2XZFA 2MR9A 3GO8A 3C9PA 4MH0E 4L8RC 5JI3E 4GHAA 1VDLA 4OU7A 2CV0A 1V33A 3E21A 3W67A 1IXSB 1QAMA 1TH4A 3JR4A 3GLHE 4LJ5A 4LRTA 4ZPXA 1DO2A 1V34A 2Q2EB 3AFHA 2WSFF 4RF0A 4B3TM 3U6PA 3PVSA 3CF6E 2MJ5B 2NQ8C 4KODA 2WZJA 4FCTA 4B7HA 4OX9M 4LJ8A 1FNNA 4HLQA 4IBDA 1GJSA 2R4EA 3DZDA 1WR1B 5FTJA 2OQ4A 1EIJA 1NNJA 3CF0A 2MGWA 2KXEA 2DWLA 4S12A 4K0KM 3KOYE 2KNZA 1I94M 3U60A 2Y0QA 1RU3A 2KA6B 2L7IA 2LXEA 5FTKA 1OFIA 1W5SA 2UXCM 4AKIA 4RF1A 2BJWA 1HNWM 3T1YM 5EP2A 1MJGM 4D81A 1JR3E 1MX0A 2DZNB 1KFVA 4B3MM 1G71A 3GLHB 2DVWB 2UXBM 3VDUA 3U61B 3QYEA 1JB0F 3VK8A 3FTFA 1IM2A 1GJTA 4G3OA 3KDSE 1R2YA 1TH3A 1N32M 3QAUA 3KS4A 4IBGA 1Y8GA 4HEOA 5BPVA 3FUVA 3LCUA 2DXIA 1D0KA 1XXHA 3EIEA 3UGJA 4M9ZA 4LF8M 3IG8A 1J7KA 3A98B 3GLGA 5IWAM 4LGMA 2G8LA 3MMPA 2JNHA 2UUAM 1N77A 1QQWA 2I7PA 2LVOC 1TR8A 1EE8A 2DAMA 4M9SA 3W68A 3U6OA 1Z5CA 3HHXA 2JY8A 2Z4RA 4GITA 1JR3D 5FTMA 2CV1A 3SASA 2LHGA 4LCBA 2K6BA 2LH0A 3T38A 3H4MA 3K8ZA 1S3SA 4LZJA 4LF6M 3SMSA 3OTOM 1LV7A 1K3XA 3U6EA 4GKKM 1D0MA 2R6FA 4DR4M 3PNYA 3KW6A 1C7YA 3ILKA 1UM8A 4GH9A 2R4JA 1QUSA 3HWSA 2F4VM 1R7RA 1L1TA 4MGHA 1GVNA 2DENA 3GPYA 4AI6A 3B7QA 4GRIA 2C5RA 2ZBKB 5DYIA 1L2DA 3SFZA 5A2QS 4FWDA 3HZJA 3VFDA 2ZM6M 2QZ4A 4LF7M 1E9SA 1QZEA 2HAKA 3GRYA 4IBKA 1VEJA 4OVZB 3TWKA 4M9XA 3SMPA 1E32A 3LVVA 4IIWA 3U6CA 1DGGA 3HJSA 4XK8F 5KQDA 1XMOM 3WHKA 1DGHB 2Z4SA 1L1ZA 3Q8GA 4GKJM 4CISA 1ORYB 3FYDA 4IBJA 3I51A 2LWXA 2QENA 4B7FA 5EXSA 1SXJE 4F2LA 3U6LA 1FJGM 3VLFB 2Z8YM 4CIZA 4DV6M 4JI0M 2OOAA 2CHGA 2LVNC 3MJ5A 3VDPA 2J7OA 1QUTA 1DGBA 1DGHA 1QZMA 1WGNA 3MHVC 4PT5A 3KOWE 4RKUF 2JY6B 1WXQA 3HJQA 4FCWA 2LTUA 1NHWC 2ZANA 7CATA 1PM5A 2JUJA 1OIZA 2KNAA 4JN6A 1EFUB 4LJ6A 1OTRA 3B74A 1YE9A 3GRRA 2V1CA 4FVMA 3ZH9B 1NSFA 3PNVA 4EIWA 3B89A 3CF2A 3UJNA 1GO5A 4JXJA 4LF4M 1BVSA 2KZSA 4NSRA 2WSCF 4QHSA 2K47A 2L4EA 4DR1M 3LCVB 4REZA 4D82A 1HT1E 2L09A 4YY3M 2CP8A 3W0LB 4JI6M 4OW0A 1NO1A 4L16A 3HHWA 2MH8A 4JYAM 4AKHA 1YSYA 1T6OA 3AJIB 3GRVA 4JI3M 4KLNA 1IQPA 2V6ZM 3HX3A 1R6BX 2A5YB 1LTMA 2FE8A 1IFYA 2XH9A 1OJLA 2DWNA 1NJFA 1XXHE 2GNOA 4QOZC 3GPPA 4ANRA 4WURA 4AZFA 3GLGB 3K1JA 3U6DA 3AOEA 1DO0A 1VQ1A 5LMNM 3E9SA 2B3TA 4G6ZA 4DBGB 2QQ8A 3FYCA 2R65A 3GPUA 1GLNA 3W0FA 1G3IA 3GQ3A 2FFJA 3KFUG 4KHPM 3ZC7B 2X8AA 1L2BA 2BJVA 4L6V6 4ITQA 4MGYE 8CATA 1HNXM 2CEAA 1E9RA 3I04M 1AIPC 2Y20A 4L15A 4TUWA 1IXSA 1HT2E 5L8RF 2ZAOA 4LGYA 2UXDM 4HL4A 1ZQ9A 2C98A 2QSFX 2XZUA 4DV5M 1R5LA 1TGUA 1D0LA 1QAOA 3FKEA 5GKNA 3EIHA 4LF9M 3LQRA 3HHZA 2DHRA 2Y0TA 3GLFB 1W5TA 5DFLA 2M60A 1OFHA 4AW4A 1QVRA 4AQYM 2ZTDA 3K9OA 1IY1A 3I4YA 3SHGB 3WHLA 3HY5A 4LJ4A 4WP2A 3KSXA 1MU5A 5E26A 1OKSA 3UMMA 4DV3M 2F5OA 2QBYA 1MN3A 4L78A 2C9CA 2HKJA 2WSEF 2OOBA 3J2PB 1T43A 4LFAM 3BBZA 3VKGA 2FOIC 4PD2A 2VF8A 1NNUC 2EA0A 2C9OA 1XHBA 4LJ9A 2HWJA 1XC8A 4MM3B 3T1HM 4M0DA 2CHVA 1D2NA 2J7NA 2R46A 2JY7A 1IY2A 2BWEA 4GEWA 3SYLA 2XSZD 3KXEC 1IBKM 1Q3BA 1DV0A 4IBEA 2LVPC 4Z6YA 1N33M 2QP9X 4X62M 2RRUA 3C3EA 2CWBA 3C3DA 5H37D 4JI1M 1PRBA 4GC9A 1G41A 3GLIA 2HL7A 1L8QA 1QAQA 1VEKA 3M6AA 5KPTA 2JZ0A 4JI7M 3VKHA 2QNJA 1VDDA 2KEBA 1PJTA 2G3QA 2XGNA 3JAMS 2DAKA 3L26A 3PFIA 3KP0E 3ZCBB 2F5NA 1DGFA 4FW9A 2QPAA 4DR6M 5C18A 4WW0A 4G4RA 3TL4X 2VQFM 5ITQA 2ZAMA 2C96A 4AG6A 3CGWA 4NSOB 1PJQA 2GQFA 3K9PA 2XLJA 3L2AA 1N78A 1F4IA 4CHTB 2DAIA 3KOXE 5DYGA 3AV0A 3SAUA 4NXMM 4MGIE 4M0WA 4KO8A 2CUZA 4MGKE 4GIPA 3M7GA 1IN6A 3GQ4A 1NV9A 3JR5A 3FUTA 3K2LA 3KVWA 4JI5M 4II7A 3K92A 3L29A 2P5TA 4QNMA
chains in the Genus database with same CATH topology
1NJGA 4I4LA 5FTLA 4I81A 2OPFA 4MGZE 3DFZA 1XWIA 4MB7A 2G5GX 3FTEA 4BBAA 2V1UA 4NXNM 3LQQA 2DZOB 4LJAA 3SATA 3TWMA 5ITTA 1Z5BA 2D7EA 4X65M 3KSJA 2UUCM 2L7HA 4DR7M 2F5QA 3SAWA 3FUXA 2F5PA 2H1RA 5IT9S 2KRKA 2AHMA 2R18A 2UUBM 1HQYE 1T3TA 1IN4A 2CHQA 2XFSA 3R8FA 1TH2A 1PJIA 2X4AA 1NY5A 2RGOA 5IREB 2CV2A 3D8BA 3GQ5A 1JR3A 2Z7JA 1IBMM 1Z59A 1C1KA 4DR5M 1Z6TA 5C1BA 4FCVA 2UU9M 2YFQA 4NRVA 1TDZA 3J81S 4R7GA 3U5ZB 4XGIA 1Q39A 3AOGA 3SYKA 5EP4A 3MK6A 2RGHA 2VIIA 3A42A 4Z8XA 3AL0C 1XXHB 2L6OA 4IJFA 2Z3XA 2EO2A 3GRUA 4DV2M 2D7GA 4LJ7A 1XNQM 1X37A 3A45A 3J7BA 3GLIB 3U5ZA 1J09A 4DV0M 3GLHA 4BB9A 2R45A 5BR8M 4DUZM 3U61A 3UK6A 1IXRC 4FD2A 4JI2M 1NHGC 1GKIA 2FNAA 4JI4M 3U60B 4GC5A 4FWGA 2O5RA 4DUYM 1XNRM 4QHTA 4QOSA 4L4UA 2EUCA 2XEPA 4YHHM 4G4NA 4W5WA 5EXXA 3NBIA 3SAVA 2LNHC 3FTCA 3KP1E 4NRWA 3HU2A 1I4WA 4I5SA 3I4VA 3HGIA 5IZ7D 3UZUA 3NWLA 5ITRA 3U6SA 3TE6A 4BLCA 4IJEA 1XMQM 4FWHA 4G4QA 4IBBA 2X49A 1L2CA 1GL6A 3AKZA 1N75A 2ERCA 1K3WA 5ITXA 1IN8A 2QCUA 2KW0A 2W82A 3RGPA 1SXJD 4DV7M 4LRSA 4AG5A 3QWLA 2XF3A 4DV1M 4R3DA 3J7AS 1QANA 3HHYA 5ITYA 1KYIA 3Q8XA 3BOSA 1G4AE 3J80S 5EXPA 3DOAA 4P16A 4X66M 3B9PA 3RFWA 1HNZM 1Z5AA 2C99A 1PJJA 4RNAA 1J5EM 2CFOA 1G59A 1IBLM 3LMMA 3FUWA 4XBOA 5ITUA 3GPXA 3FTDA 1N36M 2DWZB 1IN7A 4D80A 3L28A 1SXJA 5KQ8A 1NY6A 4LF5M 4B3RM 3U6QA 3T15A 4PDGA 4IBIA 3LVWA 3VK7A 4PCZA 4JV5M 1SXJC 4OVZA 2KZUA 5FTNA 3HKPA 5DNYA 1Q3CA 5FLXS 1YUBA 4LG2A 1TDHA 3HJ8A 3IG5A 4GMQA 4CGYB 2R62A 3HU1A 1NVMA 3RE8A 4IBFA 2RKOA 1JQJC 2QBYB 3CTWB 5EP3A 5FSWA 2VQEM 1R2ZA 4DR2M 4LFCM 4LZZA 5KPRA 3U6MA 3KS8A 4QNRA 3GLFA 2I7NA 2JA2A 3C58A 3L25A 5LMUM 4GHLA 2E5LM 2CE7A 3M0EA 5KPZA 2M5ZA 3R9XB 4IBCA 5JI2E 2XFTA 3SBJA 1SXJB 2BNKA 2HCBA 5KO3A 3THGA 3HU3A 3DA1A 4DV4M 4NOOB 1K82A 2HHHM 1IXZA 4B7GA 4PDIA 1IY0A 1ZAEA 5ITXE 4NL4H 3J27B 5EXTA 3TQSA 1H6UA 1HR0M 4A3VB 5F3WA 1KSFX 3E4RA 4X64M 2F5SA 4LY6A 3KOZE 4B08A 1QYRA 3D8LA 3TPZA 4JI8M 3AOEC 1IN5A 3TWLA 1GL7A 3GP1A 4AKGA 2DWMA 3SHFA 5EJCA 2KRUA 5EP1A 4B3SM 3SARA 5EQTA 3L27A 2YR0A 3SC3A 3A46A 5E6JA 4I8OA 4DR3M 4LFBM 3FUUA 2YQZA 3FD9A 2XSZA 3PXGA 2D7HA 1E94E 1G8PA 2Y21A 2YNMD 1HQCA 4G4OA 3RGSA 2XZFA 3GO8A 4GHAA 4MH0E 4L8RC 5JI3E 4OU7A 2CV0A 1IXSB 1QAMA 1TH4A 3JR4A 4LRTA 4LJ5A 4ZPXA 1N34M 1DO2A 2Q2EB 4RF0A 3AFHA 4B3TM 3U6PA 3PVSA 3CF6E 2NQ8C 4KODA 4OX9M 4FCTA 4B7HA 4LJ8A 1FNNA 4HLQA 4IBDA 2R4EA 3DZDA 5FTJA 2OQ4A 1NNJA 3CF0A 2KXEA 2DWLA 4S12A 4K0KM 3KOYE 1I94M 3U60A 2Y0QA 2KA6B 2L7IA 2LXEA 5FTKA 1OFIA 1W5SA 2UXCM 4AKIA 4RF1A 2BJWA 1HNWM 3T1YM 5EP2A 4D81A 1MX0A 2DZNB 1KFVA 4B3MM 2UXBM 3GLHB 2DVWB 3VDUA 3U61B 3VK8A 3FTFA 1IM2A 3KDSE 1R2YA 1TH3A 1N32M 3QAUA 3KS4A 4IBGA 5BPVA 3FUVA 2DXIA 1XXHA 3EIEA 3UGJA 4M9ZA 4LF8M 3IG8A 1J7KA 3A98B 3GLGA 5IWAM 4LGMA 2G8LA 2UUAM 1N77A 1QQWA 2I7PA 4M9SA 1EE8A 3U6OA 1Z5CA 3HHXA 2Z4RA 4GITA 1JR3D 5FTMA 2CV1A 3SASA 4LCBA 2LH0A 3T38A 3H4MA 3K8ZA 1S3SA 4LZJA 4LF6M 3SMSA 3OTOM 1LV7A 1K3XA 3U6EA 4GKKM 4DR4M 3PNYA 3KW6A 3ILKA 1UM8A 4GH9A 2R4JA 3HWSA 2F4VM 1R7RA 1L1TA 4MGHA 1GVNA 3GPYA 4AI6A 4GRIA 2C5RA 2ZBKB 5DYIA 1L2DA 3SFZA 5A2QS 4FWDA 3VFDA 2ZM6M 2QZ4A 4LF7M 1E9SA 3GRYA 4IBKA 4OVZB 3U6CA 3TWKA 4M9XA 3SMPA 1E32A 3LVVA 4IIWA 1DGGA 3HJSA 5KQDA 1XMOM 3WHKA 1DGHB 2Z4SA 1L1ZA 4GKJM 4CISA 1ORYB 3FYDA 4IBJA 3I51A 2LWXA 2QENA 4B7FA 5EXSA 1SXJE 3U6LA 1FJGM 3VLFB 4DV6M 4JI0M 2CHGA 3MJ5A 3VDPA 2J7OA 3MHVC 1QZMA 1DGBA 1DGHA 4PT5A 3KOWE 1WXQA 3HJQA 4FCWA 2ZANA 1NHWC 7CATA 1PM5A 4JN6A 4LJ6A 1YE9A 4FVMA 2V1CA 3GRRA 3ZH9B 1NSFA 3PNVA 4EIWA 3CF2A 3UJNA 4JXJA 4LF4M 2KZSA 4NSRA 4QHSA 2K47A 4DR1M 4REZA 4D82A 1HT1E 2L09A 4YY3M 3W0LB 4JI6M 4OW0A 4L16A 3HHWA 4JYAM 4AKHA 1YSYA 3AJIB 3GRVA 4JI3M 4KLNA 1IQPA 2V6ZM 1R6BX 2A5YB 2FE8A 2XH9A 1OJLA 2DWNA 1NJFA 4QOZC 3GPPA 4WURA 4AZFA 3GLGB 3K1JA 3U6DA 3AOEA 1DO0A 5LMNM 3E9SA 4G6ZA 3FYCA 2R65A 3GPUA 1GLNA 3W0FA 1G3IA 3GQ3A 2FFJA 3KFUG 4KHPM 3ZC7B 2X8AA 1L2BA 2BJVA 4ITQA 4MGYE 8CATA 1HNXM 2CEAA 1E9RA 4TUWA 2Y20A 4L15A 1HT2E 2ZAOA 4LGYA 2UXDM 4HL4A 1ZQ9A 2C98A 2XZUA 4DV5M 1TGUA 1QAOA 3FKEA 5GKNA 3EIHA 4LF9M 3LQRA 3HHZA 2DHRA 2Y0TA 3GLFB 1W5TA 2M60A 1OFHA 4AW4A 1QVRA 4AQYM 1IY1A 3I4YA 3SHGB 3WHLA 4LJ4A 3KSXA 1MU5A 5E26A 3UMMA 4DV3M 2F5OA 2QBYA 4L78A 2C9CA 2HKJA 4LFAM 3J2PB 3VKGA 2FOIC 4PD2A 1NNUC 2EA0A 2C9OA 1XHBA 4LJ9A 1XC8A 4MM3B 3T1HM 4M0DA 2CHVA 1D2NA 2J7NA 2R46A 1IY2A 3SYLA 2XSZD 3KXEC 1IBKM 1Q3BA 4IBEA 4Z6YA 1N33M 2QP9X 4X62M 5H37D 4JI1M 4GC9A 3GLIA 1G41A 2HL7A 1L8QA 1QAQA 3M6AA 5KPTA 4JI7M 3VKHA 1VDDA 2KEBA 2XGNA 3L26A 3JAMS 3PFIA 3KP0E 3ZCBB 2F5NA 1DGFA 4FW9A 2QPAA 4DR6M 5C18A 4WW0A 4G4RA 3TL4X 2VQFM 5ITQA 2ZAMA 2C96A 4AG6A 4NSOB 2XLJA 3L2AA 1N78A 4CHTB 3KOXE 5DYGA 3AV0A 3SAUA 4NXMM 4MGIE 4M0WA 4KO8A 2CUZA 4MGKE 4GIPA 3M7GA 1IN6A 3GQ4A 3JR5A 3FUTA 3K2LA 3KVWA 4JI5M 4II7A 3K92A 3L29A 2P5TA 4QNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCB B;  3SHG B;  3ZC7 B; 
#chains in the Genus database with same CATH topology
 1NJG A;  4I4L A;  5FTL A;  4I81 A;  2OPF A;  4MGZ E;  3DFZ A;  1XWI A;  4MB7 A;  2G5G X;  3FTE A;  4BBA A;  2V1U A;  4NXN M;  3LQQ A;  2DZO B;  4LJA A;  3SAT A;  3TWM A;  5ITT A;  1Z5B A;  2D7E A;  4X65 M;  3KSJ A;  2UUC M;  2L7H A;  4DR7 M;  2JY5 A;  3GLG E;  2F5Q A;  1AUA A;  3SAW A;  3FUX A;  2F5P A;  2H1R A;  3IHP A;  5IT9 S;  1Q02 A;  2KRK A;  2AHM A;  2R18 A;  2UUB M;  1HQY E;  1YLA A;  1T3T A;  1IN4 A;  4KT0 F;  3I01 M;  1ZMV A;  2CHQ A;  2DAG A;  2XFS A;  3R8F A;  1TH2 A;  1PJI A;  2X4A A;  1NY5 A;  2RGO A;  5IRE B;  2CV2 A;  2EJS A;  3D8B A;  3GQ5 A;  1JR3 A;  1ZV1 A;  2Z7J A;  1IBM M;  1Z59 A;  1C1K A;  4DR5 M;  2EKK A;  1Z6T A;  5C1B A;  4FCV A;  2UU9 M;  2YFQ A;  4NRV A;  3H4J A;  4R71 A;  3J81 S;  2LVQ D;  1TDZ A;  4R7G A;  3U5Z B;  4XGI A;  1Q39 A;  2L4F A;  3T6P A;  3AOG A;  3B7Z A;  3ZQJ A;  3SYK A;  5EP4 A;  1V92 A;  3MK6 A;  2RGH A;  1XB2 B;  2VII A;  3A42 A;  2O25 A;  3FE3 A;  3QYB A;  1XXH B;  4Z8X A;  3AL0 C;  2L6O A;  4P17 A;  4IJF A;  2Z3X A;  2JP7 A;  2EO2 A;  3GRU A;  4DV2 M;  2D7G A;  3BXW A;  4LJ7 A;  1XNQ M;  1UFZ A;  4Y28 F;  1GAB A;  1X37 A;  3A45 A;  3J7B A;  3GLI B;  3U5Z A;  1J09 A;  2QHO B;  4DV0 M;  1P3Q Q;  3GLH A;  2R45 A;  4BB9 A;  5BR8 M;  4DUZ M;  3U61 A;  3UK6 A;  1IXR C;  2VF7 A;  4FD2 A;  4JI2 M;  1NHG C;  1GKI A;  1VG5 A;  2FNA A;  4JI4 M;  2DKL A;  3U60 B;  4GC5 A;  4FWG A;  2O5R A;  4DUY M;  1XNR M;  3E46 A;  4QHT A;  4QOS A;  4L4U A;  2EUC A;  2XEP A;  2KDL A;  4YHH M;  4G4N A;  4W5W A;  5EXX A;  2BWB A;  3NBI A;  3SAV A;  2LNH C;  4NC6 A;  3FTC A;  3KP1 E;  4NRW A;  3HU2 A;  1I4W A;  1PJS A;  4I5S A;  3I4V A;  3HGI A;  1TTE A;  2DZL A;  5IZ7 D;  3UZU A;  3NWL A;  3FRH A;  5ITR A;  3U6S A;  1PGY A;  1OAO C;  1TF0 B;  3TE6 A;  3NBX X;  1QDR A;  4IJE A;  4BLC A;  1XMQ M;  4FWH A;  4G4Q A;  4IBB A;  2X49 A;  1ZMW A;  1L2C A;  1GL6 A;  3AKZ A;  1N75 A;  2R0I A;  2ERC A;  1K3W A;  1OIP A;  1QDT A;  5ITX A;  1IN8 A;  1ZMU A;  2QCU A;  2KW0 A;  2W82 A;  3RGP A;  1SXJ D;  4DV7 M;  4LRS A;  1N34 M;  2APL A;  4AG5 A;  3QWL A;  2XF3 A;  2H5X A;  4DV1 M;  4R3D A;  1HJP A;  3J7A S;  4CJ6 A;  1QAN A;  3HHY A;  5ITY A;  1KYI A;  3Q8X A;  3BOS A;  1G4A E;  3J80 S;  5EXP A;  3GLF E;  2O01 F;  3DOA A;  2EKF A;  4P16 A;  4X66 M;  3B9P A;  1WIV A;  3RFW A;  1HNZ M;  1Z5A A;  2C99 A;  1PJJ A;  4RNA A;  1J5E M;  2CFO A;  1G59 A;  1IBL M;  1A5T A;  3LMM A;  3FUW A;  1SG9 A;  4XBO A;  5ITU A;  3GPX A;  3FTD A;  1N36 M;  2DWZ B;  1VEG A;  1IN7 A;  4D80 A;  3L28 A;  1SXJ A;  2FH0 A;  5KQ8 A;  1NY6 A;  4LF5 M;  4B3R M;  3U6Q A;  2MRO B;  3T15 A;  4PDG A;  4IBI A;  3LVW A;  3LW5 F;  4UN2 B;  2KHH A;  4PCZ A;  3VK7 A;  4JV5 M;  1SXJ C;  4OVZ A;  3F92 A;  2KZU A;  2DNA A;  5FTN A;  2DHY A;  3HKP A;  5DNY A;  1Q3C A;  5FLX S;  1YUB A;  1NV8 A;  4LG2 A;  1TDH A;  3HJ8 A;  3IG5 A;  1WGL A;  4GMQ A;  1WHC A;  4CGY B;  2KNV A;  1OQY A;  2R62 A;  3HU1 A;  2JXN A;  1NVM A;  3RE8 A;  4IBF A;  2RKO A;  1JQJ C;  2QBY B;  2LVA A;  3CTW B;  3FRI A;  5EP3 A;  5FSW A;  2VQE M;  1R2Z A;  4DR2 M;  2DAE A;  2LBC A;  4LFC M;  4LZZ A;  5KPR A;  3U6M A;  3KS8 A;  4F1I A;  2VDB B;  4QNR A;  3GLF A;  3IEC A;  2I7N A;  2JA2 A;  2R44 A;  3C58 A;  3L25 A;  5LMU M;  4GHL A;  2E5L M;  2CE7 A;  3M0E A;  5KPZ A;  2JWS A;  2M5Z A;  3R9X B;  4IBC A;  3V76 A;  2L2D A;  5JI2 E;  2XFT A;  3SBJ A;  1SXJ B;  2BNK A;  2HCB A;  5KO3 A;  3THG A;  3HU3 A;  3DA1 A;  4DV4 M;  4NOO B;  1K82 A;  2HHH M;  1IXZ A;  2ZTC A;  4B7G A;  4PDI A;  1IY0 A;  1ZAE A;  2JZ1 A;  5ITX E;  4NL4 H;  3J27 B;  5EXT A;  3TQS A;  1H6U A;  1HR0 M;  3B7N A;  1OAI A;  4A3V B;  5F3W A;  1KSF X;  3E4R A;  2N35 A;  4X64 M;  1WJ7 A;  2CRU A;  2F5S A;  4LY6 A;  3KOZ E;  4B08 A;  1QYR A;  3D8L A;  3TPZ A;  3GLI E;  4JI8 M;  3AOE C;  1R4G A;  1IN5 A;  3TWL A;  1CUK A;  1GL7 A;  2J5Y A;  3GP1 A;  2DWM A;  4AKG A;  3SHF A;  2FS1 A;  2KRU A;  5EJC A;  5EP1 A;  2DI0 A;  4B3S M;  2K9D A;  3SAR A;  5EQT A;  3L27 A;  2YR0 A;  4Q7J A;  3SC3 A;  3A46 A;  5E6J A;  4I8O A;  4DR3 M;  4LFB M;  3FUU A;  2YQZ A;  2K0B X;  3FD9 A;  2XSZ A;  3PXG A;  2D7H A;  2LHC A;  1E94 E;  1G8P A;  2Y21 A;  2YNM D;  1HQC A;  4G4O A;  2OO9 A;  3RGS A;  2XZF A;  2MR9 A;  3GO8 A;  3C9P A;  4MH0 E;  4L8R C;  5JI3 E;  4GHA A;  1VDL A;  4OU7 A;  2CV0 A;  1V33 A;  3E21 A;  3W67 A;  1IXS B;  1QAM A;  1TH4 A;  3JR4 A;  3GLH E;  4LJ5 A;  4LRT A;  4ZPX A;  1DO2 A;  1V34 A;  2Q2E B;  3AFH A;  2WSF F;  4RF0 A;  4B3T M;  3U6P A;  3PVS A;  3CF6 E;  2MJ5 B;  2NQ8 C;  4KOD A;  2WZJ A;  4FCT A;  4B7H A;  4OX9 M;  4LJ8 A;  1FNN A;  4HLQ A;  4IBD A;  1GJS A;  2R4E A;  3DZD A;  1WR1 B;  5FTJ A;  2OQ4 A;  1EIJ A;  1NNJ A;  3CF0 A;  2MGW A;  2KXE A;  2DWL A;  4S12 A;  4K0K M;  3KOY E;  2KNZ A;  1I94 M;  3U60 A;  2Y0Q A;  1RU3 A;  2KA6 B;  2L7I A;  2LXE A;  5FTK A;  1OFI A;  1W5S A;  2UXC M;  4AKI A;  4RF1 A;  2BJW A;  1HNW M;  3T1Y M;  5EP2 A;  1MJG M;  4D81 A;  1JR3 E;  1MX0 A;  2DZN B;  1KFV A;  4B3M M;  1G71 A;  3GLH B;  2DVW B;  2UXB M;  3VDU A;  3U61 B;  3QYE A;  1JB0 F;  3VK8 A;  3FTF A;  1IM2 A;  1GJT A;  4G3O A;  3KDS E;  1R2Y A;  1TH3 A;  1N32 M;  3QAU A;  3KS4 A;  4IBG A;  1Y8G A;  4HEO A;  5BPV A;  3FUV A;  3LCU A;  2DXI A;  1D0K A;  1XXH A;  3EIE A;  3UGJ A;  4M9Z A;  4LF8 M;  3IG8 A;  1J7K A;  3A98 B;  3GLG A;  5IWA M;  4LGM A;  2G8L A;  3MMP A;  2JNH A;  2UUA M;  1N77 A;  1QQW A;  2I7P A;  2LVO C;  1TR8 A;  1EE8 A;  2DAM A;  4M9S A;  3W68 A;  3U6O A;  1Z5C A;  3HHX A;  2JY8 A;  2Z4R A;  4GIT A;  1JR3 D;  5FTM A;  2CV1 A;  3SAS A;  2LHG A;  4LCB A;  2K6B A;  2LH0 A;  3T38 A;  3H4M A;  3K8Z A;  1S3S A;  4LZJ A;  4LF6 M;  3SMS A;  3OTO M;  1LV7 A;  1K3X A;  3U6E A;  4GKK M;  1D0M A;  2R6F A;  4DR4 M;  3PNY A;  3KW6 A;  1C7Y A;  3ILK A;  1UM8 A;  4GH9 A;  2R4J A;  1QUS A;  3HWS A;  2F4V M;  1R7R A;  1L1T A;  4MGH A;  1GVN A;  2DEN A;  3GPY A;  4AI6 A;  3B7Q A;  4GRI A;  2C5R A;  2ZBK B;  5DYI A;  1L2D A;  3SFZ A;  5A2Q S;  4FWD A;  3HZJ A;  3VFD A;  2ZM6 M;  2QZ4 A;  4LF7 M;  1E9S A;  1QZE A;  2HAK A;  3GRY A;  4IBK A;  1VEJ A;  4OVZ B;  3TWK A;  4M9X A;  3SMP A;  1E32 A;  3LVV A;  4IIW A;  3U6C A;  1DGG A;  3HJS A;  4XK8 F;  5KQD A;  1XMO M;  3WHK A;  1DGH B;  2Z4S A;  1L1Z A;  3Q8G A;  4GKJ M;  4CIS A;  1ORY B;  3FYD A;  4IBJ A;  3I51 A;  2LWX A;  2QEN A;  4B7F A;  5EXS A;  1SXJ E;  4F2L A;  3U6L A;  1FJG M;  3VLF B;  2Z8Y M;  4CIZ A;  4DV6 M;  4JI0 M;  2OOA A;  2CHG A;  2LVN C;  3MJ5 A;  3VDP A;  2J7O A;  1QUT A;  1DGB A;  1DGH A;  1QZM A;  1WGN A;  3MHV C;  4PT5 A;  3KOW E;  4RKU F;  2JY6 B;  1WXQ A;  3HJQ A;  4FCW A;  2LTU A;  1NHW C;  2ZAN A;  7CAT A;  1PM5 A;  2JUJ A;  1OIZ A;  2KNA A;  4JN6 A;  1EFU B;  4LJ6 A;  1OTR A;  3B74 A;  1YE9 A;  3GRR A;  2V1C A;  4FVM A;  3ZH9 B;  1NSF A;  3PNV A;  4EIW A;  3B89 A;  3CF2 A;  3UJN A;  1GO5 A;  4JXJ A;  4LF4 M;  1BVS A;  2KZS A;  4NSR A;  2WSC F;  4QHS A;  2K47 A;  2L4E A;  4DR1 M;  3LCV B;  4REZ A;  4D82 A;  1HT1 E;  2L09 A;  4YY3 M;  2CP8 A;  3W0L B;  4JI6 M;  4OW0 A;  1NO1 A;  4L16 A;  3HHW A;  2MH8 A;  4JYA M;  4AKH A;  1YSY A;  1T6O A;  3AJI B;  3GRV A;  4JI3 M;  4KLN A;  1IQP A;  2V6Z M;  3HX3 A;  1R6B X;  2A5Y B;  1LTM A;  2FE8 A;  1IFY A;  2XH9 A;  1OJL A;  2DWN A;  1NJF A;  1XXH E;  2GNO A;  4QOZ C;  3GPP A;  4ANR A;  4WUR A;  4AZF A;  3GLG B;  3K1J A;  3U6D A;  3AOE A;  1DO0 A;  1VQ1 A;  5LMN M;  3E9S A;  2B3T A;  4G6Z A;  4DBG B;  2QQ8 A;  3FYC A;  2R65 A;  3GPU A;  1GLN A;  3W0F A;  1G3I A;  3GQ3 A;  2FFJ A;  3KFU G;  4KHP M;  3ZC7 B;  2X8A A;  1L2B A;  2BJV A;  4L6V 6;  4ITQ A;  4MGY E;  8CAT A;  1HNX M;  2CEA A;  1E9R A;  3I04 M;  1AIP C;  2Y20 A;  4L15 A;  4TUW A;  1IXS A;  1HT2 E;  5L8R F;  2ZAO A;  4LGY A;  2UXD M;  4HL4 A;  1ZQ9 A;  2C98 A;  2QSF X;  2XZU A;  4DV5 M;  1R5L A;  1TGU A;  1D0L A;  1QAO A;  3FKE A;  5GKN A;  3EIH A;  4LF9 M;  3LQR A;  3HHZ A;  2DHR A;  2Y0T A;  3GLF B;  1W5T A;  5DFL A;  2M60 A;  1OFH A;  4AW4 A;  1QVR A;  4AQY M;  2ZTD A;  3K9O A;  1IY1 A;  3I4Y A;  3SHG B;  3WHL A;  3HY5 A;  4LJ4 A;  4WP2 A;  3KSX A;  1MU5 A;  5E26 A;  1OKS A;  3UMM A;  4DV3 M;  2F5O A;  2QBY A;  1MN3 A;  4L78 A;  2C9C A;  2HKJ A;  2WSE F;  2OOB A;  3J2P B;  1T43 A;  4LFA M;  3BBZ A;  3VKG A;  2FOI C;  4PD2 A;  2VF8 A;  1NNU C;  2EA0 A;  2C9O A;  1XHB A;  4LJ9 A;  2HWJ A;  1XC8 A;  4MM3 B;  3T1H M;  4M0D A;  2CHV A;  1D2N A;  2J7N A;  2R46 A;  2JY7 A;  1IY2 A;  2BWE A;  4GEW A;  3SYL A;  2XSZ D;  3KXE C;  1IBK M;  1Q3B A;  1DV0 A;  4IBE A;  2LVP C;  4Z6Y A;  1N33 M;  2QP9 X;  4X62 M;  2RRU A;  3C3E A;  2CWB A;  3C3D A;  5H37 D;  4JI1 M;  1PRB A;  4GC9 A;  1G41 A;  3GLI A;  2HL7 A;  1L8Q A;  1QAQ A;  1VEK A;  3M6A A;  5KPT A;  2JZ0 A;  4JI7 M;  3VKH A;  2QNJ A;  1VDD A;  2KEB A;  1PJT A;  2G3Q A;  2XGN A;  3JAM S;  2DAK A;  3L26 A;  3PFI A;  3KP0 E;  3ZCB B;  2F5N A;  1DGF A;  4FW9 A;  2QPA A;  4DR6 M;  5C18 A;  4WW0 A;  4G4R A;  3TL4 X;  2VQF M;  5ITQ A;  2ZAM A;  2C96 A;  4AG6 A;  3CGW A;  4NSO B;  1PJQ A;  2GQF A;  3K9P A;  2XLJ A;  3L2A A;  1N78 A;  1F4I A;  4CHT B;  2DAI A;  3KOX E;  5DYG A;  3AV0 A;  3SAU A;  4NXM M;  4MGI E;  4M0W A;  4KO8 A;  2CUZ A;  4MGK E;  4GIP A;  3M7G A;  1IN6 A;  3GQ4 A;  1NV9 A;  3JR5 A;  3FUT A;  3K2L A;  3KVW A;  4JI5 M;  4II7 A;  3K92 A;  3L29 A;  2P5T A;  4QNM A; 
#chains in the Genus database with same CATH homology
 1NJG A;  4I4L A;  5FTL A;  4I81 A;  2OPF A;  4MGZ E;  3DFZ A;  1XWI A;  4MB7 A;  2G5G X;  3FTE A;  4BBA A;  2V1U A;  4NXN M;  3LQQ A;  2DZO B;  4LJA A;  3SAT A;  3TWM A;  5ITT A;  1Z5B A;  2D7E A;  4X65 M;  3KSJ A;  2UUC M;  2L7H A;  4DR7 M;  2F5Q A;  3SAW A;  3FUX A;  2F5P A;  2H1R A;  5IT9 S;  2KRK A;  2AHM A;  2R18 A;  2UUB M;  1HQY E;  1T3T A;  1IN4 A;  2CHQ A;  2XFS A;  3R8F A;  1TH2 A;  1PJI A;  2X4A A;  1NY5 A;  2RGO A;  5IRE B;  2CV2 A;  3D8B A;  3GQ5 A;  1JR3 A;  2Z7J A;  1IBM M;  1Z59 A;  1C1K A;  4DR5 M;  1Z6T A;  5C1B A;  4FCV A;  2UU9 M;  2YFQ A;  4NRV A;  1TDZ A;  3J81 S;  4R7G A;  3U5Z B;  4XGI A;  1Q39 A;  3AOG A;  3SYK A;  5EP4 A;  3MK6 A;  2RGH A;  2VII A;  3A42 A;  4Z8X A;  3AL0 C;  1XXH B;  2L6O A;  4IJF A;  2Z3X A;  2EO2 A;  3GRU A;  4DV2 M;  2D7G A;  4LJ7 A;  1XNQ M;  1X37 A;  3A45 A;  3J7B A;  3GLI B;  3U5Z A;  1J09 A;  4DV0 M;  3GLH A;  4BB9 A;  2R45 A;  5BR8 M;  4DUZ M;  3U61 A;  3UK6 A;  1IXR C;  4FD2 A;  4JI2 M;  1NHG C;  1GKI A;  2FNA A;  4JI4 M;  3U60 B;  4GC5 A;  4FWG A;  2O5R A;  4DUY M;  1XNR M;  4QHT A;  4QOS A;  4L4U A;  2EUC A;  2XEP A;  4YHH M;  4G4N A;  4W5W A;  5EXX A;  3NBI A;  3SAV A;  2LNH C;  3FTC A;  3KP1 E;  4NRW A;  3HU2 A;  1I4W A;  4I5S A;  3I4V A;  3HGI A;  5IZ7 D;  3UZU A;  3NWL A;  5ITR A;  3U6S A;  3TE6 A;  4BLC A;  4IJE A;  1XMQ M;  4FWH A;  4G4Q A;  4IBB A;  2X49 A;  1L2C A;  1GL6 A;  3AKZ A;  1N75 A;  2ERC A;  1K3W A;  5ITX A;  1IN8 A;  2QCU A;  2KW0 A;  2W82 A;  3RGP A;  1SXJ D;  4DV7 M;  4LRS A;  4AG5 A;  3QWL A;  2XF3 A;  4DV1 M;  4R3D A;  3J7A S;  1QAN A;  3HHY A;  5ITY A;  1KYI A;  3Q8X A;  3BOS A;  1G4A E;  3J80 S;  5EXP A;  3DOA A;  4P16 A;  4X66 M;  3B9P A;  3RFW A;  1HNZ M;  1Z5A A;  2C99 A;  1PJJ A;  4RNA A;  1J5E M;  2CFO A;  1G59 A;  1IBL M;  3LMM A;  3FUW A;  4XBO A;  5ITU A;  3GPX A;  3FTD A;  1N36 M;  2DWZ B;  1IN7 A;  4D80 A;  3L28 A;  1SXJ A;  5KQ8 A;  1NY6 A;  4LF5 M;  4B3R M;  3U6Q A;  3T15 A;  4PDG A;  4IBI A;  3LVW A;  3VK7 A;  4PCZ A;  4JV5 M;  1SXJ C;  4OVZ A;  2KZU A;  5FTN A;  3HKP A;  5DNY A;  1Q3C A;  5FLX S;  1YUB A;  4LG2 A;  1TDH A;  3HJ8 A;  3IG5 A;  4GMQ A;  4CGY B;  2R62 A;  3HU1 A;  1NVM A;  3RE8 A;  4IBF A;  2RKO A;  1JQJ C;  2QBY B;  3CTW B;  5EP3 A;  5FSW A;  2VQE M;  1R2Z A;  4DR2 M;  4LFC M;  4LZZ A;  5KPR A;  3U6M A;  3KS8 A;  4QNR A;  3GLF A;  2I7N A;  2JA2 A;  3C58 A;  3L25 A;  5LMU M;  4GHL A;  2E5L M;  2CE7 A;  3M0E A;  5KPZ A;  2M5Z A;  3R9X B;  4IBC A;  5JI2 E;  2XFT A;  3SBJ A;  1SXJ B;  2BNK A;  2HCB A;  5KO3 A;  3THG A;  3HU3 A;  3DA1 A;  4DV4 M;  4NOO B;  1K82 A;  2HHH M;  1IXZ A;  4B7G A;  4PDI A;  1IY0 A;  1ZAE A;  5ITX E;  4NL4 H;  3J27 B;  5EXT A;  3TQS A;  1H6U A;  1HR0 M;  4A3V B;  5F3W A;  1KSF X;  3E4R A;  4X64 M;  2F5S A;  4LY6 A;  3KOZ E;  4B08 A;  1QYR A;  3D8L A;  3TPZ A;  4JI8 M;  3AOE C;  1IN5 A;  3TWL A;  1GL7 A;  3GP1 A;  4AKG A;  2DWM A;  3SHF A;  5EJC A;  2KRU A;  5EP1 A;  4B3S M;  3SAR A;  5EQT A;  3L27 A;  2YR0 A;  3SC3 A;  3A46 A;  5E6J A;  4I8O A;  4DR3 M;  4LFB M;  3FUU A;  2YQZ A;  3FD9 A;  2XSZ A;  3PXG A;  2D7H A;  1E94 E;  1G8P A;  2Y21 A;  2YNM D;  1HQC A;  4G4O A;  3RGS A;  2XZF A;  3GO8 A;  4GHA A;  4MH0 E;  4L8R C;  5JI3 E;  4OU7 A;  2CV0 A;  1IXS B;  1QAM A;  1TH4 A;  3JR4 A;  4LRT A;  4LJ5 A;  4ZPX A;  1N34 M;  1DO2 A;  2Q2E B;  4RF0 A;  3AFH A;  4B3T M;  3U6P A;  3PVS A;  3CF6 E;  2NQ8 C;  4KOD A;  4OX9 M;  4FCT A;  4B7H A;  4LJ8 A;  1FNN A;  4HLQ A;  4IBD A;  2R4E A;  3DZD A;  5FTJ A;  2OQ4 A;  1NNJ A;  3CF0 A;  2KXE A;  2DWL A;  4S12 A;  4K0K M;  3KOY E;  1I94 M;  3U60 A;  2Y0Q A;  2KA6 B;  2L7I A;  2LXE A;  5FTK A;  1OFI A;  1W5S A;  2UXC M;  4AKI A;  4RF1 A;  2BJW A;  1HNW M;  3T1Y M;  5EP2 A;  4D81 A;  1MX0 A;  2DZN B;  1KFV A;  4B3M M;  2UXB M;  3GLH B;  2DVW B;  3VDU A;  3U61 B;  3VK8 A;  3FTF A;  1IM2 A;  3KDS E;  1R2Y A;  1TH3 A;  1N32 M;  3QAU A;  3KS4 A;  4IBG A;  5BPV A;  3FUV A;  2DXI A;  1XXH A;  3EIE A;  3UGJ A;  4M9Z A;  4LF8 M;  3IG8 A;  1J7K A;  3A98 B;  3GLG A;  5IWA M;  4LGM A;  2G8L A;  2UUA M;  1N77 A;  1QQW A;  2I7P A;  4M9S A;  1EE8 A;  3U6O A;  1Z5C A;  3HHX A;  2Z4R A;  4GIT A;  1JR3 D;  5FTM A;  2CV1 A;  3SAS A;  4LCB A;  2LH0 A;  3T38 A;  3H4M A;  3K8Z A;  1S3S A;  4LZJ A;  4LF6 M;  3SMS A;  3OTO M;  1LV7 A;  1K3X A;  3U6E A;  4GKK M;  4DR4 M;  3PNY A;  3KW6 A;  3ILK A;  1UM8 A;  4GH9 A;  2R4J A;  3HWS A;  2F4V M;  1R7R A;  1L1T A;  4MGH A;  1GVN A;  3GPY A;  4AI6 A;  4GRI A;  2C5R A;  2ZBK B;  5DYI A;  1L2D A;  3SFZ A;  5A2Q S;  4FWD A;  3VFD A;  2ZM6 M;  2QZ4 A;  4LF7 M;  1E9S A;  3GRY A;  4IBK A;  4OVZ B;  3U6C A;  3TWK A;  4M9X A;  3SMP A;  1E32 A;  3LVV A;  4IIW A;  1DGG A;  3HJS A;  5KQD A;  1XMO M;  3WHK A;  1DGH B;  2Z4S A;  1L1Z A;  4GKJ M;  4CIS A;  1ORY B;  3FYD A;  4IBJ A;  3I51 A;  2LWX A;  2QEN A;  4B7F A;  5EXS A;  1SXJ E;  3U6L A;  1FJG M;  3VLF B;  4DV6 M;  4JI0 M;  2CHG A;  3MJ5 A;  3VDP A;  2J7O A;  3MHV C;  1QZM A;  1DGB A;  1DGH A;  4PT5 A;  3KOW E;  1WXQ A;  3HJQ A;  4FCW A;  2ZAN A;  1NHW C;  7CAT A;  1PM5 A;  4JN6 A;  4LJ6 A;  1YE9 A;  4FVM A;  2V1C A;  3GRR A;  3ZH9 B;  1NSF A;  3PNV A;  4EIW A;  3CF2 A;  3UJN A;  4JXJ A;  4LF4 M;  2KZS A;  4NSR A;  4QHS A;  2K47 A;  4DR1 M;  4REZ A;  4D82 A;  1HT1 E;  2L09 A;  4YY3 M;  3W0L B;  4JI6 M;  4OW0 A;  4L16 A;  3HHW A;  4JYA M;  4AKH A;  1YSY A;  3AJI B;  3GRV A;  4JI3 M;  4KLN A;  1IQP A;  2V6Z M;  1R6B X;  2A5Y B;  2FE8 A;  2XH9 A;  1OJL A;  2DWN A;  1NJF A;  4QOZ C;  3GPP A;  4WUR A;  4AZF A;  3GLG B;  3K1J A;  3U6D A;  3AOE A;  1DO0 A;  5LMN M;  3E9S A;  4G6Z A;  3FYC A;  2R65 A;  3GPU A;  1GLN A;  3W0F A;  1G3I A;  3GQ3 A;  2FFJ A;  3KFU G;  4KHP M;  3ZC7 B;  2X8A A;  1L2B A;  2BJV A;  4ITQ A;  4MGY E;  8CAT A;  1HNX M;  2CEA A;  1E9R A;  4TUW A;  2Y20 A;  4L15 A;  1HT2 E;  2ZAO A;  4LGY A;  2UXD M;  4HL4 A;  1ZQ9 A;  2C98 A;  2XZU A;  4DV5 M;  1TGU A;  1QAO A;  3FKE A;  5GKN A;  3EIH A;  4LF9 M;  3LQR A;  3HHZ A;  2DHR A;  2Y0T A;  3GLF B;  1W5T A;  2M60 A;  1OFH A;  4AW4 A;  1QVR A;  4AQY M;  1IY1 A;  3I4Y A;  3SHG B;  3WHL A;  4LJ4 A;  3KSX A;  1MU5 A;  5E26 A;  3UMM A;  4DV3 M;  2F5O A;  2QBY A;  4L78 A;  2C9C A;  2HKJ A;  4LFA M;  3J2P B;  3VKG A;  2FOI C;  4PD2 A;  1NNU C;  2EA0 A;  2C9O A;  1XHB A;  4LJ9 A;  1XC8 A;  4MM3 B;  3T1H M;  4M0D A;  2CHV A;  1D2N A;  2J7N A;  2R46 A;  1IY2 A;  3SYL A;  2XSZ D;  3KXE C;  1IBK M;  1Q3B A;  4IBE A;  4Z6Y A;  1N33 M;  2QP9 X;  4X62 M;  5H37 D;  4JI1 M;  4GC9 A;  3GLI A;  1G41 A;  2HL7 A;  1L8Q A;  1QAQ A;  3M6A A;  5KPT A;  4JI7 M;  3VKH A;  1VDD A;  2KEB A;  2XGN A;  3L26 A;  3JAM S;  3PFI A;  3KP0 E;  3ZCB B;  2F5N A;  1DGF A;  4FW9 A;  2QPA A;  4DR6 M;  5C18 A;  4WW0 A;  4G4R A;  3TL4 X;  2VQF M;  5ITQ A;  2ZAM A;  2C96 A;  4AG6 A;  4NSO B;  2XLJ A;  3L2A A;  1N78 A;  4CHT B;  3KOX E;  5DYG A;  3AV0 A;  3SAU A;  4NXM M;  4MGI E;  4M0W A;  4KO8 A;  2CUZ A;  4MGK E;  4GIP A;  3M7G A;  1IN6 A;  3GQ4 A;  3JR5 A;  3FUT A;  3K2L A;  3KVW A;  4JI5 M;  4II7 A;  3K92 A;  3L29 A;  2P5T A;  4QNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...