3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3SHGB 3ZCBB 3ZC7B
chains in the Genus database with same CATH superfamily
4XBOA 3GLHA 1TH4A 4LRSA 2CFOA 2LVNC 1KYIA 4OW0A 3KOZE 3KOYE 3JAMS 1XNQM 2EA0A 4KHPM 3J2PB 4DUYM 3KSJA 1DGGA 2WZJA 2UUCM 4GHAA 3TE6A 3SAVA 3HHYA 5EQTA 1G59A 2UU9M 3KFUG 1V92A 4JI0M 2CHQA 2XFSA 2DZLA 1QAQA 2DVWB 4PD2A 3LVWA 4IBBA 5FTNA 4LG2A 3L27A 2DAGA 2GQFA 3FUXA 4G4NA 2LHCA 2CWBA 3WHLA 3U6EA 1N78A 4PCZA 4CHTB 2XEPA 1L2BA 4LFBM 2Y0QA 4AZFA 2R0IA 3GPYA 1G41A 2HAKA 3E4RA 1NNJA 1LV7A 1VQ1A 3LW5F 3SMSA 3GPPA 3KSXA 3HU2A 2HWJA 3PFIA 1OFIA 2DWMA 3L2AA 1DGBA 1EFUB 2MGWA 3SASA 1GLNA 1TH2A 1PJTA 4KT0F 4MGHA 5FTKA 2KXEA 2ZTCA 3HU3A 3IECA 4HEOA 2QNJA 4OVZB 2L2DA 2KEBA 2Z8YM 1G3IA 2QCUA 2XSZA 2C96A 3FYCA 3KOWE 5JI3E 1GVNA 2KDLA 1OFHA 3W67A 4IBGA 4L4UA 3VKHA 1AUAA 2LVOC 3VFDA 8CATA 4LZZA 4DV1M 3D8LA 3T15A 4LCBA 4OVZA 2N35A 2L7IA 4IIWA 3JR4A 3Q8GA 5KPZA 1RU3A 3QYEA 4B3MM 4AKGA 2FNAA 2JZ1A 4G6ZA 1IFYA 2DAKA 2QENA 1Q39A 2MROB 3B9PA 3BXWA 3EIEA 4MM3B 4HL4A 4DV0M 1WGLA 2LWXA 1DGFA 4I8OA 2D7GA 4GRIA 3CF2A 4LJ4A 4AW4A 3W68A 2NQ8C 4B08A 3PVSA 1N32M 4MGKE 4NOOB 3K9OA 3TL4X 2R46A 1TF0B 3FYDA 1NJFA 3UMMA 2UUBM 1GJTA 3I4YA 1IQPA 2L4EA 4GIPA 2R62A 4QHTA 2DWLA 3SARA 1MU5A 1E94E 4DR4M 1PRBA 1Q02A 2I7PA 3QWLA 1QANA 3FD9A 7CATA 5ITYA 4B7FA 5L8RF 3MJ5A 1PJSA 2CEAA 2JA2A 5FSWA 2OO9A 4XGIA 3R8FA 1R5LA 3CF0A 1TR8A 2DENA 4X65M 3GLFE 4DBGB 2DZOB 2JY5A 2RGHA 1H6UA 2APLA 3TPZA 1LTMA 4MGZE 3IG8A 2Z3XA 1DV0A 2V6ZM 4GH9A 5IT9S 3L26A 5KPTA 1SXJB 4LGYA 3C3EA 2OOAA 4NRWA 2BWEA 1X37A 4L16A 4NSOB 4OX9M 1UM8A 4WP2A 5KPRA 3E9SA 4D80A 3VLFB 3LCVB 3GPUA 1J7KA 4KLNA 1JQJC 1SXJA 1Z5BA 4LF9M 5EXPA 5IZ7D 4B3RM 2WSCF 1R2ZA 2JWSA 4DV6M 4QNMA 3FUTA 4HLQA 1XWIA 2LBCA 4CGYB 2L09A 4YY3M 3WHKA 2BJWA 2KNVA 1YSYA 2DHYA 3FTDA 4MB7A 4DV3M 1AIPC 1J5EM 4AKIA 1SG9A 4FVMA 4CIZA 3DZDA 1QDRA 3A42A 3U6OA 1QUTA 2JUJA 1R7RA 2Y0TA 3AOGA 2EKFA 2ERCA 4G4QA 5KO3A 3M6AA 3K9PA 1QQWA 3J7AS 5F3WA 4FWHA 3U61B 1PGYA 4B7GA 5FTLA 3J27B 1JB0F 4OU7A 4R7GA 2DZNB 2RRUA 1OAOC 2RKOA 3BOSA 1HQCA 2DWNA 4REZA 3GLGE 1XMQM 1IBKM 1Z6TA 3LVVA 4CISA 3KVWA 2ZM6M 3MHVC 2X8AA 2L4FA 1IN7A 1OQYA 3U61A 4LJ9A 1D0LA 4W5WA 3RFWA 4DR3M 2KHHA 1L8QA 3TWKA 2Y21A 3LMMA 1FJGM 3NWLA 1XHBA 1QVRA 1KFVA 4DR1M 5IREB 2LVAA 2LXEA 4X64M 4JI4M 4FCWA 4JI6M 1EIJA 4MGYE 2MJ5B 2UXBM 2LTUA 3GLIE 5EP4A 2XFTA 3D8BA 3K2LA 3PNYA 5LMUM 2C9OA 3TQSA 3RE8A 3ZCBB 4M9ZA 1IXSB 4BBAA 4X62M 2YQZA 3E46A 3HX3A 2F5SA 4B3SM 1Z5CA 1EE8A 4MGIE 4DUZM 1ORYB 1L1TA 3GQ5A 4LF7M 3IG5A 2R4JA 2QHOB 4DV2M 1HT1E 3DA1A 4GC5A 3HHZA 3LQRA 2QP9X 1VDLA 4R71A 4LRTA 4IBEA 1IXSA 3B7QA 2CHGA 2WSFF 3FRHA 2HL7A 3T38A 5ITXE 3B74A 2CUZA 1ZMWA 1P3QQ 3GQ3A 1IBMM 1IN8A 1QYRA 2V1CA 5C1BA 1N75A 2O01F 3GRVA 1A5TA 1VEKA 2Z4SA 1XMOM 1TGUA 4IBJA 3AOEA 2XGNA 1XXHE 1NHGC 4JYAM 2YNMD 1JR3D 4IBIA 4LJ8A 3U6DA 4P17A 1D2NA 4LZJA 2XH9A 4RKUF 5JI2E 1VG5A 4JI1M 3I01M 4Q7JA 4QNRA 1QDTA 1K82A 1XNRM 2EO2A 2OQ4A 2M5ZA 3GLHE 4II7A 2C99A 1I94M 1IM2A 2K6BA 1ZV1A 2QPAA 3BBZA 2H1RA 4LJ5A 4NC6A 2G5GX 2XF3A 3DOAA 1N36M 3FRIA 1DO0A 3VK7A 3L25A 3RGPA 2JY6B 3MK6A 1L2DA 2ZBKB 1R2YA 4ANRA 3F92A 4LF6M 4FWGA 2R4EA 2LVQD 2L7HA 2FFJA 5IWAM 2F4VM 4IBFA 1N34M 2G3QA 2BWBA 2RGOA 1V33A 1IY2A 5EP2A 3IHPA 4RF1A 1K3WA 2CV1A 3A98B 4D82A 4JI8M 1VEGA 2DHRA 3SMPA 4F2LA 1NO1A 4PDGA 2KNAA 3FTCA 1Z5AA 1MN3A 4GKJM 2VQEM 1NHWC 2X4AA 4M9SA 4LY6A 2M60A 1WHCA 3NBXX 1E9SA 3U6QA 1Q3CA 4IBDA 4GKKM 3TWMA 1WIVA 2CV2A 2E5LM 4MH0E 1HNXM 2VQFM 2EKKA 3SBJA 3I4VA 4I4LA 1XB2B 1TDZA 2F5NA 3AL0C 2FS1A 3GO8A 2HCBA 1YLAA 3AFHA 4DR6M 1GL6A 1VDDA 4NSRA 4DR5M 4JI5M 3U6CA 4AG6A 2KW0A 2R44A 2EJSA 2V1UA 2XSZD 2R18A 1IN5A 1TH3A 4B7HA 2WSEF 4GITA 5ITQA 3HJQA 1F4IA 1KSFX 4QHSA 3HY5A 5BR8M 4AKHA 3U6SA 3ILKA 2R65A 1I4WA 2D7HA 2FE8A 1QAMA 4LF4M 1SXJC 3HJ8A 4AI6A 3I04M 3FTEA 4DV5M 1L2CA 4I81A 3SAUA 1NY6A 3HKPA 2JY8A 3KP0E 5FTMA 1VEJA 2K47A 3HHWA 2YFQA 2ZAOA 1PJJA 2FH0A 5A2QS 2J7OA 5LMNM 1Z59A 1IN4A 1DGHB 2DXIA 1GABA 2R45A 4K0KM 2G8LA 1E32A 2KZSA 1R4GA 3UGJA 3GRUA 3A46A 1PM5A 4IBCA 3T6PA 2W82A 4LFCM 1D0MA 1MJGM 3NBIA 2XLJA 3SHGB 2AHMA 2L6OA 2O25A 1TDHA 4R3DA 1DGHA 1PJQA 2BNKA 4FW9A 2JY7A 3M7GA 2UUAM 5ITXA 2YR0A 3TWLA 4JV5M 2VF7A 3GP1A 2LVPC 1IY1A 4L8RC 3CTWB 1G4AE 3GLHB 3HHXA 1R6BX 2ZTDA 4L78A 4LJ7A 5GKNA 4EIWA 5KQ8A 2GNOA 3FE3A 1SXJD 4M9XA 1WR1B 4IJEA 1C7YA 5ITTA 4GMQA 2A5YB 3E21A 1ZMVA 2JZ0A 3EIHA 3T1YM 1Q3BA 3KOXE 1HR0M 4ITQA 4Y28F 4G4OA 1V34A 5C18A 1ZMUA 3CF6E 4M0DA 3U60B 3AV0A 5DFLA 3HGIA 3R9XB 1C1KA 3GQ4A 1QZMA 2F5QA 1DO2A 1JR3E 4P16A 1HT2E 2Q2EB 4FCVA 4QOSA 2QQ8A 1TTEA 2Y20A 3U6MA 3U60A 4YHHM 3ZQJA 1T6OA 1QZEA 2VDBB 2DAEA 3CGWA 3L28A 4BB9A 4AQYM 3A45A 4RNAA 4KO8A 4FD2A 4NRVA 3GLFB 2C5RA 1T43A 3AOEC 4L15A 3KW6A 1GKIA 1W5SA 3T1HM 3UK6A 4S12A 5EP1A 2OPFA 2QZ4A 1GO5A 1BVSA 5DNYA 3V76A 2KZUA 3Q8XA 4GEWA 3GLFA 1XC8A 3SC3A 2MR9A 3HU1A 3U5ZB 3FUUA 3AJIB 2LNHC 2B3TA 3VKGA 4G4RA 2CP8A 2BJVA 3K1JA 4X66M 1OTRA 4LFAM 3KXEC 1G71A 2XZFA 3VDPA 3J7BA 2F5PA 4QOZC 3K92A 3J80S 5EP3A 2X49A 3SFZA 1GJSA 5EJCA 1UFZA 3QAUA 3U5ZA 4XK8F 2FOIC 3RGSA 2DKLA 1N33M 4DR2M 3PNVA 3W0LB 4LJAA 1QAOA 1WXQA 2R6FA 3UJNA 1WJ7A 3FTFA 1CUKA 1OAIA 1YUBA 3C3DA 3ZH9B 3C9PA 2DAMA 3MMPA 5ITUA 2DNAA 2KA6B 3HWSA 2CHVA 2I7NA 3SHFA 3AKZA 2J5YA 2JXNA 5FTJA 1NV9A 1WGNA 4WURA 4GC9A 2EUCA 3SYLA 5KQDA 3JR5A 4GHLA 3LQQA 4NXNM 5EXXA 2KRKA 4JI7M 1ZQ9A 1NV8A 4F1IA 1PJIA 4G3OA 1D0KA 1IN6A 4JI3M 4BLCA 1NJGA 3GLGB 1G8PA 1Y8GA 3B89A 4AG5A 2MH8A 3KS4A 1OJLA 3B7NA 1HQYE 2DAIA 4IJFA 3OTOM 3KDSE 3QYBA 1W5TA 3W0FA 4Z6YA 2XZUA 3SYKA 1L1ZA 2KRUA 2UXCM 2O5RA 4PDIA 3H4JA 3GLGA 3THGA 5H37D 4JN6A 1GL7A 3UZUA 1IBLM 4JI2M 1HNWM 3GLIB 1HJPA 3VK8A 2Z7JA 2CRUA 5EXSA 1OIPA 3B7ZA 2Z4RA 2CE7A 1J09A 2UXDM 2JP7A 2ZAMA 2QSFX 4KODA 2K9DA 4LF5M 3LCUA 1MX0A 2VF8A 5E26A 2C98A 1S3SA 4I5SA 3PXGA 4DR7M 3C58A 2VIIA 4D81A 3GLIA 2JNHA 2HHHM 2QBYB 2HKJA 4LJ6A 3KS8A 5DYIA 1YE9A 2DI0A 3I51A 5DYGA 3U6PA 2LHGA 4RF0A 3VDUA 1NY5A 3H4MA 1K3XA 4DV7M 3FKEA 3SAWA 3K8ZA 3DFZA 1QUSA 3L29A 1HNZM 3FUWA 2QBYA 3FUVA 4UN2B 1XXHB 1OKSA 2K0BX 1E9RA 3J81S 1N77A 4LF8M 2OOBA 4PT5A 1IY0A 2KNZA 4WW0A 1IXZA 5FLXS 2ZANA 5ITRA 5EXTA 2CV0A 4NXMM 1NNUC 4M0WA 1JR3A 3ZC7B 4TUWA 1NSFA 4FWDA 3M0EA 3GRRA 2LH0A 2H5XA 1XXHA 2J7NA 1OIZA 1SXJE 1ZAEA 2D7EA 4FCTA 4LGMA 2DWZB 1FNNA 4L6V6 2C9CA 4IBKA 1T3TA 4Z8XA 4A3VB 3KP1E 3SATA 2P5TA 3U6LA 4JXJA 3GRYA 3HJSA 5BPVA 1IXRC 4DV4M 5E6JA 4CJ6A 3HZJA 3GPXA 4B3TM 4ZPXA 2F5OA 1NVMA 4NL4H
chains in the Genus database with same CATH topology
4XBOA 3GLHA 1TH4A 4LRSA 2CFOA 3JAMS 1KYIA 4OW0A 3KOZE 3KOYE 1XNQM 2EA0A 4KHPM 3J2PB 4DUYM 3KSJA 1DGGA 2UUCM 4GHAA 3TE6A 3SAVA 3HHYA 5EQTA 1G59A 2UU9M 3KFUG 4JI0M 2CHQA 2XFSA 1QAQA 2DVWB 4PD2A 3LVWA 4IBBA 5FTNA 4LG2A 3L27A 3FUXA 4G4NA 3WHLA 3U6EA 1N78A 4PCZA 4CHTB 2XEPA 1L2BA 4LFBM 2Y0QA 4AZFA 3GPYA 1G41A 3E4RA 1NNJA 1LV7A 3SMSA 3GPPA 3KSXA 3HU2A 3PFIA 1OFIA 2DWMA 3L2AA 1DGBA 3SASA 1GLNA 1TH2A 4MGHA 5FTKA 2KXEA 3HU3A 4OVZB 2KEBA 1G3IA 2QCUA 3KOWE 2C96A 3FYCA 2XSZA 5JI3E 1GVNA 1OFHA 4IBGA 4L4UA 3VKHA 3VFDA 8CATA 4DV1M 4LZZA 3D8LA 3T15A 4LCBA 4OVZA 2L7IA 4IIWA 3JR4A 4AKGA 5KPZA 4B3MM 2FNAA 4G6ZA 2QENA 1Q39A 3B9PA 3EIEA 4MM3B 4HL4A 4DV0M 2LWXA 1DGFA 4I8OA 2D7GA 4GRIA 3CF2A 4LJ4A 4AW4A 1N32M 2NQ8C 4B08A 3PVSA 4MGKE 4NOOB 3TL4X 2R46A 3FYDA 1NJFA 3UMMA 2UUBM 3I4YA 1IQPA 4GIPA 4QHTA 2R62A 2DWLA 3SARA 1MU5A 1E94E 4DR4M 2I7PA 7CATA 3QWLA 1QANA 3FD9A 5ITYA 4B7FA 3MJ5A 2CEAA 2JA2A 5FSWA 3R8FA 4XGIA 3CF0A 4X65M 2DZOB 2RGHA 1H6UA 3TPZA 4MGZE 3IG8A 2Z3XA 2V6ZM 4GH9A 5IT9S 3L26A 5KPTA 1SXJB 4LGYA 4NRWA 1X37A 4L16A 4NSOB 4OX9M 1UM8A 5KPRA 3E9SA 4D80A 3VLFB 3GPUA 1J7KA 4KLNA 1JQJC 1SXJA 1Z5BA 4LF9M 5EXPA 5IZ7D 4B3RM 1R2ZA 4DV6M 4QNMA 3FUTA 4HLQA 1XWIA 4YY3M 4CGYB 2L09A 3WHKA 2BJWA 3FTDA 1YSYA 4MB7A 4DV3M 1J5EM 4AKIA 4FVMA 3DZDA 3U6OA 3A42A 3AOGA 1R7RA 2Y0TA 2ERCA 4G4QA 5KO3A 3M6AA 1QQWA 3J7AS 5F3WA 4FWHA 3U61B 4B7GA 5FTLA 3J27B 4OU7A 4R7GA 2DZNB 2RKOA 3BOSA 1HQCA 2DWNA 4REZA 1XMQM 1IBKM 4CISA 1Z6TA 3LVVA 3KVWA 2ZM6M 3MHVC 2X8AA 1IN7A 3U61A 4LJ9A 4W5WA 3RFWA 4DR3M 3TWKA 1L8QA 1FJGM 2Y21A 3LMMA 3NWLA 1XHBA 1QVRA 1KFVA 4DR1M 5IREB 4X64M 2LXEA 4JI4M 4FCWA 4JI6M 4MGYE 2UXBM 5EP4A 2XFTA 3D8BA 3K2LA 3PNYA 5LMUM 2C9OA 3TQSA 3RE8A 3ZCBB 4M9ZA 1IXSB 4BBAA 4X62M 2YQZA 4B3SM 2F5SA 1Z5CA 1EE8A 4MGIE 4DUZM 1ORYB 1L1TA 3GQ5A 4LF7M 3IG5A 2R4JA 4DV2M 1HT1E 3DA1A 4GC5A 3HHZA 3LQRA 2QP9X 4LRTA 4IBEA 2CHGA 3T38A 2HL7A 5ITXE 2CUZA 3GQ3A 1IBMM 1IN8A 1QYRA 2V1CA 5C1BA 1N75A 3GRVA 2Z4SA 1XMOM 1TGUA 4IBJA 3AOEA 2XGNA 1NHGC 4JYAM 2YNMD 1JR3D 4IBIA 4LJ8A 3U6DA 1D2NA 4LZJA 2XH9A 5JI2E 4JI1M 4QNRA 1K82A 1XNRM 2EO2A 2OQ4A 2M5ZA 4II7A 2C99A 1I94M 1IM2A 2QPAA 2H1RA 4LJ5A 2G5GX 2XF3A 3DOAA 1N36M 1DO0A 3VK7A 3L25A 3RGPA 3MK6A 1L2DA 2ZBKB 1R2YA 4LF6M 4FWGA 2R4EA 2L7HA 2FFJA 5IWAM 2F4VM 4IBFA 1N34M 2RGOA 1IY2A 5EP2A 4RF1A 1K3WA 2CV1A 3A98B 4D82A 4JI8M 2DHRA 3SMPA 4PDGA 3FTCA 1Z5AA 4GKJM 2VQEM 1NHWC 2X4AA 4M9SA 4LY6A 2M60A 1E9SA 3U6QA 1Q3CA 4IBDA 4GKKM 3TWMA 2CV2A 2E5LM 4MH0E 1HNXM 2VQFM 3SBJA 3I4VA 4I4LA 1TDZA 2F5NA 3AL0C 3GO8A 2HCBA 3AFHA 4DR6M 1GL6A 1VDDA 4NSRA 4DR5M 4JI5M 3U6CA 4AG6A 2KW0A 2V1UA 2XSZD 2R18A 1IN5A 1TH3A 4B7HA 4GITA 5ITQA 3HJQA 1KSFX 4QHSA 5BR8M 4AKHA 3U6SA 3ILKA 2R65A 1I4WA 2D7HA 2FE8A 1QAMA 4LF4M 1SXJC 3HJ8A 4AI6A 3FTEA 4DV5M 1L2CA 4I81A 3SAUA 1NY6A 3HKPA 3KP0E 5FTMA 2K47A 3HHWA 2YFQA 2ZAOA 1PJJA 5A2QS 2J7OA 5LMNM 1Z59A 1IN4A 1DGHB 2DXIA 2R45A 4K0KM 2G8LA 1E32A 2KZSA 3UGJA 3A46A 3GRUA 1PM5A 4IBCA 2W82A 4LFCM 3NBIA 2XLJA 3SHGB 2AHMA 2L6OA 1TDHA 4R3DA 1DGHA 2BNKA 4FW9A 3M7GA 2UUAM 5ITXA 2YR0A 3TWLA 4JV5M 3GP1A 1IY1A 4L8RC 3CTWB 1G4AE 3GLHB 3HHXA 1R6BX 4L78A 4LJ7A 5GKNA 4EIWA 5KQ8A 1SXJD 4M9XA 4IJEA 5ITTA 4GMQA 2A5YB 3EIHA 3T1YM 1Q3BA 3KOXE 1HR0M 4ITQA 4G4OA 5C18A 3CF6E 4M0DA 3U60B 3AV0A 3HGIA 3R9XB 1C1KA 3GQ4A 1QZMA 2F5QA 1DO2A 4P16A 1HT2E 2Q2EB 4FCVA 4QOSA 3U6MA 2Y20A 3U60A 4YHHM 3L28A 4BB9A 4AQYM 3A45A 4RNAA 4KO8A 4FD2A 4NRVA 3GLFB 2C5RA 3AOEC 4L15A 3KW6A 1GKIA 1W5SA 3T1HM 3UK6A 4S12A 5EP1A 2OPFA 2QZ4A 5DNYA 2KZUA 3Q8XA 3GLFA 1XC8A 3SC3A 3VKGA 3HU1A 3U5ZB 3FUUA 3AJIB 2LNHC 4G4RA 2BJVA 3K1JA 4X66M 4LFAM 3KXEC 2XZFA 3VDPA 3J7BA 2F5PA 4QOZC 3K92A 3J80S 5EP3A 2X49A 3SFZA 5EJCA 3QAUA 3U5ZA 2FOIC 3RGSA 1N33M 4DR2M 3PNVA 3W0LB 4LJAA 1QAOA 1WXQA 3UJNA 3FTFA 1YUBA 3ZH9B 5ITUA 2KA6B 3HWSA 2CHVA 2I7NA 3SHFA 3AKZA 5FTJA 5KQDA 4WURA 4GC9A 2EUCA 3SYLA 3JR5A 4GHLA 3LQQA 4NXNM 5EXXA 2KRKA 4JI7M 1ZQ9A 1PJIA 1IN6A 4JI3M 4BLCA 1NJGA 3GLGB 1G8PA 4AG5A 3KS4A 1OJLA 1HQYE 4IJFA 3OTOM 3KDSE 1W5TA 3W0FA 4Z6YA 2XZUA 3SYKA 1L1ZA 2KRUA 2UXCM 2O5RA 4PDIA 3GLGA 3THGA 5H37D 4JN6A 1GL7A 3UZUA 1IBLM 4JI2M 1HNWM 3GLIB 3VK8A 2Z7JA 5EXSA 2Z4RA 2CE7A 1J09A 2UXDM 2ZAMA 4KODA 4LF5M 1MX0A 5E26A 2C98A 1S3SA 4I5SA 3PXGA 4DR7M 3C58A 2VIIA 4D81A 3GLIA 2HHHM 2QBYB 2HKJA 4LJ6A 3KS8A 5DYIA 1YE9A 3I51A 5DYGA 3U6PA 4RF0A 3VDUA 1NY5A 3H4MA 1K3XA 4DV7M 3FKEA 3SAWA 3K8ZA 3DFZA 3L29A 1HNZM 3FUWA 2QBYA 3FUVA 1XXHB 3J81S 1E9RA 1N77A 4LF8M 4PT5A 1IY0A 4WW0A 1IXZA 5FLXS 2ZANA 5ITRA 5EXTA 2CV0A 4NXMM 1NNUC 4M0WA 1JR3A 3ZC7B 4TUWA 1NSFA 4FWDA 3M0EA 3GRRA 2LH0A 1XXHA 2J7NA 1SXJE 1ZAEA 2D7EA 4FCTA 4LGMA 2DWZB 1FNNA 2C9CA 4IBKA 1T3TA 4Z8XA 4A3VB 3KP1E 3SATA 2P5TA 3U6LA 4JXJA 3GRYA 3HJSA 5BPVA 1IXRC 4DV4M 5E6JA 3GPXA 4B3TM 4ZPXA 2F5OA 1NVMA 4NL4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZCB B;  3ZC7 B; 
#chains in the Genus database with same CATH topology
 4XBO A;  3GLH A;  1TH4 A;  4LRS A;  2CFO A;  2LVN C;  1KYI A;  4OW0 A;  3KOZ E;  3KOY E;  3JAM S;  1XNQ M;  2EA0 A;  4KHP M;  3J2P B;  4DUY M;  3KSJ A;  1DGG A;  2WZJ A;  2UUC M;  4GHA A;  3TE6 A;  3SAV A;  3HHY A;  5EQT A;  1G59 A;  2UU9 M;  3KFU G;  1V92 A;  4JI0 M;  2CHQ A;  2XFS A;  2DZL A;  1QAQ A;  2DVW B;  4PD2 A;  3LVW A;  4IBB A;  5FTN A;  4LG2 A;  3L27 A;  2DAG A;  2GQF A;  3FUX A;  4G4N A;  2LHC A;  2CWB A;  3WHL A;  3U6E A;  1N78 A;  4PCZ A;  4CHT B;  2XEP A;  1L2B A;  4LFB M;  2Y0Q A;  4AZF A;  2R0I A;  3GPY A;  1G41 A;  2HAK A;  3E4R A;  1NNJ A;  1LV7 A;  1VQ1 A;  3LW5 F;  3SMS A;  3GPP A;  3KSX A;  3HU2 A;  2HWJ A;  3PFI A;  1OFI A;  2DWM A;  3L2A A;  1DGB A;  1EFU B;  2MGW A;  3SAS A;  1GLN A;  1TH2 A;  1PJT A;  4KT0 F;  4MGH A;  5FTK A;  2KXE A;  2ZTC A;  3HU3 A;  3IEC A;  4HEO A;  2QNJ A;  4OVZ B;  2L2D A;  2KEB A;  2Z8Y M;  1G3I A;  2QCU A;  2XSZ A;  2C96 A;  3FYC A;  3KOW E;  5JI3 E;  1GVN A;  2KDL A;  1OFH A;  3W67 A;  4IBG A;  4L4U A;  3VKH A;  1AUA A;  2LVO C;  3VFD A;  8CAT A;  4LZZ A;  4DV1 M;  3D8L A;  3T15 A;  4LCB A;  4OVZ A;  2N35 A;  2L7I A;  4IIW A;  3JR4 A;  3Q8G A;  5KPZ A;  1RU3 A;  3QYE A;  4B3M M;  4AKG A;  2FNA A;  2JZ1 A;  4G6Z A;  1IFY A;  2DAK A;  2QEN A;  1Q39 A;  2MRO B;  3B9P A;  3BXW A;  3EIE A;  4MM3 B;  4HL4 A;  4DV0 M;  1WGL A;  2LWX A;  1DGF A;  4I8O A;  2D7G A;  4GRI A;  3CF2 A;  4LJ4 A;  4AW4 A;  3W68 A;  2NQ8 C;  4B08 A;  3PVS A;  1N32 M;  4MGK E;  4NOO B;  3K9O A;  3TL4 X;  2R46 A;  1TF0 B;  3FYD A;  1NJF A;  3UMM A;  2UUB M;  1GJT A;  3I4Y A;  1IQP A;  2L4E A;  4GIP A;  2R62 A;  4QHT A;  2DWL A;  3SAR A;  1MU5 A;  1E94 E;  4DR4 M;  1PRB A;  1Q02 A;  2I7P A;  3QWL A;  1QAN A;  3FD9 A;  7CAT A;  5ITY A;  4B7F A;  5L8R F;  3MJ5 A;  1PJS A;  2CEA A;  2JA2 A;  5FSW A;  2OO9 A;  4XGI A;  3R8F A;  1R5L A;  3CF0 A;  1TR8 A;  2DEN A;  4X65 M;  3GLF E;  4DBG B;  2DZO B;  2JY5 A;  2RGH A;  1H6U A;  2APL A;  3TPZ A;  1LTM A;  4MGZ E;  3IG8 A;  2Z3X A;  1DV0 A;  2V6Z M;  4GH9 A;  5IT9 S;  3L26 A;  5KPT A;  1SXJ B;  4LGY A;  3C3E A;  2OOA A;  4NRW A;  2BWE A;  1X37 A;  4L16 A;  4NSO B;  4OX9 M;  1UM8 A;  4WP2 A;  5KPR A;  3E9S A;  4D80 A;  3VLF B;  3LCV B;  3GPU A;  1J7K A;  4KLN A;  1JQJ C;  1SXJ A;  1Z5B A;  4LF9 M;  5EXP A;  5IZ7 D;  4B3R M;  2WSC F;  1R2Z A;  2JWS A;  4DV6 M;  4QNM A;  3FUT A;  4HLQ A;  1XWI A;  2LBC A;  4CGY B;  2L09 A;  4YY3 M;  3WHK A;  2BJW A;  2KNV A;  1YSY A;  2DHY A;  3FTD A;  4MB7 A;  4DV3 M;  1AIP C;  1J5E M;  4AKI A;  1SG9 A;  4FVM A;  4CIZ A;  3DZD A;  1QDR A;  3A42 A;  3U6O A;  1QUT A;  2JUJ A;  1R7R A;  2Y0T A;  3AOG A;  2EKF A;  2ERC A;  4G4Q A;  5KO3 A;  3M6A A;  3K9P A;  1QQW A;  3J7A S;  5F3W A;  4FWH A;  3U61 B;  1PGY A;  4B7G A;  5FTL A;  3J27 B;  1JB0 F;  4OU7 A;  4R7G A;  2DZN B;  2RRU A;  1OAO C;  2RKO A;  3BOS A;  1HQC A;  2DWN A;  4REZ A;  3GLG E;  1XMQ M;  1IBK M;  1Z6T A;  3LVV A;  4CIS A;  3KVW A;  2ZM6 M;  3MHV C;  2X8A A;  2L4F A;  1IN7 A;  1OQY A;  3U61 A;  4LJ9 A;  1D0L A;  4W5W A;  3RFW A;  4DR3 M;  2KHH A;  1L8Q A;  3TWK A;  2Y21 A;  3LMM A;  1FJG M;  3NWL A;  1XHB A;  1QVR A;  1KFV A;  4DR1 M;  5IRE B;  2LVA A;  2LXE A;  4X64 M;  4JI4 M;  4FCW A;  4JI6 M;  1EIJ A;  4MGY E;  2MJ5 B;  2UXB M;  2LTU A;  3GLI E;  5EP4 A;  2XFT A;  3D8B A;  3K2L A;  3PNY A;  5LMU M;  2C9O A;  3TQS A;  3RE8 A;  3ZCB B;  4M9Z A;  1IXS B;  4BBA A;  4X62 M;  2YQZ A;  3E46 A;  3HX3 A;  2F5S A;  4B3S M;  1Z5C A;  1EE8 A;  4MGI E;  4DUZ M;  1ORY B;  1L1T A;  3GQ5 A;  4LF7 M;  3IG5 A;  2R4J A;  2QHO B;  4DV2 M;  1HT1 E;  3DA1 A;  4GC5 A;  3HHZ A;  3LQR A;  2QP9 X;  1VDL A;  4R71 A;  4LRT A;  4IBE A;  1IXS A;  3B7Q A;  2CHG A;  2WSF F;  3FRH A;  2HL7 A;  3T38 A;  5ITX E;  3B74 A;  2CUZ A;  1ZMW A;  1P3Q Q;  3GQ3 A;  1IBM M;  1IN8 A;  1QYR A;  2V1C A;  5C1B A;  1N75 A;  2O01 F;  3GRV A;  1A5T A;  1VEK A;  2Z4S A;  1XMO M;  1TGU A;  4IBJ A;  3AOE A;  2XGN A;  1XXH E;  1NHG C;  4JYA M;  2YNM D;  1JR3 D;  4IBI A;  4LJ8 A;  3U6D A;  4P17 A;  1D2N A;  4LZJ A;  2XH9 A;  4RKU F;  5JI2 E;  1VG5 A;  4JI1 M;  3I01 M;  4Q7J A;  4QNR A;  1QDT A;  1K82 A;  1XNR M;  2EO2 A;  2OQ4 A;  2M5Z A;  3GLH E;  4II7 A;  2C99 A;  1I94 M;  1IM2 A;  2K6B A;  1ZV1 A;  2QPA A;  3BBZ A;  2H1R A;  4LJ5 A;  4NC6 A;  2G5G X;  2XF3 A;  3DOA A;  1N36 M;  3FRI A;  1DO0 A;  3VK7 A;  3L25 A;  3RGP A;  2JY6 B;  3MK6 A;  1L2D A;  2ZBK B;  1R2Y A;  4ANR A;  3F92 A;  4LF6 M;  4FWG A;  2R4E A;  2LVQ D;  2L7H A;  2FFJ A;  5IWA M;  2F4V M;  4IBF A;  1N34 M;  2G3Q A;  2BWB A;  2RGO A;  1V33 A;  1IY2 A;  5EP2 A;  3IHP A;  4RF1 A;  1K3W A;  2CV1 A;  3A98 B;  4D82 A;  4JI8 M;  1VEG A;  2DHR A;  3SMP A;  4F2L A;  1NO1 A;  4PDG A;  2KNA A;  3FTC A;  1Z5A A;  1MN3 A;  4GKJ M;  2VQE M;  1NHW C;  2X4A A;  4M9S A;  4LY6 A;  2M60 A;  1WHC A;  3NBX X;  1E9S A;  3U6Q A;  1Q3C A;  4IBD A;  4GKK M;  3TWM A;  1WIV A;  2CV2 A;  2E5L M;  4MH0 E;  1HNX M;  2VQF M;  2EKK A;  3SBJ A;  3I4V A;  4I4L A;  1XB2 B;  1TDZ A;  2F5N A;  3AL0 C;  2FS1 A;  3GO8 A;  2HCB A;  1YLA A;  3AFH A;  4DR6 M;  1GL6 A;  1VDD A;  4NSR A;  4DR5 M;  4JI5 M;  3U6C A;  4AG6 A;  2KW0 A;  2R44 A;  2EJS A;  2V1U A;  2XSZ D;  2R18 A;  1IN5 A;  1TH3 A;  4B7H A;  2WSE F;  4GIT A;  5ITQ A;  3HJQ A;  1F4I A;  1KSF X;  4QHS A;  3HY5 A;  5BR8 M;  4AKH A;  3U6S A;  3ILK A;  2R65 A;  1I4W A;  2D7H A;  2FE8 A;  1QAM A;  4LF4 M;  1SXJ C;  3HJ8 A;  4AI6 A;  3I04 M;  3FTE A;  4DV5 M;  1L2C A;  4I81 A;  3SAU A;  1NY6 A;  3HKP A;  2JY8 A;  3KP0 E;  5FTM A;  1VEJ A;  2K47 A;  3HHW A;  2YFQ A;  2ZAO A;  1PJJ A;  2FH0 A;  5A2Q S;  2J7O A;  5LMN M;  1Z59 A;  1IN4 A;  1DGH B;  2DXI A;  1GAB A;  2R45 A;  4K0K M;  2G8L A;  1E32 A;  2KZS A;  1R4G A;  3UGJ A;  3GRU A;  3A46 A;  1PM5 A;  4IBC A;  3T6P A;  2W82 A;  4LFC M;  1D0M A;  1MJG M;  3NBI A;  2XLJ A;  3SHG B;  2AHM A;  2L6O A;  2O25 A;  1TDH A;  4R3D A;  1DGH A;  1PJQ A;  2BNK A;  4FW9 A;  2JY7 A;  3M7G A;  2UUA M;  5ITX A;  2YR0 A;  3TWL A;  4JV5 M;  2VF7 A;  3GP1 A;  2LVP C;  1IY1 A;  4L8R C;  3CTW B;  1G4A E;  3GLH B;  3HHX A;  1R6B X;  2ZTD A;  4L78 A;  4LJ7 A;  5GKN A;  4EIW A;  5KQ8 A;  2GNO A;  3FE3 A;  1SXJ D;  4M9X A;  1WR1 B;  4IJE A;  1C7Y A;  5ITT A;  4GMQ A;  2A5Y B;  3E21 A;  1ZMV A;  2JZ0 A;  3EIH A;  3T1Y M;  1Q3B A;  3KOX E;  1HR0 M;  4ITQ A;  4Y28 F;  4G4O A;  1V34 A;  5C18 A;  1ZMU A;  3CF6 E;  4M0D A;  3U60 B;  3AV0 A;  5DFL A;  3HGI A;  3R9X B;  1C1K A;  3GQ4 A;  1QZM A;  2F5Q A;  1DO2 A;  1JR3 E;  4P16 A;  1HT2 E;  2Q2E B;  4FCV A;  4QOS A;  2QQ8 A;  1TTE A;  2Y20 A;  3U6M A;  3U60 A;  4YHH M;  3ZQJ A;  1T6O A;  1QZE A;  2VDB B;  2DAE A;  3CGW A;  3L28 A;  4BB9 A;  4AQY M;  3A45 A;  4RNA A;  4KO8 A;  4FD2 A;  4NRV A;  3GLF B;  2C5R A;  1T43 A;  3AOE C;  4L15 A;  3KW6 A;  1GKI A;  1W5S A;  3T1H M;  3UK6 A;  4S12 A;  5EP1 A;  2OPF A;  2QZ4 A;  1GO5 A;  1BVS A;  5DNY A;  3V76 A;  2KZU A;  3Q8X A;  4GEW A;  3GLF A;  1XC8 A;  3SC3 A;  2MR9 A;  3HU1 A;  3U5Z B;  3FUU A;  3AJI B;  2LNH C;  2B3T A;  3VKG A;  4G4R A;  2CP8 A;  2BJV A;  3K1J A;  4X66 M;  1OTR A;  4LFA M;  3KXE C;  1G71 A;  2XZF A;  3VDP A;  3J7B A;  2F5P A;  4QOZ C;  3K92 A;  3J80 S;  5EP3 A;  2X49 A;  3SFZ A;  1GJS A;  5EJC A;  1UFZ A;  3QAU A;  3U5Z A;  4XK8 F;  2FOI C;  3RGS A;  2DKL A;  1N33 M;  4DR2 M;  3PNV A;  3W0L B;  4LJA A;  1QAO A;  1WXQ A;  2R6F A;  3UJN A;  1WJ7 A;  3FTF A;  1CUK A;  1OAI A;  1YUB A;  3C3D A;  3ZH9 B;  3C9P A;  2DAM A;  3MMP A;  5ITU A;  2DNA A;  2KA6 B;  3HWS A;  2CHV A;  2I7N A;  3SHF A;  3AKZ A;  2J5Y A;  2JXN A;  5FTJ A;  1NV9 A;  1WGN A;  4WUR A;  4GC9 A;  2EUC A;  3SYL A;  5KQD A;  3JR5 A;  4GHL A;  3LQQ A;  4NXN M;  5EXX A;  2KRK A;  4JI7 M;  1ZQ9 A;  1NV8 A;  4F1I A;  1PJI A;  4G3O A;  1D0K A;  1IN6 A;  4JI3 M;  4BLC A;  1NJG A;  3GLG B;  1G8P A;  1Y8G A;  3B89 A;  4AG5 A;  2MH8 A;  3KS4 A;  1OJL A;  3B7N A;  1HQY E;  2DAI A;  4IJF A;  3OTO M;  3KDS E;  3QYB A;  1W5T A;  3W0F A;  4Z6Y A;  2XZU A;  3SYK A;  1L1Z A;  2KRU A;  2UXC M;  2O5R A;  4PDI A;  3H4J A;  3GLG A;  3THG A;  5H37 D;  4JN6 A;  1GL7 A;  3UZU A;  1IBL M;  4JI2 M;  1HNW M;  3GLI B;  1HJP A;  3VK8 A;  2Z7J A;  2CRU A;  5EXS A;  1OIP A;  3B7Z A;  2Z4R A;  2CE7 A;  1J09 A;  2UXD M;  2JP7 A;  2ZAM A;  2QSF X;  4KOD A;  2K9D A;  4LF5 M;  3LCU A;  1MX0 A;  2VF8 A;  5E26 A;  2C98 A;  1S3S A;  4I5S A;  3PXG A;  4DR7 M;  3C58 A;  2VII A;  4D81 A;  3GLI A;  2JNH A;  2HHH M;  2QBY B;  2HKJ A;  4LJ6 A;  3KS8 A;  5DYI A;  1YE9 A;  2DI0 A;  3I51 A;  5DYG A;  3U6P A;  2LHG A;  4RF0 A;  3VDU A;  1NY5 A;  3H4M A;  1K3X A;  4DV7 M;  3FKE A;  3SAW A;  3K8Z A;  3DFZ A;  1QUS A;  3L29 A;  1HNZ M;  3FUW A;  2QBY A;  3FUV A;  4UN2 B;  1XXH B;  1OKS A;  2K0B X;  1E9R A;  3J81 S;  1N77 A;  4LF8 M;  2OOB A;  4PT5 A;  1IY0 A;  2KNZ A;  4WW0 A;  1IXZ A;  5FLX S;  2ZAN A;  5ITR A;  5EXT A;  2CV0 A;  4NXM M;  1NNU C;  4M0W A;  1JR3 A;  3ZC7 B;  4TUW A;  1NSF A;  4FWD A;  3M0E A;  3GRR A;  2LH0 A;  2H5X A;  1XXH A;  2J7N A;  1OIZ A;  1SXJ E;  1ZAE A;  2D7E A;  4FCT A;  4LGM A;  2DWZ B;  1FNN A;  4L6V 6;  2C9C A;  4IBK A;  1T3T A;  4Z8X A;  4A3V B;  3KP1 E;  3SAT A;  2P5T A;  3U6L A;  4JXJ A;  3GRY A;  3HJS A;  5BPV A;  1IXR C;  4DV4 M;  5E6J A;  4CJ6 A;  3HZJ A;  3GPX A;  4B3T M;  4ZPX A;  2F5O A;  1NVM A;  4NL4 H; 
#chains in the Genus database with same CATH homology
 4XBO A;  3GLH A;  1TH4 A;  4LRS A;  2CFO A;  3JAM S;  1KYI A;  4OW0 A;  3KOZ E;  3KOY E;  1XNQ M;  2EA0 A;  4KHP M;  3J2P B;  4DUY M;  3KSJ A;  1DGG A;  2UUC M;  4GHA A;  3TE6 A;  3SAV A;  3HHY A;  5EQT A;  1G59 A;  2UU9 M;  3KFU G;  4JI0 M;  2CHQ A;  2XFS A;  1QAQ A;  2DVW B;  4PD2 A;  3LVW A;  4IBB A;  5FTN A;  4LG2 A;  3L27 A;  3FUX A;  4G4N A;  3WHL A;  3U6E A;  1N78 A;  4PCZ A;  4CHT B;  2XEP A;  1L2B A;  4LFB M;  2Y0Q A;  4AZF A;  3GPY A;  1G41 A;  3E4R A;  1NNJ A;  1LV7 A;  3SMS A;  3GPP A;  3KSX A;  3HU2 A;  3PFI A;  1OFI A;  2DWM A;  3L2A A;  1DGB A;  3SAS A;  1GLN A;  1TH2 A;  4MGH A;  5FTK A;  2KXE A;  3HU3 A;  4OVZ B;  2KEB A;  1G3I A;  2QCU A;  3KOW E;  2C96 A;  3FYC A;  2XSZ A;  5JI3 E;  1GVN A;  1OFH A;  4IBG A;  4L4U A;  3VKH A;  3VFD A;  8CAT A;  4DV1 M;  4LZZ A;  3D8L A;  3T15 A;  4LCB A;  4OVZ A;  2L7I A;  4IIW A;  3JR4 A;  4AKG A;  5KPZ A;  4B3M M;  2FNA A;  4G6Z A;  2QEN A;  1Q39 A;  3B9P A;  3EIE A;  4MM3 B;  4HL4 A;  4DV0 M;  2LWX A;  1DGF A;  4I8O A;  2D7G A;  4GRI A;  3CF2 A;  4LJ4 A;  4AW4 A;  1N32 M;  2NQ8 C;  4B08 A;  3PVS A;  4MGK E;  4NOO B;  3TL4 X;  2R46 A;  3FYD A;  1NJF A;  3UMM A;  2UUB M;  3I4Y A;  1IQP A;  4GIP A;  4QHT A;  2R62 A;  2DWL A;  3SAR A;  1MU5 A;  1E94 E;  4DR4 M;  2I7P A;  7CAT A;  3QWL A;  1QAN A;  3FD9 A;  5ITY A;  4B7F A;  3MJ5 A;  2CEA A;  2JA2 A;  5FSW A;  3R8F A;  4XGI A;  3CF0 A;  4X65 M;  2DZO B;  2RGH A;  1H6U A;  3TPZ A;  4MGZ E;  3IG8 A;  2Z3X A;  2V6Z M;  4GH9 A;  5IT9 S;  3L26 A;  5KPT A;  1SXJ B;  4LGY A;  4NRW A;  1X37 A;  4L16 A;  4NSO B;  4OX9 M;  1UM8 A;  5KPR A;  3E9S A;  4D80 A;  3VLF B;  3GPU A;  1J7K A;  4KLN A;  1JQJ C;  1SXJ A;  1Z5B A;  4LF9 M;  5EXP A;  5IZ7 D;  4B3R M;  1R2Z A;  4DV6 M;  4QNM A;  3FUT A;  4HLQ A;  1XWI A;  4YY3 M;  4CGY B;  2L09 A;  3WHK A;  2BJW A;  3FTD A;  1YSY A;  4MB7 A;  4DV3 M;  1J5E M;  4AKI A;  4FVM A;  3DZD A;  3U6O A;  3A42 A;  3AOG A;  1R7R A;  2Y0T A;  2ERC A;  4G4Q A;  5KO3 A;  3M6A A;  1QQW A;  3J7A S;  5F3W A;  4FWH A;  3U61 B;  4B7G A;  5FTL A;  3J27 B;  4OU7 A;  4R7G A;  2DZN B;  2RKO A;  3BOS A;  1HQC A;  2DWN A;  4REZ A;  1XMQ M;  1IBK M;  4CIS A;  1Z6T A;  3LVV A;  3KVW A;  2ZM6 M;  3MHV C;  2X8A A;  1IN7 A;  3U61 A;  4LJ9 A;  4W5W A;  3RFW A;  4DR3 M;  3TWK A;  1L8Q A;  1FJG M;  2Y21 A;  3LMM A;  3NWL A;  1XHB A;  1QVR A;  1KFV A;  4DR1 M;  5IRE B;  4X64 M;  2LXE A;  4JI4 M;  4FCW A;  4JI6 M;  4MGY E;  2UXB M;  5EP4 A;  2XFT A;  3D8B A;  3K2L A;  3PNY A;  5LMU M;  2C9O A;  3TQS A;  3RE8 A;  3ZCB B;  4M9Z A;  1IXS B;  4BBA A;  4X62 M;  2YQZ A;  4B3S M;  2F5S A;  1Z5C A;  1EE8 A;  4MGI E;  4DUZ M;  1ORY B;  1L1T A;  3GQ5 A;  4LF7 M;  3IG5 A;  2R4J A;  4DV2 M;  1HT1 E;  3DA1 A;  4GC5 A;  3HHZ A;  3LQR A;  2QP9 X;  4LRT A;  4IBE A;  2CHG A;  3T38 A;  2HL7 A;  5ITX E;  2CUZ A;  3GQ3 A;  1IBM M;  1IN8 A;  1QYR A;  2V1C A;  5C1B A;  1N75 A;  3GRV A;  2Z4S A;  1XMO M;  1TGU A;  4IBJ A;  3AOE A;  2XGN A;  1NHG C;  4JYA M;  2YNM D;  1JR3 D;  4IBI A;  4LJ8 A;  3U6D A;  1D2N A;  4LZJ A;  2XH9 A;  5JI2 E;  4JI1 M;  4QNR A;  1K82 A;  1XNR M;  2EO2 A;  2OQ4 A;  2M5Z A;  4II7 A;  2C99 A;  1I94 M;  1IM2 A;  2QPA A;  2H1R A;  4LJ5 A;  2G5G X;  2XF3 A;  3DOA A;  1N36 M;  1DO0 A;  3VK7 A;  3L25 A;  3RGP A;  3MK6 A;  1L2D A;  2ZBK B;  1R2Y A;  4LF6 M;  4FWG A;  2R4E A;  2L7H A;  2FFJ A;  5IWA M;  2F4V M;  4IBF A;  1N34 M;  2RGO A;  1IY2 A;  5EP2 A;  4RF1 A;  1K3W A;  2CV1 A;  3A98 B;  4D82 A;  4JI8 M;  2DHR A;  3SMP A;  4PDG A;  3FTC A;  1Z5A A;  4GKJ M;  2VQE M;  1NHW C;  2X4A A;  4M9S A;  4LY6 A;  2M60 A;  1E9S A;  3U6Q A;  1Q3C A;  4IBD A;  4GKK M;  3TWM A;  2CV2 A;  2E5L M;  4MH0 E;  1HNX M;  2VQF M;  3SBJ A;  3I4V A;  4I4L A;  1TDZ A;  2F5N A;  3AL0 C;  3GO8 A;  2HCB A;  3AFH A;  4DR6 M;  1GL6 A;  1VDD A;  4NSR A;  4DR5 M;  4JI5 M;  3U6C A;  4AG6 A;  2KW0 A;  2V1U A;  2XSZ D;  2R18 A;  1IN5 A;  1TH3 A;  4B7H A;  4GIT A;  5ITQ A;  3HJQ A;  1KSF X;  4QHS A;  5BR8 M;  4AKH A;  3U6S A;  3ILK A;  2R65 A;  1I4W A;  2D7H A;  2FE8 A;  1QAM A;  4LF4 M;  1SXJ C;  3HJ8 A;  4AI6 A;  3FTE A;  4DV5 M;  1L2C A;  4I81 A;  3SAU A;  1NY6 A;  3HKP A;  3KP0 E;  5FTM A;  2K47 A;  3HHW A;  2YFQ A;  2ZAO A;  1PJJ A;  5A2Q S;  2J7O A;  5LMN M;  1Z59 A;  1IN4 A;  1DGH B;  2DXI A;  2R45 A;  4K0K M;  2G8L A;  1E32 A;  2KZS A;  3UGJ A;  3A46 A;  3GRU A;  1PM5 A;  4IBC A;  2W82 A;  4LFC M;  3NBI A;  2XLJ A;  3SHG B;  2AHM A;  2L6O A;  1TDH A;  4R3D A;  1DGH A;  2BNK A;  4FW9 A;  3M7G A;  2UUA M;  5ITX A;  2YR0 A;  3TWL A;  4JV5 M;  3GP1 A;  1IY1 A;  4L8R C;  3CTW B;  1G4A E;  3GLH B;  3HHX A;  1R6B X;  4L78 A;  4LJ7 A;  5GKN A;  4EIW A;  5KQ8 A;  1SXJ D;  4M9X A;  4IJE A;  5ITT A;  4GMQ A;  2A5Y B;  3EIH A;  3T1Y M;  1Q3B A;  3KOX E;  1HR0 M;  4ITQ A;  4G4O A;  5C18 A;  3CF6 E;  4M0D A;  3U60 B;  3AV0 A;  3HGI A;  3R9X B;  1C1K A;  3GQ4 A;  1QZM A;  2F5Q A;  1DO2 A;  4P16 A;  1HT2 E;  2Q2E B;  4FCV A;  4QOS A;  3U6M A;  2Y20 A;  3U60 A;  4YHH M;  3L28 A;  4BB9 A;  4AQY M;  3A45 A;  4RNA A;  4KO8 A;  4FD2 A;  4NRV A;  3GLF B;  2C5R A;  3AOE C;  4L15 A;  3KW6 A;  1GKI A;  1W5S A;  3T1H M;  3UK6 A;  4S12 A;  5EP1 A;  2OPF A;  2QZ4 A;  5DNY A;  2KZU A;  3Q8X A;  3GLF A;  1XC8 A;  3SC3 A;  3VKG A;  3HU1 A;  3U5Z B;  3FUU A;  3AJI B;  2LNH C;  4G4R A;  2BJV A;  3K1J A;  4X66 M;  4LFA M;  3KXE C;  2XZF A;  3VDP A;  3J7B A;  2F5P A;  4QOZ C;  3K92 A;  3J80 S;  5EP3 A;  2X49 A;  3SFZ A;  5EJC A;  3QAU A;  3U5Z A;  2FOI C;  3RGS A;  1N33 M;  4DR2 M;  3PNV A;  3W0L B;  4LJA A;  1QAO A;  1WXQ A;  3UJN A;  3FTF A;  1YUB A;  3ZH9 B;  5ITU A;  2KA6 B;  3HWS A;  2CHV A;  2I7N A;  3SHF A;  3AKZ A;  5FTJ A;  5KQD A;  4WUR A;  4GC9 A;  2EUC A;  3SYL A;  3JR5 A;  4GHL A;  3LQQ A;  4NXN M;  5EXX A;  2KRK A;  4JI7 M;  1ZQ9 A;  1PJI A;  1IN6 A;  4JI3 M;  4BLC A;  1NJG A;  3GLG B;  1G8P A;  4AG5 A;  3KS4 A;  1OJL A;  1HQY E;  4IJF A;  3OTO M;  3KDS E;  1W5T A;  3W0F A;  4Z6Y A;  2XZU A;  3SYK A;  1L1Z A;  2KRU A;  2UXC M;  2O5R A;  4PDI A;  3GLG A;  3THG A;  5H37 D;  4JN6 A;  1GL7 A;  3UZU A;  1IBL M;  4JI2 M;  1HNW M;  3GLI B;  3VK8 A;  2Z7J A;  5EXS A;  2Z4R A;  2CE7 A;  1J09 A;  2UXD M;  2ZAM A;  4KOD A;  4LF5 M;  1MX0 A;  5E26 A;  2C98 A;  1S3S A;  4I5S A;  3PXG A;  4DR7 M;  3C58 A;  2VII A;  4D81 A;  3GLI A;  2HHH M;  2QBY B;  2HKJ A;  4LJ6 A;  3KS8 A;  5DYI A;  1YE9 A;  3I51 A;  5DYG A;  3U6P A;  4RF0 A;  3VDU A;  1NY5 A;  3H4M A;  1K3X A;  4DV7 M;  3FKE A;  3SAW A;  3K8Z A;  3DFZ A;  3L29 A;  1HNZ M;  3FUW A;  2QBY A;  3FUV A;  1XXH B;  3J81 S;  1E9R A;  1N77 A;  4LF8 M;  4PT5 A;  1IY0 A;  4WW0 A;  1IXZ A;  5FLX S;  2ZAN A;  5ITR A;  5EXT A;  2CV0 A;  4NXM M;  1NNU C;  4M0W A;  1JR3 A;  3ZC7 B;  4TUW A;  1NSF A;  4FWD A;  3M0E A;  3GRR A;  2LH0 A;  1XXH A;  2J7N A;  1SXJ E;  1ZAE A;  2D7E A;  4FCT A;  4LGM A;  2DWZ B;  1FNN A;  2C9C A;  4IBK A;  1T3T A;  4Z8X A;  4A3V B;  3KP1 E;  3SAT A;  2P5T A;  3U6L A;  4JXJ A;  3GRY A;  3HJS A;  5BPV A;  1IXR C;  4DV4 M;  5E6J A;  3GPX A;  4B3T M;  4ZPX A;  2F5O A;  1NVM A;  4NL4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...