3ZCBB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin mutant e24g and atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
VLSEEEIEYRRRDARNALASQRLGGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE VBHT
publication title Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
pubmed doi rcsb
source organism Bartonella schoenbuchensis
molecule tags Transferase/antitoxin
total genus 23
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zcbB00
3SHGB 3ZC7B 3ZCBB
chains in the Genus database with same CATH superfamily
2DKLA 4BLCA 2UU9M 2JXNA 2O25A 2FS1A 2DHRA 4WW0A 3AKZA 3D8BA 1TR8A 1I4WA 1NJFA 2HL7A 3NWLA 3J7AS 3CTWB 2ZTCA 4G4OA 4IBFA 2CRUA 1ZQ9A 1PGYA 1E94E 4LFBM 2V1UA 2BJVA 1BVSA 1NV8A 2G3QA 1ZV1A 3TWKA 5ITUA 2DWMA 2EKFA 4M9SA 2R62A 4KO8A 4AG6A 2F5SA 4CIZA 4JI3M 3SC3A 3V76A 1GJTA 2KDLA 2I7PA 3NBXX 1NNJA 1XC8A 2O5RA 4B3MM 1DGFA 2VF8A 4B3TM 4FWDA 2G5GX 2Y0QA 3HU1A 2CHGA 1XXHA 2JY6B 2FNAA 4GRIA 4LF5M 4DV4M 2F5NA 1HNZM 3MMPA 1PRBA 4DUYM 2XFSA 3H4JA 3T38A 4XK8F 1HT2E 2LH0A 4GHAA 1G41A 1Z5CA 2I7NA 4LRTA 5EP4A 1X37A 3GRRA 3HKPA 4KLNA 3AOGA 5LMNM 2UUBM 3VKHA 3J27B 1IBKM 3Q8GA 4D82A 4P16A 4W5WA 2KZUA 1K3WA 4FVMA 1KFVA 2XF3A 1ZMVA 2Z4RA 4X65M 1XXHB 1YUBA 2K47A 1GABA 3KOXE 3B7ZA 3HHYA 3GLFA 4GKKM 2X8AA 1KSFX 1VG5A 4LJ4A 4R3DA 2ERCA 2HCBA 1L2BA 4QHTA 3FD9A 5ITXE 1WR1B 3I04M 3MHVC 3HZJA 4OVZA 1L1TA 2CWBA 3R8FA 1WGNA 4GHLA 2VQEM 1MJGM 1TTEA 4GC5A 3RFWA 4X66M 2LHGA 4QOSA 3SAUA 3HX3A 3FUWA 1W5TA 4DR1M 1QQWA 3SHGB 3FYCA 4G4NA 1KYIA 1UM8A 4D80A 5BR8M 4M0WA 3GLFB 4RF0A 2DAMA 2H1RA 1OKSA 3HWSA 2CV1A 2CE7A 4II7A 4Y28F 4FWGA 4ZPXA 1IY2A 1OAIA 4OVZB 1R2ZA 3HU3A 3WHLA 4S12A 1QDTA 4IBJA 2WSFF 1QAOA 4LF6M 4RKUF 4CJ6A 2R44A 2WSEF 3FE3A 4MGYE 2UXCM 2R4EA 4B08A 4AZFA 5KQDA 3KSJA 3HU2A 3FRIA 5EP3A 3W0LB 2QZ4A 3AOEC 4M9XA 3C58A 1IFYA 1SXJE 3Q8XA 2UXBM 2G8LA 3W67A 2DWNA 3JR4A 4FD2A 1QVRA 4JI2M 1TH3A 2R0IA 1YLAA 2DNAA 4LZJA 1QYRA 2L7IA 3MJ5A 4LJ8A 4LY6A 5EXXA 3FTFA 5ITYA 4LF9M 1IN8A 1WIVA 3HGIA 3AV0A 1N33M 2R65A 4MGIE 5C18A 5E6JA 2F5QA 2M60A 1HQCA 1WHCA 2DAEA 1Z59A 3SATA 3SMSA 2ZTDA 3LCVB 5FTNA 2JNHA 3U61A 3ZQJA 1V34A 3CF0A 5KPRA 2C98A 4DV2M 2MJ5B 3E9SA 5C1BA 4AI6A 1OAOC 2K6BA 7CATA 2JY5A 1TF0B 2QPAA 1CUKA 1XWIA 1NY5A 3SMPA 1Z6TA 4HLQA 1IXZA 2OQ4A 1IN7A 3FTDA 1MX0A 2CP8A 1NHGC 1QZEA 2R46A 3GRUA 3HY5A 3KOYE 4AW4A 3FYDA 3U61B 1Q3CA 5L8RF 5KPTA 4KT0F 2D7HA 2Y21A 3F92A 1QDRA 4L6V6 4DV5M 2XGNA 1QAMA 1ZAEA 4I8OA 1SXJD 1D0MA 2C96A 3GLGE 1GL6A 2OOBA 2JY8A 2L09A 4RF1A 3VDUA 3GPUA 3GLIE 1T3TA 3L29A 2O01F 2FE8A 3TWLA 3KFUG 2WSCF 2YQZA 1HNWM 1N34M 2JY7A 1Z5AA 4YY3M 2XZFA 1H6UA 1PJJA 4ITQA 4BBAA 2W82A 3KSXA 1J09A 1VEKA 2CV2A 1E32A 4LJ6A 1VQ1A 1TDHA 2Q2EB 1XB2B 3HJSA 2E5LM 3E4RA 1N77A 5EXPA 1IXSA 1G4AE 1PM5A 2F5OA 3ILKA 4MGKE 4B7GA 2QBYA 2K9DA 4GMQA 3FTCA 1JR3E 1JB0F 4IIWA 1NY6A 4MH0E 4JI8M 1Y8GA 4HL4A 2F4VM 2LHCA 1IY0A 1NVMA 4OX9M 3UGJA 4M0DA 4X64M 2XH9A 3QWLA 1P3QQ 1LTMA 1IXSB 3VFDA 1DGBA 4KHPM 2XSZA 2QBYB 2L6OA 1DO0A 3U5ZA 2RGOA 2ZM6M 1A5TA 2GQFA 3IECA 4DUZM 3AOEA 3L26A 2XFTA 5EQTA 3WHKA 2QCUA 3J7BA 4LF8M 4GC9A 3K9OA 3OTOM 4RNAA 3RGSA 3VDPA 4DR4M 4DBGB 2DZLA 4IJEA 4LJ5A 3SHFA 4NC6A 4LF4M 1DGGA 1L8QA 3GRVA 3W68A 2QHOB 3LQRA 1EIJA 1EFUB 4TUWA 2Z8YM 1VDDA 2JP7A 2LVQD 1OIZA 3M7GA 3KOWE 1WXQA 1DGHA 3U5ZB 2DZOB 1OTRA 2MH8A 4NRWA 4I81A 4GH9A 1ORYB 3HJQA 3SARA 4L8RC 1UFZA 1R4GA 1OFIA 2KXEA 2VF7A 3FKEA 3MK6A 4FCVA 1NSFA 1NV9A 2Z7JA 4NXNM 1J7KA 3GQ3A 2BJWA 1F4IA 2X49A 3HHWA 4IBDA 5EP1A 2ZANA 4DR2M 3B7QA 4JN6A 3LW5F 5EP2A 1JR3D 2DHYA 2OOAA 2Z3XA 1IY1A 3GLHA 3L28A 3UZUA 1N32M 2UXDM 2C99A 3PVSA 1DGHB 4GEWA 1HR0M 2KRUA 2L4EA 4NL4H 3FRHA 3U6OA 2DWLA 2DAGA 1XXHE 2JA2A 2CUZA 1IM2A 2OO9A 4DV1M 2CHQA 2DVWB 5ITRA 3I4VA 4F2LA 1V92A 4JV5M 2BWBA 3GLHB 3L27A 2FFJA 5EXTA 1RU3A 3C9PA 5IWAM 4CISA 4GITA 4AKIA 2RGHA 4QHSA 4DR6M 4EIWA 5BPVA 5FTJA 2HHHM 3PFIA 4NSOB 2EJSA 5DYIA 4BB9A 1C7YA 1JQJC 1OJLA 2CEAA 1R6BX 1XMQM 3GLFE 2MGWA 5EXSA 1TDZA 4NXMM 3JAMS 4LGMA 3FUXA 2XLJA 4NSRA 1PJTA 3QAUA 3A42A 5FLXS 3GLGA 1R2YA 2R6FA 3U6MA 4LG2A 1SG9A 1SXJC 2VIIA 4F1IA 2DENA 3GLIA 4LFCM 1XNRM 4FCWA 3U6LA 2A5YB 1EE8A 3A45A 4ANRA 4I4LA 4NRVA 5GKNA 1ZMWA 5LMUM 2KW0A 2AHMA 2JUJA 4Z6YA 3FUVA 3DZDA 4X62M 3ZC7B 4Q7JA 1Z5BA 4AG5A 2KZSA 3J81S 3UMMA 3K92A 2VDBB 1R7RA 3GLGB 1NJGA 3KXEC 3HHXA 3GRYA 1W5SA 2EKKA 4L4UA 1TGUA 4AQYM 4FWHA 1G71A 4CHTB 3EIHA 5H37D 1IN5A 8CATA 2EA0A 2EO2A 3D8LA 3SFZA 2ZAOA 4LFAM 3KS8A 1JR3A 4Z8XA 3A46A 4R7GA 3LVWA 1S3SA 3K2LA 4IBEA 3RE8A 4R71A 1MN3A 5EJCA 2BWEA 4IBBA 4DV6M 1DO2A 2XZUA 4JI4M 4DR5M 3AL0C 2JZ0A 2LTUA 1HJPA 4LJAA 1N78A 1N75A 1QANA 1PJQA 2N35A 1WGLA 3VKGA 4IBKA 1E9SA 1QZMA 2HAKA 5DFLA 4PDGA 5KO3A 3FUTA 2L2DA 1QUTA 1E9RA 3SYLA 3KW6A 1VEGA 4MM3B 1G59A 3B74A 3BXWA 1QUSA 2KNAA 4IBIA 3TL4X 3LQQA 1NHWC 4K0KM 4KODA 2HKJA 2V1CA 2MROB 2WZJA 2Z4SA 4MB7A 3UK6A 5IZ7D 3VK7A 2MR9A 1YE9A 2KRKA 4JI7M 3QYEA 4G4RA 4JYAM 2D7EA 2LVOC 4PT5A 1GJSA 4LJ9A 4FCTA 4JI0M 2XEPA 4MGHA 1D0KA 5FTMA 5IREB 5ITXA 3TPZA 5KQ8A 2C9OA 3A98B 5JI3E 4QNMA 2JWSA 4IBCA 1GLNA 3LCUA 4OU7A 1L2DA 2KEBA 4JI1M 1IBLM 4B3SM 4GIPA 4HEOA 1TH2A 3IG5A 1Q3BA 3RGPA 2LBCA 3C3DA 1OFHA 2DXIA 2QQ8A 2RRUA 1GVNA 1XNQM 3DOAA 3IG8A 2LVNC 3VK8A 4AKGA 1Q02A 4B7FA 4LF7M 3KP1E 1HQYE 3NBIA 4XGIA 3BBZA 3FUUA 4B7HA 2L7HA 1IN4A 3GO8A 3QYBA 2J5YA 1G3IA 1AUAA 2QENA 3CGWA 3C3EA 3T6PA 1G8PA 3AFHA 4YHHM 1V33A 4LRSA 4JXJA 4DV7M 3U6CA 3SYKA 3K8ZA 4I5SA 3HHZA 4CGYB 1XHBA 4A3VB 4B3RM 3U6SA 1SXJA 4FW9A 3KDSE 4PCZA 3I01M 4QNRA 3PNVA 2YFQA 3ZH9B 3SAWA 2FOIC 2DWZB 3H4MA 5IT9S 3B7NA 3GPPA 4OW0A 3HJ8A 3KVWA 4QOZC 1C1KA 2J7OA 2LVAA 3T1YM 2P5TA 2UUAM 3IHPA 2B3TA 3TE6A 4GKJM 1L1ZA 1HT1E 1IBMM 2YR0A 3U6PA 1SXJB 3DFZA 1LV7A 1IN6A 1FNNA 1OQYA 4P17A 5DNYA 1MU5A 2ZAMA 3GPXA 4DR7M 5F3WA 2DZNB 1R5LA 1T6OA 2R18A 4G4QA 3GP1A 3TWMA 1VEJA 3I51A 2H5XA 2Y20A 3EIEA 1NNUC 3J2PB 4WURA 4JI6M 1Q39A 2X4AA 3KS4A 1GO5A 2DAKA 2VQFM 3J80S 5ITTA 5E26A 4L78A 1IXRC 2K0BX 5DYGA 2C5RA 2YNMD 2QSFX 3UJNA 1D2NA 2C9CA 3SAVA 2KA6B 4DR3M 1GKIA 1OIPA 2R45A 3B89A 3I4YA 3M6AA 4G6ZA 4DV0M 4LZZA 3W0FA 1T43A 3T15A 2EUCA 4XBOA 3K9PA 4G3OA 4L16A 3M0EA 3BOSA 2CV0A 2DI0A 2HWJA 3KP0E 2DAIA 3E21A 1HNXM 5FTKA 4MGZE 1D0LA 3LVVA 2GNOA 1I94M 2L4FA 1QAQA 4UN2B 3GLHE 1NO1A 2NQ8C 2KNVA 2ZBKB 3PNYA 4DV3M 2Y0TA 2V6ZM 1TH4A 3FTEA 3ZCBB 2RKOA 3KOZE 3CF6E 5FTLA 3PXGA 1J5EM 4JI5M 5A2QS 1PJSA 2LNHC 4LJ7A 3GLIB 2CFOA 3T1HM 4M9ZA 2QNJA 3E46A 3U60A 3LMMA 1N36M 1DV0A 4AKHA 2F5PA 2BNKA 2CHVA 1YSYA 4L15A 4PDIA 5ITQA 2XSZD 3VLFB 3U6QA 4IBGA 2LVPC 1K82A 3L2AA 2D7GA 1WJ7A 4WP2A 4LGYA 4REZA 2LXEA 1ZMUA 1VDLA 4D81A 5KPZA 4IJFA 1L2CA 1K3XA 5FSWA 3R9XB 1AIPC 3K1JA 3GPYA 3TQSA 3AJIB 2M5ZA 3B9PA 2UUCM 3DA1A 3SBJA 1XMOM 3JR5A 3U60B 2OPFA 3SASA 4LCBA 3THGA 2J7NA 2JZ1A 3CF2A 3GQ4A 3L25A 2APLA 3U6EA 2KNZA 5JI2E 1PJIA 4PD2A 2LWXA 2QP9X 1GL7A 2KHHA 2R4JA 3GQ5A 3U6DA 1IQPA 2FH0A 4NOOB 1FJGM
chains in the Genus database with same CATH topology
4BLCA 2UU9M 2DHRA 4WW0A 3AKZA 3D8BA 1I4WA 1NJFA 2HL7A 3NWLA 3J7AS 3CTWB 4G4OA 4IBFA 1ZQ9A 1E94E 4LFBM 2V1UA 2BJVA 3TWKA 5ITUA 2DWMA 4AG6A 4M9SA 2R62A 4KO8A 2F5SA 4JI3M 3SC3A 2I7PA 4B3MM 1NNJA 1XC8A 2O5RA 4B3TM 1DGFA 4FWDA 2G5GX 2Y0QA 3HU1A 2CHGA 1XXHA 2FNAA 4GRIA 4LF5M 4DV4M 2F5NA 1HNZM 4DUYM 2XFSA 3T38A 1HT2E 2LH0A 4GHAA 1G41A 1Z5CA 2I7NA 4LRTA 5EP4A 1X37A 3GRRA 3HKPA 4KLNA 3AOGA 5LMNM 2UUBM 3VKHA 3J27B 1IBKM 4D82A 4P16A 4W5WA 2KZUA 1K3WA 4FVMA 1KFVA 2XF3A 2Z4RA 4X65M 1XXHB 1YUBA 2K47A 3KOXE 3HHYA 3GLFA 4GKKM 2X8AA 1KSFX 4LJ4A 4R3DA 1L2BA 2ERCA 2HCBA 4QHTA 3FD9A 5ITXE 1L1TA 3MHVC 4OVZA 3R8FA 4GHLA 2VQEM 4GC5A 3RFWA 4QOSA 3SAUA 3FUWA 1W5TA 4DR1M 1QQWA 3SHGB 3FYCA 4G4NA 1KYIA 1UM8A 4D80A 5BR8M 4M0WA 3GLFB 4RF0A 2H1RA 2CV1A 3HWSA 2CE7A 4II7A 4ZPXA 4FWGA 1IY2A 4OVZB 1R2ZA 3HU3A 3WHLA 4S12A 4IBJA 1QAOA 4LF6M 4MGYE 2UXCM 2R4EA 4B08A 4AZFA 5KQDA 3KSJA 3HU2A 5EP3A 3W0LB 3C58A 2QZ4A 3AOEC 4M9XA 1SXJE 3Q8XA 2UXBM 2G8LA 2DWNA 3JR4A 4FD2A 1QVRA 4JI2M 1TH3A 4LZJA 1QYRA 2L7IA 3MJ5A 4LJ8A 4LY6A 5EXXA 3FTFA 5ITYA 4LF9M 1IN8A 3HGIA 3AV0A 1N33M 2R65A 4MGIE 5C18A 5E6JA 2F5QA 2M60A 1HQCA 1Z59A 3SATA 3SMSA 5FTNA 3U61A 3CF0A 5KPRA 2C98A 4DV2M 3E9SA 5C1BA 4AI6A 7CATA 2QPAA 1XWIA 3SMPA 1NY5A 1Z6TA 4HLQA 1IXZA 2OQ4A 1IN7A 3FTDA 1MX0A 3GRUA 1NHGC 2R46A 3KOYE 4AW4A 3FYDA 3U61B 1Q3CA 5KPTA 2D7HA 2Y21A 4DV5M 2XGNA 1QAMA 1ZAEA 4I8OA 1SXJD 2C96A 1GL6A 2L09A 4RF1A 3VDUA 3GPUA 1T3TA 3L29A 2FE8A 3TWLA 3KFUG 2YQZA 1HNWM 1N34M 1Z5AA 4YY3M 2XZFA 1H6UA 1PJJA 4ITQA 4BBAA 2W82A 3KSXA 1J09A 2CV2A 1E32A 4LJ6A 2Q2EB 1TDHA 3HJSA 2E5LM 3E4RA 1N77A 5EXPA 1G4AE 1PM5A 2F5OA 3ILKA 4MGKE 4B7GA 2QBYA 4GMQA 3FTCA 4IIWA 1NY6A 4MH0E 4JI8M 4HL4A 2F4VM 1IY0A 1NVMA 4OX9M 3UGJA 4M0DA 4X64M 2XH9A 3QWLA 1IXSB 3VFDA 1DGBA 4KHPM 2XSZA 2QBYB 2L6OA 1DO0A 3U5ZA 2RGOA 2ZM6M 4DUZM 3AOEA 3L26A 2XFTA 5EQTA 3WHKA 2QCUA 3J7BA 4LF8M 4GC9A 3OTOM 4RNAA 3RGSA 3VDPA 4DR4M 4IJEA 4LJ5A 3SHFA 4LF4M 1DGGA 1L8QA 3GRVA 3LQRA 4TUWA 1VDDA 3M7GA 3KOWE 1WXQA 1DGHA 3U5ZB 2DZOB 4NRWA 4I81A 4GH9A 1ORYB 3HJQA 3SARA 4L8RC 2KXEA 3FKEA 1OFIA 4FCVA 3MK6A 4X66M 2UXDM 1NSFA 2Z7JA 4NXNM 3GQ3A 1J7KA 2BJWA 2X49A 3HHWA 4IBDA 5EP1A 2ZANA 4DR2M 4JN6A 5EP2A 1JR3D 2Z3XA 1IY1A 3GLHA 3L28A 3UZUA 1N32M 2C99A 3PVSA 1DGHB 1HR0M 2KRUA 4NL4H 3U6OA 2DWLA 2CUZA 2JA2A 1IM2A 4DV1M 2CHQA 2DVWB 5ITRA 3I4VA 4JV5M 3GLHB 3L27A 2FFJA 5EXTA 5IWAM 4CISA 4GITA 4AKIA 2RGHA 4QHSA 4DR6M 4EIWA 5BPVA 5FTJA 2HHHM 3PFIA 4NSOB 5DYIA 4BB9A 1JQJC 1OJLA 2CEAA 1R6BX 1XMQM 1TDZA 5EXSA 4NXMM 3JAMS 4LGMA 3FUXA 2XLJA 4NSRA 3QAUA 3A42A 5FLXS 3GLGA 1R2YA 3U6MA 4LG2A 1SXJC 2VIIA 3GLIA 4LFCM 1XNRM 4FCWA 3U6LA 2A5YB 1EE8A 3A45A 4I4LA 4NRVA 5GKNA 5LMUM 2KW0A 2AHMA 4Z6YA 3FUVA 3DZDA 4X62M 3ZC7B 1Z5BA 4AG5A 2KZSA 3J81S 3UMMA 3K92A 1R7RA 3GLGB 1NJGA 3KXEC 3HHXA 3GRYA 1W5SA 4L4UA 1TGUA 4AQYM 4FWHA 4CHTB 3EIHA 5H37D 1IN5A 8CATA 2EA0A 2EO2A 3D8LA 3SFZA 2ZAOA 4LFAM 3KS8A 1JR3A 4Z8XA 3A46A 4R7GA 3LVWA 1S3SA 3K2LA 4IBEA 3RE8A 5EJCA 4DV6M 4IBBA 1DO2A 2XZUA 4JI4M 4DR5M 3AL0C 4LJAA 1N78A 1N75A 1QANA 3VKGA 4IBKA 1E9SA 1QZMA 5KO3A 4PDGA 3FUTA 1E9RA 3SYLA 3KW6A 4MM3B 1G59A 4IBIA 3TL4X 3LQQA 1NHWC 4K0KM 4KODA 2HKJA 2V1CA 2Z4SA 4MB7A 3UK6A 5IZ7D 3VK7A 1YE9A 2KRKA 4JI7M 4G4RA 4JYAM 2D7EA 4PT5A 4LJ9A 4FCTA 4JI0M 2XEPA 4MGHA 5FTMA 3GPXA 5IREB 5ITXA 3TPZA 5KQ8A 2C9OA 3A98B 5JI3E 4QNMA 4IBCA 1GLNA 4OU7A 1L2DA 4JI1M 2KEBA 1IBLM 4B3SM 4GIPA 1TH2A 3IG5A 1Q3BA 3RGPA 1OFHA 2DXIA 1GVNA 1XNQM 3DOAA 3IG8A 3VK8A 4AKGA 4B7FA 4LF7M 3KP1E 1HQYE 3NBIA 4XGIA 3GO8A 3FUUA 4B7HA 2L7HA 1IN4A 1G3IA 2QENA 1G8PA 3AFHA 4YHHM 4LRSA 3U6CA 4JXJA 4DV7M 3SYKA 3K8ZA 4I5SA 3HHZA 4CGYB 1XHBA 4A3VB 4B3RM 3U6SA 1SXJA 4FW9A 3KDSE 4PCZA 4QNRA 3PNVA 2YFQA 3ZH9B 3SAWA 2FOIC 2DWZB 3H4MA 5IT9S 3GPPA 4OW0A 3HJ8A 3KVWA 4QOZC 1C1KA 2J7OA 3T1YM 2P5TA 2UUAM 3TE6A 4GKJM 1L1ZA 1HT1E 1IBMM 2YR0A 3U6PA 1SXJB 3DFZA 1LV7A 1IN6A 1FNNA 5DNYA 1MU5A 2ZAMA 4DR7M 5F3WA 2DZNB 2R18A 4G4QA 3GP1A 3TWMA 3I51A 2Y20A 3EIEA 1NNUC 3J2PB 4WURA 4JI6M 1Q39A 2X4AA 3KS4A 2VQFM 3J80S 5ITTA 5E26A 4L78A 1IXRC 5DYGA 2C5RA 2YNMD 3UJNA 1D2NA 2C9CA 3SAVA 2KA6B 4DR3M 1GKIA 2R45A 3I4YA 3M6AA 4G6ZA 4DV0M 4LZZA 3W0FA 3T15A 2EUCA 4XBOA 4L16A 2CV0A 3M0EA 3BOSA 3KP0E 1HNXM 5FTKA 4MGZE 3LVVA 1I94M 1QAQA 2NQ8C 2ZBKB 3PNYA 4DV3M 2Y0TA 2V6ZM 1TH4A 3FTEA 3ZCBB 2RKOA 3KOZE 3CF6E 5FTLA 3PXGA 1J5EM 4JI5M 5A2QS 3T1HM 2LNHC 4LJ7A 3GLIB 2CFOA 3U60A 4M9ZA 3LMMA 1N36M 4AKHA 2F5PA 2BNKA 2CHVA 1YSYA 4L15A 4PDIA 5ITQA 2XSZD 3VLFB 3U6QA 4IBGA 1K82A 3L2AA 2D7GA 4LGYA 4REZA 2LXEA 4D81A 5KPZA 4IJFA 1L2CA 1K3XA 5FSWA 3R9XB 3K1JA 3GPYA 2UUCM 3TQSA 3AJIB 2M5ZA 3B9PA 3DA1A 3SBJA 1XMOM 3JR5A 3U60B 2OPFA 3SASA 4LCBA 3THGA 2J7NA 3CF2A 3GQ4A 3L25A 3U6EA 5JI2E 1PJIA 4PD2A 2LWXA 2QP9X 1GL7A 2R4JA 3GQ5A 3U6DA 1IQPA 4NOOB 1FJGM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG B;  3ZC7 B;  3ZCB B; 
#chains in the Genus database with same CATH topology
 2DKL A;  4BLC A;  2UU9 M;  2JXN A;  2O25 A;  2FS1 A;  2DHR A;  4WW0 A;  3AKZ A;  3D8B A;  1TR8 A;  1I4W A;  1NJF A;  2HL7 A;  3NWL A;  3J7A S;  3CTW B;  2ZTC A;  4G4O A;  4IBF A;  2CRU A;  1ZQ9 A;  1PGY A;  1E94 E;  4LFB M;  2V1U A;  2BJV A;  1BVS A;  1NV8 A;  2G3Q A;  1ZV1 A;  3TWK A;  5ITU A;  2DWM A;  2EKF A;  4M9S A;  2R62 A;  4KO8 A;  4AG6 A;  2F5S A;  4CIZ A;  4JI3 M;  3SC3 A;  3V76 A;  1GJT A;  2KDL A;  2I7P A;  3NBX X;  1NNJ A;  1XC8 A;  2O5R A;  4B3M M;  1DGF A;  2VF8 A;  4B3T M;  4FWD A;  2G5G X;  2Y0Q A;  3HU1 A;  2CHG A;  1XXH A;  2JY6 B;  2FNA A;  4GRI A;  4LF5 M;  4DV4 M;  2F5N A;  1HNZ M;  3MMP A;  1PRB A;  4DUY M;  2XFS A;  3H4J A;  3T38 A;  4XK8 F;  1HT2 E;  2LH0 A;  4GHA A;  1G41 A;  1Z5C A;  2I7N A;  4LRT A;  5EP4 A;  1X37 A;  3GRR A;  3HKP A;  4KLN A;  3AOG A;  5LMN M;  2UUB M;  3VKH A;  3J27 B;  1IBK M;  3Q8G A;  4D82 A;  4P16 A;  4W5W A;  2KZU A;  1K3W A;  4FVM A;  1KFV A;  2XF3 A;  1ZMV A;  2Z4R A;  4X65 M;  1XXH B;  1YUB A;  2K47 A;  1GAB A;  3KOX E;  3B7Z A;  3HHY A;  3GLF A;  4GKK M;  2X8A A;  1KSF X;  1VG5 A;  4LJ4 A;  4R3D A;  2ERC A;  2HCB A;  1L2B A;  4QHT A;  3FD9 A;  5ITX E;  1WR1 B;  3I04 M;  3MHV C;  3HZJ A;  4OVZ A;  1L1T A;  2CWB A;  3R8F A;  1WGN A;  4GHL A;  2VQE M;  1MJG M;  1TTE A;  4GC5 A;  3RFW A;  4X66 M;  2LHG A;  4QOS A;  3SAU A;  3HX3 A;  3FUW A;  1W5T A;  4DR1 M;  1QQW A;  3SHG B;  3FYC A;  4G4N A;  1KYI A;  1UM8 A;  4D80 A;  5BR8 M;  4M0W A;  3GLF B;  4RF0 A;  2DAM A;  2H1R A;  1OKS A;  3HWS A;  2CV1 A;  2CE7 A;  4II7 A;  4Y28 F;  4FWG A;  4ZPX A;  1IY2 A;  1OAI A;  4OVZ B;  1R2Z A;  3HU3 A;  3WHL A;  4S12 A;  1QDT A;  4IBJ A;  2WSF F;  1QAO A;  4LF6 M;  4RKU F;  4CJ6 A;  2R44 A;  2WSE F;  3FE3 A;  4MGY E;  2UXC M;  2R4E A;  4B08 A;  4AZF A;  5KQD A;  3KSJ A;  3HU2 A;  3FRI A;  5EP3 A;  3W0L B;  2QZ4 A;  3AOE C;  4M9X A;  3C58 A;  1IFY A;  1SXJ E;  3Q8X A;  2UXB M;  2G8L A;  3W67 A;  2DWN A;  3JR4 A;  4FD2 A;  1QVR A;  4JI2 M;  1TH3 A;  2R0I A;  1YLA A;  2DNA A;  4LZJ A;  1QYR A;  2L7I A;  3MJ5 A;  4LJ8 A;  4LY6 A;  5EXX A;  3FTF A;  5ITY A;  4LF9 M;  1IN8 A;  1WIV A;  3HGI A;  3AV0 A;  1N33 M;  2R65 A;  4MGI E;  5C18 A;  5E6J A;  2F5Q A;  2M60 A;  1HQC A;  1WHC A;  2DAE A;  1Z59 A;  3SAT A;  3SMS A;  2ZTD A;  3LCV B;  5FTN A;  2JNH A;  3U61 A;  3ZQJ A;  1V34 A;  3CF0 A;  5KPR A;  2C98 A;  4DV2 M;  2MJ5 B;  3E9S A;  5C1B A;  4AI6 A;  1OAO C;  2K6B A;  7CAT A;  2JY5 A;  1TF0 B;  2QPA A;  1CUK A;  1XWI A;  1NY5 A;  3SMP A;  1Z6T A;  4HLQ A;  1IXZ A;  2OQ4 A;  1IN7 A;  3FTD A;  1MX0 A;  2CP8 A;  1NHG C;  1QZE A;  2R46 A;  3GRU A;  3HY5 A;  3KOY E;  4AW4 A;  3FYD A;  3U61 B;  1Q3C A;  5L8R F;  5KPT A;  4KT0 F;  2D7H A;  2Y21 A;  3F92 A;  1QDR A;  4L6V 6;  4DV5 M;  2XGN A;  1QAM A;  1ZAE A;  4I8O A;  1SXJ D;  1D0M A;  2C96 A;  3GLG E;  1GL6 A;  2OOB A;  2JY8 A;  2L09 A;  4RF1 A;  3VDU A;  3GPU A;  3GLI E;  1T3T A;  3L29 A;  2O01 F;  2FE8 A;  3TWL A;  3KFU G;  2WSC F;  2YQZ A;  1HNW M;  1N34 M;  2JY7 A;  1Z5A A;  4YY3 M;  2XZF A;  1H6U A;  1PJJ A;  4ITQ A;  4BBA A;  2W82 A;  3KSX A;  1J09 A;  1VEK A;  2CV2 A;  1E32 A;  4LJ6 A;  1VQ1 A;  1TDH A;  2Q2E B;  1XB2 B;  3HJS A;  2E5L M;  3E4R A;  1N77 A;  5EXP A;  1IXS A;  1G4A E;  1PM5 A;  2F5O A;  3ILK A;  4MGK E;  4B7G A;  2QBY A;  2K9D A;  4GMQ A;  3FTC A;  1JR3 E;  1JB0 F;  4IIW A;  1NY6 A;  4MH0 E;  4JI8 M;  1Y8G A;  4HL4 A;  2F4V M;  2LHC A;  1IY0 A;  1NVM A;  4OX9 M;  3UGJ A;  4M0D A;  4X64 M;  2XH9 A;  3QWL A;  1P3Q Q;  1LTM A;  1IXS B;  3VFD A;  1DGB A;  4KHP M;  2XSZ A;  2QBY B;  2L6O A;  1DO0 A;  3U5Z A;  2RGO A;  2ZM6 M;  1A5T A;  2GQF A;  3IEC A;  4DUZ M;  3AOE A;  3L26 A;  2XFT A;  5EQT A;  3WHK A;  2QCU A;  3J7B A;  4LF8 M;  4GC9 A;  3K9O A;  3OTO M;  4RNA A;  3RGS A;  3VDP A;  4DR4 M;  4DBG B;  2DZL A;  4IJE A;  4LJ5 A;  3SHF A;  4NC6 A;  4LF4 M;  1DGG A;  1L8Q A;  3GRV A;  3W68 A;  2QHO B;  3LQR A;  1EIJ A;  1EFU B;  4TUW A;  2Z8Y M;  1VDD A;  2JP7 A;  2LVQ D;  1OIZ A;  3M7G A;  3KOW E;  1WXQ A;  1DGH A;  3U5Z B;  2DZO B;  1OTR A;  2MH8 A;  4NRW A;  4I81 A;  4GH9 A;  1ORY B;  3HJQ A;  3SAR A;  4L8R C;  1UFZ A;  1R4G A;  1OFI A;  2KXE A;  2VF7 A;  3FKE A;  3MK6 A;  4FCV A;  1NSF A;  1NV9 A;  2Z7J A;  4NXN M;  1J7K A;  3GQ3 A;  2BJW A;  1F4I A;  2X49 A;  3HHW A;  4IBD A;  5EP1 A;  2ZAN A;  4DR2 M;  3B7Q A;  4JN6 A;  3LW5 F;  5EP2 A;  1JR3 D;  2DHY A;  2OOA A;  2Z3X A;  1IY1 A;  3GLH A;  3L28 A;  3UZU A;  1N32 M;  2UXD M;  2C99 A;  3PVS A;  1DGH B;  4GEW A;  1HR0 M;  2KRU A;  2L4E A;  4NL4 H;  3FRH A;  3U6O A;  2DWL A;  2DAG A;  1XXH E;  2JA2 A;  2CUZ A;  1IM2 A;  2OO9 A;  4DV1 M;  2CHQ A;  2DVW B;  5ITR A;  3I4V A;  4F2L A;  1V92 A;  4JV5 M;  2BWB A;  3GLH B;  3L27 A;  2FFJ A;  5EXT A;  1RU3 A;  3C9P A;  5IWA M;  4CIS A;  4GIT A;  4AKI A;  2RGH A;  4QHS A;  4DR6 M;  4EIW A;  5BPV A;  5FTJ A;  2HHH M;  3PFI A;  4NSO B;  2EJS A;  5DYI A;  4BB9 A;  1C7Y A;  1JQJ C;  1OJL A;  2CEA A;  1R6B X;  1XMQ M;  3GLF E;  2MGW A;  5EXS A;  1TDZ A;  4NXM M;  3JAM S;  4LGM A;  3FUX A;  2XLJ A;  4NSR A;  1PJT A;  3QAU A;  3A42 A;  5FLX S;  3GLG A;  1R2Y A;  2R6F A;  3U6M A;  4LG2 A;  1SG9 A;  1SXJ C;  2VII A;  4F1I A;  2DEN A;  3GLI A;  4LFC M;  1XNR M;  4FCW A;  3U6L A;  2A5Y B;  1EE8 A;  3A45 A;  4ANR A;  4I4L A;  4NRV A;  5GKN A;  1ZMW A;  5LMU M;  2KW0 A;  2AHM A;  2JUJ A;  4Z6Y A;  3FUV A;  3DZD A;  4X62 M;  3ZC7 B;  4Q7J A;  1Z5B A;  4AG5 A;  2KZS A;  3J81 S;  3UMM A;  3K92 A;  2VDB B;  1R7R A;  3GLG B;  1NJG A;  3KXE C;  3HHX A;  3GRY A;  1W5S A;  2EKK A;  4L4U A;  1TGU A;  4AQY M;  4FWH A;  1G71 A;  4CHT B;  3EIH A;  5H37 D;  1IN5 A;  8CAT A;  2EA0 A;  2EO2 A;  3D8L A;  3SFZ A;  2ZAO A;  4LFA M;  3KS8 A;  1JR3 A;  4Z8X A;  3A46 A;  4R7G A;  3LVW A;  1S3S A;  3K2L A;  4IBE A;  3RE8 A;  4R71 A;  1MN3 A;  5EJC A;  2BWE A;  4IBB A;  4DV6 M;  1DO2 A;  2XZU A;  4JI4 M;  4DR5 M;  3AL0 C;  2JZ0 A;  2LTU A;  1HJP A;  4LJA A;  1N78 A;  1N75 A;  1QAN A;  1PJQ A;  2N35 A;  1WGL A;  3VKG A;  4IBK A;  1E9S A;  1QZM A;  2HAK A;  5DFL A;  4PDG A;  5KO3 A;  3FUT A;  2L2D A;  1QUT A;  1E9R A;  3SYL A;  3KW6 A;  1VEG A;  4MM3 B;  1G59 A;  3B74 A;  3BXW A;  1QUS A;  2KNA A;  4IBI A;  3TL4 X;  3LQQ A;  1NHW C;  4K0K M;  4KOD A;  2HKJ A;  2V1C A;  2MRO B;  2WZJ A;  2Z4S A;  4MB7 A;  3UK6 A;  5IZ7 D;  3VK7 A;  2MR9 A;  1YE9 A;  2KRK A;  4JI7 M;  3QYE A;  4G4R A;  4JYA M;  2D7E A;  2LVO C;  4PT5 A;  1GJS A;  4LJ9 A;  4FCT A;  4JI0 M;  2XEP A;  4MGH A;  1D0K A;  5FTM A;  5IRE B;  5ITX A;  3TPZ A;  5KQ8 A;  2C9O A;  3A98 B;  5JI3 E;  4QNM A;  2JWS A;  4IBC A;  1GLN A;  3LCU A;  4OU7 A;  1L2D A;  2KEB A;  4JI1 M;  1IBL M;  4B3S M;  4GIP A;  4HEO A;  1TH2 A;  3IG5 A;  1Q3B A;  3RGP A;  2LBC A;  3C3D A;  1OFH A;  2DXI A;  2QQ8 A;  2RRU A;  1GVN A;  1XNQ M;  3DOA A;  3IG8 A;  2LVN C;  3VK8 A;  4AKG A;  1Q02 A;  4B7F A;  4LF7 M;  3KP1 E;  1HQY E;  3NBI A;  4XGI A;  3BBZ A;  3FUU A;  4B7H A;  2L7H A;  1IN4 A;  3GO8 A;  3QYB A;  2J5Y A;  1G3I A;  1AUA A;  2QEN A;  3CGW A;  3C3E A;  3T6P A;  1G8P A;  3AFH A;  4YHH M;  1V33 A;  4LRS A;  4JXJ A;  4DV7 M;  3U6C A;  3SYK A;  3K8Z A;  4I5S A;  3HHZ A;  4CGY B;  1XHB A;  4A3V B;  4B3R M;  3U6S A;  1SXJ A;  4FW9 A;  3KDS E;  4PCZ A;  3I01 M;  4QNR A;  3PNV A;  2YFQ A;  3ZH9 B;  3SAW A;  2FOI C;  2DWZ B;  3H4M A;  5IT9 S;  3B7N A;  3GPP A;  4OW0 A;  3HJ8 A;  3KVW A;  4QOZ C;  1C1K A;  2J7O A;  2LVA A;  3T1Y M;  2P5T A;  2UUA M;  3IHP A;  2B3T A;  3TE6 A;  4GKJ M;  1L1Z A;  1HT1 E;  1IBM M;  2YR0 A;  3U6P A;  1SXJ B;  3DFZ A;  1LV7 A;  1IN6 A;  1FNN A;  1OQY A;  4P17 A;  5DNY A;  1MU5 A;  2ZAM A;  3GPX A;  4DR7 M;  5F3W A;  2DZN B;  1R5L A;  1T6O A;  2R18 A;  4G4Q A;  3GP1 A;  3TWM A;  1VEJ A;  3I51 A;  2H5X A;  2Y20 A;  3EIE A;  1NNU C;  3J2P B;  4WUR A;  4JI6 M;  1Q39 A;  2X4A A;  3KS4 A;  1GO5 A;  2DAK A;  2VQF M;  3J80 S;  5ITT A;  5E26 A;  4L78 A;  1IXR C;  2K0B X;  5DYG A;  2C5R A;  2YNM D;  2QSF X;  3UJN A;  1D2N A;  2C9C A;  3SAV A;  2KA6 B;  4DR3 M;  1GKI A;  1OIP A;  2R45 A;  3B89 A;  3I4Y A;  3M6A A;  4G6Z A;  4DV0 M;  4LZZ A;  3W0F A;  1T43 A;  3T15 A;  2EUC A;  4XBO A;  3K9P A;  4G3O A;  4L16 A;  3M0E A;  3BOS A;  2CV0 A;  2DI0 A;  2HWJ A;  3KP0 E;  2DAI A;  3E21 A;  1HNX M;  5FTK A;  4MGZ E;  1D0L A;  3LVV A;  2GNO A;  1I94 M;  2L4F A;  1QAQ A;  4UN2 B;  3GLH E;  1NO1 A;  2NQ8 C;  2KNV A;  2ZBK B;  3PNY A;  4DV3 M;  2Y0T A;  2V6Z M;  1TH4 A;  3FTE A;  3ZCB B;  2RKO A;  3KOZ E;  3CF6 E;  5FTL A;  3PXG A;  1J5E M;  4JI5 M;  5A2Q S;  1PJS A;  2LNH C;  4LJ7 A;  3GLI B;  2CFO A;  3T1H M;  4M9Z A;  2QNJ A;  3E46 A;  3U60 A;  3LMM A;  1N36 M;  1DV0 A;  4AKH A;  2F5P A;  2BNK A;  2CHV A;  1YSY A;  4L15 A;  4PDI A;  5ITQ A;  2XSZ D;  3VLF B;  3U6Q A;  4IBG A;  2LVP C;  1K82 A;  3L2A A;  2D7G A;  1WJ7 A;  4WP2 A;  4LGY A;  4REZ A;  2LXE A;  1ZMU A;  1VDL A;  4D81 A;  5KPZ A;  4IJF A;  1L2C A;  1K3X A;  5FSW A;  3R9X B;  1AIP C;  3K1J A;  3GPY A;  3TQS A;  3AJI B;  2M5Z A;  3B9P A;  2UUC M;  3DA1 A;  3SBJ A;  1XMO M;  3JR5 A;  3U60 B;  2OPF A;  3SAS A;  4LCB A;  3THG A;  2J7N A;  2JZ1 A;  3CF2 A;  3GQ4 A;  3L25 A;  2APL A;  3U6E A;  2KNZ A;  5JI2 E;  1PJI A;  4PD2 A;  2LWX A;  2QP9 X;  1GL7 A;  2KHH A;  2R4J A;  3GQ5 A;  3U6D A;  1IQP A;  2FH0 A;  4NOO B;  1FJG M; 
#chains in the Genus database with same CATH homology
 4BLC A;  2UU9 M;  2DHR A;  4WW0 A;  3AKZ A;  3D8B A;  1I4W A;  1NJF A;  2HL7 A;  3NWL A;  3J7A S;  3CTW B;  4G4O A;  4IBF A;  1ZQ9 A;  1E94 E;  4LFB M;  2V1U A;  2BJV A;  3TWK A;  5ITU A;  2DWM A;  4AG6 A;  4M9S A;  2R62 A;  4KO8 A;  2F5S A;  4JI3 M;  3SC3 A;  2I7P A;  4B3M M;  1NNJ A;  1XC8 A;  2O5R A;  4B3T M;  1DGF A;  4FWD A;  2G5G X;  2Y0Q A;  3HU1 A;  2CHG A;  1XXH A;  2FNA A;  4GRI A;  4LF5 M;  4DV4 M;  2F5N A;  1HNZ M;  4DUY M;  2XFS A;  3T38 A;  1HT2 E;  2LH0 A;  4GHA A;  1G41 A;  1Z5C A;  2I7N A;  4LRT A;  5EP4 A;  1X37 A;  3GRR A;  3HKP A;  4KLN A;  3AOG A;  5LMN M;  2UUB M;  3VKH A;  3J27 B;  1IBK M;  4D82 A;  4P16 A;  4W5W A;  2KZU A;  1K3W A;  4FVM A;  1KFV A;  2XF3 A;  2Z4R A;  4X65 M;  1XXH B;  1YUB A;  2K47 A;  3KOX E;  3HHY A;  3GLF A;  4GKK M;  2X8A A;  1KSF X;  4LJ4 A;  4R3D A;  1L2B A;  2ERC A;  2HCB A;  4QHT A;  3FD9 A;  5ITX E;  1L1T A;  3MHV C;  4OVZ A;  3R8F A;  4GHL A;  2VQE M;  4GC5 A;  3RFW A;  4QOS A;  3SAU A;  3FUW A;  1W5T A;  4DR1 M;  1QQW A;  3SHG B;  3FYC A;  4G4N A;  1KYI A;  1UM8 A;  4D80 A;  5BR8 M;  4M0W A;  3GLF B;  4RF0 A;  2H1R A;  2CV1 A;  3HWS A;  2CE7 A;  4II7 A;  4ZPX A;  4FWG A;  1IY2 A;  4OVZ B;  1R2Z A;  3HU3 A;  3WHL A;  4S12 A;  4IBJ A;  1QAO A;  4LF6 M;  4MGY E;  2UXC M;  2R4E A;  4B08 A;  4AZF A;  5KQD A;  3KSJ A;  3HU2 A;  5EP3 A;  3W0L B;  3C58 A;  2QZ4 A;  3AOE C;  4M9X A;  1SXJ E;  3Q8X A;  2UXB M;  2G8L A;  2DWN A;  3JR4 A;  4FD2 A;  1QVR A;  4JI2 M;  1TH3 A;  4LZJ A;  1QYR A;  2L7I A;  3MJ5 A;  4LJ8 A;  4LY6 A;  5EXX A;  3FTF A;  5ITY A;  4LF9 M;  1IN8 A;  3HGI A;  3AV0 A;  1N33 M;  2R65 A;  4MGI E;  5C18 A;  5E6J A;  2F5Q A;  2M60 A;  1HQC A;  1Z59 A;  3SAT A;  3SMS A;  5FTN A;  3U61 A;  3CF0 A;  5KPR A;  2C98 A;  4DV2 M;  3E9S A;  5C1B A;  4AI6 A;  7CAT A;  2QPA A;  1XWI A;  3SMP A;  1NY5 A;  1Z6T A;  4HLQ A;  1IXZ A;  2OQ4 A;  1IN7 A;  3FTD A;  1MX0 A;  3GRU A;  1NHG C;  2R46 A;  3KOY E;  4AW4 A;  3FYD A;  3U61 B;  1Q3C A;  5KPT A;  2D7H A;  2Y21 A;  4DV5 M;  2XGN A;  1QAM A;  1ZAE A;  4I8O A;  1SXJ D;  2C96 A;  1GL6 A;  2L09 A;  4RF1 A;  3VDU A;  3GPU A;  1T3T A;  3L29 A;  2FE8 A;  3TWL A;  3KFU G;  2YQZ A;  1HNW M;  1N34 M;  1Z5A A;  4YY3 M;  2XZF A;  1H6U A;  1PJJ A;  4ITQ A;  4BBA A;  2W82 A;  3KSX A;  1J09 A;  2CV2 A;  1E32 A;  4LJ6 A;  2Q2E B;  1TDH A;  3HJS A;  2E5L M;  3E4R A;  1N77 A;  5EXP A;  1G4A E;  1PM5 A;  2F5O A;  3ILK A;  4MGK E;  4B7G A;  2QBY A;  4GMQ A;  3FTC A;  4IIW A;  1NY6 A;  4MH0 E;  4JI8 M;  4HL4 A;  2F4V M;  1IY0 A;  1NVM A;  4OX9 M;  3UGJ A;  4M0D A;  4X64 M;  2XH9 A;  3QWL A;  1IXS B;  3VFD A;  1DGB A;  4KHP M;  2XSZ A;  2QBY B;  2L6O A;  1DO0 A;  3U5Z A;  2RGO A;  2ZM6 M;  4DUZ M;  3AOE A;  3L26 A;  2XFT A;  5EQT A;  3WHK A;  2QCU A;  3J7B A;  4LF8 M;  4GC9 A;  3OTO M;  4RNA A;  3RGS A;  3VDP A;  4DR4 M;  4IJE A;  4LJ5 A;  3SHF A;  4LF4 M;  1DGG A;  1L8Q A;  3GRV A;  3LQR A;  4TUW A;  1VDD A;  3M7G A;  3KOW E;  1WXQ A;  1DGH A;  3U5Z B;  2DZO B;  4NRW A;  4I81 A;  4GH9 A;  1ORY B;  3HJQ A;  3SAR A;  4L8R C;  2KXE A;  3FKE A;  1OFI A;  4FCV A;  3MK6 A;  4X66 M;  2UXD M;  1NSF A;  2Z7J A;  4NXN M;  3GQ3 A;  1J7K A;  2BJW A;  2X49 A;  3HHW A;  4IBD A;  5EP1 A;  2ZAN A;  4DR2 M;  4JN6 A;  5EP2 A;  1JR3 D;  2Z3X A;  1IY1 A;  3GLH A;  3L28 A;  3UZU A;  1N32 M;  2C99 A;  3PVS A;  1DGH B;  1HR0 M;  2KRU A;  4NL4 H;  3U6O A;  2DWL A;  2CUZ A;  2JA2 A;  1IM2 A;  4DV1 M;  2CHQ A;  2DVW B;  5ITR A;  3I4V A;  4JV5 M;  3GLH B;  3L27 A;  2FFJ A;  5EXT A;  5IWA M;  4CIS A;  4GIT A;  4AKI A;  2RGH A;  4QHS A;  4DR6 M;  4EIW A;  5BPV A;  5FTJ A;  2HHH M;  3PFI A;  4NSO B;  5DYI A;  4BB9 A;  1JQJ C;  1OJL A;  2CEA A;  1R6B X;  1XMQ M;  1TDZ A;  5EXS A;  4NXM M;  3JAM S;  4LGM A;  3FUX A;  2XLJ A;  4NSR A;  3QAU A;  3A42 A;  5FLX S;  3GLG A;  1R2Y A;  3U6M A;  4LG2 A;  1SXJ C;  2VII A;  3GLI A;  4LFC M;  1XNR M;  4FCW A;  3U6L A;  2A5Y B;  1EE8 A;  3A45 A;  4I4L A;  4NRV A;  5GKN A;  5LMU M;  2KW0 A;  2AHM A;  4Z6Y A;  3FUV A;  3DZD A;  4X62 M;  3ZC7 B;  1Z5B A;  4AG5 A;  2KZS A;  3J81 S;  3UMM A;  3K92 A;  1R7R A;  3GLG B;  1NJG A;  3KXE C;  3HHX A;  3GRY A;  1W5S A;  4L4U A;  1TGU A;  4AQY M;  4FWH A;  4CHT B;  3EIH A;  5H37 D;  1IN5 A;  8CAT A;  2EA0 A;  2EO2 A;  3D8L A;  3SFZ A;  2ZAO A;  4LFA M;  3KS8 A;  1JR3 A;  4Z8X A;  3A46 A;  4R7G A;  3LVW A;  1S3S A;  3K2L A;  4IBE A;  3RE8 A;  5EJC A;  4DV6 M;  4IBB A;  1DO2 A;  2XZU A;  4JI4 M;  4DR5 M;  3AL0 C;  4LJA A;  1N78 A;  1N75 A;  1QAN A;  3VKG A;  4IBK A;  1E9S A;  1QZM A;  5KO3 A;  4PDG A;  3FUT A;  1E9R A;  3SYL A;  3KW6 A;  4MM3 B;  1G59 A;  4IBI A;  3TL4 X;  3LQQ A;  1NHW C;  4K0K M;  4KOD A;  2HKJ A;  2V1C A;  2Z4S A;  4MB7 A;  3UK6 A;  5IZ7 D;  3VK7 A;  1YE9 A;  2KRK A;  4JI7 M;  4G4R A;  4JYA M;  2D7E A;  4PT5 A;  4LJ9 A;  4FCT A;  4JI0 M;  2XEP A;  4MGH A;  5FTM A;  3GPX A;  5IRE B;  5ITX A;  3TPZ A;  5KQ8 A;  2C9O A;  3A98 B;  5JI3 E;  4QNM A;  4IBC A;  1GLN A;  4OU7 A;  1L2D A;  4JI1 M;  2KEB A;  1IBL M;  4B3S M;  4GIP A;  1TH2 A;  3IG5 A;  1Q3B A;  3RGP A;  1OFH A;  2DXI A;  1GVN A;  1XNQ M;  3DOA A;  3IG8 A;  3VK8 A;  4AKG A;  4B7F A;  4LF7 M;  3KP1 E;  1HQY E;  3NBI A;  4XGI A;  3GO8 A;  3FUU A;  4B7H A;  2L7H A;  1IN4 A;  1G3I A;  2QEN A;  1G8P A;  3AFH A;  4YHH M;  4LRS A;  3U6C A;  4JXJ A;  4DV7 M;  3SYK A;  3K8Z A;  4I5S A;  3HHZ A;  4CGY B;  1XHB A;  4A3V B;  4B3R M;  3U6S A;  1SXJ A;  4FW9 A;  3KDS E;  4PCZ A;  4QNR A;  3PNV A;  2YFQ A;  3ZH9 B;  3SAW A;  2FOI C;  2DWZ B;  3H4M A;  5IT9 S;  3GPP A;  4OW0 A;  3HJ8 A;  3KVW A;  4QOZ C;  1C1K A;  2J7O A;  3T1Y M;  2P5T A;  2UUA M;  3TE6 A;  4GKJ M;  1L1Z A;  1HT1 E;  1IBM M;  2YR0 A;  3U6P A;  1SXJ B;  3DFZ A;  1LV7 A;  1IN6 A;  1FNN A;  5DNY A;  1MU5 A;  2ZAM A;  4DR7 M;  5F3W A;  2DZN B;  2R18 A;  4G4Q A;  3GP1 A;  3TWM A;  3I51 A;  2Y20 A;  3EIE A;  1NNU C;  3J2P B;  4WUR A;  4JI6 M;  1Q39 A;  2X4A A;  3KS4 A;  2VQF M;  3J80 S;  5ITT A;  5E26 A;  4L78 A;  1IXR C;  5DYG A;  2C5R A;  2YNM D;  3UJN A;  1D2N A;  2C9C A;  3SAV A;  2KA6 B;  4DR3 M;  1GKI A;  2R45 A;  3I4Y A;  3M6A A;  4G6Z A;  4DV0 M;  4LZZ A;  3W0F A;  3T15 A;  2EUC A;  4XBO A;  4L16 A;  2CV0 A;  3M0E A;  3BOS A;  3KP0 E;  1HNX M;  5FTK A;  4MGZ E;  3LVV A;  1I94 M;  1QAQ A;  2NQ8 C;  2ZBK B;  3PNY A;  4DV3 M;  2Y0T A;  2V6Z M;  1TH4 A;  3FTE A;  3ZCB B;  2RKO A;  3KOZ E;  3CF6 E;  5FTL A;  3PXG A;  1J5E M;  4JI5 M;  5A2Q S;  3T1H M;  2LNH C;  4LJ7 A;  3GLI B;  2CFO A;  3U60 A;  4M9Z A;  3LMM A;  1N36 M;  4AKH A;  2F5P A;  2BNK A;  2CHV A;  1YSY A;  4L15 A;  4PDI A;  5ITQ A;  2XSZ D;  3VLF B;  3U6Q A;  4IBG A;  1K82 A;  3L2A A;  2D7G A;  4LGY A;  4REZ A;  2LXE A;  4D81 A;  5KPZ A;  4IJF A;  1L2C A;  1K3X A;  5FSW A;  3R9X B;  3K1J A;  3GPY A;  2UUC M;  3TQS A;  3AJI B;  2M5Z A;  3B9P A;  3DA1 A;  3SBJ A;  1XMO M;  3JR5 A;  3U60 B;  2OPF A;  3SAS A;  4LCB A;  3THG A;  2J7N A;  3CF2 A;  3GQ4 A;  3L25 A;  3U6E A;  5JI2 E;  1PJI A;  4PD2 A;  2LWX A;  2QP9 X;  1GL7 A;  2R4J A;  3GQ5 A;  3U6D A;  1IQP A;  4NOO B;  1FJG M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...