3ZD1A

Structure of the two c-terminal domains of complement factor h related protein 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
124
structure length
124
Chain Sequence
GEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H-RELATED PROTEIN 2
publication title Dimerization of Complement Factor H-Related Proteins Modulates Complement Activation in Vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3zd1A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3zd1A02
4AYIA 4B2SA 4ONTD 1MD7A 1TPMA 4PZ5A 2QY0A 2V8EA 5HYTB 1HFHA 1QUBA 1E5GA 4JHSA 4C16A 4LOSA 1G4FA 1SS2A 1GKGA 1PPQA 2BZMA 2RLQA 3GXEA 3OEDC 3ZD2A 2W80A 3M7PA 1E8BA 1TPNA 4WJG2 3ERBA 2IZ4A 1H2QP 2EC3A 3IX0A 1G4GA 2CKUA 3R62A 2MCYA 1FBRA 3NFPI 5HYUB 1OK2A 4IGDA 2LOJA 4DJZA 1ZJKA 2CG6A 1OK3A 1QGBA 4KKDA 3KXVA 1NWVA 4MUCA 1OK9A 1H04P 3T5OA 1OJWA 5HZPB 1ELVA 2G7IA 1HCCA 2XRBA 1H03P 2KMSA 2XWBF 1E88A 2XRDA 4AYMA 1OJYA 1O9AA 4LOTA 1H2PP 1QO6A 2EHFA 2UWNA 3L89M 2JRAA 1LY2A 1MD8A 1Q3XA 2RL0A 5I0QB 2RKYA 3O8EB 1GHQB 4J38B 1VVDA 3ZRZA 3CALA 5JPMG 2CG7A 2RKZA 2JGWA 1GKNA 3GOVA 3OP8A 4A5WB 1OK1A 2XQWC 2O39C 3IU3I 4B2RA 1Z92B 2XWJI 1OJVA 1VVCA 1HFIA 2B5ID 1TPGA 1UOTP 1U5MA 5FO8C 2WIIC 3RJ3D 1SRZA 2YBYA 4YNXA 4AYDA 2YRAA 3INBC 3ZD1A 2ERJA 3SW0X 1C1ZA 2MCZA 2A55A 3EJHA 2KRIA 3MQLA 2JGXA 4F4OC 1CKLA 4K12A 2RLPA 3KZJA 4CSYA 4FXGG 2W81A 4ZH1D 4AYEA 2IZ3A 3OXUD 5HYPA 1GPZA 3TVJA
chains in the Genus database with same CATH superfamily
4AYIA 4B2SA 2Y8RA 4ONTD 1MD7A 1TPMA 4PZ5A 2QY0A 2V8EA 5HYTB 1HFHA 1QUBA 1E5GA 4JHSA 4C16A 4LOSA 2I2LA 1G4FA 3WSYA 1SS2A 1GKGA 1PPQA 2BZMA 2RLQA 3GXEA 3OEDC 3ZD2A 2W80A 3M7PA 1E8BA 1TPNA 4WJG2 4YIZA 3ERBA 2IZ4A 1H2QP 2EC3A 3CI0J 3IX0A 1G4GA 2CKUA 3R62A 2MCYA 1FBRA 3NFPI 5HYUB 1OK2A 4IGDA 2LOJA 4DJZA 1ZJKA 2CG6A 1OK3A 1QGBA 4KKDA 3KXVA 1NWVA 4MUCA 1OK9A 1H04P 3T5OA 1OJWA 5HZPB 1ELVA 2G7IA 1HCCA 2XRBA 1H03P 2KMSA 2XWBF 1E88A 2XRDA 3NJAA 4AYMA 1OJYA 1O9AA 4LOTA 1H2PP 1QO6A 2EHFA 2UWNA 3L89M 2JRAA 1LY2A 1MD8A 1Q3XA 2RL0A 3K3TA 3WSXA 5I0QB 2RKYA 3O8EB 1GHQB 4J38B 1VVDA 3F6KA 3ZRZA 3CALA 5DN5A 5JPMG 2CG7A 2RKZA 2X2ZA 2JGWA 1GKNA 3GOVA 3OP8A 4A5WB 3VWOA 1OK1A 2XQWC 2O39C 3IU3I 4B2RA 1Z92B 2XWJI 1OJVA 2Y8TA 1VVCA 1HFIA 5DN4A 2Y8SA 4PO7A 2B5ID 1TPGA 1UOTP 1U5MA 4BWCA 5FO8C 2WIIC 1RLHA 3RJ3D 1SRZA 2YBYA 4YNXA 4AYDA 2YRAA 2ZYCA 3INBC 3ZD1A 2ERJA 3SW0X 1C1ZA 2MCZA 2A55A 3EJHA 2KRIA 3MQLA 4N7EA 2JGXA 4APLA 1CKLA 4F4OC 3FGTA 4K12A 2RLPA 3FGRA 3KZJA 4CSYA 4FXGG 3ZLDA 2W81A 4ZH1D 4AYEA 2IZ3A 3OXUD 5HYPA 1GPZA 3TVJA 4MSLA 3ZLEA
chains in the Genus database with same CATH topology
4AYIA 4B2SA 4ONTD 1MD7A 1TPMA 4PZ5A 2QY0A 2V8EA 5HYTB 1HFHA 1QUBA 1E5GA 4JHSA 4C16A 4LOSA 1G4FA 1SS2A 1GKGA 1PPQA 2BZMA 2RLQA 3GXEA 3OEDC 3ZD2A 2W80A 3M7PA 1E8BA 1TPNA 4WJG2 3ERBA 2IZ4A 1H2QP 2EC3A 3IX0A 1G4GA 2CKUA 3R62A 2MCYA 1FBRA 3NFPI 5HYUB 1OK2A 4IGDA 2LOJA 4DJZA 1ZJKA 2CG6A 1OK3A 1QGBA 4KKDA 3KXVA 1NWVA 4MUCA 1OK9A 1H04P 3T5OA 1OJWA 5HZPB 1ELVA 2G7IA 1HCCA 2XRBA 1H03P 2KMSA 2XWBF 1E88A 2XRDA 4AYMA 1OJYA 1O9AA 4LOTA 1H2PP 1QO6A 2EHFA 2UWNA 3L89M 2JRAA 1LY2A 1MD8A 1Q3XA 2RL0A 5I0QB 2RKYA 3O8EB 1GHQB 4J38B 1VVDA 3ZRZA 3CALA 5JPMG 2CG7A 2RKZA 2JGWA 1GKNA 3GOVA 3OP8A 4A5WB 1OK1A 2XQWC 2O39C 3IU3I 4B2RA 1Z92B 2XWJI 1OJVA 1VVCA 1HFIA 2B5ID 1TPGA 1UOTP 1U5MA 5FO8C 2WIIC 3RJ3D 1SRZA 2YBYA 4YNXA 4AYDA 2YRAA 3INBC 3ZD1A 2ERJA 3SW0X 1C1ZA 2MCZA 2A55A 3EJHA 2KRIA 3MQLA 2JGXA 4F4OC 1CKLA 4K12A 2RLPA 3KZJA 4CSYA 4FXGG 2W81A 4ZH1D 4AYEA 2IZ3A 3OXUD 5HYPA 1GPZA 3TVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYI A;  4B2S A;  4ONT D;  1MD7 A;  1TPM A;  4PZ5 A;  2QY0 A;  2V8E A;  5HYT B;  1HFH A;  1QUB A;  1E5G A;  4JHS A;  4C16 A;  4LOS A;  1G4F A;  1SS2 A;  1GKG A;  1PPQ A;  2BZM A;  2RLQ A;  3GXE A;  3OED C;  3ZD2 A;  2W80 A;  3M7P A;  1E8B A;  1TPN A;  4WJG 2;  3ERB A;  2IZ4 A;  1H2Q P;  2EC3 A;  3IX0 A;  1G4G A;  2CKU A;  3R62 A;  2MCY A;  1FBR A;  3NFP I;  5HYU B;  1OK2 A;  4IGD A;  2LOJ A;  4DJZ A;  1ZJK A;  2CG6 A;  1OK3 A;  1QGB A;  4KKD A;  3KXV A;  1NWV A;  4MUC A;  1OK9 A;  1H04 P;  3T5O A;  1OJW A;  5HZP B;  1ELV A;  2G7I A;  1HCC A;  2XRB A;  1H03 P;  2KMS A;  2XWB F;  1E88 A;  2XRD A;  4AYM A;  1OJY A;  1O9A A;  4LOT A;  1H2P P;  1QO6 A;  2EHF A;  2UWN A;  3L89 M;  2JRA A;  1LY2 A;  1MD8 A;  1Q3X A;  2RL0 A;  5I0Q B;  2RKY A;  3O8E B;  1GHQ B;  4J38 B;  1VVD A;  3ZRZ A;  3CAL A;  5JPM G;  2CG7 A;  2RKZ A;  2JGW A;  1GKN A;  3GOV A;  3OP8 A;  4A5W B;  1OK1 A;  2XQW C;  2O39 C;  3IU3 I;  4B2R A;  1Z92 B;  2XWJ I;  1OJV A;  1VVC A;  1HFI A;  2B5I D;  1TPG A;  1UOT P;  1U5M A;  5FO8 C;  2WII C;  3RJ3 D;  1SRZ A;  2YBY A;  4YNX A;  4AYD A;  2YRA A;  3INB C;  3ZD1 A;  2ERJ A;  3SW0 X;  1C1Z A;  2MCZ A;  2A55 A;  3EJH A;  2KRI A;  3MQL A;  2JGX A;  4F4O C;  1CKL A;  4K12 A;  2RLP A;  3KZJ A;  4CSY A;  4FXG G;  2W81 A;  4ZH1 D;  4AYE A;  2IZ3 A;  3OXU D;  5HYP A;  1GPZ A;  3TVJ A; 
#chains in the Genus database with same CATH topology
 4AYI A;  4B2S A;  2Y8R A;  4ONT D;  1MD7 A;  1TPM A;  4PZ5 A;  2QY0 A;  2V8E A;  5HYT B;  1HFH A;  1QUB A;  1E5G A;  4JHS A;  4C16 A;  4LOS A;  2I2L A;  1G4F A;  3WSY A;  1SS2 A;  1GKG A;  1PPQ A;  2BZM A;  2RLQ A;  3GXE A;  3OED C;  3ZD2 A;  2W80 A;  3M7P A;  1E8B A;  1TPN A;  4WJG 2;  4YIZ A;  3ERB A;  2IZ4 A;  1H2Q P;  2EC3 A;  3CI0 J;  3IX0 A;  1G4G A;  2CKU A;  3R62 A;  2MCY A;  1FBR A;  3NFP I;  5HYU B;  1OK2 A;  4IGD A;  2LOJ A;  4DJZ A;  1ZJK A;  2CG6 A;  1OK3 A;  1QGB A;  4KKD A;  3KXV A;  1NWV A;  4MUC A;  1OK9 A;  1H04 P;  3T5O A;  1OJW A;  5HZP B;  1ELV A;  2G7I A;  1HCC A;  2XRB A;  1H03 P;  2KMS A;  2XWB F;  1E88 A;  2XRD A;  3NJA A;  4AYM A;  1OJY A;  1O9A A;  4LOT A;  1H2P P;  1QO6 A;  2EHF A;  2UWN A;  3L89 M;  2JRA A;  1LY2 A;  1MD8 A;  1Q3X A;  2RL0 A;  3K3T A;  3WSX A;  5I0Q B;  2RKY A;  3O8E B;  1GHQ B;  4J38 B;  1VVD A;  3F6K A;  3ZRZ A;  3CAL A;  5DN5 A;  5JPM G;  2CG7 A;  2RKZ A;  2X2Z A;  2JGW A;  1GKN A;  3GOV A;  3OP8 A;  4A5W B;  3VWO A;  1OK1 A;  2XQW C;  2O39 C;  3IU3 I;  4B2R A;  1Z92 B;  2XWJ I;  1OJV A;  2Y8T A;  1VVC A;  1HFI A;  5DN4 A;  2Y8S A;  4PO7 A;  2B5I D;  1TPG A;  1UOT P;  1U5M A;  4BWC A;  5FO8 C;  2WII C;  1RLH A;  3RJ3 D;  1SRZ A;  2YBY A;  4YNX A;  4AYD A;  2YRA A;  2ZYC A;  3INB C;  3ZD1 A;  2ERJ A;  3SW0 X;  1C1Z A;  2MCZ A;  2A55 A;  3EJH A;  2KRI A;  3MQL A;  4N7E A;  2JGX A;  4APL A;  1CKL A;  4F4O C;  3FGT A;  4K12 A;  2RLP A;  3FGR A;  3KZJ A;  4CSY A;  4FXG G;  3ZLD A;  2W81 A;  4ZH1 D;  4AYE A;  2IZ3 A;  3OXU D;  5HYP A;  1GPZ A;  3TVJ A;  4MSL A;  3ZLE A; 
#chains in the Genus database with same CATH homology
 4AYI A;  4B2S A;  4ONT D;  1MD7 A;  1TPM A;  4PZ5 A;  2QY0 A;  2V8E A;  5HYT B;  1HFH A;  1QUB A;  1E5G A;  4JHS A;  4C16 A;  4LOS A;  1G4F A;  1SS2 A;  1GKG A;  1PPQ A;  2BZM A;  2RLQ A;  3GXE A;  3OED C;  3ZD2 A;  2W80 A;  3M7P A;  1E8B A;  1TPN A;  4WJG 2;  3ERB A;  2IZ4 A;  1H2Q P;  2EC3 A;  3IX0 A;  1G4G A;  2CKU A;  3R62 A;  2MCY A;  1FBR A;  3NFP I;  5HYU B;  1OK2 A;  4IGD A;  2LOJ A;  4DJZ A;  1ZJK A;  2CG6 A;  1OK3 A;  1QGB A;  4KKD A;  3KXV A;  1NWV A;  4MUC A;  1OK9 A;  1H04 P;  3T5O A;  1OJW A;  5HZP B;  1ELV A;  2G7I A;  1HCC A;  2XRB A;  1H03 P;  2KMS A;  2XWB F;  1E88 A;  2XRD A;  4AYM A;  1OJY A;  1O9A A;  4LOT A;  1H2P P;  1QO6 A;  2EHF A;  2UWN A;  3L89 M;  2JRA A;  1LY2 A;  1MD8 A;  1Q3X A;  2RL0 A;  5I0Q B;  2RKY A;  3O8E B;  1GHQ B;  4J38 B;  1VVD A;  3ZRZ A;  3CAL A;  5JPM G;  2CG7 A;  2RKZ A;  2JGW A;  1GKN A;  3GOV A;  3OP8 A;  4A5W B;  1OK1 A;  2XQW C;  2O39 C;  3IU3 I;  4B2R A;  1Z92 B;  2XWJ I;  1OJV A;  1VVC A;  1HFI A;  2B5I D;  1TPG A;  1UOT P;  1U5M A;  5FO8 C;  2WII C;  3RJ3 D;  1SRZ A;  2YBY A;  4YNX A;  4AYD A;  2YRA A;  3INB C;  3ZD1 A;  2ERJ A;  3SW0 X;  1C1Z A;  2MCZ A;  2A55 A;  3EJH A;  2KRI A;  3MQL A;  2JGX A;  4F4O C;  1CKL A;  4K12 A;  2RLP A;  3KZJ A;  4CSY A;  4FXG G;  2W81 A;  4ZH1 D;  4AYE A;  2IZ3 A;  3OXU D;  5HYP A;  1GPZ A;  3TVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...