3ZDFA

Structure of gapdh with cp12 peptide from thermosynechococcus elongatus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
b'SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Thermosynechococcus elongatus
publication title Structure of Gapdh
rcsb
total genus 121
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zdfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zdfA01
3U9LA 3A14A 1LU9A 1V8BA 1ZXLA 4EUHA 2VTEA 2NM0A 5F5NA 2VYVA 1BW9A 3NDJA 4J7XA 4R51A 1K2WA 1DBVO 2ZTVA 5C5IA 2BD0A 1A27A 3WOHA 4BB6A 4J1TA 4CLHA 2VHYA 3FWNA 1F8GA 3F9IA 4FDAA 4YVFA 3U62A 2E37A 2JAHA 4J16A 1GL3A 4B4UA 4JJGA 3OJLA 5L4LA 3T7CA 4MP3A 1M75A 4N54A 1B3RA 3FR7A 1Q0QA 1WP4A 5DZSA 1LXCA 4BL5A 3H6KA 2VQ3A 1BWSA 4AVYA 3DDNA 1LDYA 2XXBA 2G5CA 2YJZA 1HZZA 3U4IA 2YYYA 4Z9XA 1F14A 1PGJA 3HDYA 1N8KA 2NTVA 4BQRA 1LSUA 5T73A 2XXJA 4IJKA 3JQ9A 3ZWNA 1YWGO 3BMCB 3HUDA 4Q39A 5T6BA 4IZIA 4NDNE 4IDBA 1JDJA 3HSKA 3HDJA 1EE9A 2Q46A 1BTOA 2FOIA 3WICA 4CQMD 3ASVA 2Q50A 3OEYA 5TQVA 4GVXA 1M66A 2JAPA 2ZK7A 4IMRA 4NMHA 2AE1A 4NR0A 1B8PA 3R1IA 1LLQA 1E5LA 3VH4A 5G2OA 2DT5A 5C3MA 3WLEA 2JFHA 1TT5A 1LBEA 4YRAA 3A4VA 1R0SA 2B36A 1PJQA 2ZIZA 3QA9A 4XGNA 1PWZA 4FFRA 3KSDO 3TQHA 4L0QA 5KCZA 1PSDA 2AG8A 1QP8A 2I9PA 3GVHA 4U5QA 5JCJD 3PJEA 3NTQA 3L4BC 2FPGA 4JJFA 1KIFA 3WWZA 4MVJE 5B4UA 4FJ1A 1EDZA 2UVDA 3LK7A 4HP8A 5COAA 4AJKA 2VRBA 2HMWA 2QQ5A 2ZB8A 4FBGA 5CFZA 3JTMA 4AL4A 2YFHA 5A9TA 4WECA 3LC2O 5JYFA 1PJ3A 4YJGB 4ZRMA 4OAQA 4FCCA 4Q3AA 3WDSA 3A1NA 1GPDG 4FSHA 2X9VA 5TSDA 4ALLA 5U1PA 4BO0A 2I6TA 4CMHA 1C14A 4BS9A 4L75A 2OXIA 2X58A 2Y1DA 2Y1OA 3GR6A 2C20A 2W2KA 4DRYA 2PGDA 4J0FA 2PGLA 4EEZA 1R12A 4ALMA 2FPIA 4D0SA 3OJFA 4MINA 5L40A 4CM9A 3RVDA 3G1TA 4IIVA 3VOSA 4CQMB 3MJ4A 4IQ8A 1BXKA 3D1LA 4FC7A 3DTTA 3GGGA 4DIOA 2HJRA 1NVMB 2B37A 2Y0EA 2VZ0A 4WOJA 1ZJZA 3GN2A 1YONA 4JN6B 5CPFA 1YGYA 5LCXA 2Z1NA 2WM3A 5KJ1A 4BOYA 2OOSA 4EJ0A 1KEUA 1U3WA 2G1UA 2IZZA 3G0OA 4RCVA 1T2CA 5BR7A 5L7TA 4L8VA 3GG9A 2X86A 3M1AA 3W1VA 4DQXA 2Y1CA 4PLHA 1A72A 1VJ1A 2Z1MA 4NU5A 1MC4A 3JYOA 4PVCA 3JQFA 4IXTA 3NT2A 2HQ1A 1SCUA 1U8FO 3QIVA 1DRUA 1YDWA 3QVSA 1CJCA 4WJZA 2GYYA 3V2UA 3Q1LA 5COQA 2ZCUA 4CM5A 4LRTB 3SJUA 1T2AA 3BTUA 5FFFA 1VKNA 4PG7A 2WWRA 5AOVA 2BMAA 2VT3A 3NT4A 3BTSA 5G0TA 1XSEA 1CERA 3KTDA 3LT0A 5KVSA 1R37A 1XHLA 2O3QA 4BNFA 1U28A 2FZEA 3PWKA 1KVSA 4ZQBA 1M76A 1CQJA 1B2LA 2AXQA 3AU8A 2QIOA 4ROSA 3LYLA 2IYOA 3AM4A 4BNJA 5DOZA 4BO2A 2VWQA 1F12A 3AFNA 3TPCA 2B4QA 1E3LA 4E5NA 1BRMA 4YJFA 4Q3BA 1DDOA 1JW9B 3OM9A 3HB4X 3L6OO 1JTVA 4HNGA 4D43A 4M55A 1Y5RA 4Y6RA 1U5AA 4OQYA 2NVUB 2Y1GA 3ZWYA 2BKAA 3H8VA 4JROA 3FF4A 3PQDA 4BNHA 4C7JA 4KTVE 3S2IA 4E4YA 4DPMA 1YBMA 2AQHA 1PWXA 4R1SA 1TXGA 3K2EA 2WD7A 5IG2A 1GPJA 3EUWA 2CDBA 4IQGA 4I9NA 4I1IA 4IS2A 4DMLA 1QKIA 4F45A 3PHHA 4HFMA 5FWNA 3DBRA 5T64A 2WD7B 1LDMA 4U0KA 1BGVA 1AXEA 2QG4A 3MOGA 4BKPA 4R5HA 3D4PA 3C1OA 3RKRA 1I3MA 4PLTA 4ZICA 3VKUA 1H9AA 2YV1A 3DZBA 3ZWBA 3NEPX 4HBGA 5DBIA 3TSCA 5MGBA 4GVLA 1U4SA 2Z5LA 3DL2A 3D5QA 1XQ6A 3QLJA 4AFNA 1CRWG 4A27A 3KV3O 3QWHA 3DOJA 4ALNA 1O5IA 4YACA 3RUAA 3AWDA 1E3SA 3BAZA 3KM0A 2NVWA 5TX7A 3K5PA 3KOUA 4J2OA 3U4HA 3RQSA 3PYLA 1KEPA 2G76A 1HSOA 1DLIA 2GNAA 3R3SA 3R6DA 3GNQA 2D5CA 5AXDA 1X0XA 4ZU3A 1JKJA 2EGGA 2X5JO 4MKRA 1XIVA 1HL3A 1NP3A 2BFAA 4U0JA 4C7KA 3DWFA 3OQBA 1BXZA 1YQDA 2I76A 1SAYA 2O48X 5EPOA 4B3IA 1EBUA 2EV9A 1XQ1A 2J5KA 3DXFA 1I01A 4BB5A 2YHIB 4ZA2A 3FTPA 1R4MB 1UH5A 3DO5A 2ZYAA 1HDOA 1LLCA 5JCJA 4B4VA 3DBRB 3T4XA 3G17A 3UCXA 2Y1EA 3ZDFA 4RGBA 4WCFC 4R3NA 3LT2A 4O0LA 4OM8A 1V0JA 4JIGA 3ADOA 3JQFC 4FFPA 3WGYA 4XR9A 2NU8A 5TS3A 1PZGA 2OHXA 3WJAA 1H94A 4DREA 4J7UA 3H9GA 2UAGA 2P2SA 1I3KA 4PLCA 3ZW9A 2JFFA 2X0NA 3GRKA 3RI3A 1DAPA 5KOIA 4PG6A 1XCBA 3H3JA 5F1PA 3ZWXA 1E7MA 5I7FA 4KWHA 4YJHB 1G0OA 5AQ1A 3K31A 1P1IA 2X8LA 3L07A 4NPCA 1LRKA 2F1KA 7MDHA 4RDIA 4NJMA 5ER9A 1Q2XA 4MVJF 2NU9A 3K9QO 2UUPA 3QV1A 4HXYA 5IZ4A 4ALJA 2VYND 3GK3A 1LEHA 4EUEA 1OBFO 3QVXA 6LDHA 1RJWA 1Q0LA 1ZXBA 1HYHA 2J5RA 5IDXA 1NYTA 3B20A 1RYEA 1EDOA 2NVBA 1QYVA 3Q6IA 4Z0TA 1YOVB 4HFNA 3F46A 1M6WA 1P31A 1YOVA 3GOHA 3AUUA 3P2YA 5IZCC 1NM5A 4CM1A 1H93A 4GMGA 2IEBA 4J91A 4QX6A 4OOEA 3WS7A 4W9NC 1J6UA 2DTDA 4AJLA 3ZHXA 1E7YA 3BHJA 4B8ZA 5HTOA 1EFLA 4FFMA 4MOWA 4P22A 4D41A 3FSRA 2GZ3A 1I0ZA 2CSUA 4MVJG 4IIUA 3CXRA 4NJOA 3ST7A 3RKUA 4YYZA 2CUKA 4YXFA 1LDGA 1U3VA 3TZQA 3ROQA 1EK6A 4FIZA 3E82A 2GUGA 3I9KA 5TNXA 1VKOA 1EZ4A 4G65A 2PFGA 3L6DA 3FBGA 1IE3A 4G2NA 4ALIA 1VPDA 1U3UA 3UUWA 1KVTA 2JCXA 3FNHA 4E2YA 3CKYA 1EBFA 3SJ7A 3FNGA 3VZPA 1UXKA 2G82A 5H82A 2GDZA 1GR0A 3K2BA 5JE8A 4RQTA 3GY0A 2I67A 1F8FA 1T24A 2HJSA 3CZRA 3WGZA 4QFDA 5BSFA 1KVUA 3DEYX 1R4MA 4GL4A 2DU8A 4QO7A 2X6TA 1YL5A 1HWYA 1ADBA 4M89A 3RUCA 3RD5A 3IJRA 5EMHA 3ZV4A 3TFQA 1Y6JA 1PQUA 1C3VA 4MVJA 5K9ZA 3U4DA 1P1JA 2XOXA 3WGTA 4K9DA 2D0IA 3EZYA 4ZQHA 1ZEMA 3IIEA 3PHGA 3L4BA 1Q1NA 1ZMTA 3IUPA 3VPSA 1T25A 3JQGB 2CF6A 4XJTA 3WYCA 2PK3A 2HLPA 5K0ZA 4ZQGA 5I7EA 2DM6A 2V7PA 1DRWA 1PGNA 2CVOA 3OA0A 5G0WA 4GX0A 3GMDA 1HE2A 1PL7A 3AW9A 2Q49A 2VYVD 3L4SO 1U1IA 2NQTA 4YBZA 1VM6A 1V3UA 1XA0A 4K6CA 4L76A 4XYLA 3VDQA 3C7AA 4BNWA 3KSZO 3HHPA 3AY6A 3BHMA 4R1UA 4P4LA 3F1LA 4BNZA 4DC0A 1PL8A 3H5RA 4KZPA 3E5RA 1UXGA 1K6IA 2HMUA 2JD1A 1W4ZA 4C4OA 2BRUA 2RAFA 5I9MA 1YQXA 2BELA 4PG8A 2W8ZA 1XWFA 5A5FA 4ND1A 1JKIA 3HN2A 1C1DA 4LVUA 1JVBA 3F1KA 3L6EA 1H6CA 1H2BA 1ISFA 1ZSYA 2O7SA 3HZZA 3PI7A 4KDEA 3ZV5A 4NK4A 4OYRA 4D42A 5KVVA 1NNUA 2JCVA 1IL0A 2ZQZA 4H15A 3DQPA 2PD4A 3JQDA 2J3IA 1YO6A 2WDZA 3ULKA 5KVCA 1HEUA 4E12A 1PJ4A 1O95A 4RV9A 1D3AA 2HK8A 3K73O 5FF9A 2GRAA 2O7QA 4XDZA 3Q0EA 4MVJI 1AE1A 1F0YA 2ZJ1A 2X0RA 5JYEA 1Y9AA 2P9CA 3X2EA 1PGQA 4M87A 1C1XA 1DIBA 2VHXA 4RF3A 2E6UX 5CDTA 4AJOA 4LCEA 3UHAA 1E3EA 4DGSA 1BDBA 2O3JA 1Z74A 4EDFA 5ITWA 2CFCA 2B69A 4A2CA 3QRWA 1HDZA 3EK2A 4PCVA 1D4FA 4XRRA 3JQBA 2ET6A 5TC4A 3DTYA 3MOIA 3VZQA 2C82A 3KLMX 4Z3DA 5A1TA 2B35A 1LNQA 1CQIA 1HZJA 2RH8A 1X14A 2NU6A 3GAZA 2Q3EA 4KTTE 4GLOA 3OFSA 4NHEA 1D1SA 1E5QA 4CQLB 3CH6A 1SNYA 4BV9A 4CM4B 4CMAA 4HKTA 4ZHSA 3LDHA 3LZ6A 3WLFA 3AM5A 3RFVA 2C7VA 4RO0A 3PRJA 4A7PA 1PJTA 4ZD6A 2SCUA 4RF4A 3I83A 1E92A 2AEFA 2Y67A 3C3XA 4KDFA 1ZSNA 4P38A 2IE0A 3GEGA 5THQA 3TNLA 3W8EA 2J6IA 5F21A 3PXXA 3AFMA 4BIIA 2PZMA 4A26A 5CDUA 1LQUA 5K6AC 1EFKA 2DUWA 7ADHA 5JS6A 3JV7A 4F6CA 3SLGA 3I1JA 1XU7A 3TFOA 4D0RA 1ADGA 1ZZEA 3ITKA 4MPDA 2EP5A 1MX3A 2DC1A 1O9BA 3N74A 3LF2A 3UFXA 3NAQA 1ENPA 2GD1O 4BO9A 2PA3A 1A9YA 1EUDA 1HYEA 2P9GA 1NBOA 5G0VA 4BQPA 1KBZA 3IS3A 3FRJA 4GBJA 1LDNA 3WGHA 4LMRA 1CYDA 3ZU5A 4CR8A 3GFGA 4XYGA 3OF2A 2PH5A 1Y7TA 1R0LA 3RJ9A 1E1KA 3VH1A 1VL8A 3QVOA 2X0IA 2AQ8A 4TRJA 4DYDA 4YJGA 1ZSVA 1NFRA 4R9SA 1UAGA 1YKFA 1P0FA 5JBIA 5JCXA 4E6PA 4R1TA 4PG4A 3EY4A 2DQ4A 1D1TA 1LDBA 2A92A 3AOGA 4JBGA 1ZCJA 4TWRA 3I3OA 1EMDA 4Q3DA 4R68A 1MB4A 4Y6SA 1TT7A 3BXXA 5JDIA 5DT9A 1QLHA 2Q1SA 2HUNA 2FP4A 4CM3A 1YXMA 3RBZA 1HE4A 5JFOA 4E13A 5I7VA 4JX8A 5BSEA 1LRLA 4EZBA 1FXSA 1JA9A 1NR7A 2HK7A 4JJIA 3IP3A 5JAIA 3DZJA 3TN7A 3KB6A 4O5OA 4CLXA 2H6EA 5JMWA 1OOEA 2OFPA 2FN7A 4E5YA 1BSVA 4XEHA 4BNGA 4QEDA 2W4QA 4PLPA 3D3WA 2VT2A 4DQVA 3PK0A 4XWYA 3WYEA 4PRKA 3PZBA 1K6JA 3CUKA 3GEMA 3T4EA 4QUKA 5IXYA 1J49A 2PR2A 2NU7A 4J9VA 1AGNA 4JGBA 1GZ6A 4PLYA 2FR1A 4J6FA 2HSDA 3EYWA 1P1FA 3MCVA 3U5TA 1Y8QA 4B7UA 1W73A 4IDEA 2DTEA 1P1RA 1P77A 3PHLA 4BO6A 2QZZA 2DBQA 5B4VA 4U7WA 4U6QA 2NV6A 1MXFA 2C29D 4UVHA 5TIIA 1TLTA 1SOVA 2QHXA 4CLRA 3QP9A 1EK5A 3D64A 4RF5A 2DBVO 3DB2A 4TRRA 3D4OA 3INGA 3QVWA 3W8FA 1AHIA 2AEMA 3ASUA 3JQ8A 4IMPA 2CZCA 4YEDA 4Z6KA 3DOOA 1LLDA 3JD3A 2Y1FA 2C7GA 3EW7A 2QZ9A 1FMCA 3RFTA 3JCZA 1DRVA 1F17A 1R66A 1LSJA 2AMFA 2GASA 4LK3A 3QWFA 1ADCA 4M49A 4IZHA 2GPTA 1B16A 1GFSA 4YTEA 3GVXA 4YJFB 1BXGB 3H65A 3WTCA 3O26A 5DULA 3WXBA 2I3AA 4ID9A 5JO0A 1NHWA 3WFJA 2UV8A 4BO8A 3HQ4O 3E48A 3GQVA 3FD8A 3Q2IA 4Q3NA 1R4NB 4ND2A 2ZTLA 3RAJA 4LN1A 1PS9A 2IYPA 3F6YA 3PLNA 3NKLA 1T2DA 3NJ8A 3AK4A 5L51A 2JD0A 1X15A 1IZ0A 2Y99A 1VI2A 4YT4A 1PS8A 2CY0A 3I52A 1WMBA 3MJVA 4NFSA 3HDHA 2VUUA 4MDHA 4P4GA 3OJOA 1E7SA 1ISIA 4M54A 1IZ9A 4UUPA 2EKLA 3AY3A 3GMSA 3INRA 3W4KA 1E7WA 3ZI0A 4A10A 4XCVA 4I5GA 3DZIA 2P4HX 1WMAA 1N1EA 3W8DA 3ZGYA 1I32A 1E3JA 2PD3A 3DZFA 3PTZA 1KEWA 4J2HA 4EYEA 5GMOA 5KTKA 2HDHA 3DFUA 2FR8A 1U9JA 1X13A 1ENZA 3KHUA 2YY7A 3KBOA 3UH1A 3R0IA 3WBFA 1JWAB 4YCAA 1SEVA 3KYDB 1I3NA 2O4CA 3C8MA 3F4BA 1MXHA 3JQ9C 2NTJA 1VJTA 4CL8A 2C5AA 2OORA 5HBRA 3C24A 9LDBA 4E31A 3AOEC 2GN9A 4HV4A 2V6BA 1HRDA 2CVQA 1IY8A 3JYLA 5T67A 3FWZA 3GUYA 2YZ7A 1NASA 4JLWA 1AUPA 1YJ8A 3BYZA 4YRDA 1ML3A 4K6FA 4IDAA 4YRBA 4RQUA 1KC1A 3BIOA 2ZTMA 4J90A 1JKFA 3I6IA 1SC6A 3IMFA 2P9EA 3KSUA 5CDYA 1N9GB 4I5FA 3PWSA 3PHJA 3UXYA 1DAOA 1HDYA 1M67A 1YE3A 2C59A 1UP4A 2NQ8A 3OP4A 4MVJH 2WYUA 1KERA 3CIFA 1Y8QB 3MWDB 5TLSA 4ND3A 4EJMA 1GY8A 3GRPA 3HE3A 4INAA 1KEVA 1GU7A 3SVTA 4BO5A 3ZNPA 4CR6A 1GZ3A 2BGLA 2B5VA 1TEHA 2EJVA 1ZBQA 4PVDA 3RROA 4YAEA 3VDRA 1G6KA 2ZYGA 4HWKA 4ZN6A 1YBAA 1NFQA 3RUDA 2RCYA 3O38A 1Q0HA 2EIHA 1GQYA 4Y6PA 4IS3A 2AQKA 4AJHA 1Y8RA 4IDFA 4WK6A 2LDBA 1ZEJA 5CDGA 4XDYA 3GG2A 4NZ9A 1G0NA 3ON5A 1LA2A 2A35A 3BMOB 4B3JA 2UYYA 1HDCA 3GZNA 4OSPA 3ENKA 4MIYA 3NTRA 2YFQA 1PS0A 1U4OA 1Z7BA 3AJRA 4E32A 5JYAA 2W90A 3HN7A 2DBRA 4CL3A 1GCOA 1FJHA 4WE3A 3ETEA 3WR5A 5JDIC 2DPHA 4DA9A 3E03A 4OKIA 3WNVA 3SBOA 5C7LO 5C7IO 3BHIA 4PG5A 4U8GA 1Q7GA 1V3TA 4BO3A 5IFLA 4Z3KA 2DPGA 4WPGA 2C07A 3TL3A 4DLLA 4L73A 1KY4A 2VNAA 3ANLA 1SO8A 3GNSA 3TOZA 4CV3A 1HETA 1ZK2A 2J5QA 1B7GO 4O1MA 2HO5A 4RPLA 3ENNA 3OIGA 4BNVA 4CR7A 2JJYA 1JQBA 4WLUA 3DHNA 4GKBA 3LT1A 1QYCA 1NPYA 4XYMA 1FDTA 4NH4A 1VE9A 1BVUA 4PLGA 2VHVA 3FBTA 2YV3A 3GHHA 5IF3A 4WLVA 4YWJA 3AUSA 1PJLA 1YL7A 1ENYA 1I8TA 5LDGA 3SXPA 2B0JA 2C5EA 1YVEI 3L9XA 2AG5A 2VWPA 3PQEA 4XQGA 3GPDG 4BUCA 1EEHA 2V6MA 1D7OA 2I65A 3EAGA 3GDGA 1U8XX 4CUJA 4B4WA 1I2CA 3MWEB 4CV2A 3O8QA 3E9QA 3PDJA 1KVQA 2VCYA 3EDMA 1U2GA 1HSZA 4Z9FA 3H5NA 4XQ9A 4CM8B 4W82A 3HFGA 5THKA 3Q3CA 5J9GA 3EVTA 3NRCA 4TROA 2C2YA 2VHZA 4NBVA 4J43A 2NWQA 1ORRA 1P3DA 2CDCA 3NGXA 3S1LA 3ZWPA 3KO8A 2Q2WA 3FCOA 1Y1PA 4CPDA 4I08A 5KIAA 5L4SA 3H2ZA 1HLDA 1QV7A 2IEDA 1MFPA 1NVTA 3TRIA 4J4TA 2VWHA 5A05A 4PFJA 3HFSA 4XRGA 3PIDA 5TRTA 1NWCA 3GDOA 2PKRA 1PJCA 3GH3A 1H6DA 3JQCA 1YL6A 2X5KO 4YDRA 1Z73A 1ULUA 4NI5A 4CM9D 4XR4A 4B8WA 3HDQA 4MIOA 1ZIDA 4R5MA 1AHHA 3TL2A 4QFCA 2BHLA 4FD3A 2WYWA 5U9CA 4KUGA 4AJ4A 4CMEC 3FPCA 3R3JA 5DP2A 1C0KA 2DTXA 2W2LA 4AJ1A 4FS3A 2DBZA 4IJUA 4RLHA 1NWHA 1T2FA 4MIEA 2O3SA 5ADHA 2GN8A 2ZCVA 1ZKMA 3GEDA 3F5SA 3MEQA 1KYQA 3PYMA 2EF1A 3BMCA 3DMTA 3I9OA 3NV9A 4WUVA 4ND4A 3IL2A 5CPBA 1ZK4A 3VTFA 3DR3A 2O4UX 3ZCXA 3PFWO 3GZ4A 4HFRA 3PJFA 1SOWA 1GUZA 3CZMA 1M2WA 4L74A 1GADO 1OC2A 3WNQA 3Q2KA 2VRCD 1BMDA 1QORA 4NFYA 3ZWMA 3H7AA 1I2ZA 2Y93A 4GSKA 3VAZA 3PLRA 2TMGA 5BNIA 5L45A 2J3HA 5TJHA 4BO4A 4CM7A 2VOEA 3HNPA 4Z0HO 3VPGA 4WOKA 3ONDA 1MG5A 4XYBA 3MTJA 4DLAA 4EJ6A 3LVFO 3PDUA 2EGHA 4CV1A 3GDFA 2D4AA 4YR9A 2QX7A 2O23A 2RBEA 5ER6A 3BZUA 1VSUA 3JD1A 4H16A 3DHEA 2X5OA 2O3RA 4YT8A 2O2YA 4XD2A 5JC8A 3NX4A 4J7CA 2X4GA 3LU1A 2IXBA 4PZCA 1XR3A 3OQ1A 3A28A 3EC7A 1DIHA 2NACA 2UDPA 1R6DA 1ZUD1 4OOFA 2NUAA 1ISHA 3BMQA 4E5KA 2EEZA 5DOVA 1X7GA 1UZLA 4XB1A 4PGFA 3B1KA 4DYVA 3JQAA 4ND5A 5KJCA 1IPFA 2OUIA 2PV7A 5C37A 1WPQA 4B7CA 4I5DA 1YB4A 4FB5A 2ZB7A 1XGKA 1E3IA 1ULSA 3DBVO 1YB1A 2NADA 3E5MA 1GAEO 1ZNQO 3OICA 3WQSB 3LLVA 2NLOA 1K0UA 1LI4A 5AXAA 2ZYDA 3F3SA 4MKZA 4CLDA 4JP3A 1ZO8A 2FWMX 2EJWA 2HMVA 1QV6A 4DIBA 4OKNA 4OXKA 4EI2A 4Y9DA 4NNJA 2NNLD 4BNXA 4O6VA 3FPLA 4H7PA 3JQAD 2OO5A 4AJNA 3W6ZA 2AW5A 4Y67A 4P8RA 1OZAA 4BKQA 1O6ZA 2R6JA 1NHGA 4RVSA 5JAMA 8LDHA 3S2FA 4URFA 1CEQA 3SLKA 4AJIA 4W9NA 2E48A 5T8KA 2VN8A 4YJDA 3PQFA 3DBHA 4II2A 4F46A 1DHTA 1WDKA 5JW6A 4UREA 4XQEA 1H0KA 4XYEA 5J23A 1MP0A 1YJQA 2RH4A 5IDQA 2WMDA 4BMSA 3HWRA 3RASA 1PZHA 2YQ4A 3S2GA 3QVTA 2H9IA 3NJ4A 3WIEA 1N7HA 3LLSA 4XJSA 4OGWA 1LTHR 1GV1A 1WDMA 4JBHA 4X54A 5HRUA 4WEOA 3RC1A 1FDSA 3GNTA 1WXDA 3BMOA 3ZH2A 1B3BA 5BSHA 4W4TA 3UGKA 4PN3A 2Q2QA 4J9UE 2BH9A 3O03A 4PLWA 3W6UA 1IHYA 4YPOA 1DHRA 2Q2VA 2YDYA 4IDGA 4UUMA 5H81A 4KUEA 2LDXA 4FGSA 3P2OA 1RKXA 3E6AA 2GLXA 2AA3A 4J3FA 4ONEA 4BGUA 1LQTA 1UDAA 1EVYA 2GN4A 3OEWA 1T1SA 1LRJA 1XG5A 2PH3A 1JWBB 4EBFA 1UZMA 4GGOA 1X1EA 3S2EA 1PTJA 3BA1A 4H3VA 1EE2A 1P45A 4UUOA 4OIMA 5F3RA 4RORA 3ZHBA 4YA6A 3GPIA 4KQXA 3E9MA 3P5SA 3QWBA 1OAAA 3GVCA 4FFNA 5CAEA 2Q22A 2GZ2A 3OA2A 1HLPA 2E82A 4BNNA 3E1KA 1GD1O 1HE5A 3COSA 4MKXA 4PLFA 1V6AA 4XGKA 2EP7A 1DIGA 3OIFA 3OSUA 5IJZA 3WJ7A 3IDSA 2IODA 1HE3A 4CMBA 1C1XB 4BKOA 4ZQFA 3V5NA 3V2HA 2GCGA 3CE6A 1UXJA 1R15A 1H2HA 4DMMA 4MVJP 4GX1A 4OL9A 2FSVA 4Q3CA 3RC7A 4WLEA 1I2BA 3DZKA 2IXAA 3INTA 1DLJA 1LC0A 2EXXA 3TDKA 4LGVA 4PIVA 4P4NA 1P44A 1P0CA 3QY9A 1ZFNA 5A9RA 3IAHA 1VL6A 4D44A 5CEEA 4B7XA 1LLUA 3I9LA 1QYWA 4G81A 3HADA 2PGJA 3T7EA 4NBWA 4XIJA 2JKVA 5L95A 3KXDA 5TJ9A 5JLAA 1XYGA 2RIRA 1LUAA 2FR0A 2I3GA 4HUJA 1XLTA 1RYDA 5G4LA 3KLPX 3NUGA 3MJSA 4RZIA 3PHIA 1P33A 5FI5A 5A5EA 4R9RA 4PLZA 4CJXA 3UKOA 1ZH8A 3RCBA 1ONOA 4RPKA 2UUOA 3QWIA 3H9QA 4WCFB 5GZ1A 3N7UA 4ALKA 3AI2A 4TZKA 2GERA 5CG1A 4GMFA 3BMNA 4IDCA 4UVIA 4RVGA 3ROMA 4TQGA 2BF7A 2W2LD 2HRZA 4D3DA 5A03A 4TMFA 4PZDA 3VTZA 1H9BA 3CMCO 1D8AA 2AEJA 1YQGA 4OMUA 4KQWA 4XA8A 5AYVA 5T8KC 4B4OA 4RPJA 3CMMA 1MFZA 4L4RA 4L4XA 5A9SB 3JQGA 3KETA 1BXGA 4BGIA 3DOCA 3IUSA 4GWKA 2QYSA 1S6YA 2VZ9A 1X0VA 1S7CA 2VOJA 3C7CB 2GZ1A 3RUFA 2E49A 4Z0PA 4M8SA 4QTZA 5G0SA 3AU9A 4M1QA 3RIHA 3WG9A 4RJTA 5G4KB 4N5NA 3G3EA 4TRNA 3VPFA 1GV0A 1HDRA 2IDZA 4J4HA 3KEQA 2RHCA 1UUFA 1WZIA 5AXCA 2OP0A 2ILTA 3H9EO 3A9WA 8ADHA 2IZ0A 2O3TA 4J0EA 5DNAA 1LSSA 1HYGA 1PU2A 1N7GA 3NYWA 2YHUA 5HWSA 5EIOA 3GT0A 4K28A 5G0UA 4WLFA 4FGWA 4R3WA 4DWVA 4HADA 3WFIA 1E7QA 4FPXA 4B79A 3NDIA 3K92A 1MA0A 2JL1A 1I33A 1QLJA 2G17A 5L7YA 2HKIA 1PJSA 2GGSA 3I5MA 2H63A 4QO8A 3ZWVA 1VC2A 3TZ6A 5L7WA 1LDEA 2FY8A 1I24A 3GF4A 3D3WB 3IC5A 3TZKA 5EERA 1HKUA 4R16A 2O2SA 2Y0CA 3ETDA 4NFHA 4OHUA 3WQRA 1V35A 1HF3A 4B3HA 4BO7A 5JSFA 5C7OO 2J8ZA 2B4RO 5EJ2A 2PKQP 3UOGA 3M1LA 3WMWA 1UP6A 3UVEA 4M86A 4D7AA 5GY7A 5EINA 1CF2O 2OL4A 3UN1A 4QECA 1H5QA 2I5PO 3AUTA 2JCYA 1X7HA 3QSGA 2FMUA 3EHEA 3I9MA 3Q11A 3UICA 3CPSA 4CMEA 4BV8A 5JY1A 5TGDA 3PP8A 3WWYA 4CMIA 1MGOA 1OFGA 1NPDA 3WB9A 4JQCA 4UUNA 4LISA 5B12A 5DBFA 5DCYA 4CMGA 3ICCA 1NTOA 3OMLA 1G1AA 2PLAA 1E6EA 1RWBA 4IJWA 3UW3A 3D0OA 2B83A 1FF9A 1I10A 3L0DA 5JPIA 2D5AA 3VPHA 5L4NA 1N92A 3UF0A 2JHGA 5F5LA 1I5RA 3G79A 3SC4A 2CVZA 1GYPA 3H9JA 4W7IA 1ONPA 2IRWA 3HB5X 3DAGA 3TZCA 1WDLA 3GGPA 2Q99A 2ZKLA 4JP2A 4LSMA 4YB8A 3S8MA 4CQMA 3G1UA 4XQCA 1H6BA 4I5EA 1E0DA 3ONFA 4LRSB 4D3SA 3ROPA 2HRBA 3ICPA 4E5MA 4XIYA 5A4DA 1ISJA 2BGMA 1DPGA 1IULA 2I66A 2PWZA 4YAGA 2JFGA 3PVZA 2OZPA 1YH3A 1PGOA 2JD2A 2BI7A 4R69A 1I30A 1NQTA 4RVDA 4ZJUA 2Q45A 4E3ZA 1LC3A 4W7HA 3GVIA 3DZGA 1PR3A 1B8UA 5LDHA 1HTBA 4ZQEA 3PPIA 3UCEA 1I36A 4KP7A 5I9NA 4RVUA 3GN1A 1QG6A 5F1KA 3PIIA 3VPXA 1SB9A 2FZWA 4IM7A 1NQAO 1XU9A 1EUZA 4LVCA 3V1YA 2P4QA 5DCUA 3SEFA 4BKUA 1P9LA 2AHRA 1GYRA 3JQAB 3L77A 5KJFA 3JD2A 1B8VA 4GLLA 2C54A 2P5UA 1CWUA 3IKTA 4Y98A 1E6UA 5MDHA 3KZVA 3VH3A 5COBA 4D3FA 2D8AA 2ZATA 4AJ2A 4I9HA 4IGFA 1BG6A 4U6SA 3TOXA 4E2ZA 2JHFA 5KJ6A 1GZ4A 1Z82A 2Y0DA 1N1GA 3ABIA 1BVRA 3Q9NA 4EUFA 1ADFA 4EW6A 3PYXA 2DVMA 4GI2A 3RWBA 1NFFA 2BGKA 3OH8A 1Y8RB 1WNTA 1GUFA 3RBXA 3B1JA 4FC6A 2WYVA 1SB8A 4CM6A 1R16A 3P19A 3JQ7B 1SBYA 2EKQA 3OIDA 1DFGA 5TT0A 3STHA 2O50A 4GGPA 2PZKA 4CLRB 1PJBA 1AXGA 4DPKA 3GGOA 5ILGA 3DONA 4J49A 4N5LA 1YBVA 4WNIA 2YDXA 3ZNQA 1PR9A 1T4BA 4NQZA 2EWMA 2WJPA 4PLVA 3EVNA 5LC1A 3DHYA 3RC9A 4GX2A 3GVPA 2VUSA 1DJQA 3H9UA 3P7MA 1DC6A 3PGJA 1SPXA 1P1KA 1GQ2A 1UXIA 4FFOA 1E1MA 4IPTA 3I6QA 3ADPA 3O4RA 3DMYA 3UCFA 5IAAA 3F47A 3H5AA 3JQ7A 3PGXA 1DJNA 2Q4BA 2VWGA 5M6DA 3JD0A 3EZLA 1VSVA 4O63O 3NGLA 3AY7A 3AI1A 3QQPA 1V3VA 4WLOA 4LMPA 5BNTA 4DTIA 1IUKA 2C2XA 2AE2A 5TT1A 1ZVMA 1JAYA 2DLDA 1RM4A 1KVRA 4JCOA 4BNTA 4XZ3A 5ENDA 3ONEA 3BMQB 4XB2A 1Z7EA 1W0CA 3RJ5A 2BLLA 3KYDA 3TWOA 1XEAA 1WZEA 4D45A 3OECA 1QRRA 1E1NA 3AOEA 4RL6A 2A94A 3C1TA 3VC7A 4WEQA 4AJPA 1L7EA 3KVOA 4R01A 1NX6A 1M6HA 3LC7O 3OHSX 1GQQA 1K6XA 3MJCA 5A06A 5AXBA 3LF1A 3QW2A 1K89A 3C7DB 1IYZA 1UZNA 4PZEA 3G49A 3ZWAA 3RU7A 1PQPA 2VUTA 2WEKA 1KOLA 2FSSA 3LSYA 1KC3A 5JNLA 2CF5A 3GHYA 5L53A 4ILKA 2H5LA 4BNIA 4LSWA 3ORFA 4J1NA 1ID1A 4DBVO 3K30A 2P91A 5A02A 1RM5A 1Z6ZA 5AVOA 5EESA 4UULA 2ZB4A 1W8DA 2BFMA 2BI8A 3JQEA 1FDVA 3O8QB 2R2GA 5DBGA 3F5QA 3D4NA 3VZRA 4DL9A 1UDBA 5DN9A 1RM3A 5IDYA 4AJEA 3RBVA 1A7KA 3E18A 5KWEA 4L9RA 2I99A 4DLBA 4OXNA 4OO3A 1QR6A 5H83A 5JXWA 1QXSA 3OETA 1T4DA 4HY3A 2PNFA 1TA4A 2W2KB 4D46A 1TT5B 2PTGA 2Q1WA 2WTBA 4ZRNA 3GC6A 2DAPA 1Q7CA 1NXQA 1EQUA 2HMSA 4JBIA 4KWIA 4NBTA 4CMJA 2PZJA 2C0CA 2CDAA 1R0KA 2X7HA 2XAAA 3PEFA 1DC3A 1U5CA 4K1LA 4MO2A 1NPTO 1N5DA 3K6JA 3WBBA 4UEKA 3KUXA 5F1OA 5JAZA 4L4SA 2V6GA 3U49A 2VRCA 4OQZA 4OSOA 4Z9YA 2YUTA 2DFDA 3VZSA 4TVBA 4CUZA 5I7SA 3NTOA 4HX5A 3M2TA 1JLLA 2A9FA 1DOHA 3WGQA 3ANNA 2EKPA 3JYPA 4NIMA 4RVFA 4YQYA 1LSOA 1WWKA 2X9GA 3O9ZA 4QQRA 2Q1TA 4ZGWA 3PFFA 4GPD1 3B6ZA 1OC4A 3JYNA 1GEGA 1JVSA 4IBOA 3WIDA 3TF5A 1V9LA 2Q1UA 1PQWA 1U7HA 2V65A 2XPCA 1UR5A 3F4LA 2QRKA 4GX5A 4DBZA 1ISGA 1EVJA 3RC2A 2EG9A 4FFLA 1SMKA 1N9GA 4HNHA 4N5MA 4A03A 1N2SA 2FRDA 4DUPA 3ANMA 4NJMB 3V1UA 2PZLA 4YAKA 1NAIA 4YT2A 3BTVA 3GFBA 4FR5A 4AJJA 4EGFA 1A5ZA 1IPEA 2WE8A 1B15A 1J0XO 1J4AA 1WAMA 2H1SA 3KEOA 2PKQO 3RUIA 1T26A 3KRTA 4JNKA 3U3XA 4DQUA 1E7RA 4FN4A 2F00A 2D2IA 2TMDA 4HFJA 5IZCA 2YW9A 4BGEA 1GYQA 4E0BA 4I8XA 5B37A 4R54A 3AM3A 4QXMA 3OJ0A 5EN4A 2G0TA 1OMOA 4E21A 3ZV3A 3WGGA 1Y5MA 4E30A 1KETA 1DC4A 5ES3A 3EGOA 4S1VA 1QMGA 4PRLA 4E33A 1KS9A 4R1NA 5A3VA 5JDCA 3AI3A 3RUEA 3BTOA 1DFIA 3MJTA 1E77A 9LDTA 1O8CA 4NG5A 1C1DB 1QSGA 2ZTUA 4NU6A 3CEAA 4CMIB 1ISMA 2YHIA 3K96A 3ZNOA 2J3JA 1NAHA 3JYQA 2BFPA 1XKQA 3IJPA 2Z95A 2QRLA 3ZHZA 1P1HA 5T5QA 1XDWA 2V6FA 4CMKA 5HS4A 2PD6A 4CODB 2OP1A 1ONNA 2J3KA 4R41A 5A04A 3D5TA 1Q7BA 4BMVA 4A0SA 1NR1A 4A73A 4ESOA 4J1SA 5CP8A 2HU2A 5JAQA 5HM8A 2CMDA 3ZU2A 5DP1A 1XELA 3LQFA 4YT5A 3OJEA 4JXKA 1A71A 5IN5A 5ENVA 3I9NA 2AQIA 4J1QA 2VHWA 3QE3A 4CMCA 4IGEA 5CG2A 1DXYA 1CIVA 2X23A 3DFZA 2HCTA 5JY6A 4XKJA 2ZJ0A 4IQ0A 3CINA 4WLNA 2X0JA 1DC5A 2DKNA 2DUUA 3LC1O 4BNMA 1A9ZA 3DMTC 2QW8A 3RUHA 1UJMA 5FEUA 4K26A 4GKVA 4TKMA 3SC6A 3WMXA 2NTNA 3ETGA 3WTBA 4TVOA 4LCJA 3GLQA 5I8WA 1TI7A 3FHLA 4IY1A 5DF1A 4E2WA 3DAPA 1E1LA 4KUHA 4W6ZA 3RFXA 3UAGA 4XGIA 2DFVA 1C0LA 1HXHA 2Y66A 4II3A 5TF4A 4CLOB 5BQFA 1EVIA 5DCWA 3U4CA 4MP8A 4RZHA 3JQ6A 4O59O 5CEFA 5A9SA 3W4JA 1GCUA 2FHSA 3NDRA 3PWZA 3D7LA 1ZK0A 3VVBA 2NVUA 4FJ2A 1E6WA 2YQ5A 3ZN2A 4OH1A 3TZHA 2B4TO 3H4VA 2OMEA 1BW9B 4TKLA 1DFHA 1DB3A 4XX0A 2XF8A 1U3TA 2QRJA 3IKVA 3JQ8B 1B0AA 1PL6A 1MC5A 4EEXA 1J5PA 3N58A 3WGIA 4FOSA 2GR9A 3Q9UA 5I9LA 4DPLA 4IJVA 5JO9A 5B4TA 4QSMA 4BHTA 4DC1A 1ZK3A 4N18A 4UVEA 5A3JA 4F6LA 3ZHYA 2EERA 2VNSA 3ZU4A 5JMPA 4UEJA 3VH2A 1FDUA 1A4UA 1HDGO 4WGGA 4BNLA 1HT0A 3C85A 5GZ6A 4DXHA 4ZVVA 4MVJD 1IOLA 2HK9A 1ZK1A 1DIRA 1B26A 4J4BA 4KMSA 1Y9EA 4OJNA 1P74A 1A4IA 2ZQYA 1GTMA 3CTMA 3H3FA 5IDWA 3PJGA 2EW8A 5KKCA 4RLSA 3FR8A 2HMTA 1JU9A 4DIFA 3DC2A 4Q3EA 3JQBC 4MP6A 1Z45A 4BNKA 3M6IA 3U0BA 3BMNB 1UXHA 3VKVA 3KYCA 2A4KA 5KKAA 2R00C 3D3EA 2FPPA 3NT5A 4MJLA 1AN9A 1NQ5A 4ITUA 1MUUA 4G5HA 3ITDA 3PJDA 1YRLA 1ZJYA 3V1TC 2VZ8A 3I23A 3DBHB 4IUYA 4UAGA 5JC1A 4UVDA 3GA0A 3GAFA 4BNYA 3HG7A 4OXYA 1VL0A 2BFOA 2VYNA 2CD9A 3I9JA 4GSLA 4RVHA 3IP1A 1O0SA 1UAYA 1U2DA 2GSDA 6ADHA 4E2XA 1E3WB 1MLDA 3L9WA 4FW8A 4TRMA 5FYDA 2GO1A 5EQDA 3DBLA 3V8BA 2P68A 5B1YA 1PGPA 1PEDA 1H6AA 1EVZA 4WNCA 1ZMOA 1B14A 4BO1A 5ICSA 5KNLA 1O89A 4BMNA 5K6AA 3SX2A 5ICMA 3EMKA 5HS6A 4GAEA 4KOAA 3QJ5A 3FNFA 3DAFA 4NK5A 3JSAA 1QYDA 4I9UA 4CV0A 3FI9A 1X1TA 5IN4A 1WVGA 3RSHA 1NQOA 3I4FA 2Q4EA 3KYBA 5ITVA 4GQAA 1VLLA 4RPGA 4E5PA 5L9AA 4Y8VA 4Q9NA 1PJ2A 4TZTA 1ZW1A 1SEPA 3ZWOA 1K5HA 2O3UA 1E3WA 4RPHA 5I8ZA 1BDMA 1KY5A 1OI7A 3E8XA 3X2FA 2D59A 1C0PA 1EQ2A 1YDEA 2NSDA 2ZB3A 3LT4A 5GZ3A 2WD8A 4YAJA 3GUCA 3ZNNA 4NBUA 1DSSG 1PIWA 3ZZNA 1CDOA 1VRWA 3AUAA 2WE7A 3FNEA 1ENOA 1X7DA 4CM4A 4CLEA 1C0IA 1GDHA 5BSGA 3GZNB 1SZJG 2OBYA 3U09A 3ROKA 1TB4A 5JDCC 3IOYA 3IQDB 1JN0A 4MVJM 2EHDA 5CHEA 1L1FA 3JD4A 2PY6A 1NVGA 1PX0A 5U4QA 1UDCA 4BKRA 4FQ8A 4AG3A 3HJAA 3W4IA 2RHRA 3E9NA 1GEEA 4S3MA 1MG0A 2Y68A 4RDHA 2X22A 3WSWA 1IHXA 2HAEA 4EITA 2D1YA 5KVQA 3RU9A 1WLYA 1BHSA 4DVJA 3PZRA 3V2GA 4UEOA 1ARZA 1QYXA 1T1RA 4CLOA 1T2EA 1O94A 3CSDA 1CETA 4W99A 1Z75A 4RF2A 3K8ZA 1K3TA 3MZ0A 4IINA 4A5OA 2E4AA 1W6UA 3QHAA 1TVEA 1F06A 5G4KA 4CQLA 4FJ0A 4YAIA 1I3LA 3QWAA 4JK3A 3ZU3A 3TJRA 1L7DA 5L3ZA 1DIAA 2WSBA 2QYTA 1EUCA 5T57A 4BGVA 2P5YA 4YJHA 1PZEA 2Y05A 3DBLB 3DZHA 5EL0A 3VVCA 2B5WA 1IB6A 2X9NA 2D3TA 4AICA 3WYBA 1DEHA 4WKGA 4BNUA 1A7AA 4D79A 3ZWCA 2W98A 3OQ6A 4R4JA 4LW8A 2X1HA 1Y81A 3ZV6A 2OGUA 1UP7A 5CEJA 2GN6A 4QT0A 3OBBA 3WQQA 2POQX 3FN4A 2IZ1A 1FDWA 4YQZA 3WX0A 1RM0A 2R00A 3VHRA 5BNFA 1PZFA 4WCFA 4NBRA 3KYCB 1LX6A 5ILOA 5IXSA 5EQFA 4GH5A 4TSKA 5JYDA 5DDIP 2YV2A 1DO8A 2GF2A 1RPNA 2OBNA 4UVGA 3FTNA 5BT9A 2VTDA 3I4CA 1LJ8A 3MJEA 3A06A 4IXWA 5KJEA 3WSVA 3B70A 3ZW8A 4BVAA 1WW8A 3M2PA 3C1AA 4IDDA 5HA5A 4WCDA 1YS4A 3H2SA 4GWGA 4WASA 1MV8A 1HDXA 3S55A 5CDSA 1GUYA 4N7RA 1U7TA 4F3YA 4CM8A 3ZWWA 1FK8A 4FOOA 1R4NA 2CNBA 3MTGA 1JAXA 5FI3A 1VJ0A 1YB5A 3WGOA 2EW2A 4CUKA 3B1FA
chains in the Genus database with same CATH superfamily
3EZNA 1ECGA 1V8BA 5IF9A 5KSYA 4R7TA 5CNMA 3SIPA 1W30A 1B2RA 2O8BA 1BW9A 2J1LA 4ER5A 2R5WA 1WHTB 3BBPA 3GNLA 4WBSA 1J0DA 1C8BA 3WGMA 3FHOA 3V33A 4R51A 1SQSA 1ZITA 4HH0A 4ZMBA 1KAEA 2NO7A 1JAZA 1VPLA 5I7HA 3LBIA 4C21A 3U62A 1F8GA 5K5EA 4OJQA 3RS0A 1SUIA 3P0JA 4J16A 1GL3A 1KDYA 3HY4A 4IIBA 3L01A 2IHYA 3EFHA 1KI6A 3TKYA 3EVZA 4FDTA 4YMHA 2FJUA 3Q6MA 2WRZA 3LVRE 1LVHA 4Q9JA 3R6WA 5DZSA 4ZGBA 3H6KA 4OHKA 5HCIA 1N5KA 1JFFA 2VQ3A 4KR7A 4YRFA 3FOFC 3DDNA 4KLZA 4ZO7A 4XAQA 1LDYA 1GZHB 2G5CA 1R0RE 1II0A 2XXBA 3WLPA 3C45A 4EG4A 4NEHB 3MW8A 3K5IA 2QB5A 2OC4A 1N8KA 1UJCA 2XE6A 3U9TA 1LSUA 1Y3IA 2XXJA 2QUIA 4MA5A 4Y1RA 1O6BA 2Y6UA 5T6BA 7MHTA 5L3SA 1CUHA 3T61A 4HDRB 1T5BA 4YUZA 4NDNE 5F1YA 2PXHA 3C7TA 3OCCA 4KQ2A 4N1AA 3EQ2A 5D6OA 3H8JA 1QZTA 1E6CA 2Q46A 3PQ4A 4WIAA 1R0BA 3EBPA 5CT9A 4CQMD 4ZEMA 4A6DA 2ZUBA 1XN4A 2MSWA 4KR2A 2L17A 1XMPA 2C77A 2NGRA 4IMRA 3E23A 1KMMA 4NR0A 1R6UA 3BF8A 2HSZA 4LXYA 2H9AA 4GYJA 3W2GA 5ALSA 5JQGA 4ZO4A 2JFHA 1YK0A 1N5LA 1TT5A 2VCEA 1GU1A 3E7WA 1U81A 1MGPA 2NT3A 3EIQA 4Y2HA 4XGNA 1PJQA 2PWPA 3KTAA 4A2WA 4JV5B 3K0FB 5KCZA 1OA0A 3NR2A 5G3ZA 1DJMA 5JBNA 1HY3A 2QPOA 4QZVA 3PJEA 4A3SA 2PRSA 4DR6B 2QV7A 3TTXA 1ZNZA 4JJFA 3WWZA 4MVJE 1U7PA 5BV1A 1HG1A 5LMUB 5JVDA 5GADl 3UY4A 3LK7A 4AJKA 3PCTA 2VRBA 2HMWA 4ZVRA 3SJCA 3WFZA 1ZOOA 1MR3F 2Q5OA 2G06A 4Q05A 3JTMA 2RD2A 1X80A 2BEUA 2BFCA 1WF3A 1WU7A 3KQOA 3C5CA 4RY0A 2NSLA 2XZPA 4OQXA 4PNHA 1M1YB 1REQA 2I6FA 1EUQA 3WDSA 4FOLA 4MAMA 4DEYA 2Q4OA 3QITA 4Y2GA 1A5BB 1R8JA 2ANCA 2X9VA 2C0PA 3NC4A 3G8DA 3MM4A 2WLSA 1V4BA 3QGMA 1Y82A 1SU8A 2XOKD 4F4JA 1WOMA 4BVBA 5U1PA 3RE1A 1P5ZB 1ZX1A 2DJIA 2J6CA 4MTCA 1UC8A 3GIWA 4F85A 2X58A 2Y1OA 5EHZA 4DRYA 4PBSA 4ZV4A 2PGLA 1C7EA 1R12A 4ALMA 2FPIA 3FYCA 4ZU6X 4NV3A 5L40A 4DYHA 3OMWA 1W4AA 4M8KA 1KI2A 1V6SA 2E4VA 5CT4A 1B1CA 4Z2YA 1GKUB 2FXIA 3KXPA 5DK4A 3D1LA 1C5KA 4DLYA 4EPRA 1IHUA 1EFHA 2ZIEA 4ERNA 2B37A 3DOFA 3EVCA 2V0NA 2Y0EA 3CR8A 1J22A 3OX2A 4WOJA 1ZJZA 2H3HA 2I6XA 3DZDA 1BH6A 3O74A 4Q4JA 4JN6B 5DYWA 2PX5A 3RO7A 5KAMA 1EJ2A 2HIGA 3TBHA 3OZRA 3TRDA 4EUKA 1IK4A 5LCXA 1IZZA 1L4LA 1JEQB 1HMPA 2JH8A 2NVOA 2WM3A 3DS8A 2OOSA 1Z0KA 4N39A 1ESZA 3JQQA 1OGJA 3MELA 4RD6A 5SZKB 2HRQA 2IZZA 1KORA 1MVLA 4I1UA 4QBKA 1JQKA 4RCVA 4MLDA 3ZY3A 4HK4A 3W1VA 4PNEA 2YZGA 3B9QA 3GLUA 1A72A 2QORA 2Z1MA 3NJRA 1GZ5A 1FNDA 5HFNA 5CDFA 3HA2A 2AWNA 3EEFA 2G3YA 3B6KA 3HCDA 3JQFA 3EP6B 3HY3A 3JYOA 4UU1A 4AUMA 2F59A 3PXBA 1S4QA 5L3SB 1RACA 1YQQA 1SCUA 2VDRB 2V3VA 3PRHA 1P6XA 3FKSD 3V2UA 1RTKA 2AKAB 3BH0A 5COQA 1E4OA 1Y7PA 4JT8A 3IT3A 3P9IA 2BVNA 1L7MA 1N2OA 3DD1A 5EJGA 1NVUQ 1QS0B 2WWRA 3NT4A 1M8KA 5BRAA 2F3PA 2ZYTX 4RX1A 2PGOA 1IJFA 1RZUA 5G0TA 4RIEA 2V7QA 3VDMA 1EXWA 3NBKA 2WV7A 5HUHA 5J43A 3SZOA 5J4HA 5U9CA 2AWOA 3PC3A 3RK1A 4C20A 4BNFA 4EHAA 4MUEA 1U28A 2JH3A 5AKHA 5AQEA 3L93A 1A8PA 4O1HA 2BPOA 2QTGA 4PZ9A 1B2LA 2VPXA 3KALA 4PS1A 4QATA 1FLDA 2AXQA 1N8SA 2FP3A 5C31A 4FYIA 5KYNA 3ADCA 4KQIA 4N49A 1RQGA 4RXUA 3AETB 3K5HA 4EAAA 2KHZA 3O8RA 2JZOA 3DDZX 2A84A 1S2OA 1N2GA 2VWQA 5K3BA 4K8RB 1Q20A 2IPNA 1A4XA 3ZZ0A 2HPHA 2HA3A 1DDOA 1JW9B 4BB9A 1OR8A 1UXOA 3TUZC 3L6OO 3B1VA 1JTVA 3GIDA 3C7KA 3DVSX 4M37A 5CK5A 4YGYA 3TDMA 4BMZA 1GAQA 4D43A 4Y6RA 2R6AA 3HJTA 3QNWA 4X1KB 4G0WA 1WQ4A 4PSAA 1HQYE 3DPSA 3H8VA 3FF4A 1AUXA 3KBBA 2R8XA 3DJYA 5JYCA 5I4KA 1IAQA 3IV7A 3CZPA 4D1YA 4E4YA 4OXQA 2X6QA 2AQHA 3W2EA 1HK7A 3K2EA 3N53A 2WF8A 3EWNA 1GPJA 1U9YA 1XZAA 2GPNA 3G2QA 5ITZA 3QEJA 4RV5A 1E1DA 2RGNC 4GZLA 1YRQA 3OHMA 2Q3FA 4Y0AA 4GE3A 1UFKA 1DUVG 5DWDA 3RYFA 3B12A 3SCZA 2KLBA 1AXEA 5CR9A 4YI3A 5K8JB 4WZ6A 2TS1A 3RKRA 1IFXA 1OIWA 3QU4A 4IHAA 4L6IA 4PLTA 3OFND 3A9SA 3QU2A 3KQHA 4DMKA 1YAHA 4KGXA 5I4BA 5JOQA 3EIHA 4RJLA 3WKDA 3Q40A 1YZFA 4JKOA 1QZXA 4H3SA 5BYBA 3DL2A 1C7JA 3D5QA 3LP6A 3QLJA 1WHTA 4AFNA 2PVCA 1U2EA 2CYCA 3OEEA 4JJEA 1L5KA 4B3TB 1VI5A 2GHIA 1Z8FA 3BICA 2H2FA 3SBXA 3ESXA 4YJ2B 3R5FA 4KBFA 1IZ8A 3BAZA 3DMDA 3KM0A 4PX2A 4LGYA 2Y76A 1NRIA 1XPJA 2BC9A 2A9QA 1N33B 3K5PA 3N5KA 1W49A 4C1NA 5K4HA 4I4TF 2FQXA 1KEPA 2YBEA 3O47A 1JHOA 4MV1A 1W47A 5IJ0A 3E1GA 1XBTA 1G5PA 1G7RA 2BN4A 1MU0A 5AXDA 1V26A 2NNWB 4ZU3A 3QM1A 5LP1A 3MMSA 3OUZA 3T6KA 3B5JA 3OUUA 4IO0A 5C1PA 5FYQA 4C7KA 4Q9AA 3SD7A 5GONF 2H1LA 1A97A 1OASA 2UZIR 3VUFA 2Z57A 3P4UA 3F5DA 2AUNA 3UAXA 3IGFA 1Y48E 2EV9A 2QUAA 1XQ1A 2J5KA 4N3BA 5JWRA 1YCDA 4FE4A 4DMUB 3HU5A 3TCXB 1R4MB 2ZE7A 2E87A 4R8SA 2L42A 4Z1MA 2ZYAA 4OEHA 1HDOA 1LLCA 5BW6B 2C3YA 4B4VA 3DBRB 2G40A 3DE0X 4BASA 5BXQC 4K2HA 4C0XA 1FFCA 1AQUA 3P2IA 3ZDFA 1X7XA 1N75A 1T3SA 3KP1A 3HSYA 4OM8A 4JZKA 4V24A 4JIGA 3IURA 3OBIA 1T3HA 2AOXA 2NU8A 1XEWX 2OHXA 1F38A 2WIJA 1M1YE 4Y2RA 4EG7A 2C83A 3H9GA 2QY9A 4IGKA 3MSXA 3OIWA 4ZCRA 3LAWA 1I7DA 4FHCA 5FNVF 4PLCA 2Q3BA 2CCGA 3GRKA 2AFIA 3M6FA 4MKIA 4R7GA 2HNKA 3H83A 4TSFD 3H8WA 3L7IA 5F2NA 1B23P 4WQMA 3WMGA 1DOAA 1OT3A 1FC0A 3CB2A 3EVAA 4HXGA 4LZAA 2IWHA 2FZLA 2YXPX 5EE5B 3SF8B 3ZWXA 4ARZA 4EABA 3QBVA 1VMKA 2X8LA 1OTHA 4V0RA 3HPRA 1MC8A 2EFJA 3GGDA 4LF6B 4UBKA 1UEXC 3VYRB 1AUQA 4IICA 5EJ4A 2HQSA 3LCUA 5GOTA 3B52X 1MO5A 1DGQA 1S8NA 5DT2A 3M1IA 4HXYA 5IZ4A 1TQ2A 2OQRA 5D7BA 5KYXA 1TKRA 1ZGBA 4GQBA 4Z2AA 1T0HB 6LDHA 2AUMA 2GM3A 1WDWB 3A3KA 5AVKA 1RW4A 1II8B 1EFCA 1HYHA 1WXFA 2WU1A 3G02A 3GFTA 1N6NA 1D9XA 1YR8A 2UVPA 1RYEA 2WU0A 3FZYA 3K0AA 4IVNA 1H65A 1GFIA 4RH3A 5FV7A 1YOVA 3AUUA 3IUBA 1NM5A 3AEQB 2OPHA 4E14A 1QIEA 4I8DA 4GMGA 4J91A 4PBTA 4AU1A 10MHA 4MYCA 4RD1A 1DT3A 4DJ5X 3MCAA 3SSMA 3ISTA 1OILA 5DX0A 2WHQA 4LRUA 4AJLA 5H70A 2XRZA 3L6BA 1C3LA 3I28A 5AHKA 4WADA 1QF6A 1LTQA 1E7YA 2M2IA 3BGVA 5CVDA 3BHJA 2EW1A 3VSBA 3AF2A 1JJBA 4NMMA 3F7MA 4MWSA 1QGUB 3PQ7A 1L7VC 2ZBGA 1CVRA 4LYFA 2GZ3A 4RVCA 4EO7A 4E5DA 4DBLE 5LQCA 5AVRA 2XXAB 2IYNA 1CLEA 1P9OA 3ST7A 4DJEC 3Q98A 3RKUA 2CUKA 2D7JA 3CJTA 3B3FA 4BTLA 1SURA 1TQHA 4N9WA 2XMBA 3TZQA 1JIUA 3ROQA 5BNWA 2AX3A 2C58A 4EGCB 4NV1A 4N76A 4DT1A 5EIBC 2CGEA 2DX7A 1RS0A 1VKOA 2BFDB 4Z51A 3IP5A 2PFGA 2NAPA 3L6DA 3QYAA 4FYKA 4ZVSA 3U9SA 3VR6H 2O14A 2W2VA 1HG0A 1IE3A 4F9TA 4O4JB 2WWVD 1ACLA 3ACBA 1FRVA 2Q5EA 3HYNA 4MJ3A 2OFFA 3UJ7A 3FNGA 3NPMA 4N03A 4BYMA 2CKMA 4TM8A 3RB8A 1EXDA 8OHMA 3GARA 3QKSA 4Y2XA 1GR0A 1FTGA 1M8JA 2QS9A 5JNRA 4LXUA 2QJFA 3C15C 5JE8A 4FLFA 4A1FA 1Y6FA 4BQSA 4XDHA 3RTGA 2ONKA 3AV0B 1E5DA 3LQYA 2WWTA 1PVDA 4Q5IA 4WCVA 5KOYA 2QROA 4N7MA 1K8RA 1R5BA 4RHYA 4YUAA 2N75A 3IQEA 1VG8A 4G56A 4QJBA 5CA1B 3HRKA 1LI5A 4M89A 5DTQA 1VPWA 3HBFA 5EMHA 3RD5A 1GPWB 3ZV4A 1Y6JA 1C3VA 2VFAA 3BCUA 3CB4A 5EZ5A 3A1DA 2EJBA 3OEHA 2RGWA 3FJ1A 3WGTA 4K9DA 5A7FA 4O0MA 1UKZA 2BZ1A 3DE7X 3DE4X 2GXQA 2R86A 2JJ1D 1ZEMA 3EWIA 3PHGA 4OXRA 3P0RA 5DYTA 3TRHA 5DM70 1Q1NA 1ZMTA 4M9UA 3TZLA 3WXMA 1XNJA 2C2HA 1B6RA 1CF9A 1BC5A 4PE5B 3O94A 3P5BA 1X7WA 4WWHA 2Z9BA 2HLPA 2Z2YA 3PQ3A 1P6UA 3LM8A 5I7EA 1E2QA 1UBFA 3HUTA 3N75A 4M9CA 1CHDA 1TLFA 2QR5A 2V7PA 3CONA 3DV2A 4ZEVA 1LPNA 2P6PA 3UGJA 5G53C 2IYEA 2EG5A 4Q1BA 4YBZA 4K6CA 5E9WA 1KYIA 4FEYA 3PPXA 2VF7A 4KKVA 5C80A 2FLWA 1YRBA 3AONB 3VDQA 2DHQA 1Q5PA 1G7CA 2P90A 1FE8A 4WT7A 1POXA 5JSHA 1GTSA 4R1UA 4BNZA 4DC0A 4R2HA 2PWBA 1OE0A 3CGWA 2QVLA 2HMUA 1K6IA 3CSSA 2JD1A 1KZ4A 1EBBA 3FB1A 3QPCA 4C4OA 3B53X 4D92A 4LHZA 4EQ6A 5KOJA 2BRUA 1N1MA 2CC2A 4TXLA 4YX9A 4DWWA 1N32B 3MA0A 2BELA 4QJIA 2XTZA 2W8ZA 4YIKA 4ZAGA 4G6ZA 4AXXA 5LLSA 3TTSA 3L8MA 4YQFA 5HJ5A 3D7RA 3HN2A 3H9CA 1C1DA 2X40A 2EZTA 4B74A 4CKWA 3F1KA 4B17A 1ZSYA 1JS1X 3HZZA 4BAUA 3PI7A 3GJ5A 4D42A 4F71A 4NK4A 4HDRA 2QI9F 3F8WA 1NNUA 1T5DX 4OYRA 5CK4A 4L5CA 2EX1A 4FCVA 3T3GA 2PD4A 3FUWA 1HGXA 1U1GA 2BMDA 5CX1B 5DSXA 4F93B 1K4MA 3LCJA 3Q8MA 1PJ4A 1O95A 4HEHA 2AMJA 3GRAA 1A2KC 2R7MA 2F3SA 3K73O 2CLDX 3DNFA 2GRAA 5FF9A 2O7QA 4DABA 4D4LA 5LP6C 3SYNA 3PRKE 3T99A 1G21B 1K8XB 1M8GA 2ZJ1A 2HTEA 3AL2A 5JYEA 1XKTA 2R6FA 4YQEA 1PGQA 3E7DA 4A5SA 4U7GA 1DO2A 2BFEB 1Q1EA 2BMEA 2DPYA 2BUBA 3QX7A 3N2NA 5CDTA 2GWHA 5GIPE 1IZYA 2W71A 1IDOA 2WKPA 2BFDA 2J32A 2OLEA 3QVGB 2YN4A 4BRZA 4JLKA 2PMCA 1B93A 3BL5A 1AGXA 3ZU6A 1GM5A 2VNHA 1D4FA 2Y0BA 4MMYB 4O33A 4PCVA 1C9YA 1QK5A 3DTYA 5TC4A 3SNKA 4L2IA 4BB0A 1RXSA 3OPYB 4PXYA 2B35A 1LNQA 5I6DA 1HZJA 2PNJA 1LK7A 1U3GA 2MYTA 2G80A 4MEAA 2VPYA 3GAZA 1KH1A 1QGUA 2OTCA 2OLJA 1KY2A 4NHEA 1S9HA 4W7SA 4HH4A 4Y2JA 1AOXA 2IHTA 4YAOA 1NNSA 4W8GA 3J81k 1ST2A 4BV9A 1M2OA 4MRNA 4CM4B 2FFQA 3K9WA 3GCXA 4US0R 4MRMA 2PMFA 4X8LA 2ZOSA 3EUFA 3V4OA 4NJEA 2IZ6A 2ZT8A 4K9MA 1EG2A 2HHCA 3WLRA 3H2HA 4R8RA 4UBMA 1U63A 2SCUA 5FPTA 3HO1A 3AEQA 3I83A 1CY6A 1NXXA 1E92A 3QTBA 4JJ4A 3RYHA 2PRZA 1NUHA 2ERCA 3C3XA 5F73A 5JADA 3R74A 2R68A 3BDIA 4Z7JA 2IQIA 2P5SA 3GEGA 3TNLA 2W37A 4H7DA 1QQTA 1ORIA 2XTJA 1YR9A 2J45A 5KSPA 2IV2X 1C81A 2I4TA 2A33A 2Z2KA 3BGWA 2VPQA 1EVEA 4OUDA 3STUA 2GEKA 4JOSA 2DUWA 2BKUA 2X0KA 3IO3A 3T1OA 2MJLA 5EUQB 4F6CA 3L4JA 4X44A 3A1FA 1ODJA 1M1ZA 4LWZA 2X0EA 5CYOA 3TRKA 1ZY2A 1EWQA 1Z68A 3VPCA 1N9KA 3DL7A 4K6HA 5JD3A 3UWPA 4IHJB 2EP5A 1AQYA 1QUFA 1KO1A 1OAOA 2HXSA 1CD5A 3DZCA 4WOPA 3SZRA 3FYHA 3N74A 3NAQA 1C7FA 1D4OA 1WBDA 1MJHA 4FYPA 4PZAA 2UKDA 2P9GA 3ZZMA 5FWXA 3ELUA 4LZLA 4ZAFA 1FB5A 1O95D 5B1DA 4QDKA 1UK8A 3FRJA 4DQ0A 1K3FA 2QMOA 1ZBDA 4RTSA 1GL7A 4CR8A 4LMRA 2I6QA 3GFGA 2JH9A 3TECE 1Y7TA 1NV8A 1R0LA 1DBRA 1E1KA 1HBJA 3RJ9A 2FMHA 1QB7A 4J03A 5CYFA 2H1CA 3M7IA 4DV2B 4EK9A 4DYDA 1JT9A 4ZVTA 2HIHA 3ZPXA 1K66A 3GRUA 1OA1A 3MN1A 3GELA 5BMOA 1P1CA 1Y3CE 3IVGA 2HHLA 5FL7A 3OWXA 3V6MA 1WTCA 3BSWA 1Z5ZA 1GN8A 1P75A 3LUAA 1LDBA 3KWLA 4FMPA 2ZJ2A 4D25A 2ATCA 5H80A 3VVMA 5AM5A 4D9KA 2AF4C 2Y77A 4GNKA 3N6VA 2IW1A 3IP8A 3GWZA 3EVDA 3E2MA 3V6LA 4CKEA 1TZBA 1EHYA 3FUTA 1CKEA 3KKZA 3LOUA 4HXEB 1M2FA 1OQAA 1Z5NA 2Q1SA 4H0NA 3IBSA 4KE6A 5DT9A 3ZCPA 3B9RA 2ZPAA 3NOQA 2XGMA 3EDCA 3Q7TA 1MRNA 4M0CA 2XCQA 1HE4A 2WVHA 1W2HA 3U81A 4E13A 3BWEA 3QTTA 2YIDA 2I78A 3AUJB 2OB2A 3EJ6A 3H5VA 1DEKA 4XVRA 1D1PA 1FXSA 2O5EA 3HDTA 3SBEA 3DMHA 3ASYA 1Q3KA 3HUFA 4JJIA 3K9FC 5K51A 3A70A 4GI5A 3ZE1B 3KB6A 4CLXA 3TX2A 1OOEA 3L43A 3BK1A 4IH4A 8AT1A 4LYAA 1N6OA 1W36B 4PTYA 1L5HA 1N3YA 4G84A 3W2HA 3DE6X 3VPAA 1N3LA 4QJ3A 3L4KA 1UFOA 3R09A 5IBPA 1G42A 3UUGA 2F9LA 4YCMA 1LCIA 3L8CA 1VSTA 2QJWA 3WK9A 1F0KA 3GEMA 3CUKA 3H13A 2C5SA 2BLNA 2ZIWB 2W7TA 4ZI2A 3QVGA 1B6GA 3EA4A 2PR2A 5C5DA 3ILVA 3NBQA 5F3WB 3KPYA 4L85A 4Q3LA 5HSGA 3OTOB 4JGBA 3JRWA 1SPBS 1DTSA 4J6FA 3KL4A 3D2AA 3MCVA 1M6VB 3HZOA 1Y8QA 3MWDA 4ZYXA 2YH2A 2VP3A 2ZIVB 4KPUB 4LYJA 3R9KA 2DTEA 4A6XA 4OQDA 3LDAA 3PHLA 2QZZA 3CEHA 1D2HA 4P80A 2GO7A 4MKFA 3FX2A 4FGLA 2AJDA 1FP2A 3KUCA 4Z99A 1UFQA 1TLTA 2X3YA 1SOVA 2QHXA 3OTIA 4IW3B 4C1BA 2NZWA 2ZWIA 4DLPA 4RE6A 3BWCA 3OKAA 4PYJA 4P98A 1NMQA 2XUZA 1TJ3A 1AHIA 2AEMA 3BKXA 4CE6A 4ITVA 4KVZA 1OXSC 2EIXA 3DOOA 3EY9A 4YEDA 3HJRA 1VHQA 4DQKA 4Z6KA 1NMXA 4YJ2F 1RMQA 2V7GA 1R66A 2GASA 3BB4A 1X8XA 2AMFA 1L4GA 3OQJA 1IB0A 3IVRA 3S81A 1ZVKA 2IYTA 2GXUA 3W78A 4E07A 3H65A 3AB3A 3IRUA 4L3OA 5DRYA 3WXBA 1K1EA 3FTEA 1LK5A 3O8BA 1NHWA 2VF4X 2UV8A 2J9GA 4L22A 4WZAE 5FBHA 5JD4A 3UKDA 3RTCA 2XR1A 2JW5A 1T6ZA 3GQVA 5AHWA 5BOSB 1KAMA 5FL7D 4U7HA 1XD2A 1ZAKA 2QP9X 2ZTLA 4HDKA 1K0FA 1HM5A 3ELWA 3F6YA 1UKAA 1W5FA 2L19A 2AOUB 4CG3A 2MYUA 4A91A 3H97A 1EFAA 1WOYA 4K6OA 3AK4A 4LA4A 1U5BB 2C2MA 1U2SA 4Z0NA 2EDAA 4H4EA 5E9AA 1KNQA 2W6OA 4Q7JB 4Q1AA 3REFA 2CY0A 3I52A 3NHFA 4JDUA 3MJVA 4MWZA 4NFSA 1DZIA 3K1TA 2J41A 3MBIA 2G1AA 4D99A 4MDHA 4P4GA 1N0IA 5FHRA 4CU5A 2ID9A 4EY3A 4ZYWA 1E7SA 1XWIA 2OHHA 3QPDA 4RH1A 2YJGA 3NTUA 5SY6A 2E4UA 1EIWA 2PWYA 3D6NB 3KZKA 4UUPA 4QLBA 2IHJA 5BNZA 2WHRA 3W4KA 1E7WA 3H2IA 1RMYA 3HJCA 4ZDIA 1YTUA 1P81A 1W1IA 1WMAA 4FYMA 3W8DA 2GHQA 3KQMA 3WLMA 3P9ZA 3M3DA 3H1AA 3IQHX 3PTZA 3PPVA 2BBSA 4J2HA 2VEOA 2UVQA 4IJMA 3SFVA 4JJZA 5CA0B 1AJEA 3K1AB 4EM6A 1R0ZA 3R0XA 4ZVPA 1U9JA 2CUZA 2A4MA 2YY7A 3UH1A 1XEWY 3WBFA 4ZC8A 1ZLYA 1SEVA 3KYDB 2XNDA 1QVRA 3C8MA 2O4CA 4JJ7A 3BSFA 2J7KA 4G8CA 3RVJA 2NTJA 1YB7A 2AI1A 2PVPA 4KQ9A 4LPKA 3ZCVA 2C5AA 2OORA 4R0MA 5KWIA 3C24A 2XTNA 3DLHA 4MYDA 1M7BA 1EJ0A 4HV4A 2GM4A 2XW6A 1HRDA 1AKEA 5KS2A 4MS4A 4PWZA 2WWWA 5FD8A 5J4LA 4F11A 2LCQA 1HYBA 2K6GA 3DL4A 2OKGA 3NEYA 1YJ8A 3BYZA 4GMKA 5LBTA 3U7FB 4C5BA 4XLLA 1R0WA 2PEZA 1X9IA 2VAPA 2XSZD 3N8KA 2Z4RA 3BQ9A 4M1TA 4W1SA 5CDYA 1N9GB 4TMWA 3PWSA 1YE3A 2C59A 3LW7A 4EAQA 1SIOA 4M0PA 4IGIA 1UP4A 4XVHA 3VHXA 1FNMA 1V11B 3P0EA 3M6AA 1U3DA 3FMGA 3IAM1 1EP1B 1GUBA 1N0HA 4LJYA 4MQFB 5CU7A 4YFVA 3LXXA 3TI9A 4AF8A 1XZJA 1ZJWA 2V1XA 3GEIA 4RETA 3CIFA 2XIQA 3TZBA 4CIWA 4DCVA 3UHJA 4EJMA 4HLUC 2WPDA 3GRPA 2WG2A 2VKTA 4HI0E 5FQNA 1TF2A 1GU7A 5IM5A 3T7SA 2VDKB 4EPWA 1XU4A 2JAXA 1GZ3A 3DZ3B 4M88A 4V0KA 2UZAA 5ALNA 3Q8LA 1TEHA 2OCLA 3RROA 3EIFA 3R9IA 2ZS7A 1E1CB 4RTQA 5E3HA 2BRUC 4KXVA 4UNPA 2P27A 4ZN6A 4F6RB 5AI6A 2Z3WA 1F60A 1NFQA 1NI5A 2PZFA 5B6JA 2D1FA 1A7UA 3O38A 3OE5A 1GQYA 3PVCA 3KVNA 4AJHA 5KYWA 2IYSA 1RYYA 4DY4A 1IATA 1SFRA 4LFAB 1IH8A 5FWYB 3SF0A 5DB4A 1IVNA 1Z37A 3L7LA 1VCMA 5HJ2A 5BR1A 2X7XA 3LBHA 1LA2A 2A35A 3BMOB 4B3JA 1DARA 4PY2A 3VR6D 3GZNA 2G0AA 4KOEC 3ROFA 2R7LA 1WR8A 1T5SA 1J8MF 3EA0A 2I03A 4EJ2A 4TKVA 4HYYA 5KWSA 2ZZMA 3Q6NA 3DH0A 5HF6A 1TCBA 5U4XA 3O3MB 5KTYA 1ZD1A 3WR5A 1RAAA 4ECEA 4RZ2A 1SM4A 3G9TA 5DNYB 3W3AA 1A82A 3F96A 4CL0A 5LZ9A 1KEKA 2DLCX 3PEWA 1KZ7B 1SCIA 1U7OA 3B7PA 5C7IO 2ZUWA 3TK1A 4PG5A 3KKMA 1Q7GA 1W5AA 2WWHA 2ZT5A 5FIUA 1V3TA 3OLXA 3RVQA 2ZSJA 4BO3A 4Z3KA 3V7WA 3THSA 2C07A 3GEBA 3TL3A 1DWPA 2VNAA 2W2TA 3RVOA 1YDMA 3Q7EA 4S1WA 1HETA 3F3MA 4ENPA 3DUFB 2HO5A 2ZAMA 3AR3A 3DXZA 4ZO9A 4I9FA 4A16A 3HA3A 1SVNA 1HO3A 1EX7A 2JJYA 4UC0A 4CR7A 4F8JA 4NE2A 2HQRA 4WLUA 4B3XA 2DQYA 1QLWA 2I2FA 4DAOA 3VOTA 3TDNA 2I7DA 1JEYA 2XTAA 2AZDA 1KO7A 2D2FA 2QRVA 2Z0MA 1JMKC 4PM4A 1M34B 3AUSA 3UQYS 4EUNA 2Y4OA 3AVQA 3EPKA 1ENYA 1P7VA 1I8TA 1RXIA 1X1QA 3G89A 3JTEA 4UAVA 4D97A 3KJIA 1OLSA 2OCAA 2R8OA 2QSJA 1V2GA 2AG5A 1BMFD 2HF8A 2I4IA 4IEIA 3K4HA 4ZARA 4CXMA 4OX9B 3SBDA 3T52A 4K6MA 2IELA 3CRZA 2PDAA 2V6MA 3EAGA 2IU4A 2W6ID 3G7SA 3T0FA 2A6PA 2FN3A 1CULC 4CV2A 1VJCA 1RVV1 3A3NA 3PDJA 1KVQA 1PP4A 2VCYA 3HCEA 4HRVA 4I55B 4MYTA 4B40A 4MH0R 1NMEA 5DE3A 1HSZA 3NKFA 4F4IA 4A0RA 5BW8A 3ZD9A 1GZDA 4N6GA 3Q0TA 2PTHA 5J9GA 4AMBA 1X70A 4TROA 3N05A 2C2YA 1RYNA 4JXJA 4J43A 1Y89A 3NGXA 5E8JA 2PRKA 3KO8A 4ZYTA 4DLUA 5HYVA 1Y1PA 3SI7A 1J0BA 1K75A 2GPYA 5LYJB 3KSAC 5KYWB 3QE2A 3BCHA 3GYGA 3H2ZA 3VR4D 5KOHA 3H5OA 4ACAA 3C4VA 1RYFA 4O4IB 4AUNA 4TZ0A 5CCXA 1F6DA 1L5YA 1MFPA 2ES4A 3T54A 1K5GA 1XFDA 3MTIA 4R2WA 2GM5A 2VWHA 3K2QA 3CH4B 3A1WA 3OZDA 2X0FA 1G8SA 3BILA 4CT0A 4S04A 2NP6A 1GRCA 4PFJA 3HFSA 4XCQA 3G7UA 2F1RA 5DEOA 3M6UA 5TRTA 3H75A 1L1EA 2PUVA 1PJCA 3MWKA 3OEHD 1B8OA 2E5WA 2QN1A 2ZLBA 5ICGA 1QB8A 4PCAA 1ULUA 1K98A 3OG9A 3LPAA 1XMVA 4XR4A 2FKAA 2Q9CA 3ENVA 3JWPA 4IDOA 4XQ0A 1FRZA 4HB2A 3EVFA 4G1BA 2CWDA 3B1XA 2ZSKA 2HU7A 3CGGA 4FD3A 5ALRA 3WYGA 5JPCA 2XMSA 4AZTA 1TPZA 1H42A 3EG5A 4HN2A 4DR1B 3M5DA 3QEOA 2O2XA 5BSRA 5FPKA 1C0KA 1XXLA 2DTXA 5ESDA 3F9RA 1CFJA 2HFKA 2QMYA 4PHTA 4EY4A 1BX1A 4EFLA 3Q5EA 1YZQA 5ADHA 2ZCVA 1P4SA 2WJZB 1WXQA 1ZKMA 4JY7A 3T5DA 4B4DA 5KU7A 4PF1A 3MEQA 3OUTA 4CBVA 2J67A 4F4FA 4B45A 3I53A 4FMBB 5CPBA 1T9HA 3D8NA 2PSEA 4DGQA 1XZNA 3LD9A 2O4UX 3HUEA 3WZMA 1DXOA 7ABPA 2QPTA 1U8YA 3PJFA 1SOWA 4AZ0A 2QTFA 1QIDA 3O8NA 2FFHA 2ZWMA 2OV8A 4C6HA 3WNQA 4PN7A 4DCPA 1QORA 1YACA 3H5LA 2H7VA 3ZY4A 3C3WA 4GSKA 1C3XA 4MUBA 2JASA 1V7CA 4BJ1A 3SIXA 3KJFA 4BN0A 4DM7A 3T9BA 2MSNA 2EQBA 2TMGA 4ZK2A 1B74A 1WA5A 2HSEA 5E6UB 1Z4QA 1DRKA 1E8NA 4NNOA 3KHSA 4LY6A 1E6KA 3GEEA 1KYYA 1F1BA 2GLUA 3DDSA 3VPGA 3ONDA 1KHHA 1G8HA 3MTJA 4ZO6A 2CLEB 3GUUA 4ZZ3A 1CS0A 2P77A 1OPRA 4N5IX 1P7YA 5ERYA 3I2GA 2OEPA 4OFWA 3EEYA 3GDFA 3GLSA 1KMQA 1R4AA 4YR9A 1HDIA 1DXQA 2B94A 2Q3LA 3CX8A 2YHBA 1UMCB 4H16A 3HABA 2HO4A 3DHEA 4D96A 1KPGA 1W0KA 3KSRA 5SICE 3OJXA 1RJGA 2QZJA 4NDZA 1M0WA 2IYXA 3GPLA 2CMKA 1NVKA 3B82A 2WNIA 3NIDB 1V8ZA 4FQ5A 2AOWA 2GPSA 1XWWA 2Q0HA 2XNHA 2A1UB 4J7CA 4PZCA 2IT1A 1FVHA 2FE1A 3EC7A 4YI5A 3TI7A 1NXSA 1GA4A 1ZUD1 4KYIB 2HA7A 2NUAA 2Z1DA 3BMQA 3N2LA 2IBMA 3IFSA 3EGDB 3LQKA 2AXPA 1X7GA 5M3BA 1PE0A 4KPFC 3UMMA 3R9WA 3FSGA 4G1FA 3RV3A 2OUIA 2FRVA 4G8BA 4R98A 2R6CA 3EXIB 2B2XA 1WPQA 4B7CA 1QU2A 2C1ZA 1YB4A 5K2MA 4C2AA 3NNSA 1EP2B 1J24A 1E3IA 1PT6A 5IS2A 3DBVO 2NADA 2WAYA 5IP5A 2IU0A 2YMLA 3OICA 1XYYA 2Z4SA 3WRVA 5IFKA 2YFKA 3A6JA 1G4AE 3H4IA 2AYZA 1JFVA 4QYSA 4UE6A 4EA6A 3ZHOA 1JV2B 4NP6A 1C3OB 1LI4A 4UHCA 1YS7A 1JE1A 3ZCTA 4JP3A 4CLDA 2FWMX 2EJWA 3UMBA 1F8UA 4DIBA 4OXKA 5B3KA 3F6EX 4Y9DA 2RH9B 1SQGA 2DHEA 5EIWA 2WTMA 2LCIA 3FSGD 3RT1A 3ZD7A 3WL8A 4FYWA 5FTKA 3UENA 1XAJA 4Y67A 4P8RA 1VFNA 3W6ZA 5BORA 2Z6UA 1GL6A 2FH5B 2HQOA 2GBIA 2R6JA 2VZLA 2E5FA 3OQMA 1SU4A 1ND6A 1NNI1 1QO7A 1X7YA 2FPMA 3CJQA 3S2FA 3A4NA 2PBRA 2P1RA 2YYSA 4Y2VA 1U0EA 4CW7A 4ZMSA 2FWAA 1YHYA 1MMFB 1QTNA 3QEMA 1IDN1 4II2A 1QJCA 3MCZA 16PKA 4YJDA 3UNXA 3V7YA 4KMOA 1WDKA 3LDUA 2G1KA 4XQEA 3AUYA 3LPMA 3ZOZA 4Z86A 2VA8A 5FOQA 3ZD6A 4BMSA 3K70D 3HWRA 5DYNA 2YQ4A 3KD2A 3SX0A 3R8CA 1G2IA 2AMYA 1Y6QA 4NESA 3GDWA 3DZ4B 4EGJA 1G3MA 2OO7A 3HC7A 3KUKA 4RHXA 4XJSA 1X86B 1GV1A 4LRQA 4EFKA 5HRUA 4WEOA 4KREA 3C3BA 1FDSA 1NIJA 3FMFA 3GNTA 1C1HA 4P4SB 2I71A 3EEIA 3PX3A 1KQNA 3UGKA 4DDWA 5BSHA 1ISRA 1FQJA 2Q2QA 3L49A 4FW9A 1GRNA 5HIAA 1KZ9A 3OC0A 3D8TA 1TRHA 1IHYA 4YPOA 4YAUA 4YCSA 1KRXA 4F5DA 1KK1A 2FP4B 1R8SA 2XADA 3KQQA 4IDGA 4UUMA 4YRRA 5H81A 1SCAA 2VJOA 4FGSA 1DVRA 1O96A 4QM6A 3RM3A 2VNKA 2CLOB 1QMPA 2H0AA 3MJRA 1THGA 4XM1A 3VR3A 4BGUA 5DN6D 1LQTA 1UWKA 1K6MA 1UCFA 2GN4A 3OEWA 4RE5A 1LRJA 4DIUA 2XWJI 1I72B 3HXLA 2PH3A 4UM7A 3C97A 2EGUA 5JT1A 3LSTA 2KBEA 4LYHA 1QGED 4LTNA 3H8SA 3S2EA 2HWYA 3TLCA 2HF2A 1ZD9A 4B3CA 4BV3A 4XLTA 1EE2A 1JBQA 1P45A 2O2CA 1P7WA 1P9WA 1C4KA 3NBAA 1DEOA 3PFCA 3STYA 3KD3A 3P5SA 5KWJA 1YASA 4FFNA 1C4XA 4G5RA 5GQSA 1J20A 1HA3A 4DSAA 2AKEA 4MEBA 1GZSA 4WZAB 3E1KA 2ORED 1GD1O 4FMDB 4UKDA 4MKXA 2QXYA 4Z54A 5DCLA 4OX9Y 4OFXA 1CUXA 2IC5A 3KLNA 3PFKA 1H5NA 1U9IC 3DQZA 4JIMA 5IK2A 5A3SA 4AWAA 3W5CA 2ZITA 1ESMA 3QBJA 3FWPA 4D9IA 2IODA 3NYIA 3WIBA 3SAJA 1OFVA 3V3KA 3V2HA 2GCGA 2CFTA 3CUTA 3NIGB 3FDZB 4DMRA 2GN2A 5DX8A 2DFNA 4G1VA 1I2BA 1MB9A 4QL3A 3DZKA 4RKEA 2FPOA 3INTA 3FF1A 4PZUA 3IWBB 2EXXA 3W6NA 5K8TA 3UMSA 3A7EA 3U3RA 4PIVA 2C96A 4P4NA 3OCZA 5JZOA 3WA7A 3QY9A 1C8KA 3OX3A 3FSEA 3QXHA 4MZDA 2A57A 1M0EA 3VBEA 4QUJA 4M9XA 4OJTA 1LLUA 2KQUA 3I9LA 3NPAA 1CE8A 1VE3A 4G81A 3SSAA 2PGJA 4NBWA 4XIJA 2JKVA 5L95A 2VQEB 1S89A 1ZHFA 4ZO8A 1ZR2A 3KXDA 4BP3A 4AMYA 5ELLA 3FB4A 3GLGE 4I99A 5TJ9A 2R1TB 3WNZA 3QIVA 1TMYA 5G1NA 3GJ4A 2PGXA 1FLNA 2VDNB 5HQTA 2BBOA 5IPFA 2FR0A 4TSFA 1R8YA 4HUJA 3EGWA 5G4LA 3K53A 1XRSB 5DGXA 4RZIA 3LOPA 5CXSA 1TNDA 4UZEA 3DMNA 1NONA 4CJXA 3KLOA 2CXPA 3AFOA 1ONOA 4RPKA 3RG8A 3BD7A 2C8JA 1ULAA 3H9QA 3V1NA 1SCBA 1Y80A 2F1JA 3AI2A 4ZOLF 1IEQA 2ZI6A 2GERA 5CG1A 4O4LB 3D5EA 4IDCA 4N5HX 2VDMB 4P6VF 5IH3A 3TTYA 1Q0SA 4F2GA 5AW8A 4TQGA 3DTVB 1PG0A 2AG6A 4XSHA 2IZOA 5A03A 4TMFA 4W5OA 5LKRA 4GP9A 2AEJA 4OMUA 4YALA 1RHMA 3KOOA 3DAHA 3JASB 3RK0A 5EKXA 4O1IA 3UK2A 4RPJA 3HGTA 2O1XA 1BXGA 2CHEA 1THMA 1GKKA 1U1EA 2NXCA 1L5FA 4EX6A 2AS0A 5CAEB 2QYSA 1S6YA 2VZ9A 1PNRA 1X0VA 2VOJA 5LKAA 1CHNA 2Z2JA 1K5DA 2P9ZA 3OF3A 4MGEA 3AH8A 5E0OA 2R6DA 2OQ2A 3OQIA 3OZAA 4QTZA 3WG9A 4RJTA 1CEYA 2RJ3A 5G4KB 3IO5A 1Q91A 4S1NA 4HNUA 4N5NA 3SZLA 3VPFA 4J4HA 2IDZA 1DIOB 421PA 4PYQA 2RHC