3ZDFA

Structure of gapdh with cp12 peptide from thermosynechococcus elongatus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
total genus 121
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zdfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zdfA01
1DLIA 2WSBA 4HFNA 2NACA 4BGIA 4E0BA 3CUKA 3JQ9C 4M1QA 4FCCA 2P68A 1LDEA 4QX6A 2VRBA 3C1AA 4XJTA 4PZDA 4GX1A 1HE5A 1YXMA 1ZMOA 2HK9A 1R12A 2D4AA 2Q1WA 3HE3A 3OJEA 3NGXA 4HUJA 2YV2A 3O8QA 4Y6SA 4DBVO 1B8PA 5KKAA 2VCYA 3VTZA 5L95A 2FSVA 5AQ1A 2ZATA 3A1NA 3FN4A 3DEYX 3KLPX 4QO8A 4TRJA 4UVGA 5HBRA 2Y1OA 1RM0A 3LC1O 1U3WA 3TZKA 3ZU4A 4WOJA 1BXKA 1LX6A 2H9IA 4I9NA 4IS2A 3ANLA 4YWJA 1NNUA 2HO5A 4WCFA 3MJTA 1QORA 5A9SA 1D1SA 1I32A 3JQAB 3A28A 1KVTA 1Z45A 3LF2A 4BGUA 4KQXA 1F06A 3MJSA 3D3EA 4IQ0A 1B15A 1AHIA 4YJFB 5L3ZA 3IP1A 1KEWA 1H9BA 3A14A 4E33A 4R41A 4YAJA 3VOSA 5THQA 4RL6A 1U2DA 1ZH8A 2EP7A 4GVXA 3WLEA 4BNYA 5LC1A 2CDCA 2OORA 1YB4A 1YBAA 3RROA 2C54A 2O3SA 2W90A 1CIVA 1Y7TA 5A06A 1K0UA 4Y6PA 3E48A 4CODB 1EMDA 3RFTA 4HADA 1LDGA 3V1TC 3VH4A 1GCOA 3OP4A 4O59O 1ZMTA 3KV3O 1YL5A 1NTOA 4DLLA 4J2HA 2VNSA 3GLQA 4IY1A 3KSUA 5CDTA 3Q9UA 1TEHA 3BIOA 4BNTA 3L4BC 1J0XO 2ZTVA 2O3QA 5MDHA 2DM6A 1DB3A 1UP4A 1MUUA 2O3RA 2Y05A 1LSOA 4BO2A 1NR1A 5I7VA 3UH1A 3K73O 3VTFA 2ZYAA 2DTEA 3Q3CA 4RV9A 2R00C 1F17A 4GI2A 4Q3NA 1LBEA 5HA5A 4J0FA 1H5QA 2C29D 2IXAA 2QRKA 1Q1NA 3W1VA 2G5CA 3AI3A 3IJRA 3LT4A 3VHRA 4GX5A 4B3HA 4AJKA 1OMOA 2F1KA 3LQFA 4RF2A 3D0OA 4S1VA 4ND2A 4EZBA 1T4DA 1BGVA 3H2ZA 1HLPA 3GEMA 2PKRA 5JMWA 1Z6ZA 2D2IA 3JQFC 3OQ1A 4WLFA 4GSKA 3F3SA 5CEEA 3JYPA 2IRWA 5L4NA 3JQ8B 2R2GA 3SC4A 3G0OA 3GRKA 3ROKA 1QYDA 4C7JA 1P45A 2J5RA 1HZZA 2OZPA 4RVHA 4GGPA 4BKPA 4J1QA 3AWDA 4ZD6A 3EZLA 3DC2A 4UVDA 3TL3A 2RCYA 1NASA 4BNHA 1EUCA 2BI7A 1WW8A 4W99A 5DP1A 5JFOA 2YV1A 3H9GA 2BFPA 1FK8A 2BGMA 3GQVA 1TT5A 3CSDA 3DMYA 5K6AA 1WDLA 3PHLA 3ZW8A 1E1KA 4YYZA 5DCWA 3AUAA 1V0JA 3OA2A 3V5NA 3HDJA 3VKVA 5K0ZA 3DFUA 5DT9A 4JJGA 4TROA 4B4WA 1A71A 4ZU3A 4IJVA 1U4OA 5G0WA 5JAIA 4R9RA 1SB9A 4P4LA 4RCVA 1Z7EA 1F8FA 3D3WA 3VVCA 4ONEA 4Q9NA 3TDKA 4YTEA 1DFIA 1W6UA 4AJ4A 4UUNA 4ALJA 1T2CA 3CTMA 4WE3A 3F5SA 3JQ9A 1ZJZA 1GU7A 3WGGA 4NIMA 4XYMA 4IDEA 4RLSA 4ZICA 3GC6A 5DP2A 1V3UA 2PR2A 1R37A 2BGLA 5U4QA 4K26A 3U0BA 1JKIA 1XSEA 5A9TA 3N7UA 4HWKA 5B4TA 6ADHA 4II2A 3WB9A 3EVTA 3UVEA 4IQGA 4HNGA 4GWKA 1I30A 1ENOA 2Y1CA 4FOSA 2BELA 1JWAB 3DWFA 2JD2A 4YT5A 1B8VA 2NVWA 3GFGA 2W2LA 3GRPA 3OFSA 5DBFA 3WX0A 1ULSA 1WP4A 3AI1A 4WECA 3RJ5A 4MVJF 4DQXA 1U9JA 3HQ4O 1F0YA 1GQ2A 1M76A 2Y93A 4WKGA 5CP8A 3NAQA 4RZHA 4EYEA 1K6JA 3FD8A 1BDBA 3IS3A 3RFXA 2DTXA 4YDRA 1GPJA 2WYWA 3LT2A 2X0IA 1PSDA 4U8GA 2Y67A 1PL6A 5H82A 1E6EA 1EVYA 2Z1NA 1Y8QA 1UUFA 1ZSYA 3WJAA 1DIHA 2CDAA 4BKUA 4CM5A 2J3KA 3NV9A 1ZK2A 1NHGA 2JD0A 3D1LA 1Y8RB 4AJPA 2FR1A 4EGFA 4PZCA 1MLDA 1H94A 3O38A 1H2HA 1GCUA 2ZYDA 4FN4A 1TB4A 2QX7A 2JHGA 1U7HA 1YOVB 3NTRA 2OP0A 1ENZA 4RDIA 4BNWA 5I8ZA 4FD3A 1P31A 2HLPA 3L4BA 3C7DB 4LN1A 2GYYA 4WNIA 1J49A 1ONNA 3T4XA 4IJUA 5A02A 4OXYA 4O0LA 1SEVA 5F5NA 1VPDA 2GZ3A 1XDWA 2GN4A 2R00A 1H0KA 3E82A 4JN6B 5JCXA 4DPLA 2EIHA 4DGSA 4NQZA 4Z0PA 3GT0A 1GAEO 3GHHA 3OEWA 2EGGA 2C20A 1MG5A 1I3MA 3QLJA 4I5FA 3SXPA 2AHRA 1UXIA 2GUGA 4JXKA 3PPIA 5CAEA 1UZMA 3WNQA 2C7GA 2VT3A 3CH6A 5BSEA 3C24A 1B26A 1DHRA 3ZWMA 5CDSA 4EUFA 3IOYA 3L4SO 2NTVA 4MIOA 5G0TA 2ZKLA 1U3TA 4UUOA 1MXFA 2GNAA 3I6IA 2GN8A 4M49A 5ENDA 1HDXA 2DUWA 2FZEA 3AJRA 2CVZA 5KJCA 3JYOA 5L7WA 2ZIZA 5DN9A 2B36A 4TRMA 4E5KA 3ZNOA 4J91A 2GF2A 3G17A 3KYBA 3IJPA 1LA2A 3SVTA 1VJ0A 4OM8A 4W9NA 3EDMA 1JDJA 3JQAD 3MWEB 2PD3A 3N58A 4TSKA 4E32A 4S3MA 1CYDA 3D5QA 5HS6A 3QQPA 3GVHA 1VL0A 3R0IA 4WLNA 4BV9A 3S2EA 1ONOA 3I1JA 5ITVA 4CM4B 1E3WA 2YHUA 2C59A 4J16A 1HT0A 3GGOA 4MKXA 1R0SA 3M2TA 4A26A 2OHXA 2O4UX 3G49A 3QVSA 3NJ4A 5JC1A 1K89A 2O3UA 5C37A 1JWBB 4OKNA 1AE1A 4PLFA 1EE9A 4Q3EA 1B2LA 4B8ZA 4E5MA 5LCXA 3BHJA 1BXGB 1Y5RA 3ZNQA 5T57A 3CINA 3H5RA 1VC2A 1H6DA 4IJKA 3GGPA 1T2EA 2RIRA 1I3LA 3GDGA 4K28A 1ZUD1 4OMUA 5DOVA 4CQLB 2NVUA 4BL5A 2V6FA 4CV2A 4DYDA 5IXSA 3IKVA 4BO4A 5TJHA 4YJHB 1UR5A 4IDCA 2ZJ0A 1QG6A 2RHRA 1MC5A 2AG8A 2UYYA 4D45A 5CFZA 3OQ6A 2CUKA 1KY4A 3TWOA 3ZNNA 4J9VA 5JYEA 3BHIA 1YGYA 2EERA 1DC3A 4BGVA 2TMDA 4JK3A 2J3HA 1FJHA 2WD7B 3WBBA 4MIEA 2C5AA 4ALKA 1YB5A 5C5IA 2H5LA 4PLHA 4RORA 3NT4A 2PTGA 3DOJA 4CUKA 3RUEA 1Q0LA 4O1MA 2FWMX 4TKLA 3DR3A 1A9ZA 3NDRA 4XWYA 3STHA 3WGIA 2YHIB 3S2GA 2JFFA 4TZTA 3GZNB 3L0DA 3X2EA 2GLXA 3DBHA 2I3GA 3L77A 4ALLA 5G0UA 3KZVA 2YZ7A 2VTEA 1AXGA 4BO3A 3IIEA 4HFRA 3WICA 1KC1A 3GMSA 2WJPA 4YJGA 3WGTA 2CY0A 1E1MA 1DHTA 1SNYA 2DBZA 2A9FA 3I4FA 2Y1FA 2Y99A 4QQRA 3ENKA 1Q0QA 1FMCA 2G76A 4LSWA 1ENYA 1GQQA 3RQSA 3O26A 4PVDA 1ISHA 4KMSA 1FDTA 4I8XA 3ZHZA 5A03A 3WYBA 2BHLA 5C7OO 2BI8A 4U7WA 1GUYA 4OOEA 4DC0A 1GZ4A 2OMEA 4R69A 1RYDA 2RH8A 4CMCA 5ILOA 5JO9A 3AM4A 4RPGA 1PJTA 4AL4A 4FC7A 1X14A 4Z9YA 3PQFA 5TJ9A 2NTJA 4FGWA 1NFQA 4UEKA 4L9RA 5I7FA 3RC7A 3CMCO 1LDMA 3DTTA 3U4CA 5FWNA 3BMOB 4YBZA 4GPD1 2LDBA 4FIZA 3JD3A 4D44A 2FPIA 3FNFA 1B14A 2OFPA 1QR6A 3T7EA 2WD8A 3BTOA 4J7XA 1UXJA 4D0SA 3DAGA 3M1AA 1NWHA 3OIGA 4Z9XA 4INAA 3DL2A 4DLBA 4U5QA 4O63O 4E2ZA 3CPSA 4CLOA 1XLTA 1WDKA 4FFPA 1M2WA 3AOGA 2P2SA 1F14A 4PN3A 1SO8A 3P19A 5TT0A 3QRWA 3TOXA 1GZ3A 4JP2A 1P1JA 3VH2A 3ORFA 3PHIA 2IEDA 4KDEA 4JIGA 3JQAA 3OETA 5TQVA 3DXFA 1TT7A 3OJ0A 2PFGA 4YJFA 1BTOA 1C1XB 5F1PA 4J90A 3AI2A 3FTNA 2P91A 3LZ6A 1PQPA 1GYQA 4MVJD 1I33A 1IZ0A 3ON5A 3K6JA 1ADCA 2QYSA 2VZ9A 3M2PA 3D64A 1X1EA 1VSUA 1L1FA 2W2KB 3IAHA 4YACA 5FEUA 3K2BA 2P4QA 1HDRA 1N7GA 4R1UA 4RQUA 3QWHA 1U28A 3H3JA 4GKBA 4XQCA 5IN5A 4R51A 3G1TA 1PR9A 2GRAA 4BKRA 2X8LA 4ALNA 3HZZA 4DL9A 1Y9EA 1SAYA 1PZHA 2JCVA 1SOWA 4ID9A 4UVEA 4XA8A 3ZGYA 4CR6A 1TA4A 1S7CA 4HKTA 4QUKA 1PJ4A 3EY4A 3GF4A 2IDZA 5IDWA 4OJNA 5JYFA 3H4VA 3QW2A 1CQIA 4RGBA 1H6CA 1E5QA 3HSKA 1T1RA 1Y81A 2YQ5A 3WYEA 3F1KA 5IF3A 2VZ8A 2I66A 4G5HA 4H15A 4MKRA 4CUZA 4I1IA 4OXNA 3K9QO 1ZJYA 3IQDB 4E2YA 3I9MA 2PWZA 1R4NB 3INTA 3BMQB 1KVQA 1H9AA 5CPBA 4DIFA 2IYOA 4B79A 2CF6A 3FBTA 5A4DA 3GAFA 1E7SA 3JYLA 3SJ7A 2POQX 4RPJA 1A7AA 1R4MB 3I3OA 4BKQA 3P5SA 3RKRA 3CXRA 4U0JA 3UICA 1RKXA 3PDJA 2VHZA 1DIAA 4MJLA 4LVCA 3HB5X 1I36A 5I9NA 2B4TO 3ETDA 3RFVA 1PJ2A 5IJZA 3GG2A 1K5HA 5JBIA 2NQTA 3QVXA 4C4OA 4YT2A 1NP3A 3BMNA 5JC8A 3PWSA 3HG7A 1GY8A 1WVGA 3FHLA 3JQDA 4NR0A 4GLOA 4J43A 3HWRA 4B3IA 4JBIA 1PZFA 3DBRB 1ZSVA 1F8GA 1GEEA 1UDAA 3OIFA 4IDDA 4D3SA 4YRBA 4QECA 4RPKA 4WEOA 1EEHA 4XRRA 4DPMA 1LLCA 2DTDA 5KVCA 4CLXA 3NRCA 4PLYA 3F6YA 4CMEC 4CMKA 4JCOA 3V8BA 1JW9B 4OAQA 4WEQA 4CM1A 2DKNA 2EHDA 4J6FA 4TZKA 1QRRA 2VUSA 4CLEA 4XD2A 2JJYA 3K5PA 1PQWA 4EDFA 1RM3A 2EG9A 4DWVA 1U3UA 5ILGA 3HDHA 3MEQA 1QYVA 3KYDB 4K9DA 4MO2A 1LNQA 3HFSA 2VN8A 1LC0A 5IZ4A 3A06A 1BW9B 3CKYA 3X2FA 1NFRA 4ESOA 1ZXBA 4RPHA 1LRLA 3VPFA 3ICCA 5BQFA 1PGOA 5EQDA 1UZLA 5G0VA 2PKQP 2HRBA 3UCFA 2AQKA 2QYTA 4D79A 4AICA 2AQ8A 1NVTA 2VOJA 4FFRA 3ZWAA 1ADBA 4BGEA 3B6ZA 1CQJA 1DBVO 4LK3A 3GN2A 1WPQA 2X6TA 3JSAA 4MVJE 1ZVMA 1L7EA 4XB1A 4MP6A 1PZGA 3DB2A 5TT1A 1O5IA 3BA1A 4RO0A 3D4NA 3GGGA 5JY6A 1YL6A 2O7QA 2P5YA 1HE4A 4F6CA 4IS3A 4WLUA 3TZ6A 1GQYA 4F45A 1X0VA 2FR8A 4KUGA 2HCTA 2EJVA 3DFZA 2YQ4A 2AE2A 2ZCUA 3WWZA 4R9SA 4W6ZA 3RU7A 1LSUA 1JQBA 1PEDA 4YB8A 4CV1A 2Y0CA 3OF2A 3AY7A 3O03A 3I4CA 1LLDA 4KOAA 1HWYA 1T2FA 4ZRNA 2B5WA 4MOWA 5EJ2A 3PJEA 3RJ9A 3B70A 4A2CA 2E49A 1HE3A 4GVLA 4RF4A 1H2BA 1IE3A 5ICSA 3AW9A 5CDUA 4J4BA 2AQIA 2WTBA 1E3JA 2HMUA 1ZKMA 3ZV3A 2OOSA 4J0EA 1Q7GA 4AVYA 1UAGA 1K6IA 5JO0A 1LTHR 3JQ6A 2NADA 1K6XA 3FR7A 4NBVA 5CEFA 3GVXA 4DBZA 1GD1O 2O4CA 2D0IA 1WNTA 2NM0A 2B5VA 1YOVA 2VYVD 5T8KC 2EWMA 5TLSA 1HYHA 3KSDO 5COAA 1MV8A 1O9BA 4M89A 1MA0A 4PIVA 4XX0A 1HE2A 3Q2IA 2B37A 2E37A 3DBLB 3PWKA 2HJSA 2W8ZA 2QZ9A 1M6HA 4NDNE 1B0AA 1ISIA 1C0LA 2FN7A 1DRUA 5AYVA 3QV1A 4Q3AA 1YJQA 3QIVA 3WMXA 3DAFA 1A4UA 1N5DA 3WG9A 4PG4A 4XYGA 4CLRB 1EBFA 2X58A 3ZWPA 3WTBA 1GV0A 4PG8A 4WCDA 1I5RA 2PGJA 2X1HA 2A35A 5A3VA 3MWDB 4URFA 4MVJP 2HUNA 4RVSA 1ZK4A 3F5QA 2ZQYA 1E6UA 5U1PA 3GVIA 4ZHSA 1YONA 3NGLA 3VZSA 5DCUA 5JDCC 1P0FA 2FPGA 1JKJA 1E6WA 5GZ6A 5EIOA 2CVQA 3ZHXA 5JLAA 4D0RA 3DO5A 4UUMA 3WFIA 4YRDA 1PIWA 4CQMB 3HFGA 3FNEA 2EW2A 3LT1A 1UXHA 3EUWA 1PWXA 5L53A 4CMEA 3I9LA 4TRRA 4E12A 1SZJG 1NAHA 3NDIA 3DDNA 4ZN6A 1DO8A 1LDBA 4D41A 1KERA 3P2YA 3KLMX 2DBQA 2YJZA 2X9GA 1MG0A 1D7OA 1WZIA 4Z0HO 1EDZA 2X5JO 1BG6A 1E1NA 1RYEA 5J23A 2CDBA 3GNSA 4D3FA 1IYZA 1BSVA 4J4HA 2FMUA 3W6UA 4Q39A 3V2GA 1D8AA 1BXGA 1PS8A 4D42A 3QSGA 4IINA 4CMIB 3ENNA 4B7XA 2ZQZA 4N5NA 5EQFA 5L7TA 3HNPA 3GH3A 2UDPA 2RH4A 4CQLA 3BTSA 3TJRA 4I08A 3ZHBA 4PG7A 2VUTA 3SEFA 4FC6A 3KEOA 3MZ0A 1B3BA 3DZJA 4L8VA 1VM6A 4YJHA 3NTOA 2A94A 4DUPA 2C82A 1DSSG 3AM3A 4K6CA 4BQPA 3ONDA 2VZ0A 2HMVA 5B12A 3IKTA 4GWGA 1KY5A 1ZK0A 4GX2A 4AJNA 4Q3DA 4ND1A 5JDIC 1K3TA 3WYCA 3RBVA 3PFFA 4G2NA 2C7VA 1PS9A 1N9GA 3OECA 5F21A 5JYDA 5EPOA 3PDUA 4FW8A 4XQGA 3GVPA 4BO6A 1Z82A 3RVDA 3GG9A 3KYCB 1GYRA 1NPYA 3ZWNA 1I2ZA 4TVOA 4JROA 5I9LA 2FR0A 1ZK1A 4WPGA 3GZNA 3BMCA 1WMBA 3KO8A 4UVIA 5TNXA 3E6AA 1CJCA 3GMDA 2GPTA 1OFGA 2X5KO 5HRUA 5BNTA 1LDYA 2VYVA 3PHJA 4QSMA 2JAHA 4J7UA 2NU7A 2X4GA 4DYVA 5CDGA 1AXEA 2CMDA 3RKUA 3PYXA 1UXGA 3LC2O 2O2YA 3NJ8A 4L0QA 3EMKA 4QT0A 5AXDA 2Q4EA 1T1SA 1WWKA 4HY3A 3QHAA 2C2XA 2V65A 4Z3DA 3I23A 5B37A 1ARZA 3PLNA 4CR8A 4YJDA 4IDFA 2B4QA 2FPPA 1AHHA 5L45A 5T8KA 2BF7A 3S2FA 5L4SA 4J1SA 3JCZA 3ZN2A 2Q1SA 6LDHA 4IQ8A 2YUTA 4CL3A 2OBYA 1I2BA 5TC4A 1SB8A 3P2OA 4QTZA 4BV8A 1XR3A 2B35A 2Y66A 5U9CA 2DAPA 3ICPA 1ZNQO 4L4RA 4NU5A 1P1HA 4EUHA 4CV0A 1YB1A 3BMOA 2FY8A 4WLVA 4D3DA 2AMFA 4XDYA 3RC2A 2YFHA 1KS9A 1MB4A 2E82A 2PY6A 3KOUA 4W4TA 3DBVO 1G1AA 4FDAA 4B8WA 2NQ8A 4GSLA 2ET6A 3BHMA 3FR8A 3WLFA 1O94A 5JAQA 2GCGA 1C0PA 2A4KA 4O5OA 3SBOA 4BO9A 2DVMA 3BTUA 3PFWO 3W8FA 1HDOA 2PH5A 4FSHA 1PU2A 3OHSX 4LVUA 3DTYA 1Y5MA 5JDCA 3JQGB 1X7HA 1W0CA 1PQUA 3D4OA 4NG5A 1PL8A 4A27A 2D5AA 3GEGA 4OIMA 3WS7A 1DEHA 3JQEA 3MOIA 1T4BA 2OUIA 2WYVA 3COSA 1C1XA 4U6QA 3PZBA 3IUSA 4NFYA 1V35A 1IOLA 1MP0A 3H9EO 1JLLA 5KJFA 4IUYA 3C7AA 4NFHA 1XU9A 1JKFA 3JQFA 1PX0A 4N54A 5JAMA 4XYLA 3EAGA 3ULKA 1Z73A 1BHSA 3E9QA 4WNCA 1I8TA 4PRKA 4BKOA 3S1LA 5DNAA 4ILKA 1VRWA 3R3SA 3VPGA 4QFDA 1P9LA 1U7TA 1DC6A 3U4DA 1E7WA 4BO8A 2Y1GA 3ABIA 3F47A 1ZEMA 3SX2A 4NI5A 1U5CA 5T67A 5KIAA 4R54A 2YY7A 4Z0TA 1ONPA 4RVFA 4B7UA 1QYXA 3AFNA 3VC7A 3RUDA 4CMGA 1DFHA 5DF1A 4XRGA 3FWZA 5LDGA 1NR7A 3WIDA 1E7MA 1YH3A 5T6BA 1YBMA 3U5TA 2V6BA 3AOEC 3JD2A 4TKMA 2V6MA 5CHEA 3KVOA 1R4NA 3TFOA 2AXQA 4Z9FA 2Q49A 1V3TA 1VL6A 3WDSA 3F46A 4IDAA 1M75A 4EJ6A 4O6VA 5COBA 3UCEA 4NH4A 1JU9A 4XJSA 4PG5A 1P33A 1R4MA 4EUEA 1EK6A 1GV1A 4BVAA 2HMTA 3GA0A 3GZ4A 1BMDA 3FPLA 3E03A 3WBFA 4MP8A 2WE8A 4Z6KA 3H9JA 5ICMA 5DBIA 2VTDA 3GNQA 4AFNA 5G4KB 3MJCA 4TMFA 3EC7A 1HTBA 5TSDA 4IXTA 4K1LA 4B3JA 5C7LO 1E3LA 1E5LA 4E31A 3E1KA 3K92A 3JQCA 1IL0A 4FFNA 2AW5A 3S55A 4NMHA 4FB5A 3MTGA 5A5FA 3DZBA 4LISA 3OEYA 4WGGA 2VYND 4DTIA 1KBZA 4NBRA 4PZEA 4WOKA 1C3VA 2EGHA 1H93A 2GASA 3RCBA 5KKCA 3UKOA 2OBNA 5L40A 4KDFA 3BXXA 4DMLA 4FR5A 1G6KA 4ND4A 3SJUA 3D3WB 4CM9D 1UDBA 3ZU5A 4D43A 5BSFA 3GPIA 4DREA 2CNBA 4N7RA 3BTVA 3DOCA 2PZMA 3H65A 3W4IA 4CQMD 2B69A 4CLDA 1T2DA 1VI2A 3KYDA 4J3FA 1FDWA 4WJZA 4YCAA 1ZEJA 3RI3A 4BMVA 1PTJA 1DIBA 1U8XX 1DLJA 5FF9A 3H6KA 4IPTA 2NSDA 1U2GA 2NU8A 1Q2XA 2GO1A 3DONA 3TNLA 4J7CA 1JA9A 4AJJA 4BNFA 2RAFA 3AU8A 3P7MA 3VPHA 3OIDA 4GL4A 1R0LA 4FJ0A 4E5NA 4BMSA 4TRNA 1LRKA 4BO7A 2NNLD 3RD5A 1ZIDA 5ES3A 5IN4A 5HM8A 3DAPA 5H81A 1DC4A 4W7IA 3PHGA 4E6PA 1A4IA 1EFKA 3I9JA 1A5ZA 3VDQA 3WR5A 3AUSA 3U49A 1HXHA 1LSJA 4DQUA 1HRDA 2Z95A 3QWFA 3GDOA 4L73A 1EK5A 1KEPA 3OJLA 4FFLA 4CPDA 4LMPA 3LC7O 3GOHA 1OC2A 3IP3A 1ZXLA 3QE3A 3VZRA 3DZGA 2W4QA 1LQTA 3CE6A 1GTMA 4FOOA 4HFMA 1OZAA 4XR4A 3L6OO 2HK7A 4NJMB 4YAGA 1AUPA 2IEBA 1KVUA 2RHCA 1HL3A 1QMGA 4LGVA 3I5MA 2ZTMA 1TVEA 2UUOA 4CM3A 4W82A 7ADHA 2I9PA 2IE0A 3Q0EA 2CZCA 2AEJA 5BSHA 2I65A 3I9OA 5JCJD 3ZWOA 1HDZA 3ZWYA 4A5OA 3S2IA 4YAKA 3L6EA 1WLYA 2EP5A 3VH1A 1GUFA 2X86A 3JD0A 4NJOA 2HAEA 3WGQA 1QV6A 3DZFA 3PJFA 3ZWWA 1HF3A 5FYDA 4BNIA 3HJAA 3S8MA 1PJQA 1NX6A 1EFLA 4MVJI 5JE8A 4NBUA 3JQBC 2JFGA 5ADHA 4AJOA 2DQ4A 3B1JA 2D8AA 3ADPA 4LW8A 3RBZA 3VH3A 3OMLA 1O95A 2GN6A 1S6YA 1LU9A 3ASVA 1XGKA 4XGNA 3W6ZA 5L7YA 3ZNPA 1O8CA 1HYGA 1UDCA 3L6DA 2ZJ1A 1X15A 3AOEA 3DBLA 2D5CA 4IGEA 3NX4A 3GNTA 1OOEA 3B1FA 5F3RA 4PG6A 1A7KA 5A1TA 4BS9A 3UW3A 3H5AA 3WXBA 4PLWA 3F4BA 4AJ2A 2C07A 1E92A 3OSUA 3NDJA 2WE7A 2Z1MA 1YL7A 3PJGA 4BIIA 5JW6A 1FXSA 4BQRA 4RF3A 3ZH2A 4CLRA 1NYTA 1ZSNA 2PK3A 1IUKA 3NUGA 3ZV4A 4KTTE 1GPDG 2G0TA 5F5LA 3UN1A 4X54A 1A27A 5JNLA 1XA0A 1M66A 3U09A 1I0ZA 2DUUA 3EGOA 1HLDA 4RVGA 1CF2O 3FPCA 3PEFA 1DC5A 3WGOA 4M8SA 1Z74A 3MCVA 5HWSA 3E8XA 1DJQA 3K30A 1NAIA 1Q0HA 3O9ZA 3RU9A 4YT8A 5A5EA 5CG2A 4CM9A 1KOLA 3A4VA 1GR0A 4R1TA 1EVJA 2BD0A 2Q4BA 4NK5A 4DA9A 5C7IO 4RLHA 1I01A 2CSUA 3U62A 4WLEA 1RPNA 2HMWA 4R01A 2FZWA 2HK8A 4LCJA 2Y0DA 3JQ8A 1P77A 3DZKA 4E5PA 1IB6A 1X0XA 4F46A 2YDXA 3AUTA 1G0OA 3ZI0A 1JVBA 4XIYA 1O0SA 4R4JA 3F4LA 1N92A 4JQCA 5HTOA 1NQTA 4WASA 1HSOA 1PR3A 3FRJA 3TQHA 1HEUA 4PRLA 2Y1EA 5T73A 4DMMA 1HDCA 1X7DA 2J3IA 3KM0A 4B7CA 2ZTLA 1MFPA 4CMIA 4J1NA 4H16A 3Q11A 3NTQA 4GAEA 1T25A 2UUPA 3NEPX 3WFJA 3EW7A 3B20A 2Q2VA 4ND5A 5GY7A 1N2SA 1YDEA 2VQ3A 3Q6IA 3H5NA 4XIJA 4I5DA 3BAZA 1SPXA 2O2SA 3W4JA 2YYYA 1EQUA 5EESA 1V6AA 3QA9A 4DC1A 4HP8A 4WLOA 4YXFA 4JNKA 1HDYA 2HQ1A 4E2WA 2Q99A 4TQGA 1PJBA 4CM6A 1LUAA 4PLTA 1BXZA 3GUCA 3CZMA 3V2UA 3GUYA 3WSWA 2DLDA 1KIFA 5EINA 2QG4A 5CDYA 2P5UA 4LCEA 1DJNA 2PH3A 4KUHA 1D4FA 3DBHB 4AJHA 3KYCA 1YKFA 1DPGA 2DU8A 2I3AA 3OM9A 2YV3A 1HYEA 2I76A 2CFCA 2VWHA 3GHYA 3PIDA 4CR7A 1U3VA 4ROSA 4DXHA 3ZV5A 5IDQA 5JY1A 3WSVA 3N74A 4GLLA 5KWEA 4HNHA 2BRUA 2Q3EA 3HN2A 2Q46A 5IXYA 4MVJA 2WEKA 3DZHA 1N7HA 3GFBA 4XR9A 4FS3A 4H3VA 3HB4X 3RUCA 3PGJA 1TXGA 3ZV6A 1R15A 1DAPA 1RJWA 1ZK3A 3KEQA 2X5OA 3EZYA 4EI2A 5TX7A 3H8VA 1MX3A 1M6WA 1XWFA 3LSYA 3ZW9A 3TZQA 4NPCA 4YR9A 1O89A 3HUDA 1E1LA 3QVOA 4ALMA 5CPFA 5EMHA 4E3ZA 1ZBQA 4AJEA 3U4HA 3AK4A 1LXCA 1N8KA 4CM8B 4XYEA 3LLVA 3FCOA 1XIVA 1DRWA 2GR9A 3RAJA 5KTKA 3JQBA 2I99A 1NQAO 3ZU2A 3WGYA 1YWGO 2ILTA 1J4AA 2G17A 2WMDA 4Q3BA 4EJMA 1ZO8A 2FRDA 5AOVA 3VPXA 3WOHA 1E77A 1XEAA 4Y98A 5BNIA 5F1OA 4JLWA 1FDSA 4XGKA 2FSSA 2DBVO 1KVRA 3AM5A 4OL9A 5G4LA 5LDHA 3D4PA 3ANNA 2NVBA 2DFVA 1Y8RA 3L9XA 1DRVA 4HBGA 5TGDA 1GUZA 1UJMA 1NFFA 5I8WA 5TF4A 1PJ3A 1OC4A 4IM7A 4BNVA 2XAAA 2QRJA 4PLCA 1IPFA 2HKIA 3AY6A 4EJ0A 1C1DB 4CLOB 3KUXA 1FDUA 4IMRA 1QSGA 1W8DA 4MDHA 4YVFA 2ZB4A 4M86A 4Y8VA 4DIBA 3WGZA 1TI7A 3QWIA 4DLAA 3ZWCA 5IDXA 3UFXA 4BB5A 2EXXA 3INGA 4GX0A 3TF5A 4XB2A 2DPHA 4NBTA 1SOVA 1ID1A 1OBFO 2IXBA 4B4VA 1PL7A 3JQGA 4BNNA 3TFQA 3E18A 1JVSA 2VWQA 2XF8A 1UZNA 1KETA 4PCVA 3AFMA 3TRIA 1FF9A 2UVDA 1YJ8A 2PZLA 1HKUA 1P1FA 2W2LD 2Y68A 3E5RA 2X9NA 1YQDA 2GD1O 3IUPA 5CG1A 1NWCA 2XXJA 3UHAA 5FI5A 4GH5A 2BFMA 1K2WA 4R68A 4B4UA 4CJXA 5JSFA 4RDHA 2EKPA 4CMJA 1PJSA 1YE3A 1Z7BA 2DC1A 3D7LA 4DIOA 4RF5A 3LU1A 2EEZA 3GR6A 4BNZA 2PZKA 2QW8A 1HETA 2G1UA 4P22A 4CL8A 1A72A 2PV7A 5T5QA 3SLKA 1IZ9A 1IHYA 4N5LA 4H7PA 4OOFA 4A0SA 1IPEA 2BLLA 5I7EA 4NZ9A 1KVSA 3G79A 5ITWA 1R66A 1EDOA 4JJFA 1JAXA 1VE9A 4C7KA 1ENPA 3TSCA 3CIFA 1Q7BA 1CERA 3VPSA 2J3JA 4JP3A 4G65A 5DDIP 3I6QA 3TOZA 3KETA 4E13A 1VSVA 3DZIA 5DBGA 4CM4A 3ZHYA 3IMFA 4UUPA 3OH8A 3C7CB 2P9GA 3DHNA 3WJ7A 2P4HX 3LVFO 5JPIA 3MJ4A 2GDZA 3JV7A 3OJFA 1QP8A 3R1IA 4L74A 3HADA 5L51A 1DXYA 5DULA 2X0JA 3IDSA 1B16A 2O7SA 4HFJA 5GZ1A 1YQGA 5HS4A 1ISGA 3BMNB 4QXMA 4R5HA 2NUAA 3JYQA 3QY9A 3OJOA 2D1YA 2H1SA 3FF4A 3RASA 1NQ5A 1U1IA 1BDMA 3WGHA 1V8BA 4XCVA 1LLUA 5G4KA 1E0DA 1ZW1A 2NV6A 1C0KA 2NU9A 2UV8A 1X7GA 5GMOA 1GDHA 5BT9A 2EW8A 1MC4A 1YDWA 2Q50A 5AXCA 2JKVA 3IL2A 2PZJA 5M6DA 3I52A 3V2HA 4J49A 4PFJA 1UAYA 1WZEA 4EW6A 1M67A 1QYWA 1YO6A 3JQ7B 4W9NC 1UXKA 1QV7A 2WD7A 4AJLA 1BVRA 4BHTA 3ZWXA 1DDOA 3C8MA 2O3JA 4MVJH 2B0JA 4ZVVA 3KRTA 1PWZA 2BGKA 5DOZA 4YRAA 5I9MA 5KVQA 4GMFA 4OQYA 3UCXA 5KNLA 2CD9A 3H3FA 4F3YA 3KHUA 2YHIA 1NVGA 1B3RA 4YAIA 1DIRA 5G2OA 4YQZA 2BFAA 2WWRA 3NT2A 3FWNA 2W98A 1Y9AA 5DCYA 2IZ0A 4NU6A 4ZQFA 1XKQA 3UF0A 1V3VA 1ADGA 1H6BA 4CMBA 4WUVA 3WNVA 3Q2KA 3I83A 1O6ZA 4LRSB 2UAGA 1NPDA 4TVBA 4AG3A 3D5TA 1P44A 2OGUA 1T2AA 3ADOA 1B8UA 2AEFA 3GAZA 4WK6A 1P1RA 2ZTUA 3JTMA 4N18A 2X7HA 4KTVE 8ADHA 2NLOA 2HJRA 4XQ9A 4IZIA 3OQBA 4P8RA 3I9NA 3PTZA 2ZCVA 2JCYA 4LMRA 4FQ8A 1PGNA 4L76A 4BB6A 1DOHA 9LDBA 4OSOA 1RM5A 3I9KA 3MOGA 4NFSA 4HV4A 5BSGA 1P1KA 4CM7A 4CV3A 3AUUA 3W4KA 3O8QB 2E4AA 3QVWA 2PGLA 1CEQA 2Q22A 3QJ5A 4CMAA 3GEDA 5BNFA 2ZYGA 5BR7A 1QKIA 3M1LA 2X0NA 4P4GA 4BNMA 4NJMA 1EVZA 1VKNA 4A73A 2GSDA 4D46A 5GZ3A 4I5GA 4TWRA 2Z5LA 4WCFB 1WXDA 5FFFA 2NTNA 5TRTA 1ZFNA 4ALIA 5A9SB 2GZ2A 1F12A 4MP3A 5J9GA 2X23A 2QIOA 1GFSA 3PLRA 1W73A 2ZB3A 4BNXA 2A92A 1E7RA 3RIHA 4K6FA 3WTCA 2VOEA 2QQ5A 3GPDG 2DBRA 2WM3A 4FFMA 3RUIA 3WWYA 4ZQGA 3SLGA 2BH9A 5JYAA 1LJ8A 4BUCA 3TZHA 5G0SA 4FJ2A 1QXSA 1LEHA 2VUUA 4QEDA 3Q1LA 1IHXA 1I10A 1Y6JA 4LRTB 1NPTO 1P3DA 2P9CA 3HHPA 2C2YA 3QWAA 5COQA 1CDOA 4JX8A 4M54A 4ZRMA 4R3WA 1N1EA 1I2CA 2EV9A 5AXBA 4PLGA 2W2KA 4I9HA 3PRJA 1QLHA 4OKIA 3PK0A 3ST7A 3WQRA 1ML3A 1Z75A 3H9UA 4EEZA 1XCBA 3CMMA 4MVJM 3ETGA 3PP8A 3E9NA 3E9MA 1LRJA 5H83A 4MINA 4NHEA 1E3IA 3EHEA 3QP9A 3ZWBA 2BFOA 2H6EA 3NKLA 1D3AA 1D1TA 2X9VA 1UP7A 2AEMA 3JYNA 2O48X 1NM5A 5KVSA 1ZCJA 2O3TA 2ZK7A 3PGXA 3PQDA 3B1KA 4BO5A 5F1KA 4XYBA 1B7GO 3QWBA 2DT5A 1YQXA 3KBOA 3OBBA 4OYRA 3K96A 1CETA 5CEJA 5ENVA 3KB6A 4XZ3A 1JTVA 4MVJG 4CLHA 1AGNA 1SCUA 3TZCA 3UUWA 4PLPA 4F6LA 2Q45A 4Y9DA 1U5AA 4Q3CA 4ZQBA 1DIGA 4B4OA 2WDZA 3HDQA 3KSZO 1KYQA 1W4ZA 3BMQA 3U9LA 2PD6A 2EKQA 1R0KA 3RUAA 2PD4A 1MGOA 4YT4A 5EL0A 1BRMA 2Q1TA 2X0RA 2JFHA 3BZUA 4IGFA 5JDIA 3LF1A 4IDGA 4IXWA 1UP6A 2J5QA 1UH5A 1VL8A 4KWIA 4LSMA 2I6TA 3VVBA 1CRWG 3H2SA 3T7CA 3OICA 2V7PA 1NQOA 1GZ6A 2FHSA 3W8DA 2O23A 4E2XA 4IZHA 2R6JA 2JL1A 4DVJA 2B4RO 3EYWA 4GGOA 2IZ1A 4GBJA 3VDRA 4YAEA 4DQVA 2VRCD 5T64A 3TPCA 5IZCC 3QVTA 3F1LA 3DQPA 2YDYA 4JGBA 2OO5A 2VNAA 3PWZA 2VHXA 4OQZA 1JAYA 2J6IA 3VZQA 3DBRA 1ULUA 4MIYA 1TT5B 2H63A 3INRA 2QHXA 2HRZA 3BYZA 1WAMA 3FSRA 5JAZA 5ER6A 1AN9A 3C85A 3M6IA 5JS6A 4IJWA 2VWGA 4E30A 1KC3A 3ONEA 4Z3KA 3DHYA 4RJTA 1E7QA 4ZGWA 3ZWVA 3ANMA 3PI7A 1GEGA 1LDNA 4IIUA 2DPGA 3G3EA 4KQWA 2NWQA 3A9WA 1E7YA 2VHYA 4J1TA 1H6AA 2LDXA 2GERA 2O50A 3RC9A 2Q2QA 2VHWA 1C0IA 1LQUA 3PQEA 4KUEA 4UEOA 5DZSA 7MDHA 3PZRA 1N9GB 3C1OA 5IAAA 1BW9A 4BNLA 4YEDA 1I3KA 3IC5A 2JD1A 2XXBA 4R1SA 1YRLA 3TL2A 4E4YA 3RBXA 4PGFA 4FJ1A 3V1UA 4NBWA 1TLTA 1BWSA 3ZU3A 4YPOA 3RUHA 4P38A 3VAZA 2V6GA 4BO1A 3GY0A 1SEPA 2YW9A 3BMCB 1A9YA 5EERA 2E6UX 2VT2A 4AJIA 2SCUA 3DMTC 1E3SA 5JMPA 3LLSA 4IIVA 5B1YA 1J6UA 2PLAA 3JD4A 4RVDA 4PLVA 1GADO 1P74A 3KXDA 5FI3A 5L4LA 3ZDFA 2OP1A 4YQYA 5KJ6A 5L9AA 1N1GA 2VWPA 4XKJA 4ITUA 1EVIA 2EKLA 1I24A 4EEXA 1PJCA 1DAOA 1XELA 2IODA 4HX5A 1IY8A 3FNHA 1ORRA 2OL4A 1PGJA 1GYPA 1XU7A 1PZEA 4ZQHA 3RSHA 4RVUA 1C14A 1NVMB 4A10A 4OSPA 4MPDA 1MFZA 4II3A 1Y8QB 4Y67A 1P1IA 4OHUA 3RUFA 5KCZA 1NBOA 2C5EA 4OH1A 4CM8A 4W7HA 1VLLA 1KEUA 2IYPA 3PXXA 4XEHA 3OA0A 1YBVA 2NU6A 3MJVA 4L4XA 1QYCA 3SC6A 1HZJA 1X1TA 5TS3A 4KWHA 3Q9NA 2Y0EA 2I5PO 1XYGA 3NT5A 4GQAA 5A04A 1L7DA 4RQTA 3U3XA 4I5EA 4UULA 4ZQEA 2VHVA 4NK4A 3ROQA 4J9UE 1SC6A 2YFQA 4A03A 3DOOA 3HN7A 2XOXA 4JBHA 1PJLA 2BMAA 1C1DA 1IULA 3PHHA 4BOYA 4JBGA 2D59A 1VJTA 4FFOA 4ZA2A 4BNJA 9LDTA 5I7SA 1XG5A 3ETEA 5IG2A 1QLJA 2HMSA 2CF5A 3FNGA 4U0KA 1ZZEA 5C3MA 4I9UA 2E48A 8LDHA 2CVOA 2J8ZA 1I3NA 3CEAA 4NNJA 2PKQO 3MTJA 2ZB7A 4E5YA 4M55A 3E5MA 1E3EA 1NHWA 4OXKA 2HSDA 4XDZA 2VRCA 3WIEA 4U6SA 4P4NA 2J5KA 3AU9A 5KOIA 2Q2WA 3PIIA 2FP4A 4R16A 2RBEA 4WCFC 1LC3A 5B4VA 1OI7A 1KEVA 4DPKA 4L4SA 2VYNA 2HDHA 4FBGA 3PVZA 4KZPA 1CWUA 1PGQA 2EF1A 2TMGA 2OXIA 3TN7A 3PYMA 1X13A 1EQ2A 3WMWA 5A3JA 5TIIA 3VKUA 1ISFA 2BKAA 4XQEA 1R6DA 4BMNA 5IZCA 2GZ1A 3PYLA 4ZJUA 1MXHA 4FGSA 4GMGA 2Q1UA 2EJWA 1YVEI 4MKZA 1EUDA 2PA3A 2JHFA 2QZZA 1P0CA 4R5MA 1OAAA 4FPXA 4GKVA 4R1NA 4CQMA 3CZRA 1U4SA 3ROMA 1JN0A 3F9IA 4BNGA 4G81A 2PNFA 4D7AA 1RWBA 3HDYA 5KVVA 4DRYA 4RZIA 1XHLA 1E3WB 4BO0A 1VJ1A 2C0CA 1G0NA 2HU2A 5THKA 4OO3A 1T24A 1VKOA 4IBOA 4UVHA 5A9RA 1PGPA 2AA3A 2AQHA 3ASUA 3FBGA 3ITDA 4BNKA 4L75A 4PLZA 3FTPA 3FI9A 4A7PA 3PJDA 3L9WA 3GDFA 1Y1PA 3W8EA 3L07A 1T26A 1Q7CA 4J4TA 3R3JA 4KP7A 3AY3A 4R3NA 3GK3A 4HXYA 4CMHA 3T4EA 4UREA 2NVUB 3EVNA 5KJEA 1HDGO 2P9EA 3K31A 4IMPA 2AE1A 5MGBA 1LI4A 5AXAA 1PS0A 3H7AA 3UXYA 5A05A 2B83A 3GVCA 3RC1A 4RPLA 1ISMA 1EUZA 1XQ1A 3DMTA 2D3TA 1FDVA 4CUJA 3VZPA 3LYLA 1DFGA 3G1UA 3R6DA 4AJ1A 2DFDA 1EBUA 4N5MA 4ND3A 3GN1A 2GN9A 4OGWA 1ADFA 4BNUA 2X22A 1SMKA 2QRLA 5K9ZA 4XGIA 3LT0A 2GGSA 4UAGA 3MJEA 3JQ7A 4YA6A 1YS4A 4QO7A 3ZZNA 5B4UA 3LDHA 2F00A 3UOGA 1V9LA 2FOIA 4EBFA 2G82A 1J5PA 2XPCA 5JCJA 3EK2A 3ZCXA 3DHEA 3NYWA 3ROPA 2ZB8A 4PVCA 3RWBA 4IDBA 1WMAA 3C3XA 1HSZA 3UAGA 1BVUA 4J2OA 5KJ1A 5EN4A 1LSSA 4YJGB 1U8FO 2WYUA 4JJIA 3U4IA 5JXWA 3WQQA 1LLQA 1SBYA 2I67A 1WDMA 4M87A 1GL3A 5K6AC 1XQ6A 1EZ4A 5IFLA 2PGDA 4Y6RA 4UEJA 4EITA 3K2EA 2IZZA 1R16A 3H9QA 3ITKA 4QFCA 2AG5A 3K8ZA 1EE2A 3KTDA 1ISJA 5ER9A 2JAPA 5AVOA 3WQSB 1RM4A 3ONFA 3V1YA 1NXQA 3LK7A 5IDYA 2JCXA 3O4RA 4E21A 3C1TA 3UGKA 3JD1A 2Y1DA
chains in the Genus database with same CATH superfamily
3RS5A 1FOEB 2WSBA 4HFNA 2A1TS 5IH3A 1KPHA 2IOFK 3A05A 4PPQA 4NOKA 3OOSA 1C3JA 3JQ9C 2ETXA 4YGYA 4XPZA 4N8SA 2QN2A 1NC1A 4QX6A 3OPYA 2MYUA 2IBTA 3C1AA 4HQFA 3SHQA 3WMGA 2WG1A 5AD1A 2VG8A 2GCIA 4LZLA 1YXMA 5DYGA 1W581 2HK9A 3NOOA 2YUIA 3OJEA 3L4KA 4BVBA 1Z0SA 1CVLA 3HB9A 2NPOA 4KQCA 2YV2A 1MVLA 4DBVO 1M1XB 1P2UA 2CL5A 3SF8A 4LK2A 2PFKA 3FYSA 2IOFA 1REQB 4TRJA 5AQ1A 1QHHB 4DCCA 4F21A 3DEYX 2P6OA 4G85A 3SBEA 2P6MA 1RM0A 3LC1O 4G37A 4U9HS 3TZKA 2E1PA 4ZVPA 3TNDA 4G4GA 1CB0A 1X86B 1YQ9A 4X6XA 2QVCA 2AHOA 5HF8A 4YWJA 2QTFA 5B64A 4ER3A 4AY2A 4WCFA 2HO5A 3HJRA 2QLLA 3B2EA 3KLBA 4I2VA 3Q8KA 3CZ5A 3N59A 3EOAI 3QFFA 3WJ2A 4BJ6A 4FD2A 4BGUA 4C0SA 3ZQ6A 1F06A 2E3JA 5CH8A 4P5DA 1UBJS 1WCIA 2VJKA 3LKDA 3HCEA 3MJSA 4PGHA 5JNTA 1Y5LA 3AFIA 1RRFA 4UMEA 4YJFB 2BHTA 3A14A 3IELA 4EKYA 2QJOA 3VOSA 5EMLA 2EZTA 2EW1A 4WA8A 3HL4A 4UUAA 3UJ3X 3LZDA 2EP7A 1Z4LA 1O9HA 1XXHB 2NZJA 3TDMA 3DBOB 3LG2A 5DLDA 4KE6A 1YHYA 2QK4A 3REFA 3R9XA 3T9EA 3OQVA 4M7RA 2O3SA 2W90A 2VCHA 4POAA 2FPMA 1CIVA 1QK5A 4D8TA 3QX3A 2NT4A 1K9SA 1RBZA 4CODB 4F5WA 4ZC8A 4B09A 5LUAA 2OCPA 4H7IA 3LK6A 1L6IA 1NI5A 1P39A 3TSAA 3IWCB 4PYJA 1ZMTA 3KV3O 1KJ8A 1NTOA 3GLQA 3BSFA 5C3UA 4CKEA 3ICOA 4TS1A 3AKDA 1CQIB 3RRXA 2Y9MB 2O8EA 4M9UA 3CJRA 3Q9UA 2Q3CA 4U2BA 5CDTA 5IKPA 2FLKA 1WW3A 3HCOA 3C87A 2IWHA 1J0XO 4UCXA 1T4GA 2W2TA 5C4GB 3GP3A 2NPFA 3VX4A 1JDPA 5IT5A 4H77A 5DSXA 1KEZA 1T5TA 4Z9BA 1MUUA 2MR5A 2O3RA 1LSOA 1OXTA 2Q0XA 4BO2A 1NR1A 2LGJA 1JZTA 4MITA 3UH1A 5I7VA 3E3MA 3VTFA 2AH5A 3Q3CA 4GXTA 2FUEA 1TAGA 2JIDA 4MK4A 4CTJA 2FUNB 3ZCPA 4J0FA 1H5QA 4HDKA 4EOGA 5LMNB 2ZSFA 1DXHA 1GUAA 3LY5A 4DFDA 1JHMA 3H1PA 4K9QA 1NBEA 1W5SA 3LT4A 1C4WA 2WDPA 4MQEA 2A58A 4GX5A 1HBJA 4AJKA 3JRNA 2XUZA 4E1AA 4RF2A 3KJHA 3EPHA 2GWHA 5KSOA 4EA7A 4Y1FA 4RD2A 2XI4A 5BPFA 1W93A 1HLPA 5JMWA 1G6HA 1WVIA 4I1RA 3K9WA 1U80A 2ZRIA 3H3XA 1IDOA 3NI2A 5ITZB 1WD7A 4GSKA 2V1UA 3IP7A 2IRWA 5L4NA 3Q6NA 3G0OA 2P4EA 4LJ9A 3UJ8A 3THYA 3U9TA 2GBGA 1JJ7A 1OHHD 3T3OA 2OZPA 1J2JA 5FUXA 5K0CA 4BIMA 4GGPA 2H2FA 3W5SA 5M5BA 4QUJA 3VU3A 1J06A 2ZT5A 4LZOA 1Q22A 3KUCA 1MKYA 4XASA 3DC2A 1U9ZA 4UVDA 3VGPA 3IHKA 1W8IA 3E3AA 1XE3A 3PC6A 2QN3A 1M73E 3HKDB 3QLUC 2BI7A 3AEUB 3DCNA 3FROA 4ARZB 8GPBA 3EPBB 1F20A 1QFJA 3U7QB 4R8MA 5DP1A 5D51S 4BE4A 4DIMA 4RPCA 1KKUA 2YV1A 1NI4B 1A7JA 1FK8A 1QH1B 3MCWA 5DGXA 5JTTA 3S99A 1TT5A 3IBFA 2C1XA 3EGXA 3GA5A 1AZSC 3VHXB 5K6AA 1Y3IA 1E8NA 1X8KA 3KTFA 3PHLA 2ID8A 4Z51A 2I91A 4KN5A 1NQUA 2LVBA 1RJ9B 1BJTA 2F59A 3AUAA 4YIHA 1XU4A 3HJCA 3UHJA 3BCHA 4JJGA 4B4WA 3BB3A 3BWCA 9ATCA 2KLHA 2Y1KA 1U4OA 3GLHE 1LGYA 1QHGA 3ETHA 1Y63A 5G0WA 4RCVA 1AQJA 1UJNA 2ZU0C 4IUDS 1KTIA 1F8FA 1ZOPA 4DUZB 3WLPA 1O03A 3EPLA 4UHJA 4PXAA 3TDKA 3D4LA 5D85A 1Z7YA 3PCTA 3T3MB 1ZUNB 4AJ4A 3TG2A 1KO1A 2R4UA 3RBAA 1D09A 1XDBA 5E4YA 3ILVA 3AT1A 1ZJZA 3B1ZA 2Y2UA 3BICA 3L0OA 4LJ6A 3ROEA 4WOCA 2P9ZA 4WZBE 2MMCA 4XYMA 5CRIA 2IGTA 4YMUA 3OQMA 3UK0A 1AKTA 3RJMA 5IULC 3OT5A 2BGLA 4L5AA 4ZKEA 1FRQA 3LO8A 1CQJB 1VDMA 1W6RA 1Z12A 5EZYF 2OV3A 1KJQA 4ETWA 2DPXA 2ZSUA 2XMRA 5A0VA 4MSUA 2ECFA 3N7UA 2VDWB 5B4TA 4ZYZA 3Q15C 2X6QA 3U2QA 3WB9A 3EVTA 5ARBA 1DC8A 2I33A 5AVYA 3H86A 3G2IA 5DT2A 4GWKA 5FORA 2HWKA 3L40A 3BIXA 2BFDB 3AESB 4BFZA 3A1DA 1BCSB 5LKAA 1NYLA 3DWFA 3NHPA 4IR7A 2O8CB 4YT5A 2A2ZA 3NYQA 5IJ0A 1WXGA 2DFPA 2Q6TA 2CVHA 2PSJA 5J1SB 3GFGA 3GRPA 5HBGA 3O9VA 2WWGA 1S9HA 3PQ2A 3GJZA 2F8SA 1LBHA 3CRMA 1WP4A 4WECA 4D2IA 4EECA 4DQXA 2QDKA 1GQ2A 3ODGA 4C21A 1M76A 1BN7A 3QXHA 4CFSA 4Z1MD 3NAQA 1K6JA 3FD8A 2ZI3A 2O20A 3IS3A 1OXUA 3LGSA 4H4CA 1E9SA 2C2BA 2DWPA 5A4MS 2Q3MA 3TW3A 4BMZA 2VATA 1SKBA 1WUJS 2BPOA 1TX4B 1D2GA 2PL3A 5H82A 1EVYA 2IIBA 3WMRA 5A4IS 3FTEA 1Y8QA 3QEMB 4WZ6A 1UK9A 4TWJA 5K0EA 4BKUA 3ZR4B 1VKZA 2LV8A 4MTCA 3EYAA 4C89A 3KVNA 2EBWA 1RPJA 4ZU1X 1NHGA 1MPTA 4QG7A 5EEGA 2B21A 3REGA 4EB0A 4Z2AA 5IRCD 1MABB 5DYNA 2W37A 4K6MA 1M1NB 5LA6A 3ZK7A 5DRTA 1J1UA 4I6EA 1G8MA 3G0CA 1XAJA 2QTRA 2MSWA 1U2TA 1GCUA 1C2TA 5BR8B 4C4AA 5T4FA 4BN0A 1CG6A 2NYVA 2CLOB 3HJGA 4G6ZA 5DYWA 4C5AA 2XCTB 5C1DA 3JARA 1JQEA 5HRAA 1OBCA 1Z17A 4FD3A 2H3EA 4KXNA 1R0RE 1ODFA 3THXB 3C7DB 3FPEA 3GNLA 5FOTA 4JA2A 4WACA 4WNIA 2Z09A 4QDKA 3T4XA 4DUGD 4P4SA 4Q9KA 4H0CA 4OXYA 4XJXA 2GVDC 2I62A 1A9RA 3ZE2B 1KDTA 1P6UA 1OZHA 3CBQA 5DCLA 5J5CA 3W77A 3G6KA 1PBNA 2HGSA 2GN4A 2R00A 1TLLA 1RLMA 2V7UA 1SOAA 4ISCA 1LWOA 2H0RA 5EZSA 3HXPA 2EIHA 2QRVA 4EPVA 1ZIXA 3SSAA 4DV0B 2D2EA 3QG1A 3GT0A 2H08A 4NQRA 1GFWA 1NMSA 3I6YA 5DM2A 1AV7A 4Z0PA 4EA6A 3GHHA 1MH1A 4IX9A 4EK9A 2C20A 1R5JA 3RABA 1VMKA 2J3DA 3TEMA 2ADMA 1AQNA 1E4YA 1I3MA 3EJWA 1WZ2A 3SXPA 3VPXA 1N6RA 1P80A 2AOUA 1QO7A 5C9ZA 4RTQA 2VPWA 3EP9B 2EFJA 3GJ0A 4U7GA 2AN1A 4A0FA 3CH6A 2OVBA 3L8ZA 5BSEA 4RTJA 3LHDA 4I81A 3PLAE 1A04A 3ZWMA 1SBIA 3TQSA 4YRJA 1VLVA 5AUQA 1XL0A 3UPUA 2LE0A 2QA5A 3M4JA 2A0KA 3FDZA 4KO1S 5G0TA 4B0OA 2XEXA 5GONA 4D6XA 1KDVA 4XM0A 4JI3B 4G0UA 1KORA 4KXLA 3QKSB 1YI8A 2FPGB 4UUOA 4OHFA 4ZRDA 3ZD6A 2GNAA 4JI8B 2P2CA 2ZT8A 4QVKA 1FVFA 2GN8A 4CYMA 1CZNA 3IQZA 3QI2A 3Q3VA 5L7WA 3JYOA 4HATA 4TYPA 1EFAA 4BMOB 1VIAA 4R2KA 2J30A 5CT9A 4B3CA 1JNXX 5CLQA 1VLQA 3JZAA 4E5KA 2F3PA 3SYRA 5K8UA 4V1CA 3AJ8A 4J91A 2GF2A 5F7OA 3IJPA 3RGWS 2XCQA 5FA6A 3BXHA 3WNBA 3D0QA 4KZKA 4R2MA 3KQTA 5L3VA 1Z4OA 1JDJA 3A6ZA 3JQAD 4XWGA 1NVFA 1RIFA 3KLNA 1P17A 4GYYA 4ZYYA 4E32A 1CYDA 1Q7RA 2VPXA 3D5QA 4PYLA 4BX9A 1WV0A 3PFKA 4YMSA 4G24A 5JAUA 3PXUA 4H3SA 3RK1A 2VJBA 4BB0A 4Z4CA 1ONOA 2NO0A 1KI9A 2I6QA 3OKPA 3QVGA 2YHUA 4CM4B 4PFSA 3ZK8A 3EH2A 2PX5A 3EXAA 4I55B 1F1JA 4MGZR 3O5AA 5A5DA 1WSAA 4YJ3B 3SXUB 2ZWMA 4HXFB 3OCYA 5JC1A 3UO8B 2O3UA 3KQPA 4OKNA 1T9KA 3THOA 1RPZA 1CLUA 1KZ7B 1NT4A 1WTCA 2BIFA 4B8ZA 1WQ3A 5LCXA 3IR7A 1BXGB 3PCXA 4OB8A 5T57A 1Q95A 3WE7A 3WWCA 2XKBA 4IJKA 2P3SA 3COJA 2HHLA 3LNTA 4UM7A 2RIRA 3ZG6A 4R1LA 1HX7A 3LUDA 4K28A 4L95C 4OMUA 1WEHA 1OH7A 2NZWA 4CQLB 3A7DA 3GXBA 4UTRA 4DJFC 1QRSA 4BL5A 4AYXA 2RK3A 4CV2A 4DYDA 1WCWA 3HMQA 3NBMA 4LA4A 2MYPA 4MGIR 3A6FA 4BC1A 4BO4A 5HKAA 1MR3F 1KNXA 1KEEA 4IDCA 2ISQA 1MC5A 1Q15A 5AJTA 3OQ6A 1YOBA 1TJ3A 3ZNNA 1XJ5A 4Q1AA 2JRCA 5EKUA 4DJ5X 4C2AA 3UMJA 4JK3A 5IM4A 4FCTA 3WBBA 5HM6A 1Y6ZA 3ZWKA 1J8DA 1ZU4A 4RORA 2VHUA 3QHQA 5FL7A 1XPRA 1HNZB 1DWQA 3NRBA 2DWOA 3W04A 4WZAE 4O1MA 4FDMA 1ZRNA 2CXSA 5IWCA 1Z0DA 2QVXX 2GA8A 2BMDA 3S2GA 1EFUA 3L0DA 3QFTA 3DBHA 4WXYB 1EE1A 3BF8A 5G0UA 1ZIPA 4HFRA 3O74A 1E2KA 3CRZA 3RWMB 3SFTA 3JWEA 4B3FX 1VL2A 2FN9A 2MU1A 2NU7B 4TMYA 3P8ZA 4NBKA 2WFZA 1E1MA 2Y1FA 4DUGA 1PLLA 3PTLA 4HQNA 1FNSA 3WOVA 2ZJFA 2A5DA 3AZPA 5A62A 2YXEA 4KRGA 4M46A 1ENYA 4C9BA 3BRCA 1DARA 2ZW9A 3GWGA 1FDTA 4LGCA 3FCEA 1KPGA 1TZMA 4OEHA 2FPPB 4U63A 4FMPA 3MS2A 3TX6A 1KKLA 1U81A 2Z8ZA 4HX2A 5CMLA 3AVTA 4CMCA 4RZUA 3L18A 5ILOA 3BH0A 4Y7CA 4RPGA 1H1DA 4W7SA 1C9KA 1P18A 1PJTA 3A3PA 1D4ZA 3IDZA 1SQGA 4IOKA 4AL4A 1B73A 1JILA 4EUSA 5TPZA 2J3LA 3PQFA 2BGWA 3WIOA 3UWPA 3HVJA 2XDWA 3R8FA 2UXCB 4UEKA 3GLIA 4PNEA 5TB5A 3MGGA 1BCRA 3DTTA 2Q0HA 4YBZA 1XDGA 4MRPA 4FIZA 2AUNA 2PMFA 4D44A 3DE2X 3FNFA 1B14A 2OFPA 1N1DA 2A86A 1QR6A 2I4OA 2ABWA 4MYCA 4YRRA 1E2MA 4URWR 1XMJA 1EWQA 1PP4A 1QPBA 3DT8A 5EHNA 4J7XA 2QPAA 4NZYA 3DAGA 3IVRA 4Y6OA 1QH8B 2WKRA 3O8OA 5IT0A 3OIGA 4Y6QA 1SUEA 4INAA 3NNDA 4U5QA 4E2ZA 1DZ3A 5C8YA 1M2WA 1U0LA 5FX2A 1OREA 1XCGB 1I5OA 2X3FA 1GOTA 2GCEA 5AK6A 1F14A 1JE0A 2H2WA 4PXSA 1B6TA 3P19A 5TT0A 3OCXA 3ZBTA 2HRDA 3TOXA 3JWJA 2HQSA 5JS1A 2QD1A 5EJ4A 4FKZA 2J3EA 2AWNA 3JQAA 1ZH6A 4P34A 3DXFA 1UFVA 4GI5A 3C97A 1G2OA 3H42B 5DNVA 2J85A 5CDFA 4JWKA 5HDQA 2HHJA 5ALLA 4LF4B 1BWRA 3FRIA 2Z6UA 2IZ5A 4H7JA 3LZ6A 4DCOA 1PQPA 3VHLB 5JCPA 3K6JA 4PYRA 5KREA 4CF6A 1YR8A 3OPYI 4I8IA 1L1FA 2IPOA 5FEUA 3LNCA 3RLIA 3K2BA 2LNDA 5KNBD 1G5TA 1POWA 1HDRA 1N7GA 1ZMXA 4R1UA 4RQUA 5CNKA 3QWHA 3FDFA 2C8VA 1RI4A 3EA4A 3H3JA 4TWAA 3N6RA 5IN5A 1XZMA 1PR9A 1R3UA 2GRAA 4ID9A 4ZI2A 5KINB 4BNDA 4EPTA 2XVMA 4CKCB 5HPYB 1OH6A 4KLCA 1T8TA 1MTOA 1OFVA 1T5HX 4HKTA 2C2KA 4QUKA 2PV0A 1AO0A 3HL0A 4OJNA 2DG2A 4B3TB 3CSSA 2OY0A 4B7AA 1EZ1A 4FHCA 3FUTA 3T1YB 4RGBA 4O29A 4EHFA 1E5QA 3HSKA 3EP4B 1Y81A 3D31A 4UM5A 4ITVA 3VOTA 3WYEA 5HOQA 2VZ8A 1DP4A 1VG1A 5JXGA 1IY1A 5KTYA 4CUZA 1C80A 1XMPA 5A2GA 5CM8B 4NYMQ 1SBNE 3IE2A 3ACDA 3OAAD 4JX9A 4M0CA 1XHEA 4E2YA 5FTWA 3HV2A 4DCGA 5BMVB 4JMLA 3DH0A 4QD3A 3IERA 3ND7A 2YNMD 2KJQA 1K3FA 2OCYC 2YFKA 1KVQA 2JBAA 2VTVA 3BMQB 4LDQA 1JHAA 5CPBA 3ZY6A 4O4LB 4AMGA 3NTUA 1ZCBA 1W34A 1Z7GA 2CLFB 5CVCA 3RSZA 3HM9A 3FBTA 5A4DA 3SE7A 1NIPA 3VMFA 5CB6A 2XNSA 1JJBA 4IO0A 1PSZA 1ZRSA 2PL1A 1R4MB 2P41A 4NONA 4BZXA 5K0LA 3F98A 3FPGA 5AHXA 2WHXA 3UICA 1KDOA 3PDJA 4DLNA 2C8JA 3MN1A 4KO3S 4MJLA 4LVCA 1N78A 3FPKA 1UADA 5EIFA 2DQYA 4NATA 2DFLA 4WK2B 4R3UC 3T7AA 4ZV4A 3IURA 3KQWA 1VLHA 2JI9A 5FPQA 1C0EA 2IH4A 5JC8A 4I1VA 1M6EX 1Z5UA 2OZLB 4I4TF 4YAFA 1I4EB 2JLCA 3JQDA 1N77A 4BMXA 4WTOA 5IEBA 4GLOA 1AG9A 5SZKB 1TO6A 5LOVB 4ZCQA 1V16B 2PGIA 4PPYA 5I5EA 4B3IA 4JBIA 1B00A 1V4VA 3D59A 4ER0A 3R3XA 4P0QB 4JWTA 1ZSVA 4LOLA 5FRDA 2PXAA 2Q1XA 4TYQA 3DVLA 1UDAA 3GBVA 4IDDA 4KH0A 2IZ7A 5I9SA 2J9XB 4KXYA 4QBFA 1ZCZA 5IWAB 3ANYB 3PNQA 4K0KB 2P6RA 4DPMA 4PU0A 1JS1X 1WKBA 3NRCA 3NC0C 2J87A 3F6YA 4PLYA 4C06A 2O2HA 4JI6B 3Q8MA 4B3GA 1LS6A 3IUJA 1E64A 1PJZA 2P9JA 3AXTA 3FZNA 3X1WA 4D0LB 4CLEA 4KRXA 4BXOB 1L3BA 2B7CA 1ZR4A 2IVZA 2OXEA 4E4TA 2FTKE 3K5PA 3S5JA 3F5FA 1PQWA 2XCRB 4CKXA 1QFZA 1LPBB 1NV9A 5IARA 3EEYA 2I4MA 5C34B 3VV2A 1U3UA 4LHYA 1P6QA 1XOIA 3KYDB 1Z0AA 4K9DA 3RFUA 3K1AB 4MO2A 2VN8A 3S7TA 4RUKA 5AVWA 5K0GA 1O87A 1ZUHA 1BW9B 5C0OE 1XX6A 5FKJA 4LFCB 3VO9A 3VPFA 3ICCA 5BQFA 4GHWA 1QVVA 4L9SA 1G5PA 3N5KA 3Q3HA 4HGZA 5EQDA 4M1OA 4DKXA 4RZ3A 2PKQP 1ZOLA 1BA3A 2HRBA 2OSVA 3IALA 1FRFS 3B1VA 1UPBA 4L08A 1D5WA 2HWYA 4FFRA 3ZWAA 3W5UA 4BGEA 4Q82A 1K8QA 1C3EA 1I94B 4X1IB 3U7GA 1TJYA 2P90A 4CEHB 1E1DA 2O1EA 4NMMA 1E59A 1ZVMA 3I72A 4Y2SA 2JLUA 2D7CA 3O0DA 4GC9A 4Q21A 2M1XA 4MV5A 4XB1A 1V48A 1WXWA 2QAGC 2I22A 2IPNA 1QGED 4JASB 4P4UA 4M1MA 2X2FA 1IM8A 1O5IA 2A5LA 3BA1A 3BL5A 4CWAA 3PFCA 2J6BA 4EMSA 1MDBA 4RK0A 3USZA 3GGGA 1XZDA 1ZI6A 2GPNA 3EBOA 5FHQA 3WNDA 5LXTA 3L92A 4D4JA 3B7WA 1WU7A 1FDRA 3EZFA 3N07A 4MHOA 3O0TA 5DTRA 3WZMA 5J2TF 4C6TB 4KQHA 2EJVA 3ZCVA 2XB2A 1KR2A 2EZ9A 2ZCUA 2Y2VA 2QP9X 4FXOA 4CCAA 4W6ZA 3TBKA 3DAOA 4MW1A 2D00A 3N70A 1PEDA 4KEAA 4YB8A 4PX5A 2Y0CA 1WQ4A 2BUCA 3WNCA 3FMVA 4KIUA 1IVSA 1RCTE 3AY7A 3NVKI 4MS1A 1CUWA 2G9ZA 2IT1A 3TGWA 3HFJA 3U40A 1HWYA 1T2FA 2UZ1A 5FOQA 3U16A 4TM8A 3PJEA 3RJ9A 2CKDA 1IOWA 3B70A 4KXMA 4XEUA 1YVUA 4A2CA 4F72A 4DKJA 2E49A 1HE3A 3AEKA 1XB2A 2QTGA 2JI7A 5AK5A 3HKCB 3UXMA 3F2VA 1G9TA 3AW9A 3D54D 3FG9A 2V6IA 1DBPA 4JQZA 4GM1A 3L0BA 2BHSA 2P9FA 3N8GA 3M34A 2JJ8A 1IAVA 1ZKMA 2RI0A 2IXDA 1SXGA 3AG6A 1IN7A 3T35A 2V0CA 4J0EA 1XRSB 5EGNA 2VH2A 2C1EA 2MYNA 3CT6A 3OAAA 2VLBA 4ZVTA 3ZCRA 1XVTA 1W7AA 2YJ6A 4P9NA 2QMYA 3FR7A 3LA8A 4NBVA 1YIDA 3UGJA 4D0NA 4REMA 1PNTA 2MSDB 2P1ZA 4N8EA 2O4CA 3C15C 1WNTA 2C9ZA 4DCVA 4ZYWA 3E22A 1JIKA 4HGRA 2PPLA 4ZOLB 1OX4A 1ZPDA 4D02A 3GJ6A 3P2EA 5A5VA 1R0YA 4OHRA 1I4TD 3AB8A 3GJ8A 2VJMA 1QIJA 1BFDA 3FIUA 3TUXA 2G8LA 4NPHA 3NEYA 2CXQA 4FXPA 2HI0A 3DV0B 1C0LA 5A0FA 3SYNA 2Y4NA 3N5CA 1XPUA 2X2OA 3HJUA 5AYVA 4J7AA 4DARA 3UK1A 4FGZA 3V4OA 1OXXK 4Q3AA 3LPMA 2PU7A 1T29A 2G1AA 4NCNA 3VKFA 1A82A 1QS0A 2QLMA 3QIVA 1IY2A 4Q02A 3V46A 1R8YA 2QE7D 3PNLA 1N5DA 1FPQA 3KKQA 1K9VF 4NARA 3RSOA 2VPIA 3L1UA 4PG4A 2V5UA 4XYGA 4CKWA 5JQGA 1N6PA 4UMFA 4PG8A 1JIIA 2FP4B 4WCDA 2BAGA 1CUHA 1T2UA 3LX8A 2CUZA 4Z4IA 3ZK9A 3Q3EA 2CNWA 3L49A 4MVJP 1YQWA 4O2AF 1QR2A 1KOGA 2QS9A 4IHJB 5U1PA 3OJCA 4ZHSA 5AM5A 2H2AA 3AETA 3HNOA 5JDCC 3PEEA 1P0FA 3QVMA 2BEKA 3OP1A 4DDVA 4LF5B 1JKJA 2PAFA 1SKYE 1E6WA 2N46A 1Y1QA 4OHCA 1I14A 2IYUA 4WD3A 2YX1A 1TK3A 2OXCA 1QTRA 4KQ1A 3R7NA 3K1TA 3QKIA 3ZY4A 3ISJA 3D3QA 1UCFA 1V7CA 4F1WA 2P2NA 2A9OA 4M1EA 1OZFA 1Z26A 3E58A 2AD5A 1UZAA 3V6MA 5L53A 2WQ7A 2Y0BA 3S44A 3TTVA 2OECA 4G0XA 3CISA 3C1UA 3ML1A 4TRRA 2BONA 1PTKA 2HA6A 3AR5A 3KPYA 5DEOA 4C7XA 1NAHA 5C8ZA 2B61A 3C6BA 4LXGA 4F5ZA 3Q7RA 4EHHA 4ZN6A 3TMKA 3D4BA 3TTYA 3LM8A 2OHVA 3KPJA 3NTLA 1XZKA 3F4KA 1KERA 4D41A 1E3QA 1M0SA 4CF3A 2FEWB 5JMOA 3CX6A 3BWYA 5H1YA 4OQFA 2XADA 2NSHA 3R7LA 4HX9A 3MMPA 1WZIA 1FS4A 4MR8A 1Z8FA 4R7ZA 1RLUA 3CLHA 5JEDA 3RS7A 3WGJA 4DJTA 4URYR 2FMUA 1N4DA 3H0KA 4K3UA 2B30A 1LV7A 3W6UA 1D8AA 2Q7DA 1PS8A 4QVGA 1SQSA 1II8A 2P5SA 1VHJA 3ENNA 4DB4A 2GFHA 5A3RA 1DKNA 2CNOA 3HNPA 4C2TA 2RH4A 4HO1X 2GPBA 4KAXA 2EBUA 2VUTA 1I1NA 1WX1A 4D74A 4IJ6A 4FB4A 4JBNA 2YJ3A 4L8VA 4CF5A 3NTOA 1B8OA 1QCZA 2B94A 4ABYA 2VF7A 4K6CA 4BQPA 2R6HA 4JLUA 3B85A 1F0KA 4L7QA 4EB6B 2HMVA 1VECA 3TD2A 1XTKA 3KXKA 1W19A 1XROA 4GX2A 1T1JA 2HYIC 1ZITA 3AC0A 1O97D 5JDIC 3RBVA 1TNDA 2WR8A 4G2NA 4KX5A 3ZCSA 4L0MA 1PS9A 4G25A 3LV8A 2HPHA 4X93A 1W2GA 5DGHA 4RKYA 1N9GA 5F21A 4ARSA 4AKEA 3QOFA 1V8ZA 2Z43A 3CUWA 5EHZA 1KQPA 3EXHB 4OP2A 8OHMA 3JWHA 1FVOA 1EWKA 1TQ8A 3TM4A 2YZNA 2DR2A 3RVDA 1A2KC 3CRQA 2ZR7A 3OZRA 2ISSD 1NPYA 2IOQA 2XVAA 3L8GA 1ZX1A 4N0EA 3S2SA 3GZNA 1EHCA 1WMBA 4UHEA 5ALEA 1F6DA 1JVNA 1Y4SA 2IYRA 3KO8A 1H4SA 1M34B 2WJJA 3I5UA 3TUIC 3K0BA 1TZCA 5FPHA 1XZLA 4GP6A 4L22A 4NCAA 5BNTA 4AUKA 1CDDA 1IN8A 3R4CA 2JAHA 3IIMA 3QBJA 2OHGA 2JLBA 2X4GA 1VIYA 4GO1A 2OA0A 3RB8A 2J67A 1UXGA 5JATA 3P26A 2O2YA 4QU8A 1Z5ZA 3T5MA 4L0QA 4Q9AA 3ZHCA 2W48A 2Q4EA 4PC1A 3R3VA 4HY3A 1P91A 5B37A 1G1MA 3PLNA 2WWXA 1UMDA 1OT5A 2FXVA 2WPDD 1WRBA 5AOCA 1Y42X 1ZRMA 4EF5A 1U8TA 2YIJA 5LZ7A 1X8XA 4MR7B 2R1TB 5L45A 1QH9A 3T9DA 4FMCF 2PWYA 4C43A 2QD5A 1R5BA 1XMQB 2WI8A 2CB0A 3CJTA 4J1SA 4IQ8A 2ENUA 1FC0A 4PFKA 4WT7A 4NBNA 1I1OA 1WMDA 1UIRA 4P7GA 4QTZA 4YCJA 1IHUA 2YH2A 3NHYA 4GF5A 1ZNQO 3KT6A 4L4RA 4QBIA 2FPUA 3VPAA 3DZ2B 1V1JA 4EUHA 5BPHA 2UUBB 1ZM2A 2EF0A 3TZEA 2H18A 4XDYA 2IZOA 4C4SA 1PDOA 1ULHA 2CFSA 3GLKA 3WLNA 3LXXA 3OQOA 1F2TB 4TT8A 3AR4A 2PDAA 3PC7A 4FDAA 2NQ8A 3UV3A 1FW6A 3BHMA 1SCDA 1MORA 1O94A 1UOOA 5SY9A 4ZJPA 1E0JA 1Y6RA 2A4KA 2FEKA 2ZR8A 4MW5A 4ZREA 2EFEB 3KYIB 4EG0A 3BTUA 2DVMA 1KAOA 5FLKA 2OXTA 3DNFA 3D8NA 1GAWA 3DE3X 5LP1A 5IT9A 1E96A 2O1SA 2QX6A 4FSHA 4BWFB 2Q5HA 3KKOA 3DTYA 1AZTA 5H5JA 5IBCA 4K0RA 4LXTA 5DM1A 2I6UA 1PQUA 1R0WA 4F2PA 1PL8A 1KZ6A 1PSWA 3EWAA 3CGGA 3CZ4A 3DMFA 1IG3A 1DEHA 3WS7A 1RPTA 3IIIA 1AKUA 3HA2A 2WYVA 3COSA 3P96A 4CTMA 1C1XA 3CY6A 4W8OA 4LBYA 5E4JA 2K6GA 2BSQA 4IUYA 3PXEA 1QHIA 3FETA 3H19A 1QFYA 2X5XA 2XYQA 2XECA 4EA8A 4LMAA 3ZY3A 1VCNA 3BWXA 1OIVA 3LSTA 1T6NA 1E9AA 3JATB 4XYLA 3M5CA 3RVKA 1Z73A 3ULKA 4LV8B 1XQVA 4R8KA 4DSZA 3FUCA 1I8TA 4FEAA 3E61A 3S1LA 3T5TA 4ILKA 1ZGAA 3BRSA 4DCMA 1EVLA 4EB3A 2OKCA 3QUBA 1MAVA 2Y1LA 3D8BA 5KDLA 1U8ZA 4AAYA 4XUGB 4Z8YA 1D2HA 1SA0A 3OM1A 4U9IS 3VUEA 3SX2A 4KKXB 4X65B 5T67A 3R0ZA 3KT3A 3QLUA 4MEBA 5KIAA 4G1BA 1QYXA 4IGIA 4X63A 2NAFA 3GJQA 1J70A 4JC8A 5DF1A 1RC0A 3FWZA 4HVTA 2UYGA 1Z2EA 1EINA 2O5EA 4TV9B 3SM3A 1WLSA 3MTEA 4FVTA 2PSEA 4F8JA 3V8EA 3D4IA 5EKXA 1L6RA 1OTHA 4IX1A 3W7BA 1YAJA 3NP7A 4C04A 5CITA 2R5NA 3TFOA 4Y9SA 2AXQA 4XWTA 5B6JA 1FA9A 1V25A 3ITEA 2Q49A 1V3TA 1EM8B 3HDGA 2BDEA 4HN4B 3EQ8A 1D07A 4KV9A 2IHYA 4IDAA 4D4HA 4YV7A 5IJ9A 4EJ6A 3OO0A 4PC3A 1P4SA 2X1VA 2HA7A 3OLVA 1MEOA 3MXTA 3CNEA 4N6NA 3RM3A 3GA0A 3DVSX 2WFLB 2ODAA 1CS0A 4OGFA 1R5OA 5G02A 1GT91 3ZHOA 2UYHA 3EUAA 1TYEB 2NUAB 1N6OA 4JXXA 2XMQA 3N0VA 5ICMA 2HA0A 1ZC3A 5E7MA 1GPUA 1PG5A 3L1JA 1YU9A 3AF6A 5FWDA 3MJCA 3K4QA 4TMFA 3EC7A 3RREA 3FZEA 5FT9A 5TSDA 1T1GA 4IXTA 1EUCB 2HLDD 4JFRA 1E3LA 1E5LA 4K1LA 4R9UC 4E31A 2YRFA 1ZD1A 2Z6VA 2CLMB 2FPNA 1TTPB 3K92A 2ZRNA 1GTRA 3PC3A 4FFNA 1AY0A 2YWBA 4U5XA 4FB5A 5DM70 3TE7A 4JLSA 1KQFA 3IT1A 4QUBA 1TF5A 6NULA 4PZEA 1NTRA 4QOGA 2EGHA 4EQ6A 5HRCA 1H93A 3SSNA 1Q5PA 4CCYB 3RCBA 3TG8A 1PG2A 3JQQA 4Y2XA 5IAEA 1T34A 3C3BA 1XUOA 1YJAA 3M4NA 2NUTB 1G6KA 4P58A 1VG0B 2GZSA 2KPOA 3TI7A 2AR0A 3UAXA 4LDZA 4AXXA 4BVEA 4TMVA 4QULA 4A2PA 3BTVA 1ND5A 1V26A 2O2JA 2PZMA 1T2DA 1E2EA 1FDWA 4IWNA 1ICEA 2GAJA 3WLLA 2E4YA 4YCAA 2NZ8A 5LYJF 1PTJA 3C74A 1DIBA 1U8XX 1Q7EA 1W1IA 2OK7A 1SU4A 2RGDA 4BB9A 1NNSA 2PJZA 3IEUA 4RHUA 5CK4A 2CGEA 1KSGA 4BQEA 4QVIA 1KJ9A 2ONCA 3DONA 4HTFB 2ZBFA 4J7CA 5IW8A 5CTJA 5EMMA 3DW3X 4BVHA 4QM7A 2FWJA 1KYIA 2WU8A 4EB8A 4FWTA 1EP1B 1NN3A 3PQ7A 1AKVA 1K86A 4MPTA 1GRQA 5HM8A 4MZXA 4XH9B 4W7IA 3WWEA 1CHNA 1OLXA 2ZVJA 3I9JA 3DYVA 4P0TA 4CIVA 1MT0A 1FNMA 3WR5A 4E5SA 5AVZA 3AUSA 2RC6A 3OBIA 3AG5A 2QR2A 2C58A 3E9DA 1G7TA 5ICGA 2V7WA 1EK5A 1JSRA 4S1WA 3VM6A 1W36B 3CZPA 4LMPA 4M0DA 1BAPA 3S1SA 1P72A 3LC7O 3QPWA 1F0NA 4TTTS 3I28A 3I1FA 1YDHA 1ZXLA 5TPWB 3QE3A 2OB2A 3DZGA 4DCJA 1QCYA 4XCXA 3THSA 2P6UA 3KJZA 4DIDA 2FNAA 4PZAA 4QKQA 5FNVF 1G5QA 5G53C 3EP5B 2JIMA 2PBLA 3KR1A 2IEBA 4UJ5A 3Q72A 4LY3A 4KHZA 4EKNB 1QMGA 3Q9SA 4LGVA 4ZGBA 2RGWA 2ZZNA 3EODA 2OILA 1UPAA 3QBEA 3ENVA 4CM3A 4BATA 4W82A 4YH1A 1JDTA 2H0AA 3ZKWB 2ZXEA 2AEJA 1TCCA 1L5KA 5BSHA 3ZWOA 2JZNA 5G1NA 4PHFA 3QUAA 1J8FA 4FOLA 1L5LA 4YAKA 4CZ2A 2W7TA 3RANA 1XRLA 4R05A 3OD1A 4P3NA 3UJ7A 2YR0A 3DQZA 3PT5A 4D9NA 4M1WA 2PQ6A 4WXMA 1CX9B 1QTIA 2GK4A 3PJFA 5K3DA 2O52A 1IXZA 1SCKA 2Q4TA 3E9YA 3HC7A 4Q1CA 1VCMA 4TQAA 5EKTA 3P9KA 3S8MA 1EFLA 2QMQA 2VQFB 3AUYA 4FEYA 2W6CX 3D7MA 4W1PA 1I1HA 1NN5A 5BVHB 1JZQA 1MB9A 3OMLA 3QKTA 5GJCA 4QHSA 2YQZA 3B9QA 1S6YA 3RIYA 3DCYA 3QVLA 1G19A 1XGKA 3GFOA 3N8NA 4LZPA 4XGNA 1ORVA 1FUUA 4WZZA 4EY4A 3GLVA 1XEXA 5JTUA 3BH7A 3CVXA 4XFDA 2OCAA 1QFMA 1X15A 2JBWA 3AOEA 3DBLA 1E9VA 2D5CA 4JNCA 3C70A 4KXQA 4IGEA 1CR0A 3NX4A 3IE1A 3R40A 1FP6A 1OOEA 1RAAA 1YKSA 1OI3A 1JZSA 2ZBUA 5F3RA 1AT1A 2G5GX 2J9FB 3H5AA 2IHKA 4DLRA 5ABPA 3WXBA 4RL4A 2QVZX 5GVSA 3E2PA 2A9KA 2YNMC 2MR6A 3NDJA 1ZQ9A 1KJWA 4ICIA 4J76A 1NW5A 2HLDA 4P84A 4BIIA 2ZROA 2ZUDA 3C43A 3SLRA 1T3LA 1U1DA 1ZSNA 4OHXA 3U5ZB 2AV6A 3UUFA 2X1MA 4YV0A 2JJMA 3URKA 4F8YA 4S05A 3EQ2A 4JL8A 2W6JA 1X74A 3RV4A 3G89A 4BQQA 4X54A 4EF6A 5JNLA 1FYWA 4KN9S 1WHTA 3U09A 1Q1BA 3NBYC 3QH4A 4KYUA 1UBTS 1HLDA 3I37X 2ZWOA 4MPPA 4U2KA 1U11A 1KP2A 1MU0A 1XT6A 2HA3A 1FFBA 1K7CA 4HJXA 2G9UA 3G82C 3H2BA 3MCVA 4KV7A 1BU5A 3E8XA 4IRUB 4LWZA 2F67A 3EOZA 3RF7A 3BL6A 2Q28A 2H59A 3CIOA 3LLCA 5HIIA 1Q0HA 3O9ZA 3SYLA 5CG2A 4GKKB 2IS2A 3QNUA 2AFRA 2IUUA 1P1CA 5LQKA 3IOEA 3AXSA 2WFAA 5FUMA 4V3CA 5FOUA 4N1AA 2VDOB 4YCCA 3M6FA 3ELBA 4MYHA 4YXWD 2K5UA 4DA9A 1GNPA 4NK5A 2QNRA 1FJXA 1TYDE 3U62A 2HMWA 1EWYA 1RZVA 2AOXA 2FJPA 1NOIA 1YULA 4MYRA 5H3HA 3W7AA 2VQSA 4JODA 1VE5A 4LCJA 2HK8A 3M7IA 4B3MB 1MOSA 3TLGA 2Y0DA 4K5QA 3DZKA 1T3ZA 2XT9A 1FVXA 4F71A 1E61A 4GT1A 5CTAA 1PV1A 1X92A 1JFTA 3DWEX 5BN4B 4B3BA 10MHA 1L8AA 3VBCA 3IAM1 3BD9A 1Q44A 1ZINA 4X1OA 5F77A 1W4CA 4RTNA 1PKXA 3HP7A 1E18A 2JAWA 1TZKA 4MJ7A 2J5BA 1DVRA 1O0SA 1Y4ZA 1N92A 5L7TA 1QK4A 4FMDB 5HTOA 4Q01A 4NY1A 4E2FA 5AVSA 1VGQA 3QBTA 2C5SA 3BJRA 2O8DB 3EPAB 4C2BA 1AN0A 5J1TB 3CNQS 4GUAA 2JGRA 3C6YA 3FRJA 1KZGB 4EFNA 2Y1EA 2ORWA 3C39A 1MBZA 2TS1A 3NVAA 3DEIA 4PTYA 2J3IA 4WN9B 4YFYA 5JWHA 1L5YA 1MFPA 3KUKA 4UZEA 1FB5A 1U3CA 4J1NA 3GO4A 1ISSA 3TIIA 2PH7A 2DY1A 4C01A 3HU3A 3QPAA 2K4MA 1T25A 3AFOA 4AZ3A 2EYUA 4CKEB 4LJRA 3EW7A 3IKMB 3L6UA 4GGMX 3DTNA 2CJWA 3DZ3B 1N2SA 1YDEA 3N2GA 5F35A 1S8FA 3RC3A 1QGOA 5C8DA 4PZPA 4I5DA 3BAZA 1X1BA 6YASA 2IBSA 4WFQA 4HGYA 4AUEA 1Q17A 1EQUA 4KR2A 1RYZA 2BFWA 2I4IA 3C16C 4LJKA 4HP8A 1ZVVA 4JNKA 2HQ1A 1C3XA 2Q99A 2NSYA 2XRFA 4RK6A 4TQGA 4CM6A 2W2MA 5BWLA 1LUAA 4EFMA