3ZDMC

Crystal structure of the sgt2 n domain and the get5 ubl domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
AAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT- CONTAINING PR
publication title Structure of the Sgt2 Dimerization Domain Complexed with the Get5 Ubl Domain Involved in the Targeting of Tail-Anchored Membrane Proteins to the Endoplasmic Reticulum.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/signaling protein
total genus 20
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdmC00
3ZIMA 4DK5A 4KSLC 3RD2A 1WZ3A 4K7WA 3L13A 2WYQA 4HDOA 2BF8B 1UBIA 2MP2A 3H7PA 4FHJA 4CHKA 1P1AA 2C7NB 3ML8A 4J6IA 2O6VA 2N9EB 2M8SA 4KV2A 4KIKA 5J2RA 2LGDA 1SIFA 1V2YA 2C60A 2PEAA 3PREA 3A4RA 2NPTB 3AU5A 1RRBA 3CSFA 2JWZA 2KMAA 4ICVA 3ZW3A 5KHQA 5JHBA 3WA0A 1H4RA 2KO3A 2IY0B 3QARA 2IZVB 1TTNA 1K8RB 4F7ZA 2IYDB 1GNUA 4IWPA 4MGZE 4BBNF 2R2QA 1WXVA 1UBQA 1KOTA 4II3B 2FNJB 3PTFC 1V81A 1WZ0A 2K1FA 3R66C 4FJYA 4EEWA 3HM3A 1EO6A 3ZNGC 2MW5A 4HK2A 4M0WB 3QWZB 1C1YB 2WX1A 2GOWA 2GBMA 2NBUA 1RLFA 4W9CA 3H6NA 3QC8B 3W1SA 2I1KA 2KTRB 2VRRB 1T0YA 3DVNV 3ZDMC 2EMSA 4FLHA 2D10A 2KLCA 2LVOA 4FBJB 3A1QA 3IBEA 1WGGA 1NBFC 1FXTB 3GZNI 5E6PA 1OGWA 3VUWA 4FN2A 3RZFA 2J0JA 3U30A 3UINB 4AJWA 2MBQA 3ZNHB 2R2OA 1J8CA 4WQOB 3CSTA 4IG7B 4OVUA 4WJNA 3WANA 3MHSD 2ZVOA 1QZEA 3JYUA 4HCPB 1Y8RC 2XK5A 3H9DA 1GG3A 3K9PB 3V6EB 3APCA 2MBOA 3RYTA 2MX2A 1WIAA 2MSED 3L10B 2KJ6A 4W9DA 2FCMA 2L8JA 2XBBC 1WRDB 4YL8A 4BKGA 2BYFA 3QQ8B 1V5OA 3QAQA 3PLVA 1CMXB 1UZXB 2MBBB 3SHQA 4TQ0A 2A4ZA 2JRHA 2O2VB 2CKHB 2DZMA 2NPTA 2D07B 1LFDA 4M8NA 1WE6A 3PHWB 1S1QB 1Q1OA 5JHAA 2V3SA 3UQBA 2KX0A 2KFJA 4LJOB 1M94A 2MA9B 4WAAA 4FADA 2WWZA 2DYBA 3PRPB 3X23A 3IG3A 2N1VA 2MCNB 3ZRCA 2J0KA 2B3AA 3QHTA 5CTRC 3W1YA 2UYZB 2K6DB 3ZVVA 1VCBA 3PV1A 1Z5SB 2YLMA 4BKTA 4NY0A 1LQBA 4ZDVA 4F8CB 3UIOB 1OQYA 1YQBA 5G2NA 5LXIB 3Q3JA 4EZLA 1IPGA 3CMMB 1E8ZA 2L05A 2KMCA 4FJVB 2V1YA 2BPSA 2OOBB 3ZUNA 3S2AA 2KWCA 4BKSD 1G6JA 3KH0A 1WGYA 4IM0A 3QX1A 3B08A 1PQSA 3QJZA 4BOZB 1IYFA 2KKCA 4HVBA 1V49A 1A5RA 3W1SC 2K8CA 1J0GA 3V6CB 2V4LA 2RSUA 2BWES 4IWOA 4NJ7A 3D32A 3APDA 4LDTD 4K7UA 4W9JA 4W9EA 2M4NA 5CHVC 3U8ZA 3OJ3A 3A9KB 2BKFA 2MQJA 5D6JB 4XC2A 3DBLI 2DHZA 4MEMA 3VQIA 3KUDB 1WJUA 2KC2A 4AJYB 1OEYJ 1MG8A 1YD8U 3PT2B 4ANVA 3KUCB 2LZ6A 1WFYA 5EDSA 1I35A 4DHJB 2NR2A 1KM7A 3K9OB 2N9XA 4HLEA 4MELA 4WJOA 5IA7A 1HE8A 2LXCA 1JRUA 2ZPYA 3L17A 3WAPA 3VUYA 2FCQA 4NNJB 1P0RA 4GB9A 2GMIC 5CHWA 3TIXA 3APFA 3VH4B 3UQAA 4FHKA 4MGKE 5AZHA 3ZTCA 1GJZA 1GC6A 3KYCD 3UGBB 5AEKB 2M17A 4OVVA 2JPHA 1H8CA 2KWVB 3DBSA 5CHFA 2O6VD 1NI2A 4EZKA 4MGIE 2KQSA 4I6LB 4HDQA 1E7VA 3DVNU 3DVGY 4MM3A 3VTVA 1XQQA 3JSVB 4GN1A 4HCNB 5DCNA 5L95C 4DBGA 1I42A 5G55A 1WJ4A 2JZZA 3NY5A 4IC7B 4WJPA 3L0WB 4W9IA 4ZRIA 3T8MA 3SDLC 3QIJA 2RR9A 4W9FA 3TL5A 2W9NA 2LRUA 5LLIA 1ZKHA 2IO3B 3A4SC 2Z59B 4KDLB 4MH0E 3H7SA 3JW0X 1WH3A 5DPWA 2DYOA 1YX5B 2IBIB 1WE7A 2M0XA 1WJ6A 2KDEB 2XEWA 3DQVA 4JLCA 4LJPB 4MDKE 1V9JA 2KJHB 4GIVA 2RPQA 2PJHA 3R3MA 3EFUA 4PS8A 4MSQB 1P9DU 3ZLZA 2AYOB 5C1ZA 4NQKE 4E71A 2N7DA 3M62B 5D94A 2LJ5A 3NOBA 3CF6E 3AXCA 3L54A 2KX3A 2L0FA 5DPSA 1WXAA 3NZSA 3VH3B 5J18A 3A9KA 1EF1A 4I6NB 1Q0WB 1R4NI 3I3TB 3Q3FA 3HHMA 2KFKB 2LGXA 3V62A 4PYUA 2CS4A 4HPLB 3BY4B 2KD0A 3N32A 4ASWC 2UWQA 3GOEA 4FA6A 1WGRA 5C23A 3VTWA 3WIMA 2AL6A 3OAWA 4WWNA 3A9JB 5FR6A 3N30A 3PHXB 4G0NB 1V80A 3WALA 3KW5B 2HTHA 1Z2MA 2LVQA 3PRMB 4EUTA 2DAJA 2K6QA 4FJZA 1WR1A 1E90A 2DZJA 4DDID 4BOSC 1GUAB 4PYZA 2EKEC 1P98A 2ZPNA 3VFKA 2MBEA 4GGQA 2KDIA 1WJNA 3JSVA 4JIOU 5GMVA 2ASQA 1VD2A 2DENB 2C9WB 2N9PC 3PS6A 3ECIA 1F9JA 4N9F4 3SU8X 3VAWA 4A20A 4AUQC 2KWUB 3VDZA 1WYWB 2BKRB 3NZUA 3ZNID 1YJ1A 4CO7A 4HJKA 5LXHA 2KTRA 3NS8A 4WWOA 3TBLD 2JT4B 4TV3A 2JZ3B 4E74A 2AEHA 2MLBA 4X57B 3PZDA 1D3ZA 2FCSA 1TGZB 3AI5A 3KUZA 3PRZA 1C3TA 2ZNVB 4AOFA 4ANWA 1WGDA 1YX6B 4NQLB 5AZGA 2CHXA 2C7MB 4FULA 3DOWA 3ONSA 2KTFA 2NVUI 2ZEQA 2LUEA 3MJWA 4TUUA 2DX5B 1R4MI 2LRWA 2D3GA 3HM6X 1WXSA 2KFKA 4DDGD 2A5UA 3AU4A 3KYDD 3L08A 3PSEB 4LCDE 3R7QA 3TMPB 2CR5A 4BFRA 3C0RB 3HIZA 4ANUA 1V6EA 3X0WA 2G4DB 5IAAC 2CU1A 2GBKA 2ZCCA 2FIDA 2KK8A 3EC8A 3QK0A 4GSWA 4KSKC 2LXAA 3A9JA 5E6NA 4AWJA 2L7RA 2FAZA 2N1WA 3RUIB 2Z0DB 1BT0A 1Q5WB 2O2VA 4WWPA 2KNBA 2J0MA 3H1UA 3DPDA 1WX8A 2FIFA 2K8HA 3DBRI 1XD3B 4KZCA 4IM2A 1TZ1A 3ZKJC 4ANXA 3M3JA 5D2MB 1WR6E 2HD5B 1LM8B 4EOYA 1WI0A 2AL3A 4KVGB 5HKHA 1J19A 2NBVB 4K81A 3ZTDA 2LGYA 2K25A 3DCGA 3QA8A 2KANA 2J7QB 4MJSB 1OTRB 3BINA 3VXWA 4IUMB 1WMHB 1XT9B 4ICUA 3ZRFA 4GDLB 2KJRA 2G4SA 5JZEB 3PGEA 4IM3A 1SGHA 4W9KA 1E8XA 2Y5BB 4B6WA 2KLGA 1V5TA 2ZCBA 4IWQA 4K7SA 3RT3B 3B1LX 2M1MA 5BO4B 4P7IA 1IP9A 3PVLA 2YVCA 3QCAA 2C5LC 2LVPA 1WXMA 3IVFA 4IW0A 2IO2B 3WAOA 3V60A 2LASA 2NCNA 4II2B 2BWFA 4RM8A 2WDTB 5KHOA 2L3ZA 2G45B 2L0TA 4EFOA 4G50A 4KDIC 1U4AA 4HWIB 4I6PA 1L2NA 2KVRA 2K39A 3OLMD 2MWSB 2L00B 2WX0A 1WM3A 4XZ4A 5JH5C 3VVWB 1TBEA 2CHZA 2KDFB 2N4FA 2HJ8A 1ISNA 2I1JA 4ZYNA 1YIWA 4G3XB 4KZ0A 3IFWB 3AULA 2RGFA 4WJQA 4DHZB 1E7UA 4EKUA 4LDTB 5AZFA 4NAWB 2BYVE 2LWPA 4AP4C 1WGHA 2BYEA 2KQ7A 1NDDA 2PE6B 3EECA 3KVFB 3O65B 2KC1A 2D11A 2JVCA 2DZKA 4GOCA 4TKNA 2HE7A 3UIPB 1WF9A 2IY1B 3VHTC 1S3SG 2NS5A 2PPHA 2Z0EB 4DHJD 4DXAB 4MJSA 3U7DA 1WM2A 1WMHA 2CHWA 3PLUA 5L83A 2ZVNA 4GDLA 5CX3A 3ZNZB 2JY6A 4GU2A 4W9LA 1AARA 1X1MA 4K1RB 2MRPA 4PS7A 4GDKB 3HK0A 4M8MA 4RM9A 4B95A 4BVUC 1ZW7A 2LD9A 2RD0A 3ML9A 2DYMA 2FUHB 2EMTA 2JXXA 1SE9A 2IO0B 2KZRA 2ZZPB 4ZRKA 4MSMB 4W9GA 2DZIA 2MP2B 3H7PB 4A3OA 2K8BA 4HPMB 1RFAA 1E8WA 2O6VB 4E3CA 3L16A 4KIKB 4JGHB 4XX5A 2DAFA 1UD7A 3M63B 3EHVA 3RZWC 1KJTA 4URKA 3IHPC 2GBNA 4BBNC 3ENEA 3P2BA 2KDBA 4W9HA 2KHWB 3RCZA 4DWFA 4TQ1A 5D7GA 3ZO5B 4HXDA 1EUVB 3OJ4B 5E6OA 2C7HA 4GMVA 3JVZX 1WY8A 4JL9A 4BKSA 3VUXA 1WX7A 3M95A 2KOXA 2KXJA 2REXA 4MGYE 4G11A 2GBRA 2JF5A 4ZRJA 2ZNVC 4RMAA 2PE9A 4NJ6A 3T9LA 2OJRA 1UELA 2JRIB 3A33B 2G3QB 3LDZE 2QHOA 3DDCB 3N3KB 3NHEB 3A1QB 4GXBA 4NAWA 3UF8A 4EZJA 4PS3A 2GBJA 2N7EA 2NBWB 2BGFA 4B9KA 1P3QU 3RULA 2FCNA 3R7RA 1E5WA 1E8YA 2IO1B 5TR5A 4DHZE 1V86A 1ZGUB 3TCAA 1RAXA 1L7YA 2JUOA 2L76A 3VTUA 3DVGX 5DPRA 3WAMA 2LI5A 3DBHI 1LXDA 1GC7A 2KN5A 3ALBA 3PPAA 2D2QA 1WX9A 4A3PA 4NPNA 3B0AA 2XK5B 4JQWC 5DPTA 3LJ3A 2MBHA 4CYEA 3TJPA 1EF5A 5J17A 3ZDTA 1OEYA 2ZJDA 3MTNB 4GDKA 1KLVA 1UGMA 3V61A 1UH6A 4F1SA 2AWTA 3SD5A
chains in the Genus database with same CATH superfamily
3ZIMA 1I4PA 4DK5A 2WGSA 1WZ3A 2MP2A 3H7PA 4USAA 1P1AA 2HJ1A 2O6VA 2BS4B 1SIFA 2C60A 2NPTB 3SR6A 5JHBA 2CU3A 2IY0B 2KQ4X 4II3B 2FNJB 1V81A 3W5UB 4RCOA 4HK2A 1C1YB 4JWSC 1N5WA 4MACA 2GOWA 3AEFB 4W9CA 3RFZB 5C2TB 1HTOA 3H6NA 4DQOC 1PGXA 1T0YA 3ZDMC 1TS4A 2KLCA 4FBJB 1ENFA 1UUPA 2HTME 3GZNI 5E6PA 2KMMA 3VUWA 3RZFA 4OZAA 5FK9C 5T8IA 1ZDVA 4HPPA 3Q3OC 4ZRQA 1QZEA 4B0MA 1XXGA 4S0RA 3K9PB 1IGCA 3V6EB 4WQMA 2FCMA 2XBBC 1WRDB 4YL8A 2MBBB 3CWIA 1V1OA 2A4ZA 4C4VA 2JRHA 3NRZA 2KAJA 1LFDA 2INNE 2M19A 1WE6A 2V3SA 2KFJA 4WH4A 5BMHA 2WLBA 3RI7C 2DYBA 3IG3A 5MPOA 2N1VA 2J0KA 2B3AA 2UYZB 2QSDA 1VCBA 3PV1A 1XF5L 1Z5SB 5H92C 1LQBA 4ZDVA 3UIOB 3RMKC 3P4RB 5LXIB 2N0SB 1E8ZA 2KMCA 3ZUNA 2W54A 1G6JA 3KH0A 4IM0A 3IAM1 1D5XC 3E56A 1V49A 1A5RA 3W1SC 3IT6B 3PZ7A 3V6CB 2V4LA 4IWOA 4W9JA 4K7UA 2G9HD 2M4NA 2WXQA 1F52A 2ZW1A 3EA6A 2WXHA 2MQJA 4N6EB 3P63A 4XC2A 4MEMA 3VQIA 3KUDB 2KC2A 1NYRA 5EDSA 4ARCA 2NR2A 1C9FA 4WJOA 1VR9A 3V05A 3WAPA 1P0RA 2GMIC 3VH4B 3NJTA 3ZTCA 1GJZA 2V0GA 3KYCD 1A70A 2MHJA 3RNBC 4ARIA 4P16A 2O6VD 1UNSA 4MGIE 1E7VA 3DVGY 1FPYA 4GN1A 5DCNA 4DBGA 1ZXHA 2JZZA 3SDLC 3QIJA 1SIJA 5LLIA 1NVID 3H7SA 3JW0X 3IXSA 1WE7A 4JLCA 2XEWA 4LJPB 4MDKE 2VZKD 3GP7A 3EFUA 4PS8A 4MSQB 1P9DU 3M62B 1XO3A 5D94A 2NTTA 3OG5A 2J53A 1PGBA 3L54A 2KX3A 5DPSA 1WXAA 3NZSA 3A9KA 4HKZE 1TZOA 2CJNA 1E10A 2LGXA 3V62A 4HPLB 4ASWC 1QOFA 3VTWA 2AL6A 3OAWA 1VDVA 4G0NB 4EUTA 2E6XA 3PRMB 2DAJA 2K6QA 1WR1A 2DZJA 4BOSC 1B1ZA 1JROA 3VFKA 4C00A 3Q2AC 5GMVA 2FUG1 3KWLA 4US9A 3VAWA 2C9WB 3PS6A 4N9F4 3W9CB 4A20A 2KWUB 3VDZA 4WWOA 2JZ3B 5HI1A 1XLNA 1FO4A 1SB3C 3UI3A 3MC9A 2FCSA 1T0RC 4C7YA 3ZJUA 3KUZA 1YMHE 5IN7A 3PRZA 5BMGA 4ANWA 4NQLB 3ONSA 2KTFA 2ZEQA 2OJWA 2Y5PA 2DX5B 3P1MA 2ICIA 1XLPA 3KYDD 3L08A 1JWBD 2W82A 2CR5A 3C0RB 1V6EA 3X0WA 1FEHA 3QK0A 2LXAA 3J9CA 2O2VA 4HKQA 3H1UA 3DBRI 4IM2A 1TZ1A 3URYA 1WR6E 2XN9C 1WI0A 2AL3A 1RM6C 4H2AA 1JWUD 2M56B 3DCGA 4MJSB 3BINA 1CQVA 3EUB2 3ZRFA 1C4PA 1MFWA 1XLQA 2KLGA 2ZCBA 4K7SA 2M1MA 2YVCA 2C5LC 2IO2B 2BYTA 2LASA 2NCNA 3B2GA 4PT5A 2DNFA 4HWIB 1L2NA 1QOBA 1AN8A 2K39A 2KACA 3OLMD 5FR3A 3AM9A 1WM3A 2CHZA 2KYWA 4MT5A 2IGDA 2OHFA 1YIWA 4G3XB 1DOYA 2QJLA 3AULA 1R4MB 4WJQA 4EKUA 5IOIA 1WRIA 3VR9B 2BYVE 1D6EC 2LWPA 1RYJA 2PE6B 2RDBC 3EECA 3Q69A 3KVFB 2WXKA 2DZKA 4RGTA 2HE7A 1F77A 2NS5A 1VRAB 4KGSA 1TS3A 4KGTA 2ZVNA 4GDLA 5D3DA 3ZNZB 2JY6A 4W9LA 5BYRA 4K1RB 4ZOHC 2WXGA 2LEKA 2W3RA 1JCKB 2EMTA 1YN4A 4XDDA 1C78A 2DZIA 2E3TA 2K8BA 3AEEB 4BAXA 4E3CA 1TS2A 3L16A 4KIKB 4JGHB 3EHVA 1ZOYB 3IHPC 3AN1A 4BBNC 4W9HA 3ZO5B 2C7HA 3N1XC 4MGYE 4G11A 2JF5A 4NJ6A 5E6JA 2OJRA 3Q8FA 4IOIE 2V9HA 2JRIB 3A33B 3NHEB 3DDCB 3ETRA 3UF8A 4GXBA 2KN4A 2KWDA 2N7EA 2BGFA 2PKOA 5HFYA 3R7RA 1E5WA 2IO1B 4DHZE 2JUOA 5HG2A 3VTUA 1ROEA 3GZNB 2LI5A 1LXDA 2WXFA 5IP4D 2MBHA 5J17A 1EF5A 2K3UA 3ZDTA 1KLVA 3L13A 4HDOA 1UBIA 1HXYD 1TJEA 4CHKA 1QQRA 2N9EB 2PEAA 3PREA 3A4RA 3AU5A 3ZW3A 1ET9A 2LGSA 4YT0B 1H4RA 2K5PA 2IZVB 4F7ZA 2IYDB 4IWPA 4YTNB 2R2QA 2LUMA 3PTFC 2K1FA 3R66C 1EO6A 3DHGC 2D5GA 3ZNGC 4M0WB 2NBUA 2GBMA 3C19A 3TEZA 1SE4A 1AWDA 3QC8B 2I1KA 2KTRB 2VRRB 2EMSA 4OHJA 2LVOA 3A1QA 3IAS1 1E0ZA 1K51A 4GLSC 1VJKA 2R2OA 4IG7B 2AX5A 4OVUA 2IPKD 3MHSD 2ZVOA 2L32A 1QILA 4HCPB 3H9DA 3APCA 3RNCC 2MX2A 1WIAA 2MSED 2KJ6A 2FBWB 3KLSX 2BYFA 3PLVA 1CMXB 1UZXB 3Q6BA 2V3NA 4C56C 2JXTA 2CKHB 3DWGC 2NPTA 1FM0D 2X8XX 4M8NA 2ACZB 3UQBA 2BTEA 3T3NA 4UDUC 4WAAA 1DOIA 2WS3B 1JWAD 3AE5B 2XNAC 2TSSA 2INPE 4KKIA 3QHTA 5CTRC 3W1YA 2YLMA 3TEXA 4BKTA 1XLOA 4NY0A 5IO9A 4F8CB 4NAMA 1OQYA 1I4QA 3Q8CA 1J7AA 1IPGA 1JMLA 5AUKA 2OOBB 4IKGA 2PTLA 3B08A 4BOZB 1IYFA 3I9V1 4HVBA 2LFIA 3T3OA 1J0GA 3ZJTA 3D32A 3APDA 4LDTD 4W9EA 5CHVC 3MJ5A 2QILA 2BKFA 3U2SC 3DBLI 1OEYJ 1I35A 2GB1A 2N9XA 4MELA 1I4RA 2H89B 1HE8A 2LXCA 1JRUA 2ZW0A 3VUYA 1J7CA 1WGKA 3TEWA 4FHKA 5AZHA 1GC6A 1ZPSA 3AE9B 3UGBB 1H8CA 3DBSA 5CHFA 3BIID 4R3DA 3E9SA 4I6LB 4XDCA 3GE3C 3FAHA 3H8HA 1I42A 2VH1A 2OEDA 1WJ4A 5G55A 1GPXA 1WYGA 4IC7B 3L0WB 4W9IA 3T8MA 2RR9A 1EM7A 2W9NA 4XYCA 3FILB 3I5JC 1ZKHA 2WNMA 2B76B 4MH0E 2I2YA 1WH3A 1YX5B 1K50A 2HDEA 2KJHB 4GIVA 3R3MA 2PJHA 4DXGA 3ZLZA 4NQKE 1I4GA 1KLGD 2LJ5A 3NVWA 3NOBA 3AXCA 2DWQA 4HJGE 1HZ6A 5J18A 4I6NB 1R4NI 1TKEA 4N58A 2KFKB 5TSSA 4PYUA 4XGAB 1JALA 2UWQA 1WGRA 1L0XB 3WIMA 2WXNA 4WWNA 1YQ3B 5FR6A 1RWSA 2WU5B 3KW5B 2WXIA 3SEBA 3HVDA 1E90A 4PYZA 1P98A 2ZPNA 4GGQA 3HVZA 1D5MC 1YNTE 2KDIA 1BXTA 4JIOU 3U7ZA 2ASQA 1VD2A 2DENB 3VXWA 3ECIA 1F9JA 3SU8X 1WYWB 2BKRB 3NZUA 4CO7A 2K0PA 3NS8A 1EWCA 3AB5A 5EE0A 4E74A 1T0QC 2MLBA 4X57B 1SXTA 3B9JA 4MH8A 3R2TA 2V3PA 1C3TA 1HQRD 1WGDA 4FULA 3DOWA 2NVUI 4L1BA 1T5XD 4TUUA 4A6QA 1NI3A 4DDGD 2A5UA 1E6EB 4BFRA 1YQ4B 1YOVB 2G4DB 2CU1A 2ZCCA 1FFUA 3RN9C 2JSVX 4OW0A 2BBCA 2KNBA 1ACCA 3DPDA 1WX8A 2FIFA 2K8HA 1XD3B 2QDFA 2EKIA 5HKHA 2KANA 1XT9B 4ICUA 2BB5A 1D4BA 1YN5A 5JZEB 4IM3A 1SGHA 4IWQA 3B1LX 3AMZA 3PVLA 3QCAA 3WAOA 4PK1A 2L3ZA 1QLBB 4EFOA 2D3BA 1GAQB 1U4AA 3AEBB 2J52A 1GB1A 4FXCA 5EE1A 2WX0A 1IBXB 4XZ4A 3GE8C 5JH5C 1SE3A 3Q8EA 2H88B 3IFWB 1L6VA 2QMTA 3VRBB 1KH0A 4IDIA 1GB4A 2BYEA 3O65B 2KC1A 1YJIA 1MVKA 2JVCA 4GOCA 3UIPB 3VHTC 2Z0EB 4MJSA 3U7DA 2CHWA 1E9MA 2NTSA 5L83A 1CZPA 5CX3A 1AARA 2MRPA 4BVUC 1ZW7A 2DYMA 2JXXA 2IO0B 4MSMB 4WAFA 3DWMA 3M63B 3P4QB 4WWMA 2M0AA 4URKA 1MJDA 1TS5A 2KDBA 2IGHA 1L4DB 1EUVB 4YSYB 1WY8A 3VUXA 1UF0A 2KOXA 2GBRA 3GS2A 2ZNVC 1SF0A 1MHHE 5JXVA 1ET6A 1SJED 2JX5A 2MJ3A 4PS3A 4BZAA 3RULA 2Y5CA 1ZGUB 3TCAA 1IUEA 3DVGX 3C8YA 1FXIA 3ZYYX 3B0AA 2XK5B 1PYWD 3TJPA 3ZXRA 1FRDA 1L4ZB 1OEYA 4ZHPA 2AWTA 2BS3B 4K7WA 2BW2A 1FMAD 3ZGZA 2BQQA 2WYQA 3AE8B 4FHJA 2C7NB 3ML8A 4KV2A 1ESFA 2M8SA 4KIKA 5J2RA 1RRBA 1UWXA 4ICVA 5KHQA 1SE2A 3WA0A 4A9AA 1VLBA 2KO3A 1TTNA 1GNUA 4MGZE 1LO5D 1NYQA 1KOTA 3Q3MC 1L5PA 1WZ0A 3HM3A 3MHZA 3QWZB 4NJCA 2LMCA 3AEGB 2ONQA 2CJOA 4A55A 3P4PB 4AS1A 1FNWA 1DGJA 4FLHA 3GB1A 1NBFC 3BYTB 3U30A 4AJWA 3ZNHB 1J8CA 5BMIA 3AECB 4WJNA 3WANA 3JYUA 4REZA 1F2RC 1GG3A 5H8YE 4OZBA 2Y3AA 3ZXVA 3RYTA 1N60A 2IJ0A 2AQ3B 1M4VA 4W9DA 2L8JA 1MG4A 3QQ8B 3QAQA 3DBHB 1VZ7A 3SHQA 4JX1C 4LNKA 2PLPA 2O2VB 2DZMA 2D07B 3DBLB 3PHWB 1Q1OA 1S1QB 1PDXA 5JHAA 4LJOB 1M94A 2WWZA 3LXFA 3NVVA 4RGMA 4M0WA 1KRHA 2MCNB 3Q14C 1JWMD 1K52A 2K6DB 4MM3B 2W3SA 2DLBA 4LNOA 2WXRA 3AE1B 2RDHA 2BPSA 3AEDB 2KWCA 1WGYA 3BYYB 1PQSA 3QJZA 2KKCA 2IDYA 1V1PB 2RSUA 2BWES 5C3JB 4NJ7A 1E7PB 5FKAC 2LGIA 5D6JB 1WJUA 4AJYB 2BS2B 3KUCB 2LZ6A 3N9YC 1WFYA 4DHJB 4HLEA 5G5HA 2ZPYA 3P42A 2FCQA 4GB9A 3TIXA 2PIAA 2YEPF 3UQAA 4MGKE 5GXGB 2M17A 3SFDB 2JPHA 2WDRB 2WHIA 2K22A 4EZKA 2KQSA 4HDQA 3JSVB 5L95C 3NY5A 3NVZA 1J7BA 4JPSA 4ZRIA 2X38A 4W9FA 3TL5A 2LRUA 2MJDA 3NS1A 2QCZA 4KDLB 2DYOA 2M0XA 3DQVA 5G2NA 1FFVA 1V9JA 5C1ZA 3W5VB 1KLUD 5AUIA 3ZQ4A 1JRPA 3CF6E 1MI0A 3VH3B 1EF1A 3Q3FA 1WXQA 4LLGM 1SJHD 1D5ZC 2INCC 3BY4B 3N32A 3GOEA 2FE8A 4FA6A 1TKGA 3A9JB 3N30A 3TSSA 4EE2A 3WALA 1Z2MA 2LVQA 1LGRA 1VZ8A 1SBBB 4OVZA 4CQNA 4WURA 1GUAB 1PFDA 1ZUD2 4XE0A 1FRRA 1WJNA 2Z8LA 2N9PC 1MPEA 3ZNID 3FILA 3TBLD 4ZHOA 4TV3A 1D3ZA 2JWUA 2WU2B 4K3CA 2N9KA 4AOFA 5AZGA 2CHXA 2KDMA 3MC8A 2C7MB 5I4DA 4DXFA 1R4MI 1RFKA 2LRWA 2QC8A 4LK0M 3HM6X 5EE3A 4WIPA 1WXSA 2KFKA 3RNFC 1KF6B 3PSEB 4LTUA 4S17A 4ANUA 5IAAC 2PW9A 2GBKA 2SAKA 2KK8A 3EC8A 4KSKC 5E6NA 4AWJA 4XWWA 1VZ6A 2IGGA 2Z0DB 1BT0A 1NENB 1ZXIA 2J0MA 2JYTA 3ZJVA 3AE7B 4EOYA 1HA5A 1J19A 2NBVB 4K81A 3ZTDA 3Q3NC 2J7QB 2LHEA 4IUMB 1WMHB 2AQ2B 4P6VF 2G4SA 3PGEA 1E8XA 4B6WA 1XCQL 1V5TA 3RT3B 4L23A 2BB6A 5BO4B 1IP9A 2LVPA 1CJEA 3IVFA 4IW0A 2JU6X 4II2B 2BWFA 4RM8A 2WDTB 4LNFA 4HEA1 1ZDXA 4YSZB 2MJEA 1FNVA 4M00A 3HUIA 4N59A 1TBEA 2KDFB 1ISNA 2I1JA 3AE4B 4ZYNA 3PZ8A 4KZ0A 1B9RA 4C7ZA 4DHZB 1E7UA 1FXAA 5AZFA 4NAWB 3L4PA 1OFFA 2WP9B 2LHDA 4TKNA 1WF9A 2IY1B 2PPHA 3NVYA 3RNGC 1WM2A 3MC0B 2WXMA 4C80A 3DBRB 2MH7A 4GDKB 3HK0A 4M8MA 4RGOS 4B95A 3SFEB 4B0EA 1XCTL 1SE9A 2KZRA 2ZZPB 3U4EG 1MHXA 1ZE3D 1FCLA 2MP2B 3H7PB 1WSPA 3B2FA 4A3OA 1RFAA 1E8WA 1FIQA 2O6VB 2MEKA 1UD7A 3RZWC 1KJTA 1TYGB 3ENEA 3RNEC 2KHWB 3RCZA 1Y56A 1V8CA 5D7GA 4HXDA 2RDGA 1SEBD 1IBXA 3JVZX 2L52A 4BKSA 1F2RI 3M95A 2VZKB 3U52E 3AV8A 3DHHC 2PE9A 3T9LA 1UELA 4KGRA 4ITKA 4HROA 2G3QB 3LDZE 2QHOA 2GBJA 4JE3B 4AQ7A 1L6UA 4YSXB 1P3QU 4QAYA 2FCNA 1E8YA 1L7YA 4Q2JA 1GC7A 3ALBA 3PPAA 1C4AA 1FD6A 3LJ3A 4CYEA 2ZJDA 3MTNB 3V61A 1UH6A 4F1SA 4P7IA 3P4SB 1C77A 4KSLC 3RD2A 1UWMA 3MP9A 2BF8B 1HZ5A 2WXOA 4J6IA 3AE3B 4C4VB 2LGDA 1V2YA 4A8XC 2N9LA 3CSFA 2JWZA 2KMAA 1TY0A 1BUIC 1QT9A 1IGDA 3QARA 1K8RB 1CK1A 4BBNF 1WXVA 1UBQA 3EFCA 4EEWA 4FJYA 4L2YA 1I4HA 1N61A 1TT5B 2MW5A 4US8A 2WX1A 3NG0A 1L0VB 4KX6B 1RLFA 4OZCA 3W1SA 3DVNV 1JW9D 2KVZA 1P7FA 2D10A 4O1NA 4HRSA 4YTMB 3IBEA 1WGGA 1FXTB 1OGWA 2RPVA 4M01A 4FN2A 2J0JA 3UINB 2MBQA 3IT4B 4WQOB 3CSTA 3AE6B 1EWYC 1PUTA 1Y8RC 2XK5A 1YJJA 2MBOA 3Q8BA 3L10B 3DHIC 1N62A 2GRIA 4BKGA 4ACFA 1V5OA 2YEPB 2BVCA 4TQ0A 1JWSD 1R7SA 1KFYB 5BYQA 2KX0A 1STEA 1NEKB 2MA9B 2AQ1B 4FADA 3PRPB 3X23A 1SSNA 3ZRCA 2VH2A 2WXJA 3O13A 3ZVVA 2KT7A 1YQBA 4RF0A 2BT6A 3Q3JA 4EZLA 3CMMB 2L05A 4FJVB 2V1YA 2J42A 3CIRB 3S2AA 5LNK1 4BKSD 3QX1A 1AW7A 3R8BA 2D3AA 2K8CA 1K53A 4RH6A 1XEEA 3OJ3A 2G1EA 3U8ZA 3A9KB 1FNUA 1EU4A 2DHZA 4TSSA 4NZLB 1MG8A 1YD8U 3PT2B 4ANVA 3HRDD 1KM7A 3K9OB 4YWGG 4YXDB 5IA7A 2JYEA 1GOZA 1OQQA 3L17A 3FC4A 4LNNA 4NNJB 5CHWA 3KQ4A 3APFA 5AEKB 4OVVA 2KWVB 4XWTA 1NI2A 1TKYA 1T6BX 1T0SC 3DVNU 4MM3A 2ON8A 3VTVA 1XQQA 4HCNB 2PVGC 2JQRB 4WJPA 1DYQA 1KTKA 4JWUC 2IO3B 2JZPA 2Z59B 3A4SC 5DPWA 2IBIB 1WJ6A 2KDEB 1FCCC 2RPQA 3RNAC 2AYOB 4E71A 2N7DA 2V4IB 1V1PA 3PO0A 3LYYA 2L83A 1I4XA 2L0FA 1V97A 4YTPB 2WDVB 2PMVA 1Q0WB 3I3TB 3HHMA 4ZYSA 2CS4A 1PGAA 2KD0A 1EU3A 1Q10A 2LJIA 5C23A 1QKZA 3PHXB 1V80A 1N63A 2HTHA 4M02A 2PVOD 4FJZA 3TEYA 2J4XA 4DDID 3AE2B 3BZDB 2EKEC 2MBEA 4KKJA 3BK1A 3RPFC 3JSVA 3MFGA 2WDQB 4AUQC 1WWTA 3VRAB 1YN3A 1YJ1A 4HJKA 5LXHA 2KTRA 2JT4B 1L0YB 2AEHA 3BWUD 1QF6A 3V3XA 3PZDA 1TGZB 3AI5A 2ZNVB 4ZRPA 1YX6B 1OQRA 2I38A 4LNIA 3N1YC 2LUEA 3AEAB 3MJWA 2D3GA 4P1CC 3LB8C 2GI9A 1F1HA 3AU4A 4LCDE 3R7QA 3TMPB 2EELA 3HIZA 2FIDA 2INDC 4GSWA 3A9JA 2L7RA 2FAZA 2N1WA 3RUIB 1BMLC 1Q5WB 3KWVA 1R4NB 3ABVB 4WWPA 3BVMA 2WXPA 4KZCA 1TY2A 3ZKJC 4ANXA 3M3JA 5D2MB 2HD5B 1LM8B 4KVGB 5BYSA 4J3OD 2LGYA 2K25A 3I63C 3QA8A 2WQYB 1OTRB 2GLSA 4GDLB 5HHDG 2KJRA 2WXLA 3Q8AA 2W55A 4W9KA 2Y5BB 1P7EA 1I7HA 2Q5WD 3OWEB 1WXMA 3V60A 1UGJA 5KHOA 2QEJC 2G45B 2L0TA 2N7JA 4G50A 4KDIC 2SEBD 4I6PA 3W2DA 2KVRA 3NUHB 2MWSB 1DOXA 1N6ZA 3N1ZC 2L00B 3FKYA 3NZ3A 3I57A 3N20C 3VVWB 2N4FA 2HJ8A 2RGFA 4RNAA 5D3IB 3EGRA 4LDTB 4AP4C 1WGHA 2KQ7A 1NDDA 2D11A 2D3CA 3BK2A 3R2IA 4RGNA 1S3SG 3WCQA 1N5XA 4TMAB 4DHJD 4DXAB 1QOGA 1WMHA 3PLUA 4D2KA 4K3BA 4GU2A 1T3QA 1C4CA 1X1MA 3VR8B 4PS7A 4RM9A 3ML9A 2LD9A 2RD0A 2FUHB 2UU7A 4ZRKA 1ZP0B 2NMQA 2R61A 4W9GA 4HPMB 3TUOA 1JQ4A 4XX5A 2L1AA 2DAFA 1C76A 4A90A 2GBNA 2K9XA 1F0ZA 3P2BA 4DWFA 5IKCM 4TQ1A 2RMMA 3OJ4B 5E6OA 5EE9A 4GMVA 1QOAA 4JL9A 2DBYA 1WX7A 2KXJA 2REXA 1C79A 4ZRJA 1HEZE 4RMAA 1AYFA 3N3KB 4RF1A 3A1QB 4NAWA 4RFBA 4EZJA 2NBWB 3BVGA 4B9KA 5TR5A 1V86A 1RAXA 2L76A 5DPRA 3AH7A 3BVZA 3WAMA 3DBHI 2KN5A 2D2QA 1WX9A 4A3PA 4P1BC 1TIFA 4NPNA 4JQWC 5DPTA 1HTQA 4GDKA 2QIEB 1UGMA 5G5GA 3SD5A
chains in the Genus database with same CATH topology
3ZIMA 4DK5A 4KSLC 3RD2A 1WZ3A 4K7WA 3L13A 2WYQA 4HDOA 2BF8B 1UBIA 2MP2A 3H7PA 4FHJA 4CHKA 1P1AA 2C7NB 3ML8A 4J6IA 2O6VA 2N9EB 2M8SA 4KV2A 4KIKA 5J2RA 2LGDA 1SIFA 1V2YA 2C60A 2PEAA 3PREA 3A4RA 2NPTB 3AU5A 1RRBA 3CSFA 2JWZA 2KMAA 4ICVA 3ZW3A 5KHQA 5JHBA 3WA0A 1H4RA 2KO3A 2IY0B 3QARA 2IZVB 1TTNA 1K8RB 4F7ZA 2IYDB 1GNUA 4IWPA 4MGZE 4BBNF 2R2QA 1WXVA 1UBQA 1KOTA 4II3B 2FNJB 3PTFC 1V81A 1WZ0A 2K1FA 3R66C 4FJYA 4EEWA 3HM3A 1EO6A 3ZNGC 2MW5A 4HK2A 4M0WB 3QWZB 1C1YB 2WX1A 2GOWA 2GBMA 2NBUA 1RLFA 4W9CA 3H6NA 3QC8B 3W1SA 2I1KA 2KTRB 2VRRB 1T0YA 3DVNV 3ZDMC 2EMSA 4FLHA 2D10A 2KLCA 2LVOA 4FBJB 3A1QA 3IBEA 1WGGA 1NBFC 1FXTB 3GZNI 5E6PA 1OGWA 3VUWA 4FN2A 3RZFA 2J0JA 3U30A 3UINB 4AJWA 2MBQA 3ZNHB 2R2OA 1J8CA 4WQOB 3CSTA 4IG7B 4OVUA 4WJNA 3WANA 3MHSD 2ZVOA 1QZEA 3JYUA 4HCPB 1Y8RC 2XK5A 3H9DA 1GG3A 3K9PB 3V6EB 3APCA 2MBOA 3RYTA 2MX2A 1WIAA 2MSED 3L10B 2KJ6A 4W9DA 2FCMA 2L8JA 2XBBC 1WRDB 4YL8A 4BKGA 2BYFA 3QQ8B 1V5OA 3QAQA 3PLVA 1CMXB 1UZXB 2MBBB 3SHQA 4TQ0A 2A4ZA 2JRHA 2O2VB 2CKHB 2DZMA 2NPTA 2D07B 1LFDA 4M8NA 1WE6A 3PHWB 1S1QB 1Q1OA 5JHAA 2V3SA 3UQBA 2KX0A 2KFJA 4LJOB 1M94A 2MA9B 4WAAA 4FADA 2WWZA 2DYBA 3PRPB 3X23A 3IG3A 2N1VA 2MCNB 3ZRCA 2J0KA 2B3AA 3QHTA 5CTRC 3W1YA 2UYZB 2K6DB 3ZVVA 1VCBA 3PV1A 1Z5SB 2YLMA 4BKTA 4NY0A 1LQBA 4ZDVA 4F8CB 3UIOB 1OQYA 1YQBA 5G2NA 5LXIB 3Q3JA 4EZLA 1IPGA 3CMMB 1E8ZA 2L05A 2KMCA 4FJVB 2V1YA 2BPSA 2OOBB 3ZUNA 3S2AA 2KWCA 4BKSD 1G6JA 3KH0A 1WGYA 4IM0A 3QX1A 3B08A 1PQSA 3QJZA 4BOZB 1IYFA 2KKCA 4HVBA 1V49A 1A5RA 3W1SC 2K8CA 1J0GA 3V6CB 2V4LA 2RSUA 2BWES 4IWOA 4NJ7A 3D32A 3APDA 4LDTD 4K7UA 4W9JA 4W9EA 2M4NA 5CHVC 3U8ZA 3OJ3A 3A9KB 2BKFA 2MQJA 5D6JB 4XC2A 3DBLI 2DHZA 4MEMA 3VQIA 3KUDB 1WJUA 2KC2A 4AJYB 1OEYJ 1MG8A 1YD8U 3PT2B 4ANVA 3KUCB 2LZ6A 1WFYA 5EDSA 1I35A 4DHJB 2NR2A 1KM7A 3K9OB 2N9XA 4HLEA 4MELA 4WJOA 5IA7A 1HE8A 2LXCA 1JRUA 2ZPYA 3L17A 3WAPA 3VUYA 2FCQA 4NNJB 1P0RA 4GB9A 2GMIC 5CHWA 3TIXA 3APFA 3VH4B 3UQAA 4FHKA 4MGKE 5AZHA 3ZTCA 1GJZA 1GC6A 3KYCD 3UGBB 5AEKB 2M17A 4OVVA 2JPHA 1H8CA 2KWVB 3DBSA 5CHFA 2O6VD 1NI2A 4EZKA 4MGIE 2KQSA 4I6LB 4HDQA 1E7VA 3DVNU 3DVGY 4MM3A 3VTVA 1XQQA 3JSVB 4GN1A 4HCNB 5DCNA 5L95C 4DBGA 1I42A 5G55A 1WJ4A 2JZZA 3NY5A 4IC7B 4WJPA 3L0WB 4W9IA 4ZRIA 3T8MA 3SDLC 3QIJA 2RR9A 4W9FA 3TL5A 2W9NA 2LRUA 5LLIA 1ZKHA 2IO3B 3A4SC 2Z59B 4KDLB 4MH0E 3H7SA 3JW0X 1WH3A 5DPWA 2DYOA 1YX5B 2IBIB 1WE7A 2M0XA 1WJ6A 2KDEB 2XEWA 3DQVA 4JLCA 4LJPB 4MDKE 1V9JA 2KJHB 4GIVA 2RPQA 2PJHA 3R3MA 3EFUA 4PS8A 4MSQB 1P9DU 3ZLZA 2AYOB 5C1ZA 4NQKE 4E71A 2N7DA 3M62B 5D94A 2LJ5A 3NOBA 3CF6E 3AXCA 3L54A 2KX3A 2L0FA 5DPSA 1WXAA 3NZSA 3VH3B 5J18A 3A9KA 1EF1A 4I6NB 1Q0WB 1R4NI 3I3TB 3Q3FA 3HHMA 2KFKB 2LGXA 3V62A 4PYUA 2CS4A 4HPLB 3BY4B 2KD0A 3N32A 4ASWC 2UWQA 3GOEA 4FA6A 1WGRA 5C23A 3VTWA 3WIMA 2AL6A 3OAWA 4WWNA 3A9JB 5FR6A 3N30A 3PHXB 4G0NB 1V80A 3WALA 3KW5B 2HTHA 1Z2MA 2LVQA 3PRMB 4EUTA 2DAJA 2K6QA 4FJZA 1WR1A 1E90A 2DZJA 4DDID 4BOSC 1GUAB 4PYZA 2EKEC 1P98A 2ZPNA 3VFKA 2MBEA 4GGQA 2KDIA 1WJNA 3JSVA 4JIOU 5GMVA 2ASQA 1VD2A 2DENB 2C9WB 2N9PC 3PS6A 3ECIA 1F9JA 4N9F4 3SU8X 3VAWA 4A20A 4AUQC 2KWUB 3VDZA 1WYWB 2BKRB 3NZUA 3ZNID 1YJ1A 4CO7A 4HJKA 5LXHA 2KTRA 3NS8A 4WWOA 3TBLD 2JT4B 4TV3A 2JZ3B 4E74A 2AEHA 2MLBA 4X57B 3PZDA 1D3ZA 2FCSA 1TGZB 3AI5A 3KUZA 3PRZA 1C3TA 2ZNVB 4AOFA 4ANWA 1WGDA 1YX6B 4NQLB 5AZGA 2CHXA 2C7MB 4FULA 3DOWA 3ONSA 2KTFA 2NVUI 2ZEQA 2LUEA 3MJWA 4TUUA 2DX5B 1R4MI 2LRWA 2D3GA 3HM6X 1WXSA 2KFKA 4DDGD 2A5UA 3AU4A 3KYDD 3L08A 3PSEB 4LCDE 3R7QA 3TMPB 2CR5A 4BFRA 3C0RB 3HIZA 4ANUA 1V6EA 3X0WA 2G4DB 5IAAC 2CU1A 2GBKA 2ZCCA 2FIDA 2KK8A 3EC8A 3QK0A 4GSWA 4KSKC 2LXAA 3A9JA 5E6NA 4AWJA 2L7RA 2FAZA 2N1WA 3RUIB 2Z0DB 1BT0A 1Q5WB 2O2VA 4WWPA 2KNBA 2J0MA 3H1UA 3DPDA 1WX8A 2FIFA 2K8HA 3DBRI 1XD3B 4KZCA 4IM2A 1TZ1A 3ZKJC 4ANXA 3M3JA 5D2MB 1WR6E 2HD5B 1LM8B 4EOYA 1WI0A 2AL3A 4KVGB 5HKHA 1J19A 2NBVB 4K81A 3ZTDA 2LGYA 2K25A 3DCGA 3QA8A 2KANA 2J7QB 4MJSB 1OTRB 3BINA 3VXWA 4IUMB 1WMHB 1XT9B 4ICUA 3ZRFA 4GDLB 2KJRA 2G4SA 5JZEB 3PGEA 4IM3A 1SGHA 4W9KA 1E8XA 2Y5BB 4B6WA 2KLGA 1V5TA 2ZCBA 4IWQA 4K7SA 3RT3B 3B1LX 2M1MA 5BO4B 4P7IA 1IP9A 3PVLA 2YVCA 3QCAA 2C5LC 2LVPA 1WXMA 3IVFA 4IW0A 2IO2B 3WAOA 3V60A 2LASA 2NCNA 4II2B 2BWFA 4RM8A 2WDTB 5KHOA 2L3ZA 2G45B 2L0TA 4EFOA 4G50A 4KDIC 1U4AA 4HWIB 4I6PA 1L2NA 2KVRA 2K39A 3OLMD 2MWSB 2L00B 2WX0A 1WM3A 4XZ4A 5JH5C 3VVWB 1TBEA 2CHZA 2KDFB 2N4FA 2HJ8A 1ISNA 2I1JA 4ZYNA 1YIWA 4G3XB 4KZ0A 3IFWB 3AULA 2RGFA 4WJQA 4DHZB 1E7UA 4EKUA 4LDTB 5AZFA 4NAWB 2BYVE 2LWPA 4AP4C 1WGHA 2BYEA 2KQ7A 1NDDA 2PE6B 3EECA 3KVFB 3O65B 2KC1A 2D11A 2JVCA 2DZKA 4GOCA 4TKNA 2HE7A 3UIPB 1WF9A 2IY1B 3VHTC 1S3SG 2NS5A 2PPHA 2Z0EB 4DHJD 4DXAB 4MJSA 3U7DA 1WM2A 1WMHA 2CHWA 3PLUA 5L83A 2ZVNA 4GDLA 5CX3A 3ZNZB 2JY6A 4GU2A 4W9LA 1AARA 1X1MA 4K1RB 2MRPA 4PS7A 4GDKB 3HK0A 4M8MA 4RM9A 4B95A 4BVUC 1ZW7A 2LD9A 2RD0A 3ML9A 2DYMA 2FUHB 2EMTA 2JXXA 1SE9A 2IO0B 2KZRA 2ZZPB 4ZRKA 4MSMB 4W9GA 2DZIA 2MP2B 3H7PB 4A3OA 2K8BA 4HPMB 1RFAA 1E8WA 2O6VB 4E3CA 3L16A 4KIKB 4JGHB 4XX5A 2DAFA 1UD7A 3M63B 3EHVA 3RZWC 1KJTA 4URKA 3IHPC 2GBNA 4BBNC 3ENEA 3P2BA 2KDBA 4W9HA 2KHWB 3RCZA 4DWFA 4TQ1A 5D7GA 3ZO5B 4HXDA 1EUVB 3OJ4B 5E6OA 2C7HA 4GMVA 3JVZX 1WY8A 4JL9A 4BKSA 3VUXA 1WX7A 3M95A 2KOXA 2KXJA 2REXA 4MGYE 4G11A 2GBRA 2JF5A 4ZRJA 2ZNVC 4RMAA 2PE9A 4NJ6A 3T9LA 2OJRA 1UELA 2JRIB 3A33B 2G3QB 3LDZE 2QHOA 3DDCB 3N3KB 3NHEB 3A1QB 4GXBA 4NAWA 3UF8A 4EZJA 4PS3A 2GBJA 2N7EA 2NBWB 2BGFA 4B9KA 1P3QU 3RULA 2FCNA 3R7RA 1E5WA 1E8YA 2IO1B 5TR5A 4DHZE 1V86A 1ZGUB 3TCAA 1RAXA 1L7YA 2JUOA 2L76A 3VTUA 3DVGX 5DPRA 3WAMA 2LI5A 3DBHI 1LXDA 1GC7A 2KN5A 3ALBA 3PPAA 2D2QA 1WX9A 4A3PA 4NPNA 3B0AA 2XK5B 4JQWC 5DPTA 3LJ3A 2MBHA 4CYEA 3TJPA 1EF5A 5J17A 3ZDTA 1OEYA 2ZJDA 3MTNB 4GDKA 1KLVA 1UGMA 3V61A 1UH6A 4F1SA 2AWTA 3SD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIM A;  4DK5 A;  4KSL C;  3RD2 A;  1WZ3 A;  4K7W A;  3L13 A;  2WYQ A;  4HDO A;  2BF8 B;  1UBI A;  2MP2 A;  3H7P A;  4FHJ A;  4CHK A;  1P1A A;  2C7N B;  3ML8 A;  4J6I A;  2O6V A;  2N9E B;  2M8S A;  4KV2 A;  4KIK A;  5J2R A;  2LGD A;  1SIF A;  1V2Y A;  2C60 A;  2PEA A;  3PRE A;  3A4R A;  2NPT B;  3AU5 A;  1RRB A;  3CSF A;  2JWZ A;  2KMA A;  4ICV A;  3ZW3 A;  5KHQ A;  5JHB A;  3WA0 A;  1H4R A;  2KO3 A;  2IY0 B;  3QAR A;  2IZV B;  1TTN A;  1K8R B;  4F7Z A;  2IYD B;  1GNU A;  4IWP A;  4MGZ E;  4BBN F;  2R2Q A;  1WXV A;  1UBQ A;  1KOT A;  4II3 B;  2FNJ B;  3PTF C;  1V81 A;  1WZ0 A;  2K1F A;  3R66 C;  4FJY A;  4EEW A;  3HM3 A;  1EO6 A;  3ZNG C;  2MW5 A;  4HK2 A;  4M0W B;  3QWZ B;  1C1Y B;  2WX1 A;  2GOW A;  2GBM A;  2NBU A;  1RLF A;  4W9C A;  3H6N A;  3QC8 B;  3W1S A;  2I1K A;  2KTR B;  2VRR B;  1T0Y A;  3DVN V;  3ZDM C;  2EMS A;  4FLH A;  2D10 A;  2KLC A;  2LVO A;  4FBJ B;  3A1Q A;  3IBE A;  1WGG A;  1NBF C;  1FXT B;  3GZN I;  5E6P A;  1OGW A;  3VUW A;  4FN2 A;  3RZF A;  2J0J A;  3U30 A;  3UIN B;  4AJW A;  2MBQ A;  3ZNH B;  2R2O A;  1J8C A;  4WQO B;  3CST A;  4IG7 B;  4OVU A;  4WJN A;  3WAN A;  3MHS D;  2ZVO A;  1QZE A;  3JYU A;  4HCP B;  1Y8R C;  2XK5 A;  3H9D A;  1GG3 A;  3K9P B;  3V6E B;  3APC A;  2MBO A;  3RYT A;  2MX2 A;  1WIA A;  2MSE D;  3L10 B;  2KJ6 A;  4W9D A;  2FCM A;  2L8J A;  2XBB C;  1WRD B;  4YL8 A;  4BKG A;  2BYF A;  3QQ8 B;  1V5O A;  3QAQ A;  3PLV A;  1CMX B;  1UZX B;  2MBB B;  3SHQ A;  4TQ0 A;  2A4Z A;  2JRH A;  2O2V B;  2CKH B;  2DZM A;  2NPT A;  2D07 B;  1LFD A;  4M8N A;  1WE6 A;  3PHW B;  1S1Q B;  1Q1O A;  5JHA A;  2V3S A;  3UQB A;  2KX0 A;  2KFJ A;  4LJO B;  1M94 A;  2MA9 B;  4WAA A;  4FAD A;  2WWZ A;  2DYB A;  3PRP B;  3X23 A;  3IG3 A;  2N1V A;  2MCN B;  3ZRC A;  2J0K A;  2B3A A;  3QHT A;  5CTR C;  3W1Y A;  2UYZ B;  2K6D B;  3ZVV A;  1VCB A;  3PV1 A;  1Z5S B;  2YLM A;  4BKT A;  4NY0 A;  1LQB A;  4ZDV A;  4F8C B;  3UIO B;  1OQY A;  1YQB A;  5G2N A;  5LXI B;  3Q3J A;  4EZL A;  1IPG A;  3CMM B;  1E8Z A;  2L05 A;  2KMC A;  4FJV B;  2V1Y A;  2BPS A;  2OOB B;  3ZUN A;  3S2A A;  2KWC A;  4BKS D;  1G6J A;  3KH0 A;  1WGY A;  4IM0 A;  3QX1 A;  3B08 A;  1PQS A;  3QJZ A;  4BOZ B;  1IYF A;  2KKC A;  4HVB A;  1V49 A;  1A5R A;  3W1S C;  2K8C A;  1J0G A;  3V6C B;  2V4L A;  2RSU A;  2BWE S;  4IWO A;  4NJ7 A;  3D32 A;  3APD A;  4LDT D;  4K7U A;  4W9J A;  4W9E A;  2M4N A;  5CHV C;  3U8Z A;  3OJ3 A;  3A9K B;  2BKF A;  2MQJ A;  5D6J B;  4XC2 A;  3DBL I;  2DHZ A;  4MEM A;  3VQI A;  3KUD B;  1WJU A;  2KC2 A;  4AJY B;  1OEY J;  1MG8 A;  1YD8 U;  3PT2 B;  4ANV A;  3KUC B;  2LZ6 A;  1WFY A;  5EDS A;  1I35 A;  4DHJ B;  2NR2 A;  1KM7 A;  3K9O B;  2N9X A;  4HLE A;  4MEL A;  4WJO A;  5IA7 A;  1HE8 A;  2LXC A;  1JRU A;  2ZPY A;  3L17 A;  3WAP A;  3VUY A;  2FCQ A;  4NNJ B;  1P0R A;  4GB9 A;  2GMI C;  5CHW A;  3TIX A;  3APF A;  3VH4 B;  3UQA A;  4FHK A;  4MGK E;  5AZH A;  3ZTC A;  1GJZ A;  1GC6 A;  3KYC D;  3UGB B;  5AEK B;  2M17 A;  4OVV A;  2JPH A;  1H8C A;  2KWV B;  3DBS A;  5CHF A;  2O6V D;  1NI2 A;  4EZK A;  4MGI E;  2KQS A;  4I6L B;  4HDQ A;  1E7V A;  3DVN U;  3DVG Y;  4MM3 A;  3VTV A;  1XQQ A;  3JSV B;  4GN1 A;  4HCN B;  5DCN A;  5L95 C;  4DBG A;  1I42 A;  5G55 A;  1WJ4 A;  2JZZ A;  3NY5 A;  4IC7 B;  4WJP A;  3L0W B;  4W9I A;  4ZRI A;  3T8M A;  3SDL C;  3QIJ A;  2RR9 A;  4W9F A;  3TL5 A;  2W9N A;  2LRU A;  5LLI A;  1ZKH A;  2IO3 B;  3A4S C;  2Z59 B;  4KDL B;  4MH0 E;  3H7S A;  3JW0 X;  1WH3 A;  5DPW A;  2DYO A;  1YX5 B;  2IBI B;  1WE7 A;  2M0X A;  1WJ6 A;  2KDE B;  2XEW A;  3DQV A;  4JLC A;  4LJP B;  4MDK E;  1V9J A;  2KJH B;  4GIV A;  2RPQ A;  2PJH A;  3R3M A;  3EFU A;  4PS8 A;  4MSQ B;  1P9D U;  3ZLZ A;  2AYO B;  5C1Z A;  4NQK E;  4E71 A;  2N7D A;  3M62 B;  5D94 A;  2LJ5 A;  3NOB A;  3CF6 E;  3AXC A;  3L54 A;  2KX3 A;  2L0F A;  5DPS A;  1WXA A;  3NZS A;  3VH3 B;  5J18 A;  3A9K A;  1EF1 A;  4I6N B;  1Q0W B;  1R4N I;  3I3T B;  3Q3F A;  3HHM A;  2KFK B;  2LGX A;  3V62 A;  4PYU A;  2CS4 A;  4HPL B;  3BY4 B;  2KD0 A;  3N32 A;  4ASW C;  2UWQ A;  3GOE A;  4FA6 A;  1WGR A;  5C23 A;  3VTW A;  3WIM A;  2AL6 A;  3OAW A;  4WWN A;  3A9J B;  5FR6 A;  3N30 A;  3PHX B;  4G0N B;  1V80 A;  3WAL A;  3KW5 B;  2HTH A;  1Z2M A;  2LVQ A;  3PRM B;  4EUT A;  2DAJ A;  2K6Q A;  4FJZ A;  1WR1 A;  1E90 A;  2DZJ A;  4DDI D;  4BOS C;  1GUA B;  4PYZ A;  2EKE C;  1P98 A;  2ZPN A;  3VFK A;  2MBE A;  4GGQ A;  2KDI A;  1WJN A;  3JSV A;  4JIO U;  5GMV A;  2ASQ A;  1VD2 A;  2DEN B;  2C9W B;  2N9P C;  3PS6 A;  3ECI A;  1F9J A;  4N9F 4;  3SU8 X;  3VAW A;  4A20 A;  4AUQ C;  2KWU B;  3VDZ A;  1WYW B;  2BKR B;  3NZU A;  3ZNI D;  1YJ1 A;  4CO7 A;  4HJK A;  5LXH A;  2KTR A;  3NS8 A;  4WWO A;  3TBL D;  2JT4 B;  4TV3 A;  2JZ3 B;  4E74 A;  2AEH A;  2MLB A;  4X57 B;  3PZD A;  1D3Z A;  2FCS A;  1TGZ B;  3AI5 A;  3KUZ A;  3PRZ A;  1C3T A;  2ZNV B;  4AOF A;  4ANW A;  1WGD A;  1YX6 B;  4NQL B;  5AZG A;  2CHX A;  2C7M B;  4FUL A;  3DOW A;  3ONS A;  2KTF A;  2NVU I;  2ZEQ A;  2LUE A;  3MJW A;  4TUU A;  2DX5 B;  1R4M I;  2LRW A;  2D3G A;  3HM6 X;  1WXS A;  2KFK A;  4DDG D;  2A5U A;  3AU4 A;  3KYD D;  3L08 A;  3PSE B;  4LCD E;  3R7Q A;  3TMP B;  2CR5 A;  4BFR A;  3C0R B;  3HIZ A;  4ANU A;  1V6E A;  3X0W A;  2G4D B;  5IAA C;  2CU1 A;  2GBK A;  2ZCC A;  2FID A;  2KK8 A;  3EC8 A;  3QK0 A;  4GSW A;  4KSK C;  2LXA A;  3A9J A;  5E6N A;  4AWJ A;  2L7R A;  2FAZ A;  2N1W A;  3RUI B;  2Z0D B;  1BT0 A;  1Q5W B;  2O2V A;  4WWP A;  2KNB A;  2J0M A;  3H1U A;  3DPD A;  1WX8 A;  2FIF A;  2K8H A;  3DBR I;  1XD3 B;  4KZC A;  4IM2 A;  1TZ1 A;  3ZKJ C;  4ANX A;  3M3J A;  5D2M B;  1WR6 E;  2HD5 B;  1LM8 B;  4EOY A;  1WI0 A;  2AL3 A;  4KVG B;  5HKH A;  1J19 A;  2NBV B;  4K81 A;  3ZTD A;  2LGY A;  2K25 A;  3DCG A;  3QA8 A;  2KAN A;  2J7Q B;  4MJS B;  1OTR B;  3BIN A;  3VXW A;  4IUM B;  1WMH B;  1XT9 B;  4ICU A;  3ZRF A;  4GDL B;  2KJR A;  2G4S A;  5JZE B;  3PGE A;  4IM3 A;  1SGH A;  4W9K A;  1E8X A;  2Y5B B;  4B6W A;  2KLG A;  1V5T A;  2ZCB A;  4IWQ A;  4K7S A;  3RT3 B;  3B1L X;  2M1M A;  5BO4 B;  4P7I A;  1IP9 A;  3PVL A;  2YVC A;  3QCA A;  2C5L C;  2LVP A;  1WXM A;  3IVF A;  4IW0 A;  2IO2 B;  3WAO A;  3V60 A;  2LAS A;  2NCN A;  4II2 B;  2BWF A;  4RM8 A;  2WDT B;  5KHO A;  2L3Z A;  2G45 B;  2L0T A;  4EFO A;  4G50 A;  4KDI C;  1U4A A;  4HWI B;  4I6P A;  1L2N A;  2KVR A;  2K39 A;  3OLM D;  2MWS B;  2L00 B;  2WX0 A;  1WM3 A;  4XZ4 A;  5JH5 C;  3VVW B;  1TBE A;  2CHZ A;  2KDF B;  2N4F A;  2HJ8 A;  1ISN A;  2I1J A;  4ZYN A;  1YIW A;  4G3X B;  4KZ0 A;  3IFW B;  3AUL A;  2RGF A;  4WJQ A;  4DHZ B;  1E7U A;  4EKU A;  4LDT B;  5AZF A;  4NAW B;  2BYV E;  2LWP A;  4AP4 C;  1WGH A;  2BYE A;  2KQ7 A;  1NDD A;  2PE6 B;  3EEC A;  3KVF B;  3O65 B;  2KC1 A;  2D11 A;  2JVC A;  2DZK A;  4GOC A;  4TKN A;  2HE7 A;  3UIP B;  1WF9 A;  2IY1 B;  3VHT C;  1S3S G;  2NS5 A;  2PPH A;  2Z0E B;  4DHJ D;  4DXA B;  4MJS A;  3U7D A;  1WM2 A;  1WMH A;  2CHW A;  3PLU A;  5L83 A;  2ZVN A;  4GDL A;  5CX3 A;  3ZNZ B;  2JY6 A;  4GU2 A;  4W9L A;  1AAR A;  1X1M A;  4K1R B;  2MRP A;  4PS7 A;  4GDK B;  3HK0 A;  4M8M A;  4RM9 A;  4B95 A;  4BVU C;  1ZW7 A;  2LD9 A;  2RD0 A;  3ML9 A;  2DYM A;  2FUH B;  2EMT A;  2JXX A;  1SE9 A;  2IO0 B;  2KZR A;  2ZZP B;  4ZRK A;  4MSM B;  4W9G A;  2DZI A;  2MP2 B;  3H7P B;  4A3O A;  2K8B A;  4HPM B;  1RFA A;  1E8W A;  2O6V B;  4E3C A;  3L16 A;  4KIK B;  4JGH B;  4XX5 A;  2DAF A;  1UD7 A;  3M63 B;  3EHV A;  3RZW C;  1KJT A;  4URK A;  3IHP C;  2GBN A;  4BBN C;  3ENE A;  3P2B A;  2KDB A;  4W9H A;  2KHW B;  3RCZ A;  4DWF A;  4TQ1 A;  5D7G A;  3ZO5 B;  4HXD A;  1EUV B;  3OJ4 B;  5E6O A;  2C7H A;  4GMV A;  3JVZ X;  1WY8 A;  4JL9 A;  4BKS A;  3VUX A;  1WX7 A;  3M95 A;  2KOX A;  2KXJ A;  2REX A;  4MGY E;  4G11 A;  2GBR A;  2JF5 A;  4ZRJ A;  2ZNV C;  4RMA A;  2PE9 A;  4NJ6 A;  3T9L A;  2OJR A;  1UEL A;  2JRI B;  3A33 B;  2G3Q B;  3LDZ E;  2QHO A;  3DDC B;  3N3K B;  3NHE B;  3A1Q B;  4GXB A;  4NAW A;  3UF8 A;  4EZJ A;  4PS3 A;  2GBJ A;  2N7E A;  2NBW B;  2BGF A;  4B9K A;  1P3Q U;  3RUL A;  2FCN A;  3R7R A;  1E5W A;  1E8Y A;  2IO1 B;  5TR5 A;  4DHZ E;  1V86 A;  1ZGU B;  3TCA A;  1RAX A;  1L7Y A;  2JUO A;  2L76 A;  3VTU A;  3DVG X;  5DPR A;  3WAM A;  2LI5 A;  3DBH I;  1LXD A;  1GC7 A;  2KN5 A;  3ALB A;  3PPA A;  2D2Q A;  1WX9 A;  4A3P A;  4NPN A;  3B0A A;  2XK5 B;  4JQW C;  5DPT A;  3LJ3 A;  2MBH A;  4CYE A;  3TJP A;  1EF5 A;  5J17 A;  3ZDT A;  1OEY A;  2ZJD A;  3MTN B;  4GDK A;  1KLV A;  1UGM A;  3V61 A;  1UH6 A;  4F1S A;  2AWT A;  3SD5 A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  1I4P A;  4DK5 A;  2WGS A;  1WZ3 A;  2MP2 A;  3H7P A;  4USA A;  1P1A A;  2HJ1 A;  2O6V A;  2BS4 B;  1SIF A;  2C60 A;  2NPT B;  3SR6 A;  5JHB A;  2CU3 A;  2IY0 B;  2KQ4 X;  4II3 B;  2FNJ B;  1V81 A;  3W5U B;  4RCO A;  4HK2 A;  1C1Y B;  4JWS C;  1N5W A;  4MAC A;  2GOW A;  3AEF B;  4W9C A;  3RFZ B;  5C2T B;  1HTO A;  3H6N A;  4DQO C;  1PGX A;  1T0Y A;  3ZDM C;  1TS4 A;  2KLC A;  4FBJ B;  1ENF A;  1UUP A;  2HTM E;  3GZN I;  5E6P A;  2KMM A;  3VUW A;  3RZF A;  4OZA A;  5FK9 C;  5T8I A;  1ZDV A;  4HPP A;  3Q3O C;  4ZRQ A;  1QZE A;  4B0M A;  1XXG A;  4S0R A;  3K9P B;  1IGC A;  3V6E B;  4WQM A;  2FCM A;  2XBB C;  1WRD B;  4YL8 A;  2MBB B;  3CWI A;  1V1O A;  2A4Z A;  4C4V A;  2JRH A;  3NRZ A;  2KAJ A;  1LFD A;  2INN E;  2M19 A;  1WE6 A;  2V3S A;  2KFJ A;  4WH4 A;  5BMH A;  2WLB A;  3RI7 C;  2DYB A;  3IG3 A;  5MPO A;  2N1V A;  2J0K A;  2B3A A;  2UYZ B;  2QSD A;  1VCB A;  3PV1 A;  1XF5 L;  1Z5S B;  5H92 C;  1LQB A;  4ZDV A;  3UIO B;  3RMK C;  3P4R B;  5LXI B;  2N0S B;  1E8Z A;  2KMC A;  3ZUN A;  2W54 A;  1G6J A;  3KH0 A;  4IM0 A;  3IAM 1;  1D5X C;  3E56 A;  1V49 A;  1A5R A;  3W1S C;  3IT6 B;  3PZ7 A;  3V6C B;  2V4L A;  4IWO A;  4W9J A;  4K7U A;  2G9H D;  2M4N A;  2WXQ A;  1F52 A;  2ZW1 A;  3EA6 A;  2WXH A;  2MQJ A;  4N6E B;  3P63 A;  4XC2 A;  4MEM A;  3VQI A;  3KUD B;  2KC2 A;  1NYR A;  5EDS A;  4ARC A;  2NR2 A;  1C9F A;  4WJO A;  1VR9 A;  3V05 A;  3WAP A;  1P0R A;  2GMI C;  3VH4 B;  3NJT A;  3ZTC A;  1GJZ A;  2V0G A;  3KYC D;  1A70 A;  2MHJ A;  3RNB C;  4ARI A;  4P16 A;  2O6V D;  1UNS A;  4MGI E;  1E7V A;  3DVG Y;  1FPY A;  4GN1 A;  5DCN A;  4DBG A;  1ZXH A;  2JZZ A;  3SDL C;  3QIJ A;  1SIJ A;  5LLI A;  1NVI D;  3H7S A;  3JW0 X;  3IXS A;  1WE7 A;  4JLC A;  2XEW A;  4LJP B;  4MDK E;  2VZK D;  3GP7 A;  3EFU A;  4PS8 A;  4MSQ B;  1P9D U;  3M62 B;  1XO3 A;  5D94 A;  2NTT A;  3OG5 A;  2J53 A;  1PGB A;  3L54 A;  2KX3 A;  5DPS A;  1WXA A;  3NZS A;  3A9K A;  4HKZ E;  1TZO A;  2CJN A;  1E10 A;  2LGX A;  3V62 A;  4HPL B;  4ASW C;  1QOF A;  3VTW A;  2AL6 A;  3OAW A;  1VDV A;  4G0N B;  4EUT A;  2E6X A;  3PRM B;  2DAJ A;  2K6Q A;  1WR1 A;  2DZJ A;  4BOS C;  1B1Z A;  1JRO A;  3VFK A;  4C00 A;  3Q2A C;  5GMV A;  2FUG 1;  3KWL A;  4US9 A;  3VAW A;  2C9W B;  3PS6 A;  4N9F 4;  3W9C B;  4A20 A;  2KWU B;  3VDZ A;  4WWO A;  2JZ3 B;  5HI1 A;  1XLN A;  1FO4 A;  1SB3 C;  3UI3 A;  3MC9 A;  2FCS A;  1T0R C;  4C7Y A;  3ZJU A;  3KUZ A;  1YMH E;  5IN7 A;  3PRZ A;  5BMG A;  4ANW A;  4NQL B;  3ONS A;  2KTF A;  2ZEQ A;  2OJW A;  2Y5P A;  2DX5 B;  3P1M A;  2ICI A;  1XLP A;  3KYD D;  3L08 A;  1JWB D;  2W82 A;  2CR5 A;  3C0R B;  1V6E A;  3X0W A;  1FEH A;  3QK0 A;  2LXA A;  3J9C A;  2O2V A;  4HKQ A;  3H1U A;  3DBR I;  4IM2 A;  1TZ1 A;  3URY A;  1WR6 E;  2XN9 C;  1WI0 A;  2AL3 A;  1RM6 C;  4H2A A;  1JWU D;  2M56 B;  3DCG A;  4MJS B;  3BIN A;  1CQV A;  3EUB 2;  3ZRF A;  1C4P A;  1MFW A;  1XLQ A;  2KLG A;  2ZCB A;  4K7S A;  2M1M A;  2YVC A;  2C5L C;  2IO2 B;  2BYT A;  2LAS A;  2NCN A;  3B2G A;  4PT5 A;  2DNF A;  4HWI B;  1L2N A;  1QOB A;  1AN8 A;  2K39 A;  2KAC A;  3OLM D;  5FR3 A;  3AM9 A;  1WM3 A;  2CHZ A;  2KYW A;  4MT5 A;  2IGD A;  2OHF A;  1YIW A;  4G3X B;  1DOY A;  2QJL A;  3AUL A;  1R4M B;  4WJQ A;  4EKU A;  5IOI A;  1WRI A;  3VR9 B;  2BYV E;  1D6E C;  2LWP A;  1RYJ A;  2PE6 B;  2RDB C;  3EEC A;  3Q69 A;  3KVF B;  2WXK A;  2DZK A;  4RGT A;  2HE7 A;  1F77 A;  2NS5 A;  1VRA B;  4KGS A;  1TS3 A;  4KGT A;  2ZVN A;  4GDL A;  5D3D A;  3ZNZ B;  2JY6 A;  4W9L A;  5BYR A;  4K1R B;  4ZOH C;  2WXG A;  2LEK A;  2W3R A;  1JCK B;  2EMT A;  1YN4 A;  4XDD A;  1C78 A;  2DZI A;  2E3T A;  2K8B A;  3AEE B;  4BAX A;  4E3C A;  1TS2 A;  3L16 A;  4KIK B;  4JGH B;  3EHV A;  1ZOY B;  3IHP C;  3AN1 A;  4BBN C;  4W9H A;  3ZO5 B;  2C7H A;  3N1X C;  4MGY E;  4G11 A;  2JF5 A;  4NJ6 A;  5E6J A;  2OJR A;  3Q8F A;  4IOI E;  2V9H A;  2JRI B;  3A33 B;  3NHE B;  3DDC B;  3ETR A;  3UF8 A;  4GXB A;  2KN4 A;  2KWD A;  2N7E A;  2BGF A;  2PKO A;  5HFY A;  3R7R A;  1E5W A;  2IO1 B;  4DHZ E;  2JUO A;  5HG2 A;  3VTU A;  1ROE A;  3GZN B;  2LI5 A;  1LXD A;  2WXF A;  5IP4 D;  2MBH A;  5J17 A;  1EF5 A;  2K3U A;  3ZDT A;  1KLV A;  3L13 A;  4HDO A;  1UBI A;  1HXY D;  1TJE A;  4CHK A;  1QQR A;  2N9E B;  2PEA A;  3PRE A;  3A4R A;  3AU5 A;  3ZW3 A;  1ET9 A;  2LGS A;  4YT0 B;  1H4R A;  2K5P A;  2IZV B;  4F7Z A;  2IYD B;  4IWP A;  4YTN B;  2R2Q A;  2LUM A;  3PTF C;  2K1F A;  3R66 C;  1EO6 A;  3DHG C;  2D5G A;  3ZNG C;  4M0W B;  2NBU A;  2GBM A;  3C19 A;  3TEZ A;  1SE4 A;  1AWD A;  3QC8 B;  2I1K A;  2KTR B;  2VRR B;  2EMS A;  4OHJ A;  2LVO A;  3A1Q A;  3IAS 1;  1E0Z A;  1K51 A;  4GLS C;  1VJK A;  2R2O A;  4IG7 B;  2AX5 A;  4OVU A;  2IPK D;  3MHS D;  2ZVO A;  2L32 A;  1QIL A;  4HCP B;  3H9D A;  3APC A;  3RNC C;  2MX2 A;  1WIA A;  2MSE D;  2KJ6 A;  2FBW B;  3KLS X;  2BYF A;  3PLV A;  1CMX B;  1UZX B;  3Q6B A;  2V3N A;  4C56 C;  2JXT A;  2CKH B;  3DWG C;  2NPT A;  1FM0 D;  2X8X X;  4M8N A;  2ACZ B;  3UQB A;  2BTE A;  3T3N A;  4UDU C;  4WAA A;  1DOI A;  2WS3 B;  1JWA D;  3AE5 B;  2XNA C;  2TSS A;  2INP E;  4KKI A;  3QHT A;  5CTR C;  3W1Y A;  2YLM A;  3TEX A;  4BKT A;  1XLO A;  4NY0 A;  5IO9 A;  4F8C B;  4NAM A;  1OQY A;  1I4Q A;  3Q8C A;  1J7A A;  1IPG A;  1JML A;  5AUK A;  2OOB B;  4IKG A;  2PTL A;  3B08 A;  4BOZ B;  1IYF A;  3I9V 1;  4HVB A;  2LFI A;  3T3O A;  1J0G A;  3ZJT A;  3D32 A;  3APD A;  4LDT D;  4W9E A;  5CHV C;  3MJ5 A;  2QIL A;  2BKF A;  3U2S C;  3DBL I;  1OEY J;  1I35 A;  2GB1 A;  2N9X A;  4MEL A;  1I4R A;  2H89 B;  1HE8 A;  2LXC A;  1JRU A;  2ZW0 A;  3VUY A;  1J7C A;  1WGK A;  3TEW A;  4FHK A;  5AZH A;  1GC6 A;  1ZPS A;  3AE9 B;  3UGB B;  1H8C A;  3DBS A;  5CHF A;  3BII D;  4R3D A;  3E9S A;  4I6L B;  4XDC A;  3GE3 C;  3FAH A;  3H8H A;  1I42 A;  2VH1 A;  2OED A;  1WJ4 A;  5G55 A;  1GPX A;  1WYG A;  4IC7 B;  3L0W B;  4W9I A;  3T8M A;  2RR9 A;  1EM7 A;  2W9N A;  4XYC A;  3FIL B;  3I5J C;  1ZKH A;  2WNM A;  2B76 B;  4MH0 E;  2I2Y A;  1WH3 A;  1YX5 B;  1K50 A;  2HDE A;  2KJH B;  4GIV A;  3R3M A;  2PJH A;  4DXG A;  3ZLZ A;  4NQK E;  1I4G A;  1KLG D;  2LJ5 A;  3NVW A;  3NOB A;  3AXC A;  2DWQ A;  4HJG E;  1HZ6 A;  5J18 A;  4I6N B;  1R4N I;  1TKE A;  4N58 A;  2KFK B;  5TSS A;  4PYU A;  4XGA B;  1JAL A;  2UWQ A;  1WGR A;  1L0X B;  3WIM A;  2WXN A;  4WWN A;  1YQ3 B;  5FR6 A;  1RWS A;  2WU5 B;  3KW5 B;  2WXI A;  3SEB A;  3HVD A;  1E90 A;  4PYZ A;  1P98 A;  2ZPN A;  4GGQ A;  3HVZ A;  1D5M C;  1YNT E;  2KDI A;  1BXT A;  4JIO U;  3U7Z A;  2ASQ A;  1VD2 A;  2DEN B;  3VXW A;  3ECI A;  1F9J A;  3SU8 X;  1WYW B;  2BKR B;  3NZU A;  4CO7 A;  2K0P A;  3NS8 A;  1EWC A;  3AB5 A;  5EE0 A;  4E74 A;  1T0Q C;  2MLB A;  4X57 B;  1SXT A;  3B9J A;  4MH8 A;  3R2T A;  2V3P A;  1C3T A;  1HQR D;  1WGD A;  4FUL A;  3DOW A;  2NVU I;  4L1B A;  1T5X D;  4TUU A;  4A6Q A;  1NI3 A;  4DDG D;  2A5U A;  1E6E B;  4BFR A;  1YQ4 B;  1YOV B;  2G4D B;  2CU1 A;  2ZCC A;  1FFU A;  3RN9 C;  2JSV X;  4OW0 A;  2BBC A;  2KNB A;  1ACC A;  3DPD A;  1WX8 A;  2FIF A;  2K8H A;  1XD3 B;  2QDF A;  2EKI A;  5HKH A;  2KAN A;  1XT9 B;  4ICU A;  2BB5 A;  1D4B A;  1YN5 A;  5JZE B;  4IM3 A;  1SGH A;  4IWQ A;  3B1L X;  3AMZ A;  3PVL A;  3QCA A;  3WAO A;  4PK1 A;  2L3Z A;  1QLB B;  4EFO A;  2D3B A;  1GAQ B;  1U4A A;  3AEB B;  2J52 A;  1GB1 A;  4FXC A;  5EE1 A;  2WX0 A;  1IBX B;  4XZ4 A;  3GE8 C;  5JH5 C;  1SE3 A;  3Q8E A;  2H88 B;  3IFW B;  1L6V A;  2QMT A;  3VRB B;  1KH0 A;  4IDI A;  1GB4 A;  2BYE A;  3O65 B;  2KC1 A;  1YJI A;  1MVK A;  2JVC A;  4GOC A;  3UIP B;  3VHT C;  2Z0E B;  4MJS A;  3U7D A;  2CHW A;  1E9M A;  2NTS A;  5L83 A;  1CZP A;  5CX3 A;  1AAR A;  2MRP A;  4BVU C;  1ZW7 A;  2DYM A;  2JXX A;  2IO0 B;  4MSM B;  4WAF A;  3DWM A;  3M63 B;  3P4Q B;  4WWM A;  2M0A A;  4URK A;  1MJD A;  1TS5 A;  2KDB A;  2IGH A;  1L4D B;  1EUV B;  4YSY B;  1WY8 A;  3VUX A;  1UF0 A;  2KOX A;  2GBR A;  3GS2 A;  2ZNV C;  1SF0 A;  1MHH E;  5JXV A;  1ET6 A;  1SJE D;  2JX5 A;  2MJ3 A;  4PS3 A;  4BZA A;  3RUL A;  2Y5C A;  1ZGU B;  3TCA A;  1IUE A;  3DVG X;  3C8Y A;  1FXI A;  3ZYY X;  3B0A A;  2XK5 B;  1PYW D;  3TJP A;  3ZXR A;  1FRD A;  1L4Z B;  1OEY A;  4ZHP A;  2AWT A;  2BS3 B;  4K7W A;  2BW2 A;  1FMA D;  3ZGZ A;  2BQQ A;  2WYQ A;  3AE8 B;  4FHJ A;  2C7N B;  3ML8 A;  4KV2 A;  1ESF A;  2M8S A;  4KIK A;  5J2R A;  1RRB A;  1UWX A;  4ICV A;  5KHQ A;  1SE2 A;  3WA0 A;  4A9A A;  1VLB A;  2KO3 A;  1TTN A;  1GNU A;  4MGZ E;  1LO5 D;  1NYQ A;  1KOT A;  3Q3M C;  1L5P A;  1WZ0 A;  3HM3 A;  3MHZ A;  3QWZ B;  4NJC A;  2LMC A;  3AEG B;  2ONQ A;  2CJO A;  4A55 A;  3P4P B;  4AS1 A;  1FNW A;  1DGJ A;  4FLH A;  3GB1 A;  1NBF C;  3BYT B;  3U30 A;  4AJW A;  3ZNH B;  1J8C A;  5BMI A;  3AEC B;  4WJN A;  3WAN A;  3JYU A;  4REZ A;  1F2R C;  1GG3 A;  5H8Y E;  4OZB A;  2Y3A A;  3ZXV A;  3RYT A;  1N60 A;  2IJ0 A;  2AQ3 B;  1M4V A;  4W9D A;  2L8J A;  1MG4 A;  3QQ8 B;  3QAQ A;  3DBH B;  1VZ7 A;  3SHQ A;  4JX1 C;  4LNK A;  2PLP A;  2O2V B;  2DZM A;  2D07 B;  3DBL B;  3PHW B;  1Q1O A;  1S1Q B;  1PDX A;  5JHA A;  4LJO B;  1M94 A;  2WWZ A;  3LXF A;  3NVV A;  4RGM A;  4M0W A;  1KRH A;  2MCN B;  3Q14 C;  1JWM D;  1K52 A;  2K6D B;  4MM3 B;  2W3S A;  2DLB A;  4LNO A;  2WXR A;  3AE1 B;  2RDH A;  2BPS A;  3AED B;  2KWC A;  1WGY A;  3BYY B;  1PQS A;  3QJZ A;  2KKC A;  2IDY A;  1V1P B;  2RSU A;  2BWE S;  5C3J B;  4NJ7 A;  1E7P B;  5FKA C;  2LGI A;  5D6J B;  1WJU A;  4AJY B;  2BS2 B;  3KUC B;  2LZ6 A;  3N9Y C;  1WFY A;  4DHJ B;  4HLE A;  5G5H A;  2ZPY A;  3P42 A;  2FCQ A;  4GB9 A;  3TIX A;  2PIA A;  2YEP F;  3UQA A;  4MGK E;  5GXG B;  2M17 A;  3SFD B;  2JPH A;  2WDR B;  2WHI A;  2K22 A;  4EZK A;  2KQS A;  4HDQ A;  3JSV B;  5L95 C;  3NY5 A;  3NVZ A;  1J7B A;  4JPS A;  4ZRI A;  2X38 A;  4W9F A;  3TL5 A;  2LRU A;  2MJD A;  3NS1 A;  2QCZ A;  4KDL B;  2DYO A;  2M0X A;  3DQV A;  5G2N A;  1FFV A;  1V9J A;  5C1Z A;  3W5V B;  1KLU D;  5AUI A;  3ZQ4 A;  1JRP A;  3CF6 E;  1MI0 A;  3VH3 B;  1EF1 A;  3Q3F A;  1WXQ A;  4LLG M;  1SJH D;  1D5Z C;  2INC C;  3BY4 B;  3N32 A;  3GOE A;  2FE8 A;  4FA6 A;  1TKG A;  3A9J B;  3N30 A;  3TSS A;  4EE2 A;  3WAL A;  1Z2M A;  2LVQ A;  1LGR A;  1VZ8 A;  1SBB B;  4OVZ A;  4CQN A;  4WUR A;  1GUA B;  1PFD A;  1ZUD 2;  4XE0 A;  1FRR A;  1WJN A;  2Z8L A;  2N9P C;  1MPE A;  3ZNI D;  3FIL A;  3TBL D;  4ZHO A;  4TV3 A;  1D3Z A;  2JWU A;  2WU2 B;  4K3C A;  2N9K A;  4AOF A;  5AZG A;  2CHX A;  2KDM A;  3MC8 A;  2C7M B;  5I4D A;  4DXF A;  1R4M I;  1RFK A;  2LRW A;  2QC8 A;  4LK0 M;  3HM6 X;  5EE3 A;  4WIP A;  1WXS A;  2KFK A;  3RNF C;  1KF6 B;  3PSE B;  4LTU A;  4S17 A;  4ANU A;  5IAA C;  2PW9 A;  2GBK A;  2SAK A;  2KK8 A;  3EC8 A;  4KSK C;  5E6N A;  4AWJ A;  4XWW A;  1VZ6 A;  2IGG A;  2Z0D B;  1BT0 A;  1NEN B;  1ZXI A;  2J0M A;  2JYT A;  3ZJV A;  3AE7 B;  4EOY A;  1HA5 A;  1J19 A;  2NBV B;  4K81 A;  3ZTD A;  3Q3N C;  2J7Q B;  2LHE A;  4IUM B;  1WMH B;  2AQ2 B;  4P6V F;  2G4S A;  3PGE A;  1E8X A;  4B6W A;  1XCQ L;  1V5T A;  3RT3 B;  4L23 A;  2BB6 A;  5BO4 B;  1IP9 A;  2LVP A;  1CJE A;  3IVF A;  4IW0 A;  2JU6 X;  4II2 B;  2BWF A;  4RM8 A;  2WDT B;  4LNF A;  4HEA 1;  1ZDX A;  4YSZ B;  2MJE A;  1FNV A;  4M00 A;  3HUI A;  4N59 A;  1TBE A;  2KDF B;  1ISN A;  2I1J A;  3AE4 B;  4ZYN A;  3PZ8 A;  4KZ0 A;  1B9R A;  4C7Z A;  4DHZ B;  1E7U A;  1FXA A;  5AZF A;  4NAW B;  3L4P A;  1OFF A;  2WP9 B;  2LHD A;  4TKN A;  1WF9 A;  2IY1 B;  2PPH A;  3NVY A;  3RNG C;  1WM2 A;  3MC0 B;  2WXM A;  4C80 A;  3DBR B;  2MH7 A;  4GDK B;  3HK0 A;  4M8M A;  4RGO S;  4B95 A;  3SFE B;  4B0E A;  1XCT L;  1SE9 A;  2KZR A;  2ZZP B;  3U4E G;  1MHX A;  1ZE3 D;  1FCL A;  2MP2 B;  3H7P B;  1WSP A;  3B2F A;  4A3O A;  1RFA A;  1E8W A;  1FIQ A;  2O6V B;  2MEK A;  1UD7 A;  3RZW C;  1KJT A;  1TYG B;  3ENE A;  3RNE C;  2KHW B;  3RCZ A;  1Y56 A;  1V8C A;  5D7G A;  4HXD A;  2RDG A;  1SEB D;  1IBX A;  3JVZ X;  2L52 A;  4BKS A;  1F2R I;  3M95 A;  2VZK B;  3U52 E;  3AV8 A;  3DHH C;  2PE9 A;  3T9L A;  1UEL A;  4KGR A;  4ITK A;  4HRO A;  2G3Q B;  3LDZ E;  2QHO A;  2GBJ A;  4JE3 B;  4AQ7 A;  1L6U A;  4YSX B;  1P3Q U;  4QAY A;  2FCN A;  1E8Y A;  1L7Y A;  4Q2J A;  1GC7 A;  3ALB A;  3PPA A;  1C4A A;  1FD6 A;  3LJ3 A;  4CYE A;  2ZJD A;  3MTN B;  3V61 A;  1UH6 A;  4F1S A;  4P7I A;  3P4S B;  1C77 A;  4KSL C;  3RD2 A;  1UWM A;  3MP9 A;  2BF8 B;  1HZ5 A;  2WXO A;  4J6I A;  3AE3 B;  4C4V B;  2LGD A;  1V2Y A;  4A8X C;  2N9L A;  3CSF A;  2JWZ A;  2KMA A;  1TY0 A;  1BUI C;  1QT9 A;  1IGD A;  3QAR A;  1K8R B;  1CK1 A;  4BBN F;  1WXV A;  1UBQ A;  3EFC A;  4EEW A;  4FJY A;  4L2Y A;  1I4H A;  1N61 A;  1TT5 B;  2MW5 A;  4US8 A;  2WX1 A;  3NG0 A;  1L0V B;  4KX6 B;  1RLF A;  4OZC A;  3W1S A;  3DVN V;  1JW9 D;  2KVZ A;  1P7F A;  2D10 A;  4O1N A;  4HRS A;  4YTM B;  3IBE A;  1WGG A;  1FXT B;  1OGW A;  2RPV A;  4M01 A;  4FN2 A;  2J0J A;  3UIN B;  2MBQ A;  3IT4 B;  4WQO B;  3CST A;  3AE6 B;  1EWY C;  1PUT A;  1Y8R C;  2XK5 A;  1YJJ A;  2MBO A;  3Q8B A;  3L10 B;  3DHI C;  1N62 A;  2GRI A;  4BKG A;  4ACF A;  1V5O A;  2YEP B;  2BVC A;  4TQ0 A;  1JWS D;  1R7S A;  1KFY B;  5BYQ A;  2KX0 A;  1STE A;  1NEK B;  2MA9 B;  2AQ1 B;  4FAD A;  3PRP B;  3X23 A;  1SSN A;  3ZRC A;  2VH2 A;  2WXJ A;  3O13 A;  3ZVV A;  2KT7 A;  1YQB A;  4RF0 A;  2BT6 A;  3Q3J A;  4EZL A;  3CMM B;  2L05 A;  4FJV B;  2V1Y A;  2J42 A;  3CIR B;  3S2A A;  5LNK 1;  4BKS D;  3QX1 A;  1AW7 A;  3R8B A;  2D3A A;  2K8C A;  1K53 A;  4RH6 A;  1XEE A;  3OJ3 A;  2G1E A;  3U8Z A;  3A9K B;  1FNU A;  1EU4 A;  2DHZ A;  4TSS A;  4NZL B;  1MG8 A;  1YD8 U;  3PT2 B;  4ANV A;  3HRD D;  1KM7 A;  3K9O B;  4YWG G;  4YXD B;  5IA7 A;  2JYE A;  1GOZ A;  1OQQ A;  3L17 A;  3FC4 A;  4LNN A;  4NNJ B;  5CHW A;  3KQ4 A;  3APF A;  5AEK B;  4OVV A;  2KWV B;  4XWT A;  1NI2 A;  1TKY A;  1T6B X;  1T0S C;  3DVN U;  4MM3 A;  2ON8 A;  3VTV A;  1XQQ A;  4HCN B;  2PVG C;  2JQR B;  4WJP A;  1DYQ A;  1KTK A;  4JWU C;  2IO3 B;  2JZP A;  2Z59 B;  3A4S C;  5DPW A;  2IBI B;  1WJ6 A;  2KDE B;  1FCC C;  2RPQ A;  3RNA C;  2AYO B;  4E71 A;  2N7D A;  2V4I B;  1V1P A;  3PO0 A;  3LYY A;  2L83 A;  1I4X A;  2L0F A;  1V97 A;  4YTP B;  2WDV B;  2PMV A;  1Q0W B;  3I3T B;  3HHM A;  4ZYS A;  2CS4 A;  1PGA A;  2KD0 A;  1EU3 A;  1Q10 A;  2LJI A;  5C23 A;  1QKZ A;  3PHX B;  1V80 A;  1N63 A;  2HTH A;  4M02 A;  2PVO D;  4FJZ A;  3TEY A;  2J4X A;  4DDI D;  3AE2 B;  3BZD B;  2EKE C;  2MBE A;  4KKJ A;  3BK1 A;  3RPF C;  3JSV A;  3MFG A;  2WDQ B;  4AUQ C;  1WWT A;  3VRA B;  1YN3 A;  1YJ1 A;  4HJK A;  5LXH A;  2KTR A;  2JT4 B;  1L0Y B;  2AEH A;  3BWU D;  1QF6 A;  3V3X A;  3PZD A;  1TGZ B;  3AI5 A;  2ZNV B;  4ZRP A;  1YX6 B;  1OQR A;  2I38 A;  4LNI A;  3N1Y C;  2LUE A;  3AEA B;  3MJW A;  2D3G A;  4P1C C;  3LB8 C;  2GI9 A;  1F1H A;  3AU4 A;  4LCD E;  3R7Q A;  3TMP B;  2EEL A;  3HIZ A;  2FID A;  2IND C;  4GSW A;  3A9J A;  2L7R A;  2FAZ A;  2N1W A;  3RUI B;  1BML C;  1Q5W B;  3KWV A;  1R4N B;  3ABV B;  4WWP A;  3BVM A;  2WXP A;  4KZC A;  1TY2 A;  3ZKJ C;  4ANX A;  3M3J A;  5D2M B;  2HD5 B;  1LM8 B;  4KVG B;  5BYS A;  4J3O D;  2LGY A;  2K25 A;  3I63 C;  3QA8 A;  2WQY B;  1OTR B;  2GLS A;  4GDL B;  5HHD G;  2KJR A;  2WXL A;  3Q8A A;  2W55 A;  4W9K A;  2Y5B B;  1P7E A;  1I7H A;  2Q5W D;  3OWE B;  1WXM A;  3V60 A;  1UGJ A;  5KHO A;  2QEJ C;  2G45 B;  2L0T A;  2N7J A;  4G50 A;  4KDI C;  2SEB D;  4I6P A;  3W2D A;  2KVR A;  3NUH B;  2MWS B;  1DOX A;  1N6Z A;  3N1Z C;  2L00 B;  3FKY A;  3NZ3 A;  3I57 A;  3N20 C;  3VVW B;  2N4F A;  2HJ8 A;  2RGF A;  4RNA A;  5D3I B;  3EGR A;  4LDT B;  4AP4 C;  1WGH A;  2KQ7 A;  1NDD A;  2D11 A;  2D3C A;  3BK2 A;  3R2I A;  4RGN A;  1S3S G;  3WCQ A;  1N5X A;  4TMA B;  4DHJ D;  4DXA B;  1QOG A;  1WMH A;  3PLU A;  4D2K A;  4K3B A;  4GU2 A;  1T3Q A;  1C4C A;  1X1M A;  3VR8 B;  4PS7 A;  4RM9 A;  3ML9 A;  2LD9 A;  2RD0 A;  2FUH B;  2UU7 A;  4ZRK A;  1ZP0 B;  2NMQ A;  2R61 A;  4W9G A;  4HPM B;  3TUO A;  1JQ4 A;  4XX5 A;  2L1A A;  2DAF A;  1C76 A;  4A90 A;  2GBN A;  2K9X A;  1F0Z A;  3P2B A;  4DWF A;  5IKC M;  4TQ1 A;  2RMM A;  3OJ4 B;  5E6O A;  5EE9 A;  4GMV A;  1QOA A;  4JL9 A;  2DBY A;  1WX7 A;  2KXJ A;  2REX A;  1C79 A;  4ZRJ A;  1HEZ E;  4RMA A;  1AYF A;  3N3K B;  4RF1 A;  3A1Q B;  4NAW A;  4RFB A;  4EZJ A;  2NBW B;  3BVG A;  4B9K A;  5TR5 A;  1V86 A;  1RAX A;  2L76 A;  5DPR A;  3AH7 A;  3BVZ A;  3WAM A;  3DBH I;  2KN5 A;  2D2Q A;  1WX9 A;  4A3P A;  4P1B C;  1TIF A;  4NPN A;  4JQW C;  5DPT A;  1HTQ A;  4GDK A;  2QIE B;  1UGM A;  5G5G A;  3SD5 A; 
#chains in the Genus database with same CATH homology
 3ZIM A;  4DK5 A;  4KSL C;  3RD2 A;  1WZ3 A;  4K7W A;  3L13 A;  2WYQ A;  4HDO A;  2BF8 B;  1UBI A;  2MP2 A;  3H7P A;  4FHJ A;  4CHK A;  1P1A A;  2C7N B;  3ML8 A;  4J6I A;  2O6V A;  2N9E B;  2M8S A;  4KV2 A;  4KIK A;  5J2R A;  2LGD A;  1SIF A;  1V2Y A;  2C60 A;  2PEA A;  3PRE A;  3A4R A;  2NPT B;  3AU5 A;  1RRB A;  3CSF A;  2JWZ A;  2KMA A;  4ICV A;  3ZW3 A;  5KHQ A;  5JHB A;  3WA0 A;  1H4R A;  2KO3 A;  2IY0 B;  3QAR A;  2IZV B;  1TTN A;  1K8R B;  4F7Z A;  2IYD B;  1GNU A;  4IWP A;  4MGZ E;  4BBN F;  2R2Q A;  1WXV A;  1UBQ A;  1KOT A;  4II3 B;  2FNJ B;  3PTF C;  1V81 A;  1WZ0 A;  2K1F A;  3R66 C;  4FJY A;  4EEW A;  3HM3 A;  1EO6 A;  3ZNG C;  2MW5 A;  4HK2 A;  4M0W B;  3QWZ B;  1C1Y B;  2WX1 A;  2GOW A;  2GBM A;  2NBU A;  1RLF A;  4W9C A;  3H6N A;  3QC8 B;  3W1S A;  2I1K A;  2KTR B;  2VRR B;  1T0Y A;  3DVN V;  3ZDM C;  2EMS A;  4FLH A;  2D10 A;  2KLC A;  2LVO A;  4FBJ B;  3A1Q A;  3IBE A;  1WGG A;  1NBF C;  1FXT B;  3GZN I;  5E6P A;  1OGW A;  3VUW A;  4FN2 A;  3RZF A;  2J0J A;  3U30 A;  3UIN B;  4AJW A;  2MBQ A;  3ZNH B;  2R2O A;  1J8C A;  4WQO B;  3CST A;  4IG7 B;  4OVU A;  4WJN A;  3WAN A;  3MHS D;  2ZVO A;  1QZE A;  3JYU A;  4HCP B;  1Y8R C;  2XK5 A;  3H9D A;  1GG3 A;  3K9P B;  3V6E B;  3APC A;  2MBO A;  3RYT A;  2MX2 A;  1WIA A;  2MSE D;  3L10 B;  2KJ6 A;  4W9D A;  2FCM A;  2L8J A;  2XBB C;  1WRD B;  4YL8 A;  4BKG A;  2BYF A;  3QQ8 B;  1V5O A;  3QAQ A;  3PLV A;  1CMX B;  1UZX B;  2MBB B;  3SHQ A;  4TQ0 A;  2A4Z A;  2JRH A;  2O2V B;  2CKH B;  2DZM A;  2NPT A;  2D07 B;  1LFD A;  4M8N A;  1WE6 A;  3PHW B;  1S1Q B;  1Q1O A;  5JHA A;  2V3S A;  3UQB A;  2KX0 A;  2KFJ A;  4LJO B;  1M94 A;  2MA9 B;  4WAA A;  4FAD A;  2WWZ A;  2DYB A;  3PRP B;  3X23 A;  3IG3 A;  2N1V A;  2MCN B;  3ZRC A;  2J0K A;  2B3A A;  3QHT A;  5CTR C;  3W1Y A;  2UYZ B;  2K6D B;  3ZVV A;  1VCB A;  3PV1 A;  1Z5S B;  2YLM A;  4BKT A;  4NY0 A;  1LQB A;  4ZDV A;  4F8C B;  3UIO B;  1OQY A;  1YQB A;  5G2N A;  5LXI B;  3Q3J A;  4EZL A;  1IPG A;  3CMM B;  1E8Z A;  2L05 A;  2KMC A;  4FJV B;  2V1Y A;  2BPS A;  2OOB B;  3ZUN A;  3S2A A;  2KWC A;  4BKS D;  1G6J A;  3KH0 A;  1WGY A;  4IM0 A;  3QX1 A;  3B08 A;  1PQS A;  3QJZ A;  4BOZ B;  1IYF A;  2KKC A;  4HVB A;  1V49 A;  1A5R A;  3W1S C;  2K8C A;  1J0G A;  3V6C B;  2V4L A;  2RSU A;  2BWE S;  4IWO A;  4NJ7 A;  3D32 A;  3APD A;  4LDT D;  4K7U A;  4W9J A;  4W9E A;  2M4N A;  5CHV C;  3U8Z A;  3OJ3 A;  3A9K B;  2BKF A;  2MQJ A;  5D6J B;  4XC2 A;  3DBL I;  2DHZ A;  4MEM A;  3VQI A;  3KUD B;  1WJU A;  2KC2 A;  4AJY B;  1OEY J;  1MG8 A;  1YD8 U;  3PT2 B;  4ANV A;  3KUC B;  2LZ6 A;  1WFY A;  5EDS A;  1I35 A;  4DHJ B;  2NR2 A;  1KM7 A;  3K9O B;  2N9X A;  4HLE A;  4MEL A;  4WJO A;  5IA7 A;  1HE8 A;  2LXC A;  1JRU A;  2ZPY A;  3L17 A;  3WAP A;  3VUY A;  2FCQ A;  4NNJ B;  1P0R A;  4GB9 A;  2GMI C;  5CHW A;  3TIX A;  3APF A;  3VH4 B;  3UQA A;  4FHK A;  4MGK E;  5AZH A;  3ZTC A;  1GJZ A;  1GC6 A;  3KYC D;  3UGB B;  5AEK B;  2M17 A;  4OVV A;  2JPH A;  1H8C A;  2KWV B;  3DBS A;  5CHF A;  2O6V D;  1NI2 A;  4EZK A;  4MGI E;  2KQS A;  4I6L B;  4HDQ A;  1E7V A;  3DVN U;  3DVG Y;  4MM3 A;  3VTV A;  1XQQ A;  3JSV B;  4GN1 A;  4HCN B;  5DCN A;  5L95 C;  4DBG A;  1I42 A;  5G55 A;  1WJ4 A;  2JZZ A;  3NY5 A;  4IC7 B;  4WJP A;  3L0W B;  4W9I A;  4ZRI A;  3T8M A;  3SDL C;  3QIJ A;  2RR9 A;  4W9F A;  3TL5 A;  2W9N A;  2LRU A;  5LLI A;  1ZKH A;  2IO3 B;  3A4S C;  2Z59 B;  4KDL B;  4MH0 E;  3H7S A;  3JW0 X;  1WH3 A;  5DPW A;  2DYO A;  1YX5 B;  2IBI B;  1WE7 A;  2M0X A;  1WJ6 A;  2KDE B;  2XEW A;  3DQV A;  4JLC A;  4LJP B;  4MDK E;  1V9J A;  2KJH B;  4GIV A;  2RPQ A;  2PJH A;  3R3M A;  3EFU A;  4PS8 A;  4MSQ B;  1P9D U;  3ZLZ A;  2AYO B;  5C1Z A;  4NQK E;  4E71 A;  2N7D A;  3M62 B;  5D94 A;  2LJ5 A;  3NOB A;  3CF6 E;  3AXC A;  3L54 A;  2KX3 A;  2L0F A;  5DPS A;  1WXA A;  3NZS A;  3VH3 B;  5J18 A;  3A9K A;  1EF1 A;  4I6N B;  1Q0W B;  1R4N I;  3I3T B;  3Q3F A;  3HHM A;  2KFK B;  2LGX A;  3V62 A;  4PYU A;  2CS4 A;  4HPL B;  3BY4 B;  2KD0 A;  3N32 A;  4ASW C;  2UWQ A;  3GOE A;  4FA6 A;  1WGR A;  5C23 A;  3VTW A;  3WIM A;  2AL6 A;  3OAW A;  4WWN A;  3A9J B;  5FR6 A;  3N30 A;  3PHX B;  4G0N B;  1V80 A;  3WAL A;  3KW5 B;  2HTH A;  1Z2M A;  2LVQ A;  3PRM B;  4EUT A;  2DAJ A;  2K6Q A;  4FJZ A;  1WR1 A;  1E90 A;  2DZJ A;  4DDI D;  4BOS C;  1GUA B;  4PYZ A;  2EKE C;  1P98 A;  2ZPN A;  3VFK A;  2MBE A;  4GGQ A;  2KDI A;  1WJN A;  3JSV A;  4JIO U;  5GMV A;  2ASQ A;  1VD2 A;  2DEN B;  2C9W B;  2N9P C;  3PS6 A;  3ECI A;  1F9J A;  4N9F 4;  3SU8 X;  3VAW A;  4A20 A;  4AUQ C;  2KWU B;  3VDZ A;  1WYW B;  2BKR B;  3NZU A;  3ZNI D;  1YJ1 A;  4CO7 A;  4HJK A;  5LXH A;  2KTR A;  3NS8 A;  4WWO A;  3TBL D;  2JT4 B;  4TV3 A;  2JZ3 B;  4E74 A;  2AEH A;  2MLB A;  4X57 B;  3PZD A;  1D3Z A;  2FCS A;  1TGZ B;  3AI5 A;  3KUZ A;  3PRZ A;  1C3T A;  2ZNV B;  4AOF A;  4ANW A;  1WGD A;  1YX6 B;  4NQL B;  5AZG A;  2CHX A;  2C7M B;  4FUL A;  3DOW A;  3ONS A;  2KTF A;  2NVU I;  2ZEQ A;  2LUE A;  3MJW A;  4TUU A;  2DX5 B;  1R4M I;  2LRW A;  2D3G A;  3HM6 X;  1WXS A;  2KFK A;  4DDG D;  2A5U A;  3AU4 A;  3KYD D;  3L08 A;  3PSE B;  4LCD E;  3R7Q A;  3TMP B;  2CR5 A;  4BFR A;  3C0R B;  3HIZ A;  4ANU A;  1V6E A;  3X0W A;  2G4D B;  5IAA C;  2CU1 A;  2GBK A;  2ZCC A;  2FID A;  2KK8 A;  3EC8 A;  3QK0 A;  4GSW A;  4KSK C;  2LXA A;  3A9J A;  5E6N A;  4AWJ A;  2L7R A;  2FAZ A;  2N1W A;  3RUI B;  2Z0D B;  1BT0 A;  1Q5W B;  2O2V A;  4WWP A;  2KNB A;  2J0M A;  3H1U A;  3DPD A;  1WX8 A;  2FIF A;  2K8H A;  3DBR I;  1XD3 B;  4KZC A;  4IM2 A;  1TZ1 A;  3ZKJ C;  4ANX A;  3M3J A;  5D2M B;  1WR6 E;  2HD5 B;  1LM8 B;  4EOY A;  1WI0 A;  2AL3 A;  4KVG B;  5HKH A;  1J19 A;  2NBV B;  4K81 A;  3ZTD A;  2LGY A;  2K25 A;  3DCG A;  3QA8 A;  2KAN A;  2J7Q B;  4MJS B;  1OTR B;  3BIN A;  3VXW A;  4IUM B;  1WMH B;  1XT9 B;  4ICU A;  3ZRF A;  4GDL B;  2KJR A;  2G4S A;  5JZE B;  3PGE A;  4IM3 A;  1SGH A;  4W9K A;  1E8X A;  2Y5B B;  4B6W A;  2KLG A;  1V5T A;  2ZCB A;  4IWQ A;  4K7S A;  3RT3 B;  3B1L X;  2M1M A;  5BO4 B;  4P7I A;  1IP9 A;  3PVL A;  2YVC A;  3QCA A;  2C5L C;  2LVP A;  1WXM A;  3IVF A;  4IW0 A;  2IO2 B;  3WAO A;  3V60 A;  2LAS A;  2NCN A;  4II2 B;  2BWF A;  4RM8 A;  2WDT B;  5KHO A;  2L3Z A;  2G45 B;  2L0T A;  4EFO A;  4G50 A;  4KDI C;  1U4A A;  4HWI B;  4I6P A;  1L2N A;  2KVR A;  2K39 A;  3OLM D;  2MWS B;  2L00 B;  2WX0 A;  1WM3 A;  4XZ4 A;  5JH5 C;  3VVW B;  1TBE A;  2CHZ A;  2KDF B;  2N4F A;  2HJ8 A;  1ISN A;  2I1J A;  4ZYN A;  1YIW A;  4G3X B;  4KZ0 A;  3IFW B;  3AUL A;  2RGF A;  4WJQ A;  4DHZ B;  1E7U A;  4EKU A;  4LDT B;  5AZF A;  4NAW B;  2BYV E;  2LWP A;  4AP4 C;  1WGH A;  2BYE A;  2KQ7 A;  1NDD A;  2PE6 B;  3EEC A;  3KVF B;  3O65 B;  2KC1 A;  2D11 A;  2JVC A;  2DZK A;  4GOC A;  4TKN A;  2HE7 A;  3UIP B;  1WF9 A;  2IY1 B;  3VHT C;  1S3S G;  2NS5 A;  2PPH A;  2Z0E B;  4DHJ D;  4DXA B;  4MJS A;  3U7D A;  1WM2 A;  1WMH A;  2CHW A;  3PLU A;  5L83 A;  2ZVN A;  4GDL A;  5CX3 A;  3ZNZ B;  2JY6 A;  4GU2 A;  4W9L A;  1AAR A;  1X1M A;  4K1R B;  2MRP A;  4PS7 A;  4GDK B;  3HK0 A;  4M8M A;  4RM9 A;  4B95 A;  4BVU C;  1ZW7 A;  2LD9 A;  2RD0 A;  3ML9 A;  2DYM A;  2FUH B;  2EMT A;  2JXX A;  1SE9 A;  2IO0 B;  2KZR A;  2ZZP B;  4ZRK A;  4MSM B;  4W9G A;  2DZI A;  2MP2 B;  3H7P B;  4A3O A;  2K8B A;  4HPM B;  1RFA A;  1E8W A;  2O6V B;  4E3C A;  3L16 A;  4KIK B;  4JGH B;  4XX5 A;  2DAF A;  1UD7 A;  3M63 B;  3EHV A;  3RZW C;  1KJT A;  4URK A;  3IHP C;  2GBN A;  4BBN C;  3ENE A;  3P2B A;  2KDB A;  4W9H A;  2KHW B;  3RCZ A;  4DWF A;  4TQ1 A;  5D7G A;  3ZO5 B;  4HXD A;  1EUV B;  3OJ4 B;  5E6O A;  2C7H A;  4GMV A;  3JVZ X;  1WY8 A;  4JL9 A;  4BKS A;  3VUX A;  1WX7 A;  3M95 A;  2KOX A;  2KXJ A;  2REX A;  4MGY E;  4G11 A;  2GBR A;  2JF5 A;  4ZRJ A;  2ZNV C;  4RMA A;  2PE9 A;  4NJ6 A;  3T9L A;  2OJR A;  1UEL A;  2JRI B;  3A33 B;  2G3Q B;  3LDZ E;  2QHO A;  3DDC B;  3N3K B;  3NHE B;  3A1Q B;  4GXB A;  4NAW A;  3UF8 A;  4EZJ A;  4PS3 A;  2GBJ A;  2N7E A;  2NBW B;  2BGF A;  4B9K A;  1P3Q U;  3RUL A;  2FCN A;  3R7R A;  1E5W A;  1E8Y A;  2IO1 B;  5TR5 A;  4DHZ E;  1V86 A;  1ZGU B;  3TCA A;  1RAX A;  1L7Y A;  2JUO A;  2L76 A;  3VTU A;  3DVG X;  5DPR A;  3WAM A;  2LI5 A;  3DBH I;  1LXD A;  1GC7 A;  2KN5 A;  3ALB A;  3PPA A;  2D2Q A;  1WX9 A;  4A3P A;  4NPN A;  3B0A A;  2XK5 B;  4JQW C;  5DPT A;  3LJ3 A;  2MBH A;  4CYE A;  3TJP A;  1EF5 A;  5J17 A;  3ZDT A;  1OEY A;  2ZJD A;  3MTN B;  4GDK A;  1KLV A;  1UGM A;  3V61 A;  1UH6 A;  4F1S A;  2AWT A;  3SD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...