3ZDTA

Crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
368
structure length
326
Chain Sequence
ERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYKKSNYEVLEKDVGLRRFFPKSLLDSVAAATLAALIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPDYAEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 89
structure length 326
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3zdtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3zdtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdtA01
3VXWA 2G4SA 5EDSA 4E3CA 4KSKC 2K2UA 2Z0PA 1WY8A 3VOQA 4DK5A 1DDMA 1EUVB 4DDID 4BVUC 3PSEB 2L00B 4HJKA 3ZKJC 2W2WA 1WM3A 5CLQB 4HDOA 2M14A 1WIAA 4K2PA 1I2HA 2IO2B 2KJ6A 4Z2NA 5E6NA 1U5EA 2KK8A 2YVCA 2HD5B 2DENB 2W2XC 1YJ1A 3RCPA 2K39A 1I7AA 1WE7A 4WJPA 1GC6A 3CSTA 3A1QB 4W9GA 2G3QB 1LFDA 4N9F4 3QCAA 2H7EA 2L2IA 1V5OA 1WM2A 2AL3A 2DZKA 2XQNM 3ENEA 3WAOA 5HE0A 1BT0A 3HQCA 2COAA 2KZRA 4KDIC 4B9KA 1IYFA 4IWOA 3IVFA 2DLWA 2KKCA 4W9LA 1XCGA 4JLCA 5AZGA 4NJ6A 1DYNA 4H8SA 2OOBB 4ANVA 4HPMB 4BOSC 4EUTA 2KXJA 1WJ4A 1X86A 1X1MA 2MSED 3ML9A 3SU8X 4K1RB 4DHJD 3PEGA 1WR1A 2N4FA 3AXCA 5C79A 3R3MA 1ZM0A 1EVHA 3WA0A 1FGZA 2KFKB 3OAWA 4DHJB 3PZDA 3ULCA 4HAWB 4FJYA 3ML4A 3ZRCA 3PRMB 2ZZPB 2VSZA 1Y19B 2O2VA 4WAAA 2ZNVC 4E74A 3HK0A 5L95C 5KHOA 2D9VA 2JRIB 4JL9A 3X0WA 3T8MA 2AEHA 5KQ1A 2MQJA 1U5FA 1ISNA 1RJ2A 1IRSA 3GYPA 5FI1A 2X18A 1E8XA 1VCBA 4P7IA 2ZNVB 3B1LX 5C1ZA 4MJSA 3ZRFA 1QZEA 4BFRA 1Z87A 2Z0DB 4ZYNA 3ZNZB 5DI9B 1V86A 2CAYA 4K2OA 3IFWB 5D2MB 2K6DB 2C7MB 1QC6A 2MP2B 3I3TB 1WGUA 2I5FA 3DXCA 3RT3B 2ZCCA 3KUDB 2DYMA 4DX90 3UZTA 2LZ6A 2YSZA 4MK0A 4BBNF 2K1FA 2NBUA 1OGWA 4TV3A 3MHSD 4WQOB 2I1JA 2D4QA 5C6RA 1P0RA 1QQGA 2DKQA 3H6NA 4K81A 3LDZE 4IM0A 2L3ZA 1C1YB 5CHVC 2IBIB 2DHKA 4B95A 4IM2A 2NCNA 3D8FA 1WI1A 4HAZB 1P1AA 2RVBB 1UZXB 4MJSB 4MSQB 5C23A 1Q0WB 3VUYA 1UGMA 2D9YA 4WJ7A 4TQ0A 2NZ8B 4GMVA 1WGHA 4BKSA 3M1IB 1V89A 3G9WA 1XKEA 3KSYA 2N9PC 1Y8RC 3EHVA 4HWIB 3A4RA 4ANWA 5KHQA 4W9KA 1OEYA 2PE9A 3UQBA 3R66C 1H4RA 4OVVA 4HHVA 4XZ4A 4MH0E 1UNPA 2DHJA 3UINB 3T06A 2ZVOA 2FCSA 2LGDA 4W9FA 2LVOA 1WGGA 5DPSA 1WX7A 1K5GB 4M8MA 3T9LA 2YT0A 3QHTA 2Y8GA 4LCDE 1V5UA 2JZZA 1UD7A 2JUOA 2LBBA 2JY6A 4RMAA 2DAJA 1XT9B 1OMWA 1V6EA 2M17A 2V3SA 2GCLA 1X1GA 2KTFA 2MDXA 3D32A 2D07B 3QAQA 2GCJA 4F7UP 1XD3B 2MLBA 3SUZA 2WX0A 1BTKA 3MTNB 4EMOA 3CMMB 4FLHA 5TR5A 2KDIA 3R7QA 3UF8A 4D0NB 3UIOB 1I35A 2DX5A 3DVNU 4FA6A 1SIFA 2KWUB 3CSFA 2JRHA 2KC1A 2V1YA 1E5WA 3ZTDA 3A98B 1WXSA 3DBSA 3SD5A 5LLIA 1UBQA 3K9PB 4M0WB 4E71A 4NNJB 4ANXA 1HB8A 2DHIA 2HTHB 3QWMA 2L8JA 2REXA 1FAOA 3KRXA 4GZUA 1WMHA 3RUIB 3IBEA 1XR0B 4AJYB 1GNUA 3EECA 4YL8A 4MT7A 3DXDA 2G45B 4F7ZA 4II2B 3A33B 2KHWB 3HM6X 4MY6A 4G11A 2C60A 4DHZE 1WXVA 1T0YA 2MWSB 4FADA 1WX8A 2LG1A 3P2BA 4XWXA 1W1DA 3V5WA 1E8WA 3H9DA 1FHOA 2C9WB 2K8HA 4NJ7A 2DYNA 2P0FA 2RGNB 2A4ZA 1XD4A 1P3QU 2DX1A 2KLCA 2FNJB 4B6HA 2ADZA 2DYQA 3ULBA 2BKRB 3PVLA 2GMIC 3GOEA 4KIKA 3WAPA 1E8ZA 5JH5C 2GBJA 2O6VD 1YX5B 4MGZE 1RFAA 4TKNA 4HCPB 4WSFA 1V9JA 2R2OA 2DHZA 1RAXA 1EGXA 4IWPA 4NQLB 3F0WA 1OTRB 2GOWA 3JYUA 3VQIA 3VTUA 4CHJA 3FP5A 2PJHA 2KQSA 1J8CA 2NBVB 4PS7A 4GDLA 2KFJA 1GC7A 4A6FB 2MRPA 1UNQA 3AI5A 1K5DB 5BO4B 2LASA 2M4NA 4EEWA 3ODXA 3X23A 3W1SA 2FJLA 2AWTA 2EKEC 3TW1A 2WX1A 2Q13A 3H7SA 5CHWA 4HB4B 2CQUA 1Q1OA 3O96A 4NY0A 1KI1B 4JGHB 5JHGA 5AZFA 4I6LB 5EFXA 3VH4B 1S1QB 4AJWA 4GN1A 2CB8A 3HHMA 4LDTD 3PVWA 4KHBB 4MEMA 4CYEA 2FUHB 2CY4A 3V6EB 3QX1A 3UIPB 3ZNGC 2ZCBA 2VRRB 1DDVA 3P6AA 2KN5A 3V61A 4BBNC 3WIMA 2RPQA 2N0YA 2PEAA 4GIVA 1SGHA 4GOCA 3JSVB 4KZ0A 1UPQA 3QK0A 1WZ0A 4K7WA 3QBVB 4Y94A 5DHFB 2DTCA 1KJTA 2GBMA 3DPDA 3NOBA 2RSUA 1HB6A 1TTNA 2K2JA 2J7QB 3M63B 4B6WA 1MAIA 5E6OA 1X1FA 1PQSA 3SHQA 1RRBA 2FCQA 1YD8U 5LOPB 4XC2A 3AJ4A 1WJUA 2FAZA 3EC8A 3L17A 4PYUA 2RUKB 3N3KB 1ACAA 3FM8C 4WJOA 4XX5A 5J3YA 3SDLC 1L2NA 3Q3JA 4GDKA 1NI2A 4HVBA 1FGYA 4K17A 4HXDA 2LKOA 3PHWB 1FHWA 5D3WA 2DZIA 3M3JA 2RSGA 5D27A 1FB8A 2YT1A 5D3XA 1IPGA 2L7RA 4HAXB 1E7VA 3M95A 5DHAB 2YS3A 1OY2A 3DVGY 4A20A 3KRWA 1XQQA 2IYBA 2JT4B 3TL5A 1TZ1A 5JP4A 2B3AA 5C16A 2N7DA 4KDLB 5J2RA 1U29A 3A9JB 1B55A 2JZ3B 2Y5BB 4IUMB 3VHTC 3UQAA 2L1CA 4W9HA 3A8QA 2ZPNA 4BKTA 5JHAA 1WF9A 4II3B 3FSSA 4M8NA 2NS5A 4IAPA 1EO6A 1ST7A 1WE6A 2C7HA 4HK2A 1WJ1A 2COCA 3AU5A 2BYFA 2COPA 2R09A 1WYWB 4W9IA 3RZFA 5HE3A 2QKLA 1AWEA 2RR9A 2CODA 3KW5B 1YIWA 2DFKA 4WWNA 2UWQA 3ZUNA 1D3ZA 2D10A 2FCMA 1MK9B 1R4NI 1XODA 3QC8B 1ZW7A 3R7RA 3VDZA 2ZPYA 2G4DB 1WJMA 5DPRA 2P0HA 4A6HA 3TMPB 3FLVA 2GS0A 3LJ3A 2JWZA 2N9EB 1S3SG 3MPXA 1MK7B 2IO0B 3QARA 2K6QA 1LW3A 1X05A 3VUWA 4Z2MB 1WGYA 4DHZB 1OQYA 2A5UA 2YS5A 1FXTB 2MFQA 4HB3B 2KTRA 3W1SC 4EZLA 1OEYJ 3VFKA 3BINA 3TFMA 3ZDTA 2LD9A 4TQ1A 2JP2A 4HCNB 2YS1A 2L0FA 3SO6A 1UELA 2GJYA 3M62B 4LJPB 2PZ1A 3VUXA 4AWJA 4EZJA 4GU2A 4EZKA 2DYBA 1YQBA 4GXBA 1DDWA 2HTHA 1J0GA 4HAVB 3KUCB 2KD0A 3CIKA 2Z59B 3QWZB 5GMVA 2UZRA 3F5RA 3GYOA 2KDFB 3PT2B 2KCJA 2BYVE 4GGQA 4HATB 4J6IA 4PS8A 5CHFA 5HKHA 2D9ZA 4F7HA 4NSWA 4DXAB 1V5PA 3BY4B 2D9XA 3H7PA 1L7YA 5D6JB 1BTNA 1NVLA 3ODWA 1V2YA 4KV2A 1WXMA 2COFA 2BYEA 2EMSA 2NMBA 3OLMD 4G0NB 4GPTB 4K7SA 4KAXB 3IHPC 2UYZB 2KJHB 1N3HA 4IWQA 4X57B 1V81A 2LJ5A 5DCNA 1ZGUB 3RD2A 3MJWA 4RM9A 2MP2A 4ANUA 3ALBA 1IP9A 1R4MI 3UGBB 1V5MA 1ZKHA 2RD0A 3QIJA 2CHXA 3KVFB 4W9DA 4HAYB 1XX0A 2NR2A 2XEWA 5J3QA 2ABDA 2UVMA 2RQ1A 4LJOB 2K8CA 4A6KA 4KSLC 3ONSA 3H7PB 5CLLB 5FR6A 1I42A 2BKFA 3AULA 2DX5B 4DBBA 2GBRA 3V60A 5KCVA 4PS3A 2M38A 3PG7A 3PSCA 4G3XB 4F7GA 2BCJA 5D7GA 1Z5SB 1WGQA 1F9JA 4TUUA 2KO3A 3A4SC 4K7UA 2KANA 3DDCB 3L0WB 1J0WA 5E6PA 1LB1A 2E2XA 2BF8B 4ZRIA 3ECIA 5G55A 1NTYA 1U5GA 1WG7A 5GOWB 3PPAA 3TIXA 2CY5A 1X11A 2G35A 3DBLI 4W9CA 1KLVA 1NDDA 3NZUA 1A5RA 2CKHB 1DROA 2BPSA 2Y8FA 3WANA 5D3YA 2HRJA 2GBNA 3KZ1A 3DQVA 3PRPB 4I6NB 2MBQA 1NTIA 2CR5A 3DVNV 1E8YA 1Z2MA 2LWPA 2HJ8A 3ML8A 2DZMA 4HAUB 3ZTCA 2Z0OA 2N7EA 2V4LA 1KZ7A 1WRDB 1V49A 2YLMA 4MGKE 3ZIMA 4CHKA 3DBHI 2RGFA 4ZDVA 1H10A 4KVGB 4KHOA 4PNKA 2ELBA 1WI0A 2NBWB 2XBBC 3QJZA 4FHJA 5AEKB 2BWES 1VD2A 2JVCA 2KQ7A 2M1MA 1NTVA 1UBIA 1WFYA 3JSVA 4DX8A 2LXCA 4BBKA 2LULA 3N32A 3PP2A 3ZNID 1AARA 1LM8B 2CS4A 4GMXB 5J3TA 1SHCA 5D3VA 3OJ4B 1BWNA 1P5TA 1OQNA 2K00A 4NAWA 2M0XA 3PVUA 2KC2A 2XK5A 3L10B 5IAAC 2ROZB 4EOYA 1G6JA 3HW2B 5JHHA 1P98A 1TBEA 2NVUI 2ASQA 4FULA 1FOEA 3A8PA 3LJUX 2D9WA 2RLOA 2MA9B 1NBFC 3APDA 2ROVA 4GDKB 1DBHA 3VAWA 3RCZA 4ICUA 3L08A 4DDGD 3U7DA 3U8ZA 2MBBB 4W9JA 5HE2A 2NPTA 2MWNB 3B0AA 3DVGX 2KNBA 5D94A 4TYZA 5KQ4A 3AU4A 1U27A 1KM7A 1WVHA 2OJRA 2L76A 3APFA 3RYTA 3ZVVA 2N9XA 2ELAA 2OTXA 1U4AA 4JIOU 3TCAA 3L54A 5G2NA 4EFOA 2IY0B 4PQ0A 3JVZX 3W1YA 5CX3A 4BKSD 2PE6B 1TJ6A 2FIFA 2DZJA 3A9JA 1AQCA 5FI0A 1EF5A 4WVFB 1Q67A 1WJNA 2KX0A 2UZSA 4YONA 2K8BA 2RNRB 4MELA 4A5KA 2I1KA 2EC1A 2KMAA 1V5TA 2N1VA 3N7CA 2CHWA 4WWPA 2NPTB 3FEHA 1GUAB 2O6VA 3PV1A 5LXIB 2ZJDA 1JRUA 1MIXA 1E90A 2IO3B 4HB0B 4JQWC 2I5CA 2J0KA 2KX3A 1ZSQA 4MGYE 3WALA 3VVWB 2Z0QA 2BWFA 2L0TA 3B08A 4F1SA 3DCGA 3KYCD 1GJZA 2DAFA 2LYDA 4CHMA 4MSMB 3ZNHB 1WX9A 2J0JA 3ZO5B 2KOXA 4MM3A 4CO7A 4OVUA 2JPHA 3Q3FA 5DPTA 2W2XD 1RRPB 3WYFB 2O6VB 3NHEB 3IG3A 2KTRB 4FN2A 4HLEA 5J18A 3L16A 1V80A 2J0MA 1H8CA 4WJQA 2QHOA 5L83A 3TJPA 2JXXA 1C3TA 2MKRA 3VIAA 4DWFA 4EJNA 2IZVB 2OQBA 3PLUA 3SNHA 1TGZB 1U5DA 1P3RA 1YX6B 5J17A 1CMXB 4PYZA 4EKUA 1PMSA 3P7ZA 3KH0A 4IW0A 2LOZA 3NY5A 2KJRA 5L81A 3PS6A 1NU2A 2L05A 4NPNA 2LRWA 2W9NA 2ZVNA 1M94A 2R2QA 2Z0EB 3QA8A 4IOYX 3PREA 3WAMA 4AUQC 2LGXA 2M8SA 3APCA 2PPHA 4BOZB 1M7RA 2MCNB 1BAKA 2D2QA 3ODOA 2D3GA 3SV1A 2MX2A 5DPWA 2DA0A 1HE8A 3HIZA 4W9EA 3ZW3A 5JZEB 3A9KA 1WMHB 3ZDMC 2N1WA 2KFKA 1GG3A 4FJVB 2V76A 4HDQA 1W1HA 2D11A 2Y7BA 2AYOB 1FHXA 2CHZA 2LUEA 2O2VB 1WGDA 4FHKA 4IG7B 1UNRA 1Q5WB 5AZHA 4FBJB 2WH5A 1ZVRA 1P9DU 2P0DA 3N30A 3DXEA 4RM8A 4A3PA 3VTWA 4F8CB 4GB9A 2HE7A 4IM3A 2EJ8A 3OJ3A 2MBHA 3U30A 3KUZA 3PHXB 2YF0A 2IFSA 3TVVA 4ZRJA 1MKEA 2KVRA 4HPLB 5C5BB 3NSUA 2LGYA 3A9KB 2FIDA 4KIKB 3RZWC 5DIFB 1LQBA 2QKMA 3C0RB 2DKPA 1E7UA 1V88A 3BJIA 4MDKE 1PFJA 2ZEQA 2MBEA 2YRYA 3L13A 3OANA 2LVQA 4KHAA 5DH9B 4C0AA 3PGEA 1MG8A 3TO1A 4HB2B 3MDBC 3S2AA 1WXAA 4DBGA 5LXHA 4MGIE 1P6SA 5IA7A 1U2BA 2KWCA 4L6EA 4IC7B 4ZRKA 2CRFA 4GSWA 2IO1B 1KOTA 1SE9A 2KDEB 3V62A 2DYOA 5C5BA 4FJZA 1LXDA 1WGRA 2K25A 2C7NB 1K8RB 3EPYA 2LRUA 2J59M 4NQKE 2AL6A 4WJNA 1TQZA 3DOWA 3SYXA 3K9OB 1HBKA 1PLSA 1ZC4B 4NAWB 2IYDB 2VRWB 1UEFA 1Y5OA 2MBOA 1ZC3B 1MIZB 2KDBA 2KUPA 2XK5B 4G50A 4AP4C 2H7DA 3RULA 3KY9A 2WYQA 2KWVB 1WR6E 3ZVRA 2BGFA 3HM3A 4IFSA 2FJ9A 2GBKA 3PLVA 3PTFC 4KZCA 3O65B 3D8EA 2N23A 2JF5A 2CU1A 3DBRI 1WZ3A 4A3OA 5IJMA 4BKGA 1W1GA 3VTVA 2LI5A 1V61A 3PRZA 3VH3B 1RLFA 2FDQA 2WWZA 4ASWC 1KZGA 2C5LC 4GDLB 3TBLD 4A6FA 3V6CB 4AOFA 4URKA 1TXDA 4LDTB 2EMTA 2LXAA 3D8DA 5CTRC 1J19A 2LVPA 3NS8A 3NZSA 1M7EA 2WDTB 2MW5A 4ICVA 2KMCA 2KGXB 3QQ8B 1UH6A 3CF6E 2R0DA 5LONB 2KLGA 3CXBB 1WH3A 4I6PA 3H1UA 4WWOA 1UPRA 2IY1B 2FCNA 1WJ6A 2DN6A 2P8VA 5HE1A 3EFUA 3GZNI 5JLJB 1EF1A 3KYDD 2VKIA 3JW0X 3ZLZA 3A1QA 5JHBA 1EAZA 1MPHA 2LOXA
chains in the Genus database with same CATH superfamily
2WXQA 3GP7A 4DDID 4BVUC 1L4DB 2INCC 1WM3A 2BS3B 3P4PB 3AEFB 1N5XA 1U5EA 2YVCA 4JK8A 2QMTA 3Q3OC 3RCPA 1ET9A 3A1QB 4W9GA 3QCAA 2DZKA 3ENEA 2XQNM 3W5VB 3GZNB 4USAA 3TUOA 4KDIC 3IVFA 4EUTA 1WJ4A 3AXCA 2RRFA 1ZM0A 1XF5L 1EVHA 1FGZA 3ULCA 4HAWB 4FJYA 3ML4A 3ZRCA 4WAAA 2ZNVC 3HK0A 5L95C 1FXAA 2AEHA 1U5FA 1IRSA 4QJ5B 1YOVB 4CSQA 2ZNVB 1R4MB 4MJSA 3ZRFA 5EE3A 2FBWB 4BFRA 4ZYNA 5DI9B 3IFWB 4K2OA 2PW9A 5D2MB 2C7MB 2I5FA 1D5ZC 4JK7A 2LZ6A 2YSZA 1YJJA 2I38A 1KRHA 4N6EB 3MHSD 1P0RA 2D4QA 2PVOD 1QQGA 1JWSD 4K81A 5CHVC 1C1YB 5MPOA 2I2YA 4B95A 3BWUD 1P1AA 5C23A 2D9YA 4WJ7A 3RN9C 2NZ8B 4BKSA 3G9WA 3EHVA 1OEYA 2PE9A 3UQBA 4CQNA 4HHVA 4MH0E 4YT0B 2FCSA 2LGDA 3AE3B 5DPSA 4M8MA 2YT0A 3QHTA 3RI7C 1XEEA 2JZZA 1EWYC 2LBBA 2DAJA 1V6EA 3QAQA 3D32A 2D07B 4F7UP 2MLBA 4QXAB 1BTKA 1NYQA 3MTNB 3UF8A 1MHHE 4S17A 1BUIC 2KC1A 1WXSA 5LLIA 1UBQA 5AUKA 2DHIA 2HTHB 2YT2A 1FAOA 3KRXA 3U7ZA 1TKEA 1GNUA 2MJ3A 3N1YC 4MY6A 4P1BC 4KGSA 2NTSA 2RGNB 1XD4A 2K0PA 4YSZB 1QOBA 4B6HA 3ULBA 2BKRB 4ZOHC 3I5JC 4C4VB 2O6VD 3Q8AA 1YJIA 3MC8A 1FEHA 2DHZA 3F0WA 4LNFA 3JYUA 2PJHA 3FP5A 4LTUA 1GC7A 1SJED 2MRPA 4QAYA 1NENB 3X23A 3W1SA 2FJLA 3TW1A 4I6LB 4JPSA 4LDTD 3PVWA 4KHBB 3KWVA 3KWLA 1C78A 3UIPB 1T6BX 3P6AA 4BBNC 2RPQA 2N0YA 4GIVA 3JSVB 2ACZB 2PLPA 3FC4A 1WZ0A 1JALA 1BXTA 2GBMA 2K2JA 3VRBB 4B6WA 2FCQA 2WXGA 3LYYA 4XC2A 3AJ4A 1WJUA 3EC8A 4XX5A 5J3YA 2V0GA 4HXDA 1FHWA 2RSGA 2K8EA 2YS3A 1OY2A 1TYGB 3TL5A 3W5UB 2B3AA 4KDLB 3ZXRA 2ZPNA 2ZW1A 4BKTA 4M8NA 3OHMB 2NS5A 4IAPA 1WWTA 1C77A 4HK2A 4M00A 2YEPB 3MJ5A 2QKLA 3ZUNA 2LHDA 3ZJVA 2DFKA 4RGNA 2G4DB 1WJMA 4A6HA 3TMPB 3SBTA 3FLVA 4QJ4B 2N9EB 2W82A 1X05A 1WGYA 2A5UA 4EZLA 3VFKA 2LD9A 2YS1A 2L0FA 4BZAA 4GU2A 1NYRA 1DDWA 1D6EC 3KUCB 1XCTL 4KKJA 2KCJA 5HKHA 4PS8A 4HATB 1DYQA 3SFEB 2D9ZA 1N5WA 4DXAB 2WXOA 1SB3C 3BVGA 4ZHOA 1NVLA 3ODWA 2COFA 2BYEA 4G0NB 4K7SA 4GPTB 3IHPC 1N3HA 1V81A 1IP9A 2PKOA 1I4XA 2NR2A 2XEWA 2K8CA 3ONSA 3H7PB 3AULA 4PS3A 1YNTE 4K7UA 2KANA 3L0WB 1J0WA 2BF8B 3ECIA 1U5GA 2CY5A 4W9CA 4KGTA 3DHHC 2CKHB 2IPKD 4JKCA 4I6NB 3DQVA 1E8YA 2LWPA 4IKGA 3ML8A 2Z0OA 4CHKA 1WRDB 3ZIMA 4PNKA 3IAM1 1WI0A 4JKGA 2XBBC 5AEKB 1FCLA 2BWES 1SE4A 1UBIA 2CU3A 1WFYA 3JSVA 2VZKD 2XNAC 3PP2A 1AARA 1UGJA 1OQNA 2K00A 3PVUA 3BK1A 4EOYA 4C00A 2NVUI 1TBEA 2D9WA 3VAWA 4DDGD 4JX1C 5HE2A 2KNBA 2OJRA 5KQ4A 1VBGA 2L76A 2DWQA 2ELAA 1U4AA 3TCAA 3L54A 3AH7A 2PE6B 1TJ6A 2DZJA 2FJUB 1EF5A 2RNRB 1TS4A 1GPXA 3R8BA 1DOIA 3URYA 2BVCA 4R3DA 3N7CA 4WWPA 1ZYIA 1N60A 2JZPA 2NPTB 5LXIB 1E90A 2IO3B 4HROA 4MGYE 2I5CA 2KX3A 1YMHE 2Z0QA 3B08A 2L0TA 1UNSA 3DCGA 3DWMA 4CHMA 2D3BA 4NAMA 3ZO5B 4MM3A 4HLEA 3Q3FA 5I2SA 1RRPB 1OQQA 2LEKA 2GRIA 4FN2A 1MHXA 5L83A 1C3TA 2JXXA 2MKRA 2OQBA 1U5DA 1CMXB 2V3PA 3LXFA 4AS1A 1KLGD 1PMSA 1NU2A 2L05A 2LRWA 2ZVNA 1M94A 2Z0EB 4OHJA 2M8SA 2J42A 3APCA 2PPHA 4BOZB 2D2QA 3ODOA 1E9MA 4RGTA 2WXFA 1MI0A 1UWMA 3A9KA 1WMHB 2WXMA 4OZAA 1FM0D 5TSSA 2ZW0A 3HUIA 5H8YE 1ESFA 1N62A 3B2GA 1P9DU 3N30A 3P63A 1IGCA 4GB9A 2HE7A 4IM3A 2MBHA 2BB6A 1YN5A 2YF0A 4HPLB 4KIKB 1JROA 2DKPA 1E7UA 3BJIA 5HG2A 2KUQA 2LVQA 5DH9B 4C0AA 3PGEA 3TO1A 3S2AA 1DIKA 4DBGA 4ZRKA 3B9JA 1SE9A 2DYOA 4FJZA 1EU3A 4L2YA 2C7NB 1HZ5A 1JWAD 3Q69A 3DOWA 2W55A 1IUEA 4US8A 1AYFA 2LFIA 1ZC4B 2VRWB 3MC0B 2M19A 1ZC3B 1MIZB 2KUPA 2RDBC 2H7DA 2JQRB 2N0SB 1PGBA 2WDQB 2H89B 1ZE3D 1CJEA 2KQ4X 2W3RA 2FJ9A 1QKZA 3D8EA 2N23A 2JF5A 3N20C 5IJMA 3VR9B 4ILJA 2WWZA 1UUPA 4GDLB 1DOYA 4LDTB 3P42A 3QQ8B 4BAXA 1SBBB 2KLGA 4I6PA 1UPRA 1XCQL 1TKGA 1EF1A 3JW0X 1UZXB 1AW7A 5E6NA 3VXWA 5BYSA 4Q2JA 2J53A 3DHIC 1DDMA 2L00B 3ZKJC 2M14A 4K2PA 2K39A 1P7FA 1GC6A 1YQ3B 2KVZA 3CSTA 3IAS1 1ZUD2 3C19A 2G3QB 4UDUC 3TEZA 1V5OA 3WAOA 5HE0A 1BT0A 3HQCA 3I9V1 4NZLB 2DLWA 4JLCA 1GAQB 1KLUD 4NJ6A 1XXGA 4BOSC 2KXJA 3ML9A 4DHJD 3PEGA 2KAJA 4DHJB 2IJ0A 3PRMB 3O13A 2VSZA 1B1ZA 3LB8C 5KHOA 3T8MA 4O1NA 1T5XD 1TJEA 2X18A 1VZ6A 5C1ZA 1T0QC 1QZEA 1Z87A 3ZNZB 1V86A 4RCOA 2K6DB 1WGUA 1E0ZA 3RT3B 2NBUA 3FILA 2Z4DA 2I1JA 2KDMA 3H6NA 2L3ZA 2DHKA 4MSQB 4HAZB 1WI1A 3P4QB 3VUYA 1Q0WB 1UGMA 4TQ0A 1K53A 1XKEA 4HWIB 3KSYA 3B2FA 3HVZA 4XZ4A 1UNPA 2DHJA 4ZRPA 3T06A 3I57A 2LVOA 1WGGA 3AE7B 1TT5B 1WX7A 4XYCA 2Y3AA 4RMAA 2WXJA 2K5PA 2WXHA 2HTME 5BYRA 2KTFA 1ZOYB 5FK9C 4ARIA 5TR5A 1TZOA 4D0NB 2DX5A 4FA6A 2JXTA 2V1YA 1QQRA 2QSDA 3A98B 3AN1A 4NNJB 2L8JA 2REXA 1SXTA 1QILA 1OFFA 3IBEA 4AJYB 1FNUA 3AE6B 3EECA 4MT7A 2G45B 4F7ZA 4II2B 3CWIA 1WXVA 1LGRA 1JW9D 3AEDB 4FADA 1W1DA 3H9DA 1FHOA 2W54A 4ZYSA 4NJ7A 3Q3NC 1FRDA 1TKYA 2RDHA 5JH5C 2GBJA 3NUHB 4ITKA 2Q5WD 4HCPB 5D3IB 2CJNA 1RAXA 4NQLB 5LNK1 2GOWA 4HSIA 2TSSA 2NBVB 2D3AA 4GDLA 2KFJA 1UF0A 5BO4B 2WXRA 2AWTA 2EKEC 2WX1A 3H7SA 5CHWA 2CQUA 3O96A 2WXKA 5JHGA 5EFXA 4AJWA 3A58A 4CYEA 3V6EB 3QX1A 4JKGB 4KZ0A 5D3DA 1SGHA 4GOCA 1UPQA 4ACFA 5DHFB 1KJTA 2DTCA 4MT5A 1TTNA 2GI9A 4ILGB 5LOPB 2FAZA 4PYUA 3L17A 3N3KB 5HFYA 1L2NA 3HRDD 1NI2A 2K49A 3PHWB 3R66C 3M3JA 5D27A 2YT1A 3M95A 4HAXB 1J7BA 2BS2B 3DVGY 4A20A 4HKQA 3KRWA 4J3OD 2N7DA 3A9JB 1B55A 4IUMB 3UQAA 5JHAA 5JVLA 3P4SB 2BBCA 4C80A 3FSSA 1UWXA 1EO6A 2C7HA 2L32A 2COCA 2R09A 3RZFA 2PMVA 5HE3A 1VRAB 1SEBD 2D10A 2FCMA 3QC8B 1XODA 3VDZA 2GS0A 3LJ3A 2JWZA 1C9FA 4MH8A 1MK7B 2IO0B 4DHZB 3VUWA 2YS5A 2KTRA 1MPEA 1C4CA 3ZDTA 2WXNA 1J7AA 4HCNB 4LJPB 3VUXA 2INDC 2ICIA 1J0GA 4HAVB 2KD0A 5GMVA 3VTWA 4FBJB 3F5RA 2KDFB 2N7JA 4F7HA 2WU2B 3E9OA 2D9XA 3H7PA 4B0MA 4A6QA 1V2YA 1WXMA 3RNEC 4X57B 2DNFA 2KJHB 3MP9A 3E9SA 1ZGUB 5DCNA 2R82A 2WGSA 2KYWA 5BMIA 3UGBB 3KVFB 3IXSA 3Q8EA 5FR6A 2DX5B 4DBBA 1D5MC 5KCVA 1E6EB 2M38A 4G3XB 1QF6A 2BCJA 3FVCA 1Z5SB 4B9KA 2KO3A 3MC9A 4ZRIA 1WG7A 3PPAA 2WDRB 1C76A 3WANA 3DWGC 2Y8FA 1SSNA 2MBQA 1NTIA 2CR5A 1F2RC 4A90A 1MVKA 2V4LA 1KZ7A 1PGXA 1V49A 3DBHI 4JKFA 3Q8CA 4KHOA 3QJZA 2ELBA 4LK0M 4FHJA 2JVCA 3ZNID 1E10A 2LULA 2BQQA 2CS4A 4MACA 1BWNA 3TSSA 2KC2A 3SEBA 2EELA 4DXGA 2ROZB 2RPVA 3HW2B 5JHHA 3AMZA 4KZCA 3LJUX 2RLOA 1NBFC 1HXYD 3RCZA 1DOXA 5HI1A 2NPTA 1ET6A 4TYZA 1U27A 3ZVVA 1WVHA 3RYTA 2OTXA 2SAKA 4JIOU 5G2NA 4KHBA 4TMAB 3IT6B 1B9RA 3NWFA 1C4PA 3A9JA 4L1RA 1AQCA 3NWDA 4YTMB 2JX5A 4YONA 5EE0A 2LJIA 2I1KA 2EC1A 2N1VA 1V5TA 2CHWA 1C4AA 3FEHA 1GUAB 2ZJDA 4WURA 1T0SC 4RGOS 3Q8FA 4JKHA 1RFKA 3KYCD 1GJZA 4MSMB 3ZNHB 1CQVA 2WQYB 1JQ4A 5DPTA 2JPHA 2O6VB 3NHEB 5IP4D 2KTRB 3L16A 1GB4A 2J0MA 1H8CA 3VIAA 4OZBA 2KMMA 3PLUA 3SNHA 2N9LA 1P3RA 3AE5B 1PUTA 4IW0A 2LOZA 2KJRA 4NPNA 3UIOB 2QIEB 2QDFA 2W9NA 2R2QA 3QA8A 1TY0A 4AUQC 2IDYA 2LGXA 4PT5A 1M7RA 2D3GA 5DPWA 2X0SA 4M0WA 2DA0A 4LNKA 4W9EA 1JWMD 2N1WA 2KFKA 1W1HA 2AYOB 3OWEB 2WH5A 4A3PA 2P0DA 4RM8A 1XLNA 2K3UA 3AEAB 2IFSA 1E7PB 2BYTA 3AM9A 4ZRJA 3UI3A 3NSUA 2G9HD 3HIEA 1LQBA 1V88A 3MHZA 2ZEQA 3OANA 4KHAA 2INNE 2WLBA 1JRPA 4JKAA 1P6SA 2KT7A 2CRFA 2DBYA 2WU5B 2VH1A 3AEBB 3V62A 3AE4B 3NS1A 5C5BA 4A55A 4LLGM 2RDGA 1SF0A 2LRUA 2AL6A 3SYXA 3E9PA 3K9OB 2IYDB 1UEFA 1N6ZA 1QOFA 2MBOA 1WYGA 4G50A 1XLOA 3IT4B 4XGAB 3NVVA 2WYQA 1T0RC 4ZHPA 2JYTA 3E66A 4GOUA 3KQ4A 1WZ3A 4BKGA 1W1GA 2Z14A 1F52A 1BMLC 4C7ZA 1RLFA 1QT9A 4ASWC 2C5LC 3L4PA 3V6CB 4A6FA 1TXDA 2KWDA 1L6VA 3NS8A 1MJDA 1M7EA 2WDTB 2MW5A 2KMCA 3CF6E 5LONB 3H1UA 4XWTA 2IY1B 2FCNA 1WJ6A 2DN6A 2P8VA 5HE1A 5JLJB 3KYDD 1SIJA 3A1QA 1SE3A 2LOXA 4E3CA 1LO5D 2Z0PA 4DK5A 1EUVB 1L4ZB 4WH4A 3PSEB 4HJKA 5CLQB 1WIAA 1I2HA 2KK8A 3AEGB 2HD5B 2DENB 2W2XC 3GE3C 3ZJTA 1WE7A 4WJPA 1AN8A 1VLBA 1LFDA 4JK9A 2AL3A 1C79A 1IYFA 2VZKB 1XCGA 4H8SA 2OOBB 1X86A 4K1RB 2N4FA 4KKIA 1GGOA 3WA0A 2WP9B 2KFKB 3OAWA 3PZDA 1HTOA 3NVYA 1Y19B 2O2VA 2D9VA 1TS2A 4JL9A 2MQJA 5FI1A 3GYPA 1E8XA 3B1LX 4OW0A 1NEKB 1WRIA 2CAYA 2FUG1 2KACA 2MP2B 4HJGE 2MEKA 4L1BA 3DXCA 1EU4A 2QC8A 2DYMA 3UZTA 4MK0A 1K50A 4WAFA 1OGWA 4TV3A 3OG5A 2DKQA 2WXLA 2HDEA 2IBIB 2JU6X 4WIPA 1MG4A 3D8FA 3TEYA 2RVBB 4JKDA 4GMVA 3M1IB 2N9PC 5KHQA 1L6UA 1Y8RC 3A4RA 4W9KA 2J4XA 4OZCA 1ACCA 5E6JA 2ZVOA 4W9FA 1K5GB 3T9LA 4LCDE 1V5UA 2JUOA 1OMWA 4RNAA 3DCXA 2M17A 5BMGA 2GCLA 1X1GA 2GCJA 1XD3B 2PTLA 4FLHA 2WX0A 3U52E 4EMOA 3R7QA 2KDIA 3NRZA 3ETRA 5I4DA 2J52A 4IOIE 1RYJA 2X8XX 3CSFA 3GB1A 3ZTDA 3SD5A 2GUMA 3U12A 1HB8A 1WXQA 4XE0A 1WMHA 4GZUA 2KR0A 4YL8A 3A33B 3HM6X 1IBXB 2C60A 1T0YA 2MWSB 3P2BA 2UU7A 4XWXA 2K22A 2K8HA 2P0FA 1P3QU 2DX1A 1L5PA 3PVLA 3GOEA 1E8ZA 1GOZA 1YX5B 4MGZE 4RF1A 4TKNA 2AQ2B 2LUMA 4WSFA 1V9JA 2OEDA 2R2OA 5IOIA 3E9LA 1OTRB 1I7HA 2KQSA 3NZ3A 4PS7A 4A6FB 3AI5A 4P1CC 1K5DB 4EEWA 2LASA 2M4NA 3ODXA 4MM3B 5HHDG 2Q13A 1I4PA 4HB4B 1Q1OA 4JGHB 1KI1B 2MJDA 5AZFA 4RFBA 3VH4B 1S1QB 4GN1A 3HHMA 4MEMA 2CY4A 4DIXA 4LNIA 1DDVA 2KN5A 1VJKA 3V61A 2BTEA 4YWGG 2PEAA 2Z8LA 4N58A 3QK0A 4D6WA 4K7WA 2HJ1A 3DPDA 3NY5A 3NOBA 2J7QB 3M63B 1MAIA 5E6OA 1F1HA 1PQSA 3SHQA 4YTNB 3SDLC 2RUKB 1ACAA 3FM8C 4WJOA 3Q3JA 4GDKA 4K17A 2LKOA 5D3WA 1FB8A 1IPGA 2L7RA 5DHAB 3BYTB 2IYBA 2JT4B 3DHGC 4K3CA 5JP4A 5C16A 3U4EG 4PK1A 5J2RA 4IDIA 2Y5BB 2L1CA 1TIFA 4W9HA 1WF9A 4II3B 1JMLA 3MFGA 1ZDVA 1WJ1A 3AU5A 2BYFA 1WYWB 1L0XB 4W9IA 4M01A 4N59A 2UWQA 1R4NI 3R7RA 2ZPYA 2P0HA 1JCKB 3MPXA 2QEJC 4Z2MB 3R2IA 1OQYA 1N61A 1FXTB 1OEYJ 2D3CA 3BINA 3TFMA 5IRSA 4TQ1A 3FAHA 3SO6A 4AWJA 2GJYA 3M62B 2PZ1A 4EZJA 1FFVA 1YQBA 5G5GA 3CIKA 3GYOA 4J6IA 3PT2B 5CHFA 4LNOA 4GGQA 1XLPA 4YSYB 1WSPA 2G1EA 5D6JB 2R61A 4KV2A 1I35A 3W1SC 3ZGZA 5EE1A 1KTKA 3MJWA 4ANUA 3ALBA 2Z59A 1R4MI 1V5MA 1WGKA 2RD0A 3QIJA 2CHXA 4HAYB 4ANXA 3B77A 4LJOB 2RQ1A 2ONQA 3SBGA 4REZA 2GBRA 5T8IA 3PG7A 1F9JA 3A4SC 3DDCB 3AEEB 1DGJA 2E2XA 5G55A 4JKBA 3ZLZA 1NTYA 3DBHB 5GOWB 3DBLI 1X11A 2G35A 4YXDB 1RM6C 4NJCA 1NDDA 3AE2B 2BW2A 5D3YA 2HRJA 2GLSA 3DVNV 1Z2MA 2DZMA 2N7EA 4ZDVA 4MGKE 3NWAA 1N63A 1H10A 1V1PA 1I4GA 1VD2A 2QILA 1NTVA 3RFZB 4A8XC 5LG4B 4DX8A 1HEZE 2V9HA 3SFDB 2B76B 4BBKA 2LXCA 5J3TA 1SHCA 3OJ4B 3PZ8A 1KF6B 5IAAC 1G6JA 2L1AA 4FULA 2ASQA 3RNAC 4B0EA 3A8PA 2MA9B 4GDKB 1T3QA 3U8ZA 2MBBB 3RPFC 3BVZA 4W9JA 3DVGX 5D94A 1RWSA 3AU4A 2XN9C 2H88B 2N9XA 4EFOA 2IY0B 4PQ0A 3JVZX 2FIFA 4XDDA 5FI0A 1Q67A 4A5KA 1KC7A 2KIGA 2KMAA 4C4VA 3PV1A 1JRUA 3I63C 4LNNA 3AV8A 4K3BA 2BWFA 4F1SA 2DAFA 2LYDA 2L52A 4QJ3B 2OHFA 4OVUA 2QHOA 3HVDA 4EJNA 4PYZA 1I4RA 3PREA 3KLSX 2JYEA 2KN4A 2MCNB 3SV1A 2MX2A 3BIID 2GB1A 3ZDMC 3ZW3A 2D11A 2Y7BA 1TS3A 1FHXA 2O2VB 2LUEA 4FHKA 1UNRA 5AZHA 4F8CB 3DXEA 1ROEA 5BMHA 1JWBD 3U30A 3PHXB 5C3JB 3TVVA 3N1XC 4L23A 3H8HA 1I4QA 1F2RI 5C2TB 5C5BB 2LGYA 5FKAC 5DIFB 2QKMA 3C0RB 4MDKE 1PFJA 3AB5A 1QOAA 1TS5A 2YRYA 3E56A 2BB5A 2WDVB 1U2BA 3GE8C 2KWCA 4IC7B 1V1PB 3CIRB 1LXDA 1WGRA 1CZPA 2K25A 2Z13A 2J59M 2Y5CA 4WJNA 2QCZA 1HBKA 1PLSA 1SJHD 4GLSC 4YTPB 1MI1A 1F77A 2KDBA 2XK5B 3RULA 3NJTA 5I2MA 1OQRA 1V1OA 2KWVB 1WR6E 2Y5PA 2BGFA 3HM3A 1VR9A 3PTFC 3PLVA 1P7EA 4JWSC 1FD6A 3VTVA 2FDQA 2OJWA 1KZGA 4HRSA 1YN4A 3TBLD 4AOFA 4URKA 5JXVA 2LXAA 5CTRC 1J19A 1VZ8A 3NZSA 4ICVA 1UH6A 4WWOA 3CXBB 1WH3A 1R4NB 1FPYA 2VKIA 5JHBA 1MPHA 5EDSA 2G4SA 4KSKC 2K2UA 1WY8A 3VOQA 3PZ7A 3HSAA 2W2WA 4HDOA 3NG0A 2IO2B 2KJ6A 4Z2NA 2W3SA 1YJ1A 4ARCA 1I7AA 4N9F4 2H7EA 2L2IA 1WM2A 2WS3B 2COAA 2KZRA 2N9KA 4IWOA 4W9LA 2KKCA 4FXCA 5AZGA 1DYNA 4ANVA 4HPMB 2E6XA 1X1MA 2MSED 3SU8X 1WR1A 5C79A 3R3MA 2WXPA 3AE8B 1JWUD 3ZXVA 2ZZPB 4E74A 3FILB 2WXIA 1FO4A 2JRIB 3X0WA 5KQ1A 3DBRB 1ISNA 1RJ2A 2DLBA 1VCBA 4P7IA 3RNCC 1ZXHA 3RNFC 2Z0DB 4OVZA 1F0ZA 1QC6A 3I3TB 1GB1A 3N9YC 2ZCCA 3KUDB 4DX90 4BBNF 2K1FA 4KX6B 3EUB2 4WQOB 3TEXA 5C6RA 3LDZE 4IM0A 4IM2A 2NCNA 4MJSB 2PVGC 3SR6A 2MH7A 1WGHA 1D4BA 1V89A 4C7YA 4ANWA 4M02A 4EE2A 1ZDXA 1H4RA 4OVVA 2AQ1B 3NVWA 3UINB 2Y8GA 4HKZE 1UD7A 2JY6A 1XT9B 1KFYB 2V3SA 1KH0A 2MDXA 4HVBA 1EM7A 5EE9A 3SUZA 3CMMB 1NVID 3DVNU 1SIFA 2KWUB 1FFUA 2JRHA 3P1MA 1E5WA 3RNBC 3DBSA 2NTTA 4E71A 3K9PB 4M0WB 3EGRA 1FRRA 3QWMA 2WHIA 3RUIB 2K9XA 1XR0B 3DXDA 3ZYYX 2KHWB 4G11A 2LGIA 4DHZE 1WX8A 2LG1A 3V5WA 1E8WA 2C9WB 2DYNA 1VZ7A 1YQ4B 2A4ZA 1PFDA 2KLCA 3EFCA 2FNJB 3WAPA 2ADZA 2DYQA 2GMIC 4KIKA 1IGDA 3AE1B 1SE2A 2ZKMX 1PGAA 2CJOA 1NI3A 1RFAA 3N1ZC 3Q3MC 1EGXA 4IWPA 3VTUA 3VQIA 4CHJA 3PO0A 1J8CA 1UNQA 3ENBA 4JWUC 4YSXB 4NY0A 4KGRA 2CB8A 2FUHB 3BZDB 2EKIA 3ZNGC 2ZCBA 2VRRB 4H2AA 5M4YB 3W9CB 3QBVB 4Y94A 2RSUA 1HB6A 1I4HA 2D5GA 2JSVX 1X1FA 1FMAD 1RRBA 1YD8U 4XDCA 2LHEA 1FGYA 1HZ6A 3WALA 4XWWA 2DZIA 1QLBB 5D3XA 4P6VF 1E7VA 3Q6BA 4RH6A 1XQQA 3T3OA 3AE9B 1TZ1A 3RMKC 1VDVA 5G5HA 3VR8B 1U29A 1ZP0B 4ILHA 3W2DA 2JZ3B 2E3TA 4DXFA 3C8YA 3VHTC 3A8QA 3R2TA 4HPPA 3V05A 4JKEA 2L83A 1YN3A 1WE6A 1ST7A 1FIQA 3NW8A 5AUIA 2COPA 1AWEA 2INPE 2CODA 2RR9A 1YIWA 3KW5B 4WWNA 1D3ZA 1HTQA 1MK9B 1V8CA 1ZW7A 5DPRA 1KBLA 1S3SG 3QARA 2K6QA 1LW3A 4JE3B 2DIKA 2MFQA 4HB3B 4US9A 4C56C 4S0RA 2JP2A 2MJEA 3EA6A 1UELA 4EZKA 2DYBA 2HTHA 4GXBA 2M56B 4AQ7A 3NVZA 2Z59B 3QWZB 1FNWA 2UZRA 4OT1A 2BYVE 4NSWA 1V5PA 3BY4B 1L7YA 1BTNA 5IN7A 2AQ3B 3Q14C 3OLMD 2EMSA 2NMBA 4KAXB 4IWQA 2UYZB 2BS4B 2X38A 2LJ5A 1D5XC 3RD2A 4RM9A 2MP2A 4TSSA 1ZKHA 4W9DA 1XX0A 2SEBD 5J3QA 2ABDA 2UVMA 4ZRQA 4A6KA 4KSLC 2ON8A 5CLLB 1I42A 2BKFA 3V60A 2M0AA 3PSCA 1TY2A 3BVMA 4F7GA 2IGDA 5D7GA 1WGQA 1V97A 4TUUA 5LXHA 5E6PA 1LB1A 1CK1A 3TIXA 1KLVA 1Y56A 1XLQA 3NZUA 4DQOC 1DROA 2BPSA 1A5RA 2GBNA 3KZ1A 3PRPB 2HJ8A 2JWUA 4HAUB 2LMCA 3ZTCA 5GXGB 2YLMA 3DBLB 2RGFA 1HA5A 4KVGB 4D2KA 2NBWB 2M1MA 2KQ7A 3BYYB 3Q8BA 1J7CA 3N32A 1LM8B 4GMXB 5D3VA 4NAWA 2V4IB 1P5TA 2M0XA 1PYWD 2XK5A 3L10B 1P98A 1FCCC 1FOEA 3APDA 2ROVA 1DBHA 4RGMA 4ICUA 3L08A 3U7DA 2MWNB 3B0AA 1KM7A 3APFA 4CO7A 1FNVA 3W1YA 5CX3A 4BKSD 1Q10A 1WJNA 4WVFB 2KX0A 2UZSA 2K8BA 1XO3A 4MELA 2O6VA 1PDXA 1MIXA 2MHJA 4WWMA 4HB0B 4JQWC 2J0KA 1ZSQA 3ZQ4A 2WNMA 3VVWB 1ZXIA 2NBVA 4HEA1 1WX9A 2R2YA 2J0JA 2YEPF 3BK2A 2KOXA 3WIMA 2W2XD 5IKCM 3WYFB 3IG3A 1JDEA 3T3NA 3P4RB 1A70A 5J18A 1MFWA 1V80A 3V3XA 4WJQA 3TJPA 1ENFA 4DWFA 2IZVB 1TGZB 1YX6B 5J17A 2AX5A 4EKUA 3P7ZA 3KH0A 2FE8A 5L81A 3PS6A 3WAMA 4IOYX 3WCQA 3RNGC 2QJLA 1R7SA 1BAKA 3U2SC 1HE8A 3HIZA 5JZEB 4A9AA 1GG3A 4FJVB 1EWCA 2V76A 4HDQA 3AECB 2CHZA 4IG7B 1L0YB 1WGDA 1Q5WB 1ZVRA 1IBXA 1ZPSA 2EJ8A 3OJ3A 1FXIA 1L0VB 3KUZA 3FKYA 1MKEA 2IGGA 2KVRA 3A9KB 3RZWC 2FIDA 2RMMA 2MBEA 4GNKB 3L13A 1MG8A 4RF0A 4OSNA 4HB2B 3MDBC 1WXAA 4MGIE 2PIAA 5IA7A 4L6EA 5H92C 1KOTA 2VH2A 2IO1B 1K51A 4GSWA 2V3NA 2KDEB 1AWDA 1K8RB 3EPYA 4NQKE 1TQZA 2KIEA 4NAWB 3TEWA 2IGHA 1K52A 1Y5OA 5FR3A 5IO9A 4AP4C 3Q2AC 2NMQA 1M4VA 3KY9A 1HQRD 4WQMA 1T77A 3ZVRA 4IFSA 2GBKA 3VRAB 3O65B 3DBRI 2CU1A 1QOGA 4A3OA 1VBHA 3J9CA 2LI5A 1V61A 3PRZA 3VH3B 2EMTA 3D8DA 2BT6A 2LVPA 2LGSA 2KGXB 3GS2A 2R0DA 3ABVB 4P16A 3GZNI 3EFUA 1STEA 5BYQA 3ZJUA 1EAZA
chains in the Genus database with same CATH topology
4DDID 4BVUC 1WM3A 1U5EA 2YVCA 4JK8A 3RCPA 3A1QB 4W9GA 3QCAA 2DZKA 3ENEA 2XQNM 4KDIC 3IVFA 4EUTA 1WJ4A 3AXCA 1ZM0A 1EVHA 1FGZA 3ULCA 4HAWB 4FJYA 3ML4A 3ZRCA 4WAAA 2ZNVC 3HK0A 5L95C 2AEHA 1U5FA 1IRSA 2ZNVB 4MJSA 3ZRFA 4BFRA 4ZYNA 5DI9B 3IFWB 4K2OA 5D2MB 2C7MB 2I5FA 4JK7A 2LZ6A 2YSZA 3MHSD 1P0RA 2D4QA 1QQGA 4K81A 5CHVC 1C1YB 4B95A 1P1AA 5C23A 2D9YA 4WJ7A 2NZ8B 4BKSA 3G9WA 3EHVA 1OEYA 2PE9A 3UQBA 4HHVA 4MH0E 2FCSA 2LGDA 5DPSA 4M8MA 2YT0A 3QHTA 2JZZA 2LBBA 2DAJA 1V6EA 3QAQA 3D32A 2D07B 4F7UP 2MLBA 1BTKA 3MTNB 3UF8A 2KC1A 1WXSA 5LLIA 1UBQA 2DHIA 2HTHB 1FAOA 3KRXA 1GNUA 4MY6A 2RGNB 1XD4A 4B6HA 3ULBA 2BKRB 2O6VD 2DHZA 3F0WA 3JYUA 2PJHA 3FP5A 1GC7A 2MRPA 3W1SA 3X23A 2FJLA 3TW1A 4I6LB 4LDTD 3PVWA 4KHBB 3UIPB 3P6AA 4BBNC 2RPQA 2N0YA 4GIVA 3JSVB 1WZ0A 2GBMA 2K2JA 4B6WA 2FCQA 4XC2A 3AJ4A 1WJUA 3EC8A 4XX5A 5J3YA 4HXDA 1FHWA 2RSGA 2YS3A 1OY2A 3TL5A 2B3AA 4KDLB 2ZPNA 4BKTA 4M8NA 2NS5A 4IAPA 4HK2A 2QKLA 3ZUNA 2DFKA 2G4DB 1WJMA 4A6HA 3TMPB 3SBTA 3FLVA 2N9EB 1X05A 1WGYA 2A5UA 4EZLA 3VFKA 2LD9A 2YS1A 2L0FA 4GU2A 1DDWA 3KUCB 2KCJA 5HKHA 4PS8A 4HATB 2D9ZA 4DXAB 1NVLA 3ODWA 2COFA 2BYEA 4G0NB 4K7SA 4GPTB 3IHPC 1N3HA 1V81A 1IP9A 2NR2A 2XEWA 2K8CA 3ONSA 3H7PB 3AULA 4PS3A 4K7UA 2KANA 3L0WB 1J0WA 2BF8B 3ECIA 1U5GA 2CY5A 4W9CA 2CKHB 4JKCA 4I6NB 3DQVA 1E8YA 2LWPA 3ML8A 2Z0OA 4CHKA 1WRDB 3ZIMA 4PNKA 1WI0A 4JKGA 2XBBC 5AEKB 2BWES 1UBIA 3JSVA 1WFYA 3PP2A 1AARA 1OQNA 2K00A 3PVUA 4EOYA 2NVUI 1TBEA 2D9WA 3VAWA 4DDGD 5HE2A 2KNBA 5KQ4A 2OJRA 1VBGA 2L76A 2ELAA 1U4AA 3TCAA 3L54A 2PE6B 1TJ6A 2DZJA 1EF5A 2RNRB 3N7CA 4WWPA 2NPTB 5LXIB 1E90A 2IO3B 4MGYE 2I5CA 2KX3A 2Z0QA 3B08A 2L0TA 3DCGA 4CHMA 3ZO5B 4MM3A 4HLEA 3Q3FA 1RRPB 4FN2A 5L83A 1C3TA 2JXXA 2MKRA 2OQBA 1U5DA 1CMXB 1PMSA 1NU2A 2L05A 2LRWA 2ZVNA 1M94A 2Z0EB 2M8SA 3APCA 2PPHA 4BOZB 2D2QA 3ODOA 3A9KA 1WMHB 1P9DU 3N30A 4GB9A 2HE7A 4IM3A 2MBHA 2YF0A 4HPLB 4KIKB 2DKPA 1E7UA 3BJIA 2LVQA 5DH9B 4C0AA 3PGEA 3TO1A 3S2AA 1DIKA 4DBGA 4ZRKA 1SE9A 2DYOA 4FJZA 2C7NB 3DOWA 1ZC4B 2VRWB 1ZC3B 1MIZB 2KUPA 2H7DA 2FJ9A 3D8EA 2N23A 2JF5A 5IJMA 4ILJA 2WWZA 4GDLB 4LDTB 3QQ8B 2KLGA 4I6PA 1UPRA 1EF1A 3JW0X 5E6NA 1UZXB 3VXWA 1DDMA 2L00B 3ZKJC 2M14A 4K2PA 2K39A 1GC6A 3CSTA 2G3QB 1V5OA 3WAOA 5HE0A 1BT0A 3HQCA 2DLWA 4JLCA 4NJ6A 4BOSC 2KXJA 3ML9A 4DHJD 3PEGA 4DHJB 3PRMB 2VSZA 5KHOA 3T8MA 2X18A 5C1ZA 1QZEA 1Z87A 3ZNZB 1V86A 2K6DB 1WGUA 3RT3B 2NBUA 2I1JA 3H6NA 2L3ZA 2DHKA 4MSQB 4HAZB 1WI1A 3VUYA 1Q0WB 1UGMA 4TQ0A 1XKEA 4HWIB 3KSYA 4XZ4A 1UNPA 2DHJA 3T06A 2LVOA 1WGGA 1WX7A 4RMAA 2KTFA 5TR5A 4D0NB 2DX5A 4FA6A 2V1YA 3A98B 4NNJB 2L8JA 2REXA 3IBEA 4AJYB 3EECA 4MT7A 2G45B 4F7ZA 4II2B 1WXVA 4FADA 1W1DA 3H9DA 1FHOA 4NJ7A 5JH5C 2GBJA 4HCPB 1RAXA 4NQLB 2GOWA 2NBVB 4GDLA 2KFJA 5BO4B 2AWTA 2EKEC 2WX1A 3H7SA 5CHWA 2CQUA 3O96A 5JHGA 5EFXA 4AJWA 4CYEA 3V6EB 3QX1A 4JKGB 4KZ0A 1SGHA 4GOCA 1UPQA 5DHFB 1KJTA 2DTCA 1TTNA 4ILGB 5LOPB 2FAZA 4PYUA 3L17A 3N3KB 1L2NA 1NI2A 3PHWB 3R66C 3M3JA 5D27A 2YT1A 3M95A 4HAXB 3DVGY 4A20A 3KRWA 2N7DA 3A9JB 1B55A 4IUMB 3UQAA 5JHAA 5JVLA 3FSSA 1EO6A 2C7HA 2COCA 2R09A 3RZFA 5HE3A 2D10A 2FCMA 3QC8B 1XODA 3VDZA 2GS0A 3LJ3A 2JWZA 1MK7B 2IO0B 4DHZB 3VUWA 2YS5A 2KTRA 3ZDTA 4HCNB 4LJPB 3VUXA 1J0GA 4HAVB 2KD0A 5GMVA 4FBJB 3VTWA 3F5RA 2KDFB 4F7HA 3E9OA 2D9XA 3H7PA 1V2YA 1WXMA 4X57B 2KJHB 5DCNA 1ZGUB 2R82A 3UGBB 3KVFB 5FR6A 2DX5B 4DBBA 5KCVA 2M38A 4G3XB 2BCJA 4B9KA 1Z5SB 2KO3A 4ZRIA 1WG7A 3PPAA 3WANA 2Y8FA 2MBQA 1NTIA 2CR5A 2V4LA 1KZ7A 1V49A 3DBHI 4JKFA 4KHOA 3QJZA 2ELBA 4FHJA 2JVCA 3ZNID 2LULA 2CS4A 1BWNA 2KC2A 2ROZB 3HW2B 5JHHA 4KZCA 3LJUX 2RLOA 1NBFC 3RCZA 2NPTA 4TYZA 3ZVVA 1U27A 1WVHA 3RYTA 2OTXA 4JIOU 5G2NA 3A9JA 1AQCA 4YONA 2I1KA 2EC1A 2N1VA 1V5TA 2CHWA 3FEHA 1GUAB 2ZJDA 4JKHA 3KYCD 1GJZA 4MSMB 3ZNHB 5DPTA 2JPHA 2O6VB 3NHEB 2KTRB 3L16A 2J0MA 1H8CA 3VIAA 3PLUA 3SNHA 1P3RA 4IW0A 2LOZA 2KJRA 3UIOB 4NPNA 2W9NA 2R2QA 3QA8A 4AUQC 2LGXA 1M7RA 2D3GA 5DPWA 2X0SA 2DA0A 4W9EA 2N1WA 2KFKA 1W1HA 2AYOB 2WH5A 4A3PA 2P0DA 4RM8A 2IFSA 4ZRJA 3NSUA 1LQBA 1V88A 2ZEQA 3OANA 4KHAA 4JKAA 1P6SA 2CRFA 3V62A 5C5BA 2LRUA 2AL6A 3SYXA 3E9PA 3K9OB 2IYDB 1UEFA 2MBOA 4G50A 2WYQA 3E66A 1WZ3A 4BKGA 1W1GA 1RLFA 4ASWC 2C5LC 3V6CB 4A6FA 1TXDA 3NS8A 1M7EA 2WDTB 2MW5A 2KMCA 3CF6E 5LONB 3H1UA 2IY1B 2FCNA 1WJ6A 2DN6A 2P8VA 5HE1A 5JLJB 3KYDD 3A1QA 2LOXA 4E3CA 2Z0PA 4DK5A 1EUVB 3PSEB 4HJKA 5CLQB 1WIAA 1I2HA 2KK8A 2HD5B 2DENB 2W2XC 1WE7A 4WJPA 1LFDA 4JK9A 2AL3A 1IYFA 1XCGA 4H8SA 2OOBB 1X86A 4K1RB 2N4FA 1GGOA 3WA0A 3OAWA 2KFKB 3PZDA 1Y19B 2O2VA 2D9VA 4JL9A 2MQJA 5FI1A 3GYPA 1E8XA 3B1LX 2CAYA 2MP2B 3DXCA 2DYMA 3UZTA 4MK0A 1OGWA 4TV3A 2DKQA 2IBIB 3D8FA 2RVBB 4JKDA 4GMVA 3M1IB 2N9PC 5KHQA 1Y8RC 3A4RA 4W9KA 2ZVOA 4W9FA 1K5GB 3T9LA 4LCDE 1V5UA 2JUOA 1OMWA 2M17A 2GCLA 1X1GA 2GCJA 1XD3B 4FLHA 2WX0A 4EMOA 3R7QA 2KDIA 3CSFA 3ZTDA 3SD5A 1HB8A 1WMHA 4GZUA 4YL8A 3A33B 3HM6X 2C60A 1T0YA 2MWSB 3P2BA 4XWXA 2K8HA 2P0FA 1P3QU 2DX1A 3PVLA 3GOEA 1E8ZA 1YX5B 4MGZE 4TKNA 4WSFA 1V9JA 2R2OA 3E9LA 1OTRB 2KQSA 4PS7A 4A6FB 3AI5A 1K5DB 4EEWA 2LASA 2M4NA 3ODXA 2Q13A 4HB4B 1Q1OA 4JGHB 1KI1B 5AZFA 3VH4B 1S1QB 4GN1A 3HHMA 4MEMA 2CY4A 1DDVA 2KN5A 3V61A 2PEAA 3QK0A 4K7WA 3DPDA 3NY5A 3NOBA 2J7QB 3M63B 1MAIA 5E6OA 1PQSA 3SHQA 3SDLC 2RUKB 1ACAA 3FM8C 4WJOA 3Q3JA 4GDKA 4K17A 2LKOA 5D3WA 1FB8A 1IPGA 2L7RA 5DHAB 2IYBA 2JT4B 5JP4A 5C16A 5J2RA 2Y5BB 2L1CA 4W9HA 1WF9A 4II3B 1WJ1A 3AU5A 2BYFA 1WYWB 4W9IA 2UWQA 1R4NI 3R7RA 2ZPYA 2P0HA 3MPXA 4Z2MB 1OQYA 1FXTB 1OEYJ 3BINA 3TFMA 4TQ1A 4AWJA 3SO6A 2GJYA 3M62B 2PZ1A 4EZJA 1YQBA 3CIKA 3GYOA 4J6IA 3PT2B 5CHFA 4GGQA 5D6JB 4KV2A 1I35A 3W1SC 3MJWA 4ANUA 3ALBA 1R4MI 1V5MA 2RD0A 3QIJA 2CHXA 4ANXA 4HAYB 4LJOB 2RQ1A 3SBGA 2GBRA 3PG7A 1F9JA 3A4SC 3DDCB 5G55A 2E2XA 3ZLZA 4JKBA 1NTYA 5GOWB 3DBLI 1X11A 2G35A 1NDDA 5D3YA 2HRJA 3DVNV 1Z2MA 2DZMA 2N7EA 4ZDVA 4MGKE 1H10A 1VD2A 1NTVA 4DX8A 2LXCA 4BBKA 5J3TA 1SHCA 3OJ4B 5IAAC 1G6JA 4FULA 2ASQA 3A8PA 2MA9B 4GDKB 3U8ZA 2MBBB 4W9JA 3DVGX 5D94A 3AU4A 2N9XA 4EFOA 2IY0B 4PQ0A 3JVZX 2FIFA 5FI0A 1Q67A 4A5KA 1KC7A 2KMAA 3PV1A 1JRUA 2BWFA 4F1SA 2DAFA 2LYDA 4OVUA 2QHOA 4EJNA 4PYZA 3PREA 2MCNB 3SV1A 2MX2A 3ZDMC 3ZW3A 2D11A 2Y7BA 2LUEA 1FHXA 2O2VB 4FHKA 1UNRA 5AZHA 4F8CB 3DXEA 3U30A 3PHXB 3TVVA 5C5BB 2LGYA 5DIFB 2QKMA 3C0RB 4MDKE 1PFJA 2YRYA 1U2BA 2KWCA 4IC7B 1LXDA 1WGRA 2K25A 2J59M 4WJNA 1HBKA 1PLSA 2KDBA 2XK5B 3RULA 2KWVB 1WR6E 2BGFA 3HM3A 3PTFC 3PLVA 3VTVA 2FDQA 1KZGA 3TBLD 4URKA 4AOFA 2LXAA 5CTRC 1J19A 3NZSA 4ICVA 1UH6A 4WWOA 3CXBB 1WH3A 2VKIA 5JHBA 1MPHA 5EDSA 2G4SA 4KSKC 2K2UA 1WY8A 3VOQA 2W2WA 4HDOA 2IO2B 2KJ6A 4Z2NA 1YJ1A 1I7AA 4N9F4 2H7EA 2L2IA 1WM2A 2COAA 2KZRA 4IWOA 4W9LA 2KKCA 5AZGA 1DYNA 4ANVA 4HPMB 1X1MA 2MSED 3SU8X 1WR1A 5C79A 3R3MA 2ZZPB 4E74A 2JRIB 3X0WA 5KQ1A 1ISNA 1RJ2A 1VCBA 4P7IA 2Z0DB 1QC6A 3I3TB 2ZCCA 3KUDB 4DX90 4BBNF 2K1FA 4WQOB 5C6RA 3LDZE 4IM0A 4IM2A 2NCNA 4MJSB 1WGHA 1V89A 4ANWA 1H4RA 4OVVA 3UINB 2Y8GA 1UD7A 2JY6A 1XT9B 2V3SA 2MDXA 4HVBA 3SUZA 3CMMB 3DVNU 1SIFA 2KWUB 2JRHA 1E5WA 3DBSA 4E71A 3K9PB 4M0WB 3QWMA 3RUIB 1XR0B 3DXDA 2KHWB 4G11A 4DHZE 1WX8A 2LG1A 3V5WA 1E8WA 2C9WB 2DYNA 2A4ZA 2KLCA 2FNJB 3WAPA 2ADZA 2DYQA 2GMIC 4KIKA 1RFAA 1EGXA 4IWPA 3VTUA 3VQIA 4CHJA 1J8CA 1UNQA 3ENBA 4NY0A 2CB8A 2FUHB 3ZNGC 2ZCBA 2VRRB 3QBVB 4Y94A 2RSUA 1HB6A 1X1FA 1RRBA 1YD8U 1FGYA 3WALA 2DZIA 5D3XA 1E7VA 1XQQA 1TZ1A 1U29A 4ILHA 2JZ3B 3VHTC 3A8QA 4JKEA 1WE6A 1ST7A 2COPA 1AWEA 2RR9A 2CODA 3KW5B 1YIWA 4WWNA 1D3ZA 1MK9B 1ZW7A 5DPRA 1KBLA 1S3SG 3QARA 2K6QA 1LW3A 2DIKA 2MFQA 4HB3B 2JP2A 1UELA 4EZKA 2DYBA 2HTHA 4GXBA 2Z59B 3QWZB 2UZRA 2BYVE 4NSWA 1V5PA 3BY4B 1L7YA 1BTNA 3OLMD 2EMSA 2NMBA 4KAXB 4IWQA 2UYZB 2LJ5A 3RD2A 4RM9A 2MP2A 1ZKHA 4W9DA 1XX0A 5J3QA 2ABDA 2UVMA 4A6KA 4KSLC 5CLLB 1I42A 2BKFA 3V60A 3PSCA 4F7GA 5D7GA 1WGQA 4TUUA 5LXHA 5E6PA 1LB1A 3TIXA 1KLVA 3NZUA 1DROA 2BPSA 1A5RA 2GBNA 3KZ1A 3PRPB 2HJ8A 4HAUB 3ZTCA 2YLMA 2RGFA 4KVGB 2NBWB 2M1MA 2KQ7A 3N32A 1LM8B 4GMXB 5D3VA 4NAWA 1P5TA 2M0XA 2XK5A 3L10B 1P98A 1FOEA 3APDA 2ROVA 1DBHA 4ICUA 3L08A 3U7DA 2MWNB 3B0AA 1KM7A 3APFA 4CO7A 3W1YA 5CX3A 4BKSD 1WJNA 4WVFB 2KX0A 2UZSA 2K8BA 4MELA 2O6VA 1MIXA 4HB0B 4JQWC 2J0KA 1ZSQA 3VVWB 1WX9A 2J0JA 2KOXA 3WIMA 2W2XD 3WYFB 3IG3A 1JDEA 5J18A 1V80A 4WJQA 3TJPA 4DWFA 2IZVB 1TGZB 1YX6B 5J17A 4EKUA 3P7ZA 3KH0A 5L81A 3PS6A 3WAMA 4IOYX 1BAKA 1HE8A 3HIZA 5JZEB 1GG3A 4FJVB 2V76A 4HDQA 2CHZA 4IG7B 1WGDA 1Q5WB 1ZVRA 2EJ8A 3OJ3A 3KUZA 1MKEA 2KVRA 3A9KB 3RZWC 2FIDA 2MBEA 3L13A 1MG8A 4HB2B 3MDBC 1WXAA 4MGIE 5IA7A 4L6EA 1KOTA 4GSWA 2IO1B 2KDEB 1K8RB 3EPYA 4NQKE 1TQZA 4NAWB 1Y5OA 4AP4C 3KY9A 3ZVRA 4IFSA 2GBKA 3O65B 3DBRI 2CU1A 4A3OA 1VBHA 2LI5A 1V61A 3PRZA 3VH3B 2EMTA 3D8DA 2LVPA 2KGXB 2R0DA 3GZNI 3EFUA 1EAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VXW A;  2G4S A;  5EDS A;  4E3C A;  4KSK C;  2K2U A;  2Z0P A;  1WY8 A;  3VOQ A;  4DK5 A;  1DDM A;  1EUV B;  4DDI D;  4BVU C;  3PSE B;  2L00 B;  4HJK A;  3ZKJ C;  2W2W A;  1WM3 A;  5CLQ B;  4HDO A;  2M14 A;  1WIA A;  4K2P A;  1I2H A;  2IO2 B;  2KJ6 A;  4Z2N A;  5E6N A;  1U5E A;  2KK8 A;  2YVC A;  2HD5 B;  2DEN B;  2W2X C;  1YJ1 A;  3RCP A;  2K39 A;  1I7A A;  1WE7 A;  4WJP A;  1GC6 A;  3CST A;  3A1Q B;  4W9G A;  2G3Q B;  1LFD A;  4N9F 4;  3QCA A;  2H7E A;  2L2I A;  1V5O A;  1WM2 A;  2AL3 A;  2DZK A;  2XQN M;  3ENE A;  3WAO A;  5HE0 A;  1BT0 A;  3HQC A;  2COA A;  2KZR A;  4KDI C;  4B9K A;  1IYF A;  4IWO A;  3IVF A;  2DLW A;  2KKC A;  4W9L A;  1XCG A;  4JLC A;  5AZG A;  4NJ6 A;  1DYN A;  4H8S A;  2OOB B;  4ANV A;  4HPM B;  4BOS C;  4EUT A;  2KXJ A;  1WJ4 A;  1X86 A;  1X1M A;  2MSE D;  3ML9 A;  3SU8 X;  4K1R B;  4DHJ D;  3PEG A;  1WR1 A;  2N4F A;  3AXC A;  5C79 A;  3R3M A;  1ZM0 A;  1EVH A;  3WA0 A;  1FGZ A;  2KFK B;  3OAW A;  4DHJ B;  3PZD A;  3ULC A;  4HAW B;  4FJY A;  3ML4 A;  3ZRC A;  3PRM B;  2ZZP B;  2VSZ A;  1Y19 B;  2O2V A;  4WAA A;  2ZNV C;  4E74 A;  3HK0 A;  5L95 C;  5KHO A;  2D9V A;  2JRI B;  4JL9 A;  3X0W A;  3T8M A;  2AEH A;  5KQ1 A;  2MQJ A;  1U5F A;  1ISN A;  1RJ2 A;  1IRS A;  3GYP A;  5FI1 A;  2X18 A;  1E8X A;  1VCB A;  4P7I A;  2ZNV B;  3B1L X;  5C1Z A;  4MJS A;  3ZRF A;  1QZE A;  4BFR A;  1Z87 A;  2Z0D B;  4ZYN A;  3ZNZ B;  5DI9 B;  1V86 A;  2CAY A;  4K2O A;  3IFW B;  5D2M B;  2K6D B;  2C7M B;  1QC6 A;  2MP2 B;  3I3T B;  1WGU A;  2I5F A;  3DXC A;  3RT3 B;  2ZCC A;  3KUD B;  2DYM A;  4DX9 0;  3UZT A;  2LZ6 A;  2YSZ A;  4MK0 A;  4BBN F;  2K1F A;  2NBU A;  1OGW A;  4TV3 A;  3MHS D;  4WQO B;  2I1J A;  2D4Q A;  5C6R A;  1P0R A;  1QQG A;  2DKQ A;  3H6N A;  4K81 A;  3LDZ E;  4IM0 A;  2L3Z A;  1C1Y B;  5CHV C;  2IBI B;  2DHK A;  4B95 A;  4IM2 A;  2NCN A;  3D8F A;  1WI1 A;  4HAZ B;  1P1A A;  2RVB B;  1UZX B;  4MJS B;  4MSQ B;  5C23 A;  1Q0W B;  3VUY A;  1UGM A;  2D9Y A;  4WJ7 A;  4TQ0 A;  2NZ8 B;  4GMV A;  1WGH A;  4BKS A;  3M1I B;  1V89 A;  3G9W A;  1XKE A;  3KSY A;  2N9P C;  1Y8R C;  3EHV A;  4HWI B;  3A4R A;  4ANW A;  5KHQ A;  4W9K A;  1OEY A;  2PE9 A;  3UQB A;  3R66 C;  1H4R A;  4OVV A;  4HHV A;  4XZ4 A;  4MH0 E;  1UNP A;  2DHJ A;  3UIN B;  3T06 A;  2ZVO A;  2FCS A;  2LGD A;  4W9F A;  2LVO A;  1WGG A;  5DPS A;  1WX7 A;  1K5G B;  4M8M A;  3T9L A;  2YT0 A;  3QHT A;  2Y8G A;  4LCD E;  1V5U A;  2JZZ A;  1UD7 A;  2JUO A;  2LBB A;  2JY6 A;  4RMA A;  2DAJ A;  1XT9 B;  1OMW A;  1V6E A;  2M17 A;  2V3S A;  2GCL A;  1X1G A;  2KTF A;  2MDX A;  3D32 A;  2D07 B;  3QAQ A;  2GCJ A;  4F7U P;  1XD3 B;  2MLB A;  3SUZ A;  2WX0 A;  1BTK A;  3MTN B;  4EMO A;  3CMM B;  4FLH A;  5TR5 A;  2KDI A;  3R7Q A;  3UF8 A;  4D0N B;  3UIO B;  1I35 A;  2DX5 A;  3DVN U;  4FA6 A;  1SIF A;  2KWU B;  3CSF A;  2JRH A;  2KC1 A;  2V1Y A;  1E5W A;  3ZTD A;  3A98 B;  1WXS A;  3DBS A;  3SD5 A;  5LLI A;  1UBQ A;  3K9P B;  4M0W B;  4E71 A;  4NNJ B;  4ANX A;  1HB8 A;  2DHI A;  2HTH B;  3QWM A;  2L8J A;  2REX A;  1FAO A;  3KRX A;  4GZU A;  1WMH A;  3RUI B;  3IBE A;  1XR0 B;  4AJY B;  1GNU A;  3EEC A;  4YL8 A;  4MT7 A;  3DXD A;  2G45 B;  4F7Z A;  4II2 B;  3A33 B;  2KHW B;  3HM6 X;  4MY6 A;  4G11 A;  2C60 A;  4DHZ E;  1WXV A;  1T0Y A;  2MWS B;  4FAD A;  1WX8 A;  2LG1 A;  3P2B A;  4XWX A;  1W1D A;  3V5W A;  1E8W A;  3H9D A;  1FHO A;  2C9W B;  2K8H A;  4NJ7 A;  2DYN A;  2P0F A;  2RGN B;  2A4Z A;  1XD4 A;  1P3Q U;  2DX1 A;  2KLC A;  2FNJ B;  4B6H A;  2ADZ A;  2DYQ A;  3ULB A;  2BKR B;  3PVL A;  2GMI C;  3GOE A;  4KIK A;  3WAP A;  1E8Z A;  5JH5 C;  2GBJ A;  2O6V D;  1YX5 B;  4MGZ E;  1RFA A;  4TKN A;  4HCP B;  4WSF A;  1V9J A;  2R2O A;  2DHZ A;  1RAX A;  1EGX A;  4IWP A;  4NQL B;  3F0W A;  1OTR B;  2GOW A;  3JYU A;  3VQI A;  3VTU A;  4CHJ A;  3FP5 A;  2PJH A;  2KQS A;  1J8C A;  2NBV B;  4PS7 A;  4GDL A;  2KFJ A;  1GC7 A;  4A6F B;  2MRP A;  1UNQ A;  3AI5 A;  1K5D B;  5BO4 B;  2LAS A;  2M4N A;  4EEW A;  3ODX A;  3X23 A;  3W1S A;  2FJL A;  2AWT A;  2EKE C;  3TW1 A;  2WX1 A;  2Q13 A;  3H7S A;  5CHW A;  4HB4 B;  2CQU A;  1Q1O A;  3O96 A;  4NY0 A;  1KI1 B;  4JGH B;  5JHG A;  5AZF A;  4I6L B;  5EFX A;  3VH4 B;  1S1Q B;  4AJW A;  4GN1 A;  2CB8 A;  3HHM A;  4LDT D;  3PVW A;  4KHB B;  4MEM A;  4CYE A;  2FUH B;  2CY4 A;  3V6E B;  3QX1 A;  3UIP B;  3ZNG C;  2ZCB A;  2VRR B;  1DDV A;  3P6A A;  2KN5 A;  3V61 A;  4BBN C;  3WIM A;  2RPQ A;  2N0Y A;  2PEA A;  4GIV A;  1SGH A;  4GOC A;  3JSV B;  4KZ0 A;  1UPQ A;  3QK0 A;  1WZ0 A;  4K7W A;  3QBV B;  4Y94 A;  5DHF B;  2DTC A;  1KJT A;  2GBM A;  3DPD A;  3NOB A;  2RSU A;  1HB6 A;  1TTN A;  2K2J A;  2J7Q B;  3M63 B;  4B6W A;  1MAI A;  5E6O A;  1X1F A;  1PQS A;  3SHQ A;  1RRB A;  2FCQ A;  1YD8 U;  5LOP B;  4XC2 A;  3AJ4 A;  1WJU A;  2FAZ A;  3EC8 A;  3L17 A;  4PYU A;  2RUK B;  3N3K B;  1ACA A;  3FM8 C;  4WJO A;  4XX5 A;  5J3Y A;  3SDL C;  1L2N A;  3Q3J A;  4GDK A;  1NI2 A;  4HVB A;  1FGY A;  4K17 A;  4HXD A;  2LKO A;  3PHW B;  1FHW A;  5D3W A;  2DZI A;  3M3J A;  2RSG A;  5D27 A;  1FB8 A;  2YT1 A;  5D3X A;  1IPG A;  2L7R A;  4HAX B;  1E7V A;  3M95 A;  5DHA B;  2YS3 A;  1OY2 A;  3DVG Y;  4A20 A;  3KRW A;  1XQQ A;  2IYB A;  2JT4 B;  3TL5 A;  1TZ1 A;  5JP4 A;  2B3A A;  5C16 A;  2N7D A;  4KDL B;  5J2R A;  1U29 A;  3A9J B;  1B55 A;  2JZ3 B;  2Y5B B;  4IUM B;  3VHT C;  3UQA A;  2L1C A;  4W9H A;  3A8Q A;  2ZPN A;  4BKT A;  5JHA A;  1WF9 A;  4II3 B;  3FSS A;  4M8N A;  2NS5 A;  4IAP A;  1EO6 A;  1ST7 A;  1WE6 A;  2C7H A;  4HK2 A;  1WJ1 A;  2COC A;  3AU5 A;  2BYF A;  2COP A;  2R09 A;  1WYW B;  4W9I A;  3RZF A;  5HE3 A;  2QKL A;  1AWE A;  2RR9 A;  2COD A;  3KW5 B;  1YIW A;  2DFK A;  4WWN A;  2UWQ A;  3ZUN A;  1D3Z A;  2D10 A;  2FCM A;  1MK9 B;  1R4N I;  1XOD A;  3QC8 B;  1ZW7 A;  3R7R A;  3VDZ A;  2ZPY A;  2G4D B;  1WJM A;  5DPR A;  2P0H A;  4A6H A;  3TMP B;  3FLV A;  2GS0 A;  3LJ3 A;  2JWZ A;  2N9E B;  1S3S G;  3MPX A;  1MK7 B;  2IO0 B;  3QAR A;  2K6Q A;  1LW3 A;  1X05 A;  3VUW A;  4Z2M B;  1WGY A;  4DHZ B;  1OQY A;  2A5U A;  2YS5 A;  1FXT B;  2MFQ A;  4HB3 B;  2KTR A;  3W1S C;  4EZL A;  1OEY J;  3VFK A;  3BIN A;  3TFM A;  3ZDT A;  2LD9 A;  4TQ1 A;  2JP2 A;  4HCN B;  2YS1 A;  2L0F A;  3SO6 A;  1UEL A;  2GJY A;  3M62 B;  4LJP B;  2PZ1 A;  3VUX A;  4AWJ A;  4EZJ A;  4GU2 A;  4EZK A;  2DYB A;  1YQB A;  4GXB A;  1DDW A;  2HTH A;  1J0G A;  4HAV B;  3KUC B;  2KD0 A;  3CIK A;  2Z59 B;  3QWZ B;  5GMV A;  2UZR A;  3F5R A;  3GYO A;  2KDF B;  3PT2 B;  2KCJ A;  2BYV E;  4GGQ A;  4HAT B;  4J6I A;  4PS8 A;  5CHF A;  5HKH A;  2D9Z A;  4F7H A;  4NSW A;  4DXA B;  1V5P A;  3BY4 B;  2D9X A;  3H7P A;  1L7Y A;  5D6J B;  1BTN A;  1NVL A;  3ODW A;  1V2Y A;  4KV2 A;  1WXM A;  2COF A;  2BYE A;  2EMS A;  2NMB A;  3OLM D;  4G0N B;  4GPT B;  4K7S A;  4KAX B;  3IHP C;  2UYZ B;  2KJH B;  1N3H A;  4IWQ A;  4X57 B;  1V81 A;  2LJ5 A;  5DCN A;  1ZGU B;  3RD2 A;  3MJW A;  4RM9 A;  2MP2 A;  4ANU A;  3ALB A;  1IP9 A;  1R4M I;  3UGB B;  1V5M A;  1ZKH A;  2RD0 A;  3QIJ A;  2CHX A;  3KVF B;  4W9D A;  4HAY B;  1XX0 A;  2NR2 A;  2XEW A;  5J3Q A;  2ABD A;  2UVM A;  2RQ1 A;  4LJO B;  2K8C A;  4A6K A;  4KSL C;  3ONS A;  3H7P B;  5CLL B;  5FR6 A;  1I42 A;  2BKF A;  3AUL A;  2DX5 B;  4DBB A;  2GBR A;  3V60 A;  5KCV A;  4PS3 A;  2M38 A;  3PG7 A;  3PSC A;  4G3X B;  4F7G A;  2BCJ A;  5D7G A;  1Z5S B;  1WGQ A;  1F9J A;  4TUU A;  2KO3 A;  3A4S C;  4K7U A;  2KAN A;  3DDC B;  3L0W B;  1J0W A;  5E6P A;  1LB1 A;  2E2X A;  2BF8 B;  4ZRI A;  3ECI A;  5G55 A;  1NTY A;  1U5G A;  1WG7 A;  5GOW B;  3PPA A;  3TIX A;  2CY5 A;  1X11 A;  2G35 A;  3DBL I;  4W9C A;  1KLV A;  1NDD A;  3NZU A;  1A5R A;  2CKH B;  1DRO A;  2BPS A;  2Y8F A;  3WAN A;  5D3Y A;  2HRJ A;  2GBN A;  3KZ1 A;  3DQV A;  3PRP B;  4I6N B;  2MBQ A;  1NTI A;  2CR5 A;  3DVN V;  1E8Y A;  1Z2M A;  2LWP A;  2HJ8 A;  3ML8 A;  2DZM A;  4HAU B;  3ZTC A;  2Z0O A;  2N7E A;  2V4L A;  1KZ7 A;  1WRD B;  1V49 A;  2YLM A;  4MGK E;  3ZIM A;  4CHK A;  3DBH I;  2RGF A;  4ZDV A;  1H10 A;  4KVG B;  4KHO A;  4PNK A;  2ELB A;  1WI0 A;  2NBW B;  2XBB C;  3QJZ A;  4FHJ A;  5AEK B;  2BWE S;  1VD2 A;  2JVC A;  2KQ7 A;  2M1M A;  1NTV A;  1UBI A;  1WFY A;  3JSV A;  4DX8 A;  2LXC A;  4BBK A;  2LUL A;  3N32 A;  3PP2 A;  3ZNI D;  1AAR A;  1LM8 B;  2CS4 A;  4GMX B;  5J3T A;  1SHC A;  5D3V A;  3OJ4 B;  1BWN A;  1P5T A;  1OQN A;  2K00 A;  4NAW A;  2M0X A;  3PVU A;  2KC2 A;  2XK5 A;  3L10 B;  5IAA C;  2ROZ B;  4EOY A;  1G6J A;  3HW2 B;  5JHH A;  1P98 A;  1TBE A;  2NVU I;  2ASQ A;  4FUL A;  1FOE A;  3A8P A;  3LJU X;  2D9W A;  2RLO A;  2MA9 B;  1NBF C;  3APD A;  2ROV A;  4GDK B;  1DBH A;  3VAW A;  3RCZ A;  4ICU A;  3L08 A;  4DDG D;  3U7D A;  3U8Z A;  2MBB B;  4W9J A;  5HE2 A;  2NPT A;  2MWN B;  3B0A A;  3DVG X;  2KNB A;  5D94 A;  4TYZ A;  5KQ4 A;  3AU4 A;  1U27 A;  1KM7 A;  1WVH A;  2OJR A;  2L76 A;  3APF A;  3RYT A;  3ZVV A;  2N9X A;  2ELA A;  2OTX A;  1U4A A;  4JIO U;  3TCA A;  3L54 A;  5G2N A;  4EFO A;  2IY0 B;  4PQ0 A;  3JVZ X;  3W1Y A;  5CX3 A;  4BKS D;  2PE6 B;  1TJ6 A;  2FIF A;  2DZJ A;  3A9J A;  1AQC A;  5FI0 A;  1EF5 A;  4WVF B;  1Q67 A;  1WJN A;  2KX0 A;  2UZS A;  4YON A;  2K8B A;  2RNR B;  4MEL A;  4A5K A;  2I1K A;  2EC1 A;  2KMA A;  1V5T A;  2N1V A;  3N7C A;  2CHW A;  4WWP A;  2NPT B;  3FEH A;  1GUA B;  2O6V A;  3PV1 A;  5LXI B;  2ZJD A;  1JRU A;  1MIX A;  1E90 A;  2IO3 B;  4HB0 B;  4JQW C;  2I5C A;  2J0K A;  2KX3 A;  1ZSQ A;  4MGY E;  3WAL A;  3VVW B;  2Z0Q A;  2BWF A;  2L0T A;  3B08 A;  4F1S A;  3DCG A;  3KYC D;  1GJZ A;  2DAF A;  2LYD A;  4CHM A;  4MSM B;  3ZNH B;  1WX9 A;  2J0J A;  3ZO5 B;  2KOX A;  4MM3 A;  4CO7 A;  4OVU A;  2JPH A;  3Q3F A;  5DPT A;  2W2X D;  1RRP B;  3WYF B;  2O6V B;  3NHE B;  3IG3 A;  2KTR B;  4FN2 A;  4HLE A;  5J18 A;  3L16 A;  1V80 A;  2J0M A;  1H8C A;  4WJQ A;  2QHO A;  5L83 A;  3TJP A;  2JXX A;  1C3T A;  2MKR A;  3VIA A;  4DWF A;  4EJN A;  2IZV B;  2OQB A;  3PLU A;  3SNH A;  1TGZ B;  1U5D A;  1P3R A;  1YX6 B;  5J17 A;  1CMX B;  4PYZ A;  4EKU A;  1PMS A;  3P7Z A;  3KH0 A;  4IW0 A;  2LOZ A;  3NY5 A;  2KJR A;  5L81 A;  3PS6 A;  1NU2 A;  2L05 A;  4NPN A;  2LRW A;  2W9N A;  2ZVN A;  1M94 A;  2R2Q A;  2Z0E B;  3QA8 A;  4IOY X;  3PRE A;  3WAM A;  4AUQ C;  2LGX A;  2M8S A;  3APC A;  2PPH A;  4BOZ B;  1M7R A;  2MCN B;  1BAK A;  2D2Q A;  3ODO A;  2D3G A;  3SV1 A;  2MX2 A;  5DPW A;  2DA0 A;  1HE8 A;  3HIZ A;  4W9E A;  3ZW3 A;  5JZE B;  3A9K A;  1WMH B;  3ZDM C;  2N1W A;  2KFK A;  1GG3 A;  4FJV B;  2V76 A;  4HDQ A;  1W1H A;  2D11 A;  2Y7B A;  2AYO B;  1FHX A;  2CHZ A;  2LUE A;  2O2V B;  1WGD A;  4FHK A;  4IG7 B;  1UNR A;  1Q5W B;  5AZH A;  4FBJ B;  2WH5 A;  1ZVR A;  1P9D U;  2P0D A;  3N30 A;  3DXE A;  4RM8 A;  4A3P A;  3VTW A;  4F8C B;  4GB9 A;  2HE7 A;  4IM3 A;  2EJ8 A;  3OJ3 A;  2MBH A;  3U30 A;  3KUZ A;  3PHX B;  2YF0 A;  2IFS A;  3TVV A;  4ZRJ A;  1MKE A;  2KVR A;  4HPL B;  5C5B B;  3NSU A;  2LGY A;  3A9K B;  2FID A;  4KIK B;  3RZW C;  5DIF B;  1LQB A;  2QKM A;  3C0R B;  2DKP A;  1E7U A;  1V88 A;  3BJI A;  4MDK E;  1PFJ A;  2ZEQ A;  2MBE A;  2YRY A;  3L13 A;  3OAN A;  2LVQ A;  4KHA A;  5DH9 B;  4C0A A;  3PGE A;  1MG8 A;  3TO1 A;  4HB2 B;  3MDB C;  3S2A A;  1WXA A;  4DBG A;  5LXH A;  4MGI E;  1P6S A;  5IA7 A;  1U2B A;  2KWC A;  4L6E A;  4IC7 B;  4ZRK A;  2CRF A;  4GSW A;  2IO1 B;  1KOT A;  1SE9 A;  2KDE B;  3V62 A;  2DYO A;  5C5B A;  4FJZ A;  1LXD A;  1WGR A;  2K25 A;  2C7N B;  1K8R B;  3EPY A;  2LRU A;  2J59 M;  4NQK E;  2AL6 A;  4WJN A;  1TQZ A;  3DOW A;  3SYX A;  3K9O B;  1HBK A;  1PLS A;  1ZC4 B;  4NAW B;  2IYD B;  2VRW B;  1UEF A;  1Y5O A;  2MBO A;  1ZC3 B;  1MIZ B;  2KDB A;  2KUP A;  2XK5 B;  4G50 A;  4AP4 C;  2H7D A;  3RUL A;  3KY9 A;  2WYQ A;  2KWV B;  1WR6 E;  3ZVR A;  2BGF A;  3HM3 A;  4IFS A;  2FJ9 A;  2GBK A;  3PLV A;  3PTF C;  4KZC A;  3O65 B;  3D8E A;  2N23 A;  2JF5 A;  2CU1 A;  3DBR I;  1WZ3 A;  4A3O A;  5IJM A;  4BKG A;  1W1G A;  3VTV A;  2LI5 A;  1V61 A;  3PRZ A;  3VH3 B;  1RLF A;  2FDQ A;  2WWZ A;  4ASW C;  1KZG A;  2C5L C;  4GDL B;  3TBL D;  4A6F A;  3V6C B;  4AOF A;  4URK A;  1TXD A;  4LDT B;  2EMT A;  2LXA A;  3D8D A;  5CTR C;  1J19 A;  2LVP A;  3NS8 A;  3NZS A;  1M7E A;  2WDT B;  2MW5 A;  4ICV A;  2KMC A;  2KGX B;  3QQ8 B;  1UH6 A;  3CF6 E;  2R0D A;  5LON B;  2KLG A;  3CXB B;  1WH3 A;  4I6P A;  3H1U A;  4WWO A;  1UPR A;  2IY1 B;  2FCN A;  1WJ6 A;  2DN6 A;  2P8V A;  5HE1 A;  3EFU A;  3GZN I;  5JLJ B;  1EF1 A;  3KYD D;  2VKI A;  3JW0 X;  3ZLZ A;  3A1Q A;  5JHB A;  1EAZ A;  1MPH A;  2LOX A; 
#chains in the Genus database with same CATH topology
 2WXQ A;  3GP7 A;  4DDI D;  4BVU C;  1L4D B;  2INC C;  1WM3 A;  2BS3 B;  3P4P B;  3AEF B;  1N5X A;  1U5E A;  2YVC A;  4JK8 A;  2QMT A;  3Q3O C;  3RCP A;  1ET9 A;  3A1Q B;  4W9G A;  3QCA A;  2DZK A;  3ENE A;  2XQN M;  3W5V B;  3GZN B;  4USA A;  3TUO A;  4KDI C;  3IVF A;  4EUT A;  1WJ4 A;  3AXC A;  2RRF A;  1ZM0 A;  1XF5 L;  1EVH A;  1FGZ A;  3ULC A;  4HAW B;  4FJY A;  3ML4 A;  3ZRC A;  4WAA A;  2ZNV C;  3HK0 A;  5L95 C;  1FXA A;  2AEH A;  1U5F A;  1IRS A;  4QJ5 B;  1YOV B;  4CSQ A;  2ZNV B;  1R4M B;  4MJS A;  3ZRF A;  5EE3 A;  2FBW B;  4BFR A;  4ZYN A;  5DI9 B;  3IFW B;  4K2O A;  2PW9 A;  5D2M B;  2C7M B;  2I5F A;  1D5Z C;  4JK7 A;  2LZ6 A;  2YSZ A;  1YJJ A;  2I38 A;  1KRH A;  4N6E B;  3MHS D;  1P0R A;  2D4Q A;  2PVO D;  1QQG A;  1JWS D;  4K81 A;  5CHV C;  1C1Y B;  5MPO A;  2I2Y A;  4B95 A;  3BWU D;  1P1A A;  5C23 A;  2D9Y A;  4WJ7 A;  3RN9 C;  2NZ8 B;  4BKS A;  3G9W A;  3EHV A;  1OEY A;  2PE9 A;  3UQB A;  4CQN A;  4HHV A;  4MH0 E;  4YT0 B;  2FCS A;  2LGD A;  3AE3 B;  5DPS A;  4M8M A;  2YT0 A;  3QHT A;  3RI7 C;  1XEE A;  2JZZ A;  1EWY C;  2LBB A;  2DAJ A;  1V6E A;  3QAQ A;  3D32 A;  2D07 B;  4F7U P;  2MLB A;  4QXA B;  1BTK A;  1NYQ A;  3MTN B;  3UF8 A;  1MHH E;  4S17 A;  1BUI C;  2KC1 A;  1WXS A;  5LLI A;  1UBQ A;  5AUK A;  2DHI A;  2HTH B;  2YT2 A;  1FAO A;  3KRX A;  3U7Z A;  1TKE A;  1GNU A;  2MJ3 A;  3N1Y C;  4MY6 A;  4P1B C;  4KGS A;  2NTS A;  2RGN B;  1XD4 A;  2K0P A;  4YSZ B;  1QOB A;  4B6H A;  3ULB A;  2BKR B;  4ZOH C;  3I5J C;  4C4V B;  2O6V D;  3Q8A A;  1YJI A;  3MC8 A;  1FEH A;  2DHZ A;  3F0W A;  4LNF A;  3JYU A;  2PJH A;  3FP5 A;  4LTU A;  1GC7 A;  1SJE D;  2MRP A;  4QAY A;  1NEN B;  3X23 A;  3W1S A;  2FJL A;  3TW1 A;  4I6L B;  4JPS A;  4LDT D;  3PVW A;  4KHB B;  3KWV A;  3KWL A;  1C78 A;  3UIP B;  1T6B X;  3P6A A;  4BBN C;  2RPQ A;  2N0Y A;  4GIV A;  3JSV B;  2ACZ B;  2PLP A;  3FC4 A;  1WZ0 A;  1JAL A;  1BXT A;  2GBM A;  2K2J A;  3VRB B;  4B6W A;  2FCQ A;  2WXG A;  3LYY A;  4XC2 A;  3AJ4 A;  1WJU A;  3EC8 A;  4XX5 A;  5J3Y A;  2V0G A;  4HXD A;  1FHW A;  2RSG A;  2K8E A;  2YS3 A;  1OY2 A;  1TYG B;  3TL5 A;  3W5U B;  2B3A A;  4KDL B;  3ZXR A;  2ZPN A;  2ZW1 A;  4BKT A;  4M8N A;  3OHM B;  2NS5 A;  4IAP A;  1WWT A;  1C77 A;  4HK2 A;  4M00 A;  2YEP B;  3MJ5 A;  2QKL A;  3ZUN A;  2LHD A;  3ZJV A;  2DFK A;  4RGN A;  2G4D B;  1WJM A;  4A6H A;  3TMP B;  3SBT A;  3FLV A;  4QJ4 B;  2N9E B;  2W82 A;  1X05 A;  1WGY A;  2A5U A;  4EZL A;  3VFK A;  2LD9 A;  2YS1 A;  2L0F A;  4BZA A;  4GU2 A;  1NYR A;  1DDW A;  1D6E C;  3KUC B;  1XCT L;  4KKJ A;  2KCJ A;  5HKH A;  4PS8 A;  4HAT B;  1DYQ A;  3SFE B;  2D9Z A;  1N5W A;  4DXA B;  2WXO A;  1SB3 C;  3BVG A;  4ZHO A;  1NVL A;  3ODW A;  2COF A;  2BYE A;  4G0N B;  4K7S A;  4GPT B;  3IHP C;  1N3H A;  1V81 A;  1IP9 A;  2PKO A;  1I4X A;  2NR2 A;  2XEW A;  2K8C A;  3ONS A;  3H7P B;  3AUL A;  4PS3 A;  1YNT E;  4K7U A;  2KAN A;  3L0W B;  1J0W A;  2BF8 B;  3ECI A;  1U5G A;  2CY5 A;  4W9C A;  4KGT A;  3DHH C;  2CKH B;  2IPK D;  4JKC A;  4I6N B;  3DQV A;  1E8Y A;  2LWP A;  4IKG A;  3ML8 A;  2Z0O A;  4CHK A;  1WRD B;  3ZIM A;  4PNK A;  3IAM 1;  1WI0 A;  4JKG A;  2XBB C;  5AEK B;  1FCL A;  2BWE S;  1SE4 A;  1UBI A;  2CU3 A;  1WFY A;  3JSV A;  2VZK D;  2XNA C;  3PP2 A;  1AAR A;  1UGJ A;  1OQN A;  2K00 A;  3PVU A;  3BK1 A;  4EOY A;  4C00 A;  2NVU I;  1TBE A;  2D9W A;  3VAW A;  4DDG D;  4JX1 C;  5HE2 A;  2KNB A;  2OJR A;  5KQ4 A;  1VBG A;  2L76 A;  2DWQ A;  2ELA A;  1U4A A;  3TCA A;  3L54 A;  3AH7 A;  2PE6 B;  1TJ6 A;  2DZJ A;  2FJU B;  1EF5 A;  2RNR B;  1TS4 A;  1GPX A;  3R8B A;  1DOI A;  3URY A;  2BVC A;  4R3D A;  3N7C A;  4WWP A;  1ZYI A;  1N60 A;  2JZP A;  2NPT B;  5LXI B;  1E90 A;  2IO3 B;  4HRO A;  4MGY E;  2I5C A;  2KX3 A;  1YMH E;  2Z0Q A;  3B08 A;  2L0T A;  1UNS A;  3DCG A;  3DWM A;  4CHM A;  2D3B A;  4NAM A;  3ZO5 B;  4MM3 A;  4HLE A;  3Q3F A;  5I2S A;  1RRP B;  1OQQ A;  2LEK A;  2GRI A;  4FN2 A;  1MHX A;  5L83 A;  1C3T A;  2JXX A;  2MKR A;  2OQB A;  1U5D A;  1CMX B;  2V3P A;  3LXF A;  4AS1 A;  1KLG D;  1PMS A;  1NU2 A;  2L05 A;  2LRW A;  2ZVN A;  1M94 A;  2Z0E B;  4OHJ A;  2M8S A;  2J42 A;  3APC A;  2PPH A;  4BOZ B;  2D2Q A;  3ODO A;  1E9M A;  4RGT A;  2WXF A;  1MI0 A;  1UWM A;  3A9K A;  1WMH B;  2WXM A;  4OZA A;  1FM0 D;  5TSS A;  2ZW0 A;  3HUI A;  5H8Y E;  1ESF A;  1N62 A;  3B2G A;  1P9D U;  3N30 A;  3P63 A;  1IGC A;  4GB9 A;  2HE7 A;  4IM3 A;  2MBH A;  2BB6 A;  1YN5 A;  2YF0 A;  4HPL B;  4KIK B;  1JRO A;  2DKP A;  1E7U A;  3BJI A;  5HG2 A;  2KUQ A;  2LVQ A;  5DH9 B;  4C0A A;  3PGE A;  3TO1 A;  3S2A A;  1DIK A;  4DBG A;  4ZRK A;  3B9J A;  1SE9 A;  2DYO A;  4FJZ A;  1EU3 A;  4L2Y A;  2C7N B;  1HZ5 A;  1JWA D;  3Q69 A;  3DOW A;  2W55 A;  1IUE A;  4US8 A;  1AYF A;  2LFI A;  1ZC4 B;  2VRW B;  3MC0 B;  2M19 A;  1ZC3 B;  1MIZ B;  2KUP A;  2RDB C;  2H7D A;  2JQR B;  2N0S B;  1PGB A;  2WDQ B;  2H89 B;  1ZE3 D;  1CJE A;  2KQ4 X;  2W3R A;  2FJ9 A;  1QKZ A;  3D8E A;  2N23 A;  2JF5 A;  3N20 C;  5IJM A;  3VR9 B;  4ILJ A;  2WWZ A;  1UUP A;  4GDL B;  1DOY A;  4LDT B;  3P42 A;  3QQ8 B;  4BAX A;  1SBB B;  2KLG A;  4I6P A;  1UPR A;  1XCQ L;  1TKG A;  1EF1 A;  3JW0 X;  1UZX B;  1AW7 A;  5E6N A;  3VXW A;  5BYS A;  4Q2J A;  2J53 A;  3DHI C;  1DDM A;  2L00 B;  3ZKJ C;  2M14 A;  4K2P A;  2K39 A;  1P7F A;  1GC6 A;  1YQ3 B;  2KVZ A;  3CST A;  3IAS 1;  1ZUD 2;  3C19 A;  2G3Q B;  4UDU C;  3TEZ A;  1V5O A;  3WAO A;  5HE0 A;  1BT0 A;  3HQC A;  3I9V 1;  4NZL B;  2DLW A;  4JLC A;  1GAQ B;  1KLU D;  4NJ6 A;  1XXG A;  4BOS C;  2KXJ A;  3ML9 A;  4DHJ D;  3PEG A;  2KAJ A;  4DHJ B;  2IJ0 A;  3PRM B;  3O13 A;  2VSZ A;  1B1Z A;  3LB8 C;  5KHO A;  3T8M A;  4O1N A;  1T5X D;  1TJE A;  2X18 A;  1VZ6 A;  5C1Z A;  1T0Q C;  1QZE A;  1Z87 A;  3ZNZ B;  1V86 A;  4RCO A;  2K6D B;  1WGU A;  1E0Z A;  3RT3 B;  2NBU A;  3FIL A;  2Z4D A;  2I1J A;  2KDM A;  3H6N A;  2L3Z A;  2DHK A;  4MSQ B;  4HAZ B;  1WI1 A;  3P4Q B;  3VUY A;  1Q0W B;  1UGM A;  4TQ0 A;  1K53 A;  1XKE A;  4HWI B;  3KSY A;  3B2F A;  3HVZ A;  4XZ4 A;  1UNP A;  2DHJ A;  4ZRP A;  3T06 A;  3I57 A;  2LVO A;  1WGG A;  3AE7 B;  1TT5 B;  1WX7 A;  4XYC A;  2Y3A A;  4RMA A;  2WXJ A;  2K5P A;  2WXH A;  2HTM E;  5BYR A;  2KTF A;  1ZOY B;  5FK9 C;  4ARI A;  5TR5 A;  1TZO A;  4D0N B;  2DX5 A;  4FA6 A;  2JXT A;  2V1Y A;  1QQR A;  2QSD A;  3A98 B;  3AN1 A;  4NNJ B;  2L8J A;  2REX A;  1SXT A;  1QIL A;  1OFF A;  3IBE A;  4AJY B;  1FNU A;  3AE6 B;  3EEC A;  4MT7 A;  2G45 B;  4F7Z A;  4II2 B;  3CWI A;  1WXV A;  1LGR A;  1JW9 D;  3AED B;  4FAD A;  1W1D A;  3H9D A;  1FHO A;  2W54 A;  4ZYS A;  4NJ7 A;  3Q3N C;  1FRD A;  1TKY A;  2RDH A;  5JH5 C;  2GBJ A;  3NUH B;  4ITK A;  2Q5W D;  4HCP B;  5D3I B;  2CJN A;  1RAX A;  4NQL B;  5LNK 1;  2GOW A;  4HSI A;  2TSS A;  2NBV B;  2D3A A;  4GDL A;  2KFJ A;  1UF0 A;  5BO4 B;  2WXR A;  2AWT A;  2EKE C;  2WX1 A;  3H7S A;  5CHW A;  2CQU A;  3O96 A;  2WXK A;  5JHG A;  5EFX A;  4AJW A;  3A58 A;  4CYE A;  3V6E B;  3QX1 A;  4JKG B;  4KZ0 A;  5D3D A;  1SGH A;  4GOC A;  1UPQ A;  4ACF A;  5DHF B;  1KJT A;  2DTC A;  4MT5 A;  1TTN A;  2GI9 A;  4ILG B;  5LOP B;  2FAZ A;  4PYU A;  3L17 A;  3N3K B;  5HFY A;  1L2N A;  3HRD D;  1NI2 A;  2K49 A;  3PHW B;  3R66 C;  3M3J A;  5D27 A;  2YT1 A;  3M95 A;  4HAX B;  1J7B A;  2BS2 B;  3DVG Y;  4A20 A;  4HKQ A;  3KRW A;  4J3O D;  2N7D A;  3A9J B;  1B55 A;  4IUM B;  3UQA A;  5JHA A;  5JVL A;  3P4S B;  2BBC A;  4C80 A;  3FSS A;  1UWX A;  1EO6 A;  2C7H A;  2L32 A;  2COC A;  2R09 A;  3RZF A;  2PMV A;  5HE3 A;  1VRA B;  1SEB D;  2D10 A;  2FCM A;  3QC8 B;  1XOD A;  3VDZ A;  2GS0 A;  3LJ3 A;  2JWZ A;  1C9F A;  4MH8 A;  1MK7 B;  2IO0 B;  4DHZ B;  3VUW A;  2YS5 A;  2KTR A;  1MPE A;  1C4C A;  3ZDT A;  2WXN A;  1J7A A;  4HCN B;  4LJP B;  3VUX A;  2IND C;  2ICI A;  1J0G A;  4HAV B;  2KD0 A;  5GMV A;  3VTW A;  4FBJ B;  3F5R A;  2KDF B;  2N7J A;  4F7H A;  2WU2 B;  3E9O A;  2D9X A;  3H7P A;  4B0M A;  4A6Q A;  1V2Y A;  1WXM A;  3RNE C;  4X57 B;  2DNF A;  2KJH B;  3MP9 A;  3E9S A;  1ZGU B;  5DCN A;  2R82 A;  2WGS A;  2KYW A;  5BMI A;  3UGB B;  3KVF B;  3IXS A;  3Q8E A;  5FR6 A;  2DX5 B;  4DBB A;  1D5M C;  5KCV A;  1E6E B;  2M38 A;  4G3X B;  1QF6 A;  2BCJ A;  3FVC A;  1Z5S B;  4B9K A;  2KO3 A;  3MC9 A;  4ZRI A;  1WG7 A;  3PPA A;  2WDR B;  1C76 A;  3WAN A;  3DWG C;  2Y8F A;  1SSN A;  2MBQ A;  1NTI A;  2CR5 A;  1F2R C;  4A90 A;  1MVK A;  2V4L A;  1KZ7 A;  1PGX A;  1V49 A;  3DBH I;  4JKF A;  3Q8C A;  4KHO A;  3QJZ A;  2ELB A;  4LK0 M;  4FHJ A;  2JVC A;  3ZNI D;  1E10 A;  2LUL A;  2BQQ A;  2CS4 A;  4MAC A;  1BWN A;  3TSS A;  2KC2 A;  3SEB A;  2EEL A;  4DXG A;  2ROZ B;  2RPV A;  3HW2 B;  5JHH A;  3AMZ A;  4KZC A;  3LJU X;  2RLO A;  1NBF C;  1HXY D;  3RCZ A;  1DOX A;  5HI1 A;  2NPT A;  1ET6 A;  4TYZ A;  1U27 A;  3ZVV A;  1WVH A;  3RYT A;  2OTX A;  2SAK A;  4JIO U;  5G2N A;  4KHB A;  4TMA B;  3IT6 B;  1B9R A;  3NWF A;  1C4P A;  3A9J A;  4L1R A;  1AQC A;  3NWD A;  4YTM B;  2JX5 A;  4YON A;  5EE0 A;  2LJI A;  2I1K A;  2EC1 A;  2N1V A;  1V5T A;  2CHW A;  1C4A A;  3FEH A;  1GUA B;  2ZJD A;  4WUR A;  1T0S C;  4RGO S;  3Q8F A;  4JKH A;  1RFK A;  3KYC D;  1GJZ A;  4MSM B;  3ZNH B;  1CQV A;  2WQY B;  1JQ4 A;  5DPT A;  2JPH A;  2O6V B;  3NHE B;  5IP4 D;  2KTR B;  3L16 A;  1GB4 A;  2J0M A;  1H8C A;  3VIA A;  4OZB A;  2KMM A;  3PLU A;  3SNH A;  2N9L A;  1P3R A;  3AE5 B;  1PUT A;  4IW0 A;  2LOZ A;  2KJR A;  4NPN A;  3UIO B;  2QIE B;  2QDF A;  2W9N A;  2R2Q A;  3QA8 A;  1TY0 A;  4AUQ C;  2IDY A;  2LGX A;  4PT5 A;  1M7R A;  2D3G A;  5DPW A;  2X0S A;  4M0W A;  2DA0 A;  4LNK A;  4W9E A;  1JWM D;  2N1W A;  2KFK A;  1W1H A;  2AYO B;  3OWE B;  2WH5 A;  4A3P A;  2P0D A;  4RM8 A;  1XLN A;  2K3U A;  3AEA B;  2IFS A;  1E7P B;  2BYT A;  3AM9 A;  4ZRJ A;  3UI3 A;  3NSU A;  2G9H D;  3HIE A;  1LQB A;  1V88 A;  3MHZ A;  2ZEQ A;  3OAN A;  4KHA A;  2INN E;  2WLB A;  1JRP A;  4JKA A;  1P6S A;  2KT7 A;  2CRF A;  2DBY A;  2WU5 B;  2VH1 A;  3AEB B;  3V62 A;  3AE4 B;  3NS1 A;  5C5B A;  4A55 A;  4LLG M;  2RDG A;  1SF0 A;  2LRU A;  2AL6 A;  3SYX A;  3E9P A;  3K9O B;  2IYD B;  1UEF A;  1N6Z A;  1QOF A;  2MBO A;  1WYG A;  4G50 A;  1XLO A;  3IT4 B;  4XGA B;  3NVV A;  2WYQ A;  1T0R C;  4ZHP A;  2JYT A;  3E66 A;  4GOU A;  3KQ4 A;  1WZ3 A;  4BKG A;  1W1G A;  2Z14 A;  1F52 A;  1BML C;  4C7Z A;  1RLF A;  1QT9 A;  4ASW C;  2C5L C;  3L4P A;  3V6C B;  4A6F A;  1TXD A;  2KWD A;  1L6V A;  3NS8 A;  1MJD A;  1M7E A;  2WDT B;  2MW5 A;  2KMC A;  3CF6 E;  5LON B;  3H1U A;  4XWT A;  2IY1 B;  2FCN A;  1WJ6 A;  2DN6 A;  2P8V A;  5HE1 A;  5JLJ B;  3KYD D;  1SIJ A;  3A1Q A;  1SE3 A;  2LOX A;  4E3C A;  1LO5 D;  2Z0P A;  4DK5 A;  1EUV B;  1L4Z B;  4WH4 A;  3PSE B;  4HJK A;  5CLQ B;  1WIA A;  1I2H A;  2KK8 A;  3AEG B;  2HD5 B;  2DEN B;  2W2X C;  3GE3 C;  3ZJT A;  1WE7 A;  4WJP A;  1AN8 A;  1VLB A;  1LFD A;  4JK9 A;  2AL3 A;  1C79 A;  1IYF A;  2VZK B;  1XCG A;  4H8S A;  2OOB B;  1X86 A;  4K1R B;  2N4F A;  4KKI A;  1GGO A;  3WA0 A;  2WP9 B;  2KFK B;  3OAW A;  3PZD A;  1HTO A;  3NVY A;  1Y19 B;  2O2V A;  2D9V A;  1TS2 A;  4JL9 A;  2MQJ A;  5FI1 A;  3GYP A;  1E8X A;  3B1L X;  4OW0 A;  1NEK B;  1WRI A;  2CAY A;  2FUG 1;  2KAC A;  2MP2 B;  4HJG E;  2MEK A;  4L1B A;  3DXC A;  1EU4 A;  2QC8 A;  2DYM A;  3UZT A;  4MK0 A;  1K50 A;  4WAF A;  1OGW A;  4TV3 A;  3OG5 A;  2DKQ A;  2WXL A;  2HDE A;  2IBI B;  2JU6 X;  4WIP A;  1MG4 A;  3D8F A;  3TEY A;  2RVB B;  4JKD A;  4GMV A;  3M1I B;  2N9P C;  5KHQ A;  1L6U A;  1Y8R C;  3A4R A;  4W9K A;  2J4X A;  4OZC A;  1ACC A;  5E6J A;  2ZVO A;  4W9F A;  1K5G B;  3T9L A;  4LCD E;  1V5U A;  2JUO A;  1OMW A;  4RNA A;  3DCX A;  2M17 A;  5BMG A;  2GCL A;  1X1G A;  2GCJ A;  1XD3 B;  2PTL A;  4FLH A;  2WX0 A;  3U52 E;  4EMO A;  3R7Q A;  2KDI A;  3NRZ A;  3ETR A;  5I4D A;  2J52 A;  4IOI E;  1RYJ A;  2X8X X;  3CSF A;  3GB1 A;  3ZTD A;  3SD5 A;  2GUM A;  3U12 A;  1HB8 A;  1WXQ A;  4XE0 A;  1WMH A;  4GZU A;  2KR0 A;  4YL8 A;  3A33 B;  3HM6 X;  1IBX B;  2C60 A;  1T0Y A;  2MWS B;  3P2B A;  2UU7 A;  4XWX A;  2K22 A;  2K8H A;  2P0F A;  1P3Q U;  2DX1 A;  1L5P A;  3PVL A;  3GOE A;  1E8Z A;  1GOZ A;  1YX5 B;  4MGZ E;  4RF1 A;  4TKN A;  2AQ2 B;  2LUM A;  4WSF A;  1V9J A;  2OED A;  2R2O A;  5IOI A;  3E9L A;  1OTR B;  1I7H A;  2KQS A;  3NZ3 A;  4PS7 A;  4A6F B;  3AI5 A;  4P1C C;  1K5D B;  4EEW A;  2LAS A;  2M4N A;  3ODX A;  4MM3 B;  5HHD G;  2Q13 A;  1I4P A;  4HB4 B;  1Q1O A;  4JGH B;  1KI1 B;  2MJD A;  5AZF A;  4RFB A;  3VH4 B;  1S1Q B;  4GN1 A;  3HHM A;  4MEM A;  2CY4 A;  4DIX A;  4LNI A;  1DDV A;  2KN5 A;  1VJK A;  3V61 A;  2BTE A;  4YWG G;  2PEA A;  2Z8L A;  4N58 A;  3QK0 A;  4D6W A;  4K7W A;  2HJ1 A;  3DPD A;  3NY5 A;  3NOB A;  2J7Q B;  3M63 B;  1MAI A;  5E6O A;  1F1H A;  1PQS A;  3SHQ A;  4YTN B;  3SDL C;  2RUK B;  1ACA A;  3FM8 C;  4WJO A;  3Q3J A;  4GDK A;  4K17 A;  2LKO A;  5D3W A;  1FB8 A;  1IPG A;  2L7R A;  5DHA B;  3BYT B;  2IYB A;  2JT4 B;  3DHG C;  4K3C A;  5JP4 A;  5C16 A;  3U4E G;  4PK1 A;  5J2R A;  4IDI A;  2Y5B B;  2L1C A;  1TIF A;  4W9H A;  1WF9 A;  4II3 B;  1JML A;  3MFG A;  1ZDV A;  1WJ1 A;  3AU5 A;  2BYF A;  1WYW B;  1L0X B;  4W9I A;  4M01 A;  4N59 A;  2UWQ A;  1R4N I;  3R7R A;  2ZPY A;  2P0H A;  1JCK B;  3MPX A;  2QEJ C;  4Z2M B;  3R2I A;  1OQY A;  1N61 A;  1FXT B;  1OEY J;  2D3C A;  3BIN A;  3TFM A;  5IRS A;  4TQ1 A;  3FAH A;  3SO6 A;  4AWJ A;  2GJY A;  3M62 B;  2PZ1 A;  4EZJ A;  1FFV A;  1YQB A;  5G5G A;  3CIK A;  3GYO A;  4J6I A;  3PT2 B;  5CHF A;  4LNO A;  4GGQ A;  1XLP A;  4YSY B;  1WSP A;  2G1E A;  5D6J B;  2R61 A;  4KV2 A;  1I35 A;  3W1S C;  3ZGZ A;  5EE1 A;  1KTK A;  3MJW A;  4ANU A;  3ALB A;  2Z59 A;  1R4M I;  1V5M A;  1WGK A;  2RD0 A;  3QIJ A;  2CHX A;  4HAY B;  4ANX A;  3B77 A;  4LJO B;  2RQ1 A;  2ONQ A;  3SBG A;  4REZ A;  2GBR A;  5T8I A;  3PG7 A;  1F9J A;  3A4S C;  3DDC B;  3AEE B;  1DGJ A;  2E2X A;  5G55 A;  4JKB A;  3ZLZ A;  1NTY A;  3DBH B;  5GOW B;  3DBL I;  1X11 A;  2G35 A;  4YXD B;  1RM6 C;  4NJC A;  1NDD A;  3AE2 B;  2BW2 A;  5D3Y A;  2HRJ A;  2GLS A;  3DVN V;  1Z2M A;  2DZM A;  2N7E A;  4ZDV A;  4MGK E;  3NWA A;  1N63 A;  1H10 A;  1V1P A;  1I4G A;  1VD2 A;  2QIL A;  1NTV A;  3RFZ B;  4A8X C;  5LG4 B;  4DX8 A;  1HEZ E;  2V9H A;  3SFD B;  2B76 B;  4BBK A;  2LXC A;  5J3T A;  1SHC A;  3OJ4 B;  3PZ8 A;  1KF6 B;  5IAA C;  1G6J A;  2L1A A;  4FUL A;  2ASQ A;  3RNA C;  4B0E A;  3A8P A;  2MA9 B;  4GDK B;  1T3Q A;  3U8Z A;  2MBB B;  3RPF C;  3BVZ A;  4W9J A;  3DVG X;  5D94 A;  1RWS A;  3AU4 A;  2XN9 C;  2H88 B;  2N9X A;  4EFO A;  2IY0 B;  4PQ0 A;  3JVZ X;  2FIF A;  4XDD A;  5FI0 A;  1Q67 A;  4A5K A;  1KC7 A;  2KIG A;  2KMA A;  4C4V A;  3PV1 A;  1JRU A;  3I63 C;  4LNN A;  3AV8 A;  4K3B A;  2BWF A;  4F1S A;  2DAF A;  2LYD A;  2L52 A;  4QJ3 B;  2OHF A;  4OVU A;  2QHO A;  3HVD A;  4EJN A;  4PYZ A;  1I4R A;  3PRE A;  3KLS X;  2JYE A;  2KN4 A;  2MCN B;  3SV1 A;  2MX2 A;  3BII D;  2GB1 A;  3ZDM C;  3ZW3 A;  2D11 A;  2Y7B A;  1TS3 A;  1FHX A;  2O2V B;  2LUE A;  4FHK A;  1UNR A;  5AZH A;  4F8C B;  3DXE A;  1ROE A;  5BMH A;  1JWB D;  3U30 A;  3PHX B;  5C3J B;  3TVV A;  3N1X C;  4L23 A;  3H8H A;  1I4Q A;  1F2R I;  5C2T B;  5C5B B;  2LGY A;  5FKA C;  5DIF B;  2QKM A;  3C0R B;  4MDK E;  1PFJ A;  3AB5 A;  1QOA A;  1TS5 A;  2YRY A;  3E56 A;  2BB5 A;  2WDV B;  1U2B A;  3GE8 C;  2KWC A;  4IC7 B;  1V1P B;  3CIR B;  1LXD A;  1WGR A;  1CZP A;  2K25 A;  2Z13 A;  2J59 M;  2Y5C A;  4WJN A;  2QCZ A;  1HBK A;  1PLS A;  1SJH D;  4GLS C;  4YTP B;  1MI1 A;  1F77 A;  2KDB A;  2XK5 B;  3RUL A;  3NJT A;  5I2M A;  1OQR A;  1V1O A;  2KWV B;  1WR6 E;  2Y5P A;  2BGF A;  3HM3 A;  1VR9 A;  3PTF C;  3PLV A;  1P7E A;  4JWS C;  1FD6 A;  3VTV A;  2FDQ A;  2OJW A;  1KZG A;  4HRS A;  1YN4 A;  3TBL D;  4AOF A;  4URK A;  5JXV A;  2LXA A;  5CTR C;  1J19 A;  1VZ8 A;  3NZS A;  4ICV A;  1UH6 A;  4WWO A;  3CXB B;  1WH3 A;  1R4N B;  1FPY A;  2VKI A;  5JHB A;  1MPH A;  5EDS A;  2G4S A;  4KSK C;  2K2U A;  1WY8 A;  3VOQ A;  3PZ7 A;  3HSA A;  2W2W A;  4HDO A;  3NG0 A;  2IO2 B;  2KJ6 A;  4Z2N A;  2W3S A;  1YJ1 A;  4ARC A;  1I7A A;  4N9F 4;  2H7E A;  2L2I A;  1WM2 A;  2WS3 B;  2COA A;  2KZR A;  2N9K A;  4IWO A;  4W9L A;  2KKC A;  4FXC A;  5AZG A;  1DYN A;  4ANV A;  4HPM B;  2E6X A;  1X1M A;  2MSE D;  3SU8 X;  1WR1 A;  5C79 A;  3R3M A;  2WXP A;  3AE8 B;  1JWU D;  3ZXV A;  2ZZP B;  4E74 A;  3FIL B;  2WXI A;  1FO4 A;  2JRI B;  3X0W A;  5KQ1 A;  3DBR B;  1ISN A;  1RJ2 A;  2DLB A;  1VCB A;  4P7I A;  3RNC C;  1ZXH A;  3RNF C;  2Z0D B;  4OVZ A;  1F0Z A;  1QC6 A;  3I3T B;  1GB1 A;  3N9Y C;  2ZCC A;  3KUD B;  4DX9 0;  4BBN F;  2K1F A;  4KX6 B;  3EUB 2;  4WQO B;  3TEX A;  5C6R A;  3LDZ E;  4IM0 A;  4IM2 A;  2NCN A;  4MJS B;  2PVG C;  3SR6 A;  2MH7 A;  1WGH A;  1D4B A;  1V89 A;  4C7Y A;  4ANW A;  4M02 A;  4EE2 A;  1ZDX A;  1H4R A;  4OVV A;  2AQ1 B;  3NVW A;  3UIN B;  2Y8G A;  4HKZ E;  1UD7 A;  2JY6 A;  1XT9 B;  1KFY B;  2V3S A;  1KH0 A;  2MDX A;  4HVB A;  1EM7 A;  5EE9 A;  3SUZ A;  3CMM B;  1NVI D;  3DVN U;  1SIF A;  2KWU B;  1FFU A;  2JRH A;  3P1M A;  1E5W A;  3RNB C;  3DBS A;  2NTT A;  4E71 A;  3K9P B;  4M0W B;  3EGR A;  1FRR A;  3QWM A;  2WHI A;  3RUI B;  2K9X A;  1XR0 B;  3DXD A;  3ZYY X;  2KHW B;  4G11 A;  2LGI A;  4DHZ E;  1WX8 A;  2LG1 A;  3V5W A;  1E8W A;  2C9W B;  2DYN A;  1VZ7 A;  1YQ4 B;  2A4Z A;  1PFD A;  2KLC A;  3EFC A;  2FNJ B;  3WAP A;  2ADZ A;  2DYQ A;  2GMI C;  4KIK A;  1IGD A;  3AE1 B;  1SE2 A;  2ZKM X;  1PGA A;  2CJO A;  1NI3 A;  1RFA A;  3N1Z C;  3Q3M C;  1EGX A;  4IWP A;  3VTU A;  3VQI A;  4CHJ A;  3PO0 A;  1J8C A;  1UNQ A;  3ENB A;  4JWU C;  4YSX B;  4NY0 A;  4KGR A;  2CB8 A;  2FUH B;  3BZD B;  2EKI A;  3ZNG C;  2ZCB A;  2VRR B;  4H2A A;  5M4Y B;  3W9C B;  3QBV B;  4Y94 A;  2RSU A;  1HB6 A;  1I4H A;  2D5G A;  2JSV X;  1X1F A;  1FMA D;  1RRB A;  1YD8 U;  4XDC A;  2LHE A;  1FGY A;  1HZ6 A;  3WAL A;  4XWW A;  2DZI A;  1QLB B;  5D3X A;  4P6V F;  1E7V A;  3Q6B A;  4RH6 A;  1XQQ A;  3T3O A;  3AE9 B;  1TZ1 A;  3RMK C;  1VDV A;  5G5H A;  3VR8 B;  1U29 A;  1ZP0 B;  4ILH A;  3W2D A;  2JZ3 B;  2E3T A;  4DXF A;  3C8Y A;  3VHT C;  3A8Q A;  3R2T A;  4HPP A;  3V05 A;  4JKE A;  2L83 A;  1YN3 A;  1WE6 A;  1ST7 A;  1FIQ A;  3NW8 A;  5AUI A;  2COP A;  1AWE A;  2INP E;  2COD A;  2RR9 A;  1YIW A;  3KW5 B;  4WWN A;  1D3Z A;  1HTQ A;  1MK9 B;  1V8C A;  1ZW7 A;  5DPR A;  1KBL A;  1S3S G;  3QAR A;  2K6Q A;  1LW3 A;  4JE3 B;  2DIK A;  2MFQ A;  4HB3 B;  4US9 A;  4C56 C;  4S0R A;  2JP2 A;  2MJE A;  3EA6 A;  1UEL A;  4EZK A;  2DYB A;  2HTH A;  4GXB A;  2M56 B;  4AQ7 A;  3NVZ A;  2Z59 B;  3QWZ B;  1FNW A;  2UZR A;  4OT1 A;  2BYV E;  4NSW A;  1V5P A;  3BY4 B;  1L7Y A;  1BTN A;  5IN7 A;  2AQ3 B;  3Q14 C;  3OLM D;  2EMS A;  2NMB A;  4KAX B;  4IWQ A;  2UYZ B;  2BS4 B;  2X38 A;  2LJ5 A;  1D5X C;  3RD2 A;  4RM9 A;  2MP2 A;  4TSS A;  1ZKH A;  4W9D A;  1XX0 A;  2SEB D;  5J3Q A;  2ABD A;  2UVM A;  4ZRQ A;  4A6K A;  4KSL C;  2ON8 A;  5CLL B;  1I42 A;  2BKF A;  3V60 A;  2M0A A;  3PSC A;  1TY2 A;  3BVM A;  4F7G A;  2IGD A;  5D7G A;  1WGQ A;  1V97 A;  4TUU A;  5LXH A;  5E6P A;  1LB1 A;  1CK1 A;  3TIX A;  1KLV A;  1Y56 A;  1XLQ A;  3NZU A;  4DQO C;  1DRO A;  2BPS A;  1A5R A;  2GBN A;  3KZ1 A;  3PRP B;  2HJ8 A;  2JWU A;  4HAU B;  2LMC A;  3ZTC A;  5GXG B;  2YLM A;  3DBL B;  2RGF A;  1HA5 A;  4KVG B;  4D2K A;  2NBW B;  2M1M A;  2KQ7 A;  3BYY B;  3Q8B A;  1J7C A;  3N32 A;  1LM8 B;  4GMX B;  5D3V A;  4NAW A;  2V4I B;  1P5T A;  2M0X A;  1PYW D;  2XK5 A;  3L10 B;  1P98 A;  1FCC C;  1FOE A;  3APD A;  2ROV A;  1DBH A;  4RGM A;  4ICU A;  3L08 A;  3U7D A;  2MWN B;  3B0A A;  1KM7 A;  3APF A;  4CO7 A;  1FNV A;  3W1Y A;  5CX3 A;  4BKS D;  1Q10 A;  1WJN A;  4WVF B;  2KX0 A;  2UZS A;  2K8B A;  1XO3 A;  4MEL A;  2O6V A;  1PDX A;  1MIX A;  2MHJ A;  4WWM A;  4HB0 B;  4JQW C;  2J0K A;  1ZSQ A;  3ZQ4 A;  2WNM A;  3VVW B;  1ZXI A;  2NBV A;  4HEA 1;  1WX9 A;  2R2Y A;  2J0J A;  2YEP F;  3BK2 A;  2KOX A;  3WIM A;  2W2X D;  5IKC M;  3WYF B;  3IG3 A;  1JDE A;  3T3N A;  3P4R B;  1A70 A;  5J18 A;  1MFW A;  1V80 A;  3V3X A;  4WJQ A;  3TJP A;  1ENF A;  4DWF A;  2IZV B;  1TGZ B;  1YX6 B;  5J17 A;  2AX5 A;  4EKU A;  3P7Z A;  3KH0 A;  2FE8 A;  5L81 A;  3PS6 A;  3WAM A;  4IOY X;  3WCQ A;  3RNG C;  2QJL A;  1R7S A;  1BAK A;  3U2S C;  1HE8 A;  3HIZ A;  5JZE B;  4A9A A;  1GG3 A;  4FJV B;  1EWC A;  2V76 A;  4HDQ A;  3AEC B;  2CHZ A;  4IG7 B;  1L0Y B;  1WGD A;  1Q5W B;  1ZVR A;  1IBX A;  1ZPS A;  2EJ8 A;  3OJ3 A;  1FXI A;  1L0V B;  3KUZ A;  3FKY A;  1MKE A;  2IGG A;  2KVR A;  3A9K B;  3RZW C;  2FID A;  2RMM A;  2MBE A;  4GNK B;  3L13 A;  1MG8 A;  4RF0 A;  4OSN A;  4HB2 B;  3MDB C;  1WXA A;  4MGI E;  2PIA A;  5IA7 A;  4L6E A;  5H92 C;  1KOT A;  2VH2 A;  2IO1 B;  1K51 A;  4GSW A;  2V3N A;  2KDE B;  1AWD A;  1K8R B;  3EPY A;  4NQK E;  1TQZ A;  2KIE A;  4NAW B;  3TEW A;  2IGH A;  1K52 A;  1Y5O A;  5FR3 A;  5IO9 A;  4AP4 C;  3Q2A C;  2NMQ A;  1M4V A;  3KY9 A;  1HQR D;  4WQM A;  1T77 A;  3ZVR A;  4IFS A;  2GBK A;  3VRA B;  3O65 B;  3DBR I;  2CU1 A;  1QOG A;  4A3O A;  1VBH A;  3J9C A;  2LI5 A;  1V61 A;  3PRZ A;  3VH3 B;  2EMT A;  3D8D A;  2BT6 A;  2LVP A;  2LGS A;  2KGX B;  3GS2 A;  2R0D A;  3ABV B;  4P16 A;  3GZN I;  3EFU A;  1STE A;  5BYQ A;  3ZJU A;  1EAZ A; 
#chains in the Genus database with same CATH homology
 4DDI D;  4BVU C;  1WM3 A;  1U5E A;  2YVC A;  4JK8 A;  3RCP A;  3A1Q B;  4W9G A;  3QCA A;  2DZK A;  3ENE A;  2XQN M;  4KDI C;  3IVF A;  4EUT A;  1WJ4 A;  3AXC A;  1ZM0 A;  1EVH A;  1FGZ A;  3ULC A;  4HAW B;  4FJY A;  3ML4 A;  3ZRC A;  4WAA A;  2ZNV C;  3HK0 A;  5L95 C;  2AEH A;  1U5F A;  1IRS A;  2ZNV B;  4MJS A;  3ZRF A;  4BFR A;  4ZYN A;  5DI9 B;  3IFW B;  4K2O A;  5D2M B;  2C7M B;  2I5F A;  4JK7 A;  2LZ6 A;  2YSZ A;  3MHS D;  1P0R A;  2D4Q A;  1QQG A;  4K81 A;  5CHV C;  1C1Y B;  4B95 A;  1P1A A;  5C23 A;  2D9Y A;  4WJ7 A;  2NZ8 B;  4BKS A;  3G9W A;  3EHV A;  1OEY A;  2PE9 A;  3UQB A;  4HHV A;  4MH0 E;  2FCS A;  2LGD A;  5DPS A;  4M8M A;  2YT0 A;  3QHT A;  2JZZ A;  2LBB A;  2DAJ A;  1V6E A;  3QAQ A;  3D32 A;  2D07 B;  4F7U P;  2MLB A;  1BTK A;  3MTN B;  3UF8 A;  2KC1 A;  1WXS A;  5LLI A;  1UBQ A;  2DHI A;  2HTH B;  1FAO A;  3KRX A;  1GNU A;  4MY6 A;  2RGN B;  1XD4 A;  4B6H A;  3ULB A;  2BKR B;  2O6V D;  2DHZ A;  3F0W A;  3JYU A;  2PJH A;  3FP5 A;  1GC7 A;  2MRP A;  3W1S A;  3X23 A;  2FJL A;  3TW1 A;  4I6L B;  4LDT D;  3PVW A;  4KHB B;  3UIP B;  3P6A A;  4BBN C;  2RPQ A;  2N0Y A;  4GIV A;  3JSV B;  1WZ0 A;  2GBM A;  2K2J A;  4B6W A;  2FCQ A;  4XC2 A;  3AJ4 A;  1WJU A;  3EC8 A;  4XX5 A;  5J3Y A;  4HXD A;  1FHW A;  2RSG A;  2YS3 A;  1OY2 A;  3TL5 A;  2B3A A;  4KDL B;  2ZPN A;  4BKT A;  4M8N A;  2NS5 A;  4IAP A;  4HK2 A;  2QKL A;  3ZUN A;  2DFK A;  2G4D B;  1WJM A;  4A6H A;  3TMP B;  3SBT A;  3FLV A;  2N9E B;  1X05 A;  1WGY A;  2A5U A;  4EZL A;  3VFK A;  2LD9 A;  2YS1 A;  2L0F A;  4GU2 A;  1DDW A;  3KUC B;  2KCJ A;  5HKH A;  4PS8 A;  4HAT B;  2D9Z A;  4DXA B;  1NVL A;  3ODW A;  2COF A;  2BYE A;  4G0N B;  4K7S A;  4GPT B;  3IHP C;  1N3H A;  1V81 A;  1IP9 A;  2NR2 A;  2XEW A;  2K8C A;  3ONS A;  3H7P B;  3AUL A;  4PS3 A;  4K7U A;  2KAN A;  3L0W B;  1J0W A;  2BF8 B;  3ECI A;  1U5G A;  2CY5 A;  4W9C A;  2CKH B;  4JKC A;  4I6N B;  3DQV A;  1E8Y A;  2LWP A;  3ML8 A;  2Z0O A;  4CHK A;  1WRD B;  3ZIM A;  4PNK A;  1WI0 A;  4JKG A;  2XBB C;  5AEK B;  2BWE S;  1UBI A;  3JSV A;  1WFY A;  3PP2 A;  1AAR A;  1OQN A;  2K00 A;  3PVU A;  4EOY A;  2NVU I;  1TBE A;  2D9W A;  3VAW A;  4DDG D;  5HE2 A;  2KNB A;  5KQ4 A;  2OJR A;  1VBG A;  2L76 A;  2ELA A;  1U4A A;  3TCA A;  3L54 A;  2PE6 B;  1TJ6 A;  2DZJ A;  1EF5 A;  2RNR B;  3N7C A;  4WWP A;  2NPT B;  5LXI B;  1E90 A;  2IO3 B;  4MGY E;  2I5C A;  2KX3 A;  2Z0Q A;  3B08 A;  2L0T A;  3DCG A;  4CHM A;  3ZO5 B;  4MM3 A;  4HLE A;  3Q3F A;  1RRP B;  4FN2 A;  5L83 A;  1C3T A;  2JXX A;  2MKR A;  2OQB A;  1U5D A;  1CMX B;  1PMS A;  1NU2 A;  2L05 A;  2LRW A;  2ZVN A;  1M94 A;  2Z0E B;  2M8S A;  3APC A;  2PPH A;  4BOZ B;  2D2Q A;  3ODO A;  3A9K A;  1WMH B;  1P9D U;  3N30 A;  4GB9 A;  2HE7 A;  4IM3 A;  2MBH A;  2YF0 A;  4HPL B;  4KIK B;  2DKP A;  1E7U A;  3BJI A;  2LVQ A;  5DH9 B;  4C0A A;  3PGE A;  3TO1 A;  3S2A A;  1DIK A;  4DBG A;  4ZRK A;  1SE9 A;  2DYO A;  4FJZ A;  2C7N B;  3DOW A;  1ZC4 B;  2VRW B;  1ZC3 B;  1MIZ B;  2KUP A;  2H7D A;  2FJ9 A;  3D8E A;  2N23 A;  2JF5 A;  5IJM A;  4ILJ A;  2WWZ A;  4GDL B;  4LDT B;  3QQ8 B;  2KLG A;  4I6P A;  1UPR A;  1EF1 A;  3JW0 X;  5E6N A;  1UZX B;  3VXW A;  1DDM A;  2L00 B;  3ZKJ C;  2M14 A;  4K2P A;  2K39 A;  1GC6 A;  3CST A;  2G3Q B;  1V5O A;  3WAO A;  5HE0 A;  1BT0 A;  3HQC A;  2DLW A;  4JLC A;  4NJ6 A;  4BOS C;  2KXJ A;  3ML9 A;  4DHJ D;  3PEG A;  4DHJ B;  3PRM B;  2VSZ A;  5KHO A;  3T8M A;  2X18 A;  5C1Z A;  1QZE A;  1Z87 A;  3ZNZ B;  1V86 A;  2K6D B;  1WGU A;  3RT3 B;  2NBU A;  2I1J A;  3H6N A;  2L3Z A;  2DHK A;  4MSQ B;  4HAZ B;  1WI1 A;  3VUY A;  1Q0W B;  1UGM A;  4TQ0 A;  1XKE A;  4HWI B;  3KSY A;  4XZ4 A;  1UNP A;  2DHJ A;  3T06 A;  2LVO A;  1WGG A;  1WX7 A;  4RMA A;  2KTF A;  5TR5 A;  4D0N B;  2DX5 A;  4FA6 A;  2V1Y A;  3A98 B;  4NNJ B;  2L8J A;  2REX A;  3IBE A;  4AJY B;  3EEC A;  4MT7 A;  2G45 B;  4F7Z A;  4II2 B;  1WXV A;  4FAD A;  1W1D A;  3H9D A;  1FHO A;  4NJ7 A;  5JH5 C;  2GBJ A;  4HCP B;  1RAX A;  4NQL B;  2GOW A;  2NBV B;  4GDL A;  2KFJ A;  5BO4 B;  2AWT A;  2EKE C;  2WX1 A;  3H7S A;  5CHW A;  2CQU A;  3O96 A;  5JHG A;  5EFX A;  4AJW A;  4CYE A;  3V6E B;  3QX1 A;  4JKG B;  4KZ0 A;  1SGH A;  4GOC A;  1UPQ A;  5DHF B;  1KJT A;  2DTC A;  1TTN A;  4ILG B;  5LOP B;  2FAZ A;  4PYU A;  3L17 A;  3N3K B;  1L2N A;  1NI2 A;  3PHW B;  3R66 C;  3M3J A;  5D27 A;  2YT1 A;  3M95 A;  4HAX B;  3DVG Y;  4A20 A;  3KRW A;  2N7D A;  3A9J B;  1B55 A;  4IUM B;  3UQA A;  5JHA A;  5JVL A;  3FSS A;  1EO6 A;  2C7H A;  2COC A;  2R09 A;  3RZF A;  5HE3 A;  2D10 A;  2FCM A;  3QC8 B;  1XOD A;  3VDZ A;  2GS0 A;  3LJ3 A;  2JWZ A;  1MK7 B;  2IO0 B;  4DHZ B;  3VUW A;  2YS5 A;  2KTR A;  3ZDT A;  4HCN B;  4LJP B;  3VUX A;  1J0G A;  4HAV B;  2KD0 A;  5GMV A;  4FBJ B;  3VTW A;  3F5R A;  2KDF B;  4F7H A;  3E9O A;  2D9X A;  3H7P A;  1V2Y A;  1WXM A;  4X57 B;  2KJH B;  5DCN A;  1ZGU B;  2R82 A;  3UGB B;  3KVF B;  5FR6 A;  2DX5 B;  4DBB A;  5KCV A;  2M38 A;  4G3X B;  2BCJ A;  4B9K A;  1Z5S B;  2KO3 A;  4ZRI A;  1WG7 A;  3PPA A;  3WAN A;  2Y8F A;  2MBQ A;  1NTI A;  2CR5 A;  2V4L A;  1KZ7 A;  1V49 A;  3DBH I;  4JKF A;  4KHO A;  3QJZ A;  2ELB A;  4FHJ A;  2JVC A;  3ZNI D;  2LUL A;  2CS4 A;  1BWN A;  2KC2 A;  2ROZ B;  3HW2 B;  5JHH A;  4KZC A;  3LJU X;  2RLO A;  1NBF C;  3RCZ A;  2NPT A;  4TYZ A;  3ZVV A;  1U27 A;  1WVH A;  3RYT A;  2OTX A;  4JIO U;  5G2N A;  3A9J A;  1AQC A;  4YON A;  2I1K A;  2EC1 A;  2N1V A;  1V5T A;  2CHW A;  3FEH A;  1GUA B;  2ZJD A;  4JKH A;  3KYC D;  1GJZ A;  4MSM B;  3ZNH B;  5DPT A;  2JPH A;  2O6V B;  3NHE B;  2KTR B;  3L16 A;  2J0M A;  1H8C A;  3VIA A;  3PLU A;  3SNH A;  1P3R A;  4IW0 A;  2LOZ A;  2KJR A;  3UIO B;  4NPN A;  2W9N A;  2R2Q A;  3QA8 A;  4AUQ C;  2LGX A;  1M7R A;  2D3G A;  5DPW A;  2X0S A;  2DA0 A;  4W9E A;  2N1W A;  2KFK A;  1W1H A;  2AYO B;  2WH5 A;  4A3P A;  2P0D A;  4RM8 A;  2IFS A;  4ZRJ A;  3NSU A;  1LQB A;  1V88 A;  2ZEQ A;  3OAN A;  4KHA A;  4JKA A;  1P6S A;  2CRF A;  3V62 A;  5C5B A;  2LRU A;  2AL6 A;  3SYX A;  3E9P A;  3K9O B;  2IYD B;  1UEF A;  2MBO A;  4G50 A;  2WYQ A;  3E66 A;  1WZ3 A;  4BKG A;  1W1G A;  1RLF A;  4ASW C;  2C5L C;  3V6C B;  4A6F A;  1TXD A;  3NS8 A;  1M7E A;  2WDT B;  2MW5 A;  2KMC A;  3CF6 E;  5LON B;  3H1U A;  2IY1 B;  2FCN A;  1WJ6 A;  2DN6 A;  2P8V A;  5HE1 A;  5JLJ B;  3KYD D;  3A1Q A;  2LOX A;  4E3C A;  2Z0P A;  4DK5 A;  1EUV B;  3PSE B;  4HJK A;  5CLQ B;  1WIA A;  1I2H A;  2KK8 A;  2HD5 B;  2DEN B;  2W2X C;  1WE7 A;  4WJP A;  1LFD A;  4JK9 A;  2AL3 A;  1IYF A;  1XCG A;  4H8S A;  2OOB B;  1X86 A;  4K1R B;  2N4F A;  1GGO A;  3WA0 A;  3OAW A;  2KFK B;  3PZD A;  1Y19 B;  2O2V A;  2D9V A;  4JL9 A;  2MQJ A;  5FI1 A;  3GYP A;  1E8X A;  3B1L X;  2CAY A;  2MP2 B;  3DXC A;  2DYM A;  3UZT A;  4MK0 A;  1OGW A;  4TV3 A;  2DKQ A;  2IBI B;  3D8F A;  2RVB B;  4JKD A;  4GMV A;  3M1I B;  2N9P C;  5KHQ A;  1Y8R C;  3A4R A;  4W9K A;  2ZVO A;  4W9F A;  1K5G B;  3T9L A;  4LCD E;  1V5U A;  2JUO A;  1OMW A;  2M17 A;  2GCL A;  1X1G A;  2GCJ A;  1XD3 B;  4FLH A;  2WX0 A;  4EMO A;  3R7Q A;  2KDI A;  3CSF A;  3ZTD A;  3SD5 A;  1HB8 A;  1WMH A;  4GZU A;  4YL8 A;  3A33 B;  3HM6 X;  2C60 A;  1T0Y A;  2MWS B;  3P2B A;  4XWX A;  2K8H A;  2P0F A;  1P3Q U;  2DX1 A;  3PVL A;  3GOE A;  1E8Z A;  1YX5 B;  4MGZ E;  4TKN A;  4WSF A;  1V9J A;  2R2O A;  3E9L A;  1OTR B;  2KQS A;  4PS7 A;  4A6F B;  3AI5 A;  1K5D B;  4EEW A;  2LAS A;  2M4N A;  3ODX A;  2Q13 A;  4HB4 B;  1Q1O A;  4JGH B;  1KI1 B;  5AZF A;  3VH4 B;  1S1Q B;  4GN1 A;  3HHM A;  4MEM A;  2CY4 A;  1DDV A;  2KN5 A;  3V61 A;  2PEA A;  3QK0 A;  4K7W A;  3DPD A;  3NY5 A;  3NOB A;  2J7Q B;  3M63 B;  1MAI A;  5E6O A;  1PQS A;  3SHQ A;  3SDL C;  2RUK B;  1ACA A;  3FM8 C;  4WJO A;  3Q3J A;  4GDK A;  4K17 A;  2LKO A;  5D3W A;  1FB8 A;  1IPG A;  2L7R A;  5DHA B;  2IYB A;  2JT4 B;  5JP4 A;  5C16 A;  5J2R A;  2Y5B B;  2L1C A;  4W9H A;  1WF9 A;  4II3 B;  1WJ1 A;  3AU5 A;  2BYF A;  1WYW B;  4W9I A;  2UWQ A;  1R4N I;  3R7R A;  2ZPY A;  2P0H A;  3MPX A;  4Z2M B;  1OQY A;  1FXT B;  1OEY J;  3BIN A;  3TFM A;  4TQ1 A;  4AWJ A;  3SO6 A;  2GJY A;  3M62 B;  2PZ1 A;  4EZJ A;  1YQB A;  3CIK A;  3GYO A;  4J6I A;  3PT2 B;  5CHF A;  4GGQ A;  5D6J B;  4KV2 A;  1I35 A;  3W1S C;  3MJW A;  4ANU A;  3ALB A;  1R4M I;  1V5M A;  2RD0 A;  3QIJ A;  2CHX A;  4ANX A;  4HAY B;  4LJO B;  2RQ1 A;  3SBG A;  2GBR A;  3PG7 A;  1F9J A;  3A4S C;  3DDC B;  5G55 A;  2E2X A;  3ZLZ A;  4JKB A;  1NTY A;  5GOW B;  3DBL I;  1X11 A;  2G35 A;  1NDD A;  5D3Y A;  2HRJ A;  3DVN V;  1Z2M A;  2DZM A;  2N7E A;  4ZDV A;  4MGK E;  1H10 A;  1VD2 A;  1NTV A;  4DX8 A;  2LXC A;  4BBK A;  5J3T A;  1SHC A;  3OJ4 B;  5IAA C;  1G6J A;  4FUL A;  2ASQ A;  3A8P A;  2MA9 B;  4GDK B;  3U8Z A;  2MBB B;  4W9J A;  3DVG X;  5D94 A;  3AU4 A;  2N9X A;  4EFO A;  2IY0 B;  4PQ0 A;  3JVZ X;  2FIF A;  5FI0 A;  1Q67 A;  4A5K A;  1KC7 A;  2KMA A;  3PV1 A;  1JRU A;  2BWF A;  4F1S A;  2DAF A;  2LYD A;  4OVU A;  2QHO A;  4EJN A;  4PYZ A;  3PRE A;  2MCN B;  3SV1 A;  2MX2 A;  3ZDM C;  3ZW3 A;  2D11 A;  2Y7B A;  2LUE A;  1FHX A;  2O2V B;  4FHK A;  1UNR A;  5AZH A;  4F8C B;  3DXE A;  3U30 A;  3PHX B;  3TVV A;  5C5B B;  2LGY A;  5DIF B;  2QKM A;  3C0R B;  4MDK E;  1PFJ A;  2YRY A;  1U2B A;  2KWC A;  4IC7 B;  1LXD A;  1WGR A;  2K25 A;  2J59 M;  4WJN A;  1HBK A;  1PLS A;  2KDB A;  2XK5 B;  3RUL A;  2KWV B;  1WR6 E;  2BGF A;  3HM3 A;  3PTF C;  3PLV A;  3VTV A;  2FDQ A;  1KZG A;  3TBL D;  4URK A;  4AOF A;  2LXA A;  5CTR C;  1J19 A;  3NZS A;  4ICV A;  1UH6 A;  4WWO A;  3CXB B;  1WH3 A;  2VKI A;  5JHB A;  1MPH A;  5EDS A;  2G4S A;  4KSK C;  2K2U A;  1WY8 A;  3VOQ A;  2W2W A;  4HDO A;  2IO2 B;  2KJ6 A;  4Z2N A;  1YJ1 A;  1I7A A;  4N9F 4;  2H7E A;  2L2I A;  1WM2 A;  2COA A;  2KZR A;  4IWO A;  4W9L A;  2KKC A;  5AZG A;  1DYN A;  4ANV A;  4HPM B;  1X1M A;  2MSE D;  3SU8 X;  1WR1 A;  5C79 A;  3R3M A;  2ZZP B;  4E74 A;  2JRI B;  3X0W A;  5KQ1 A;  1ISN A;  1RJ2 A;  1VCB A;  4P7I A;  2Z0D B;  1QC6 A;  3I3T B;  2ZCC A;  3KUD B;  4DX9 0;  4BBN F;  2K1F A;  4WQO B;  5C6R A;  3LDZ E;  4IM0 A;  4IM2 A;  2NCN A;  4MJS B;  1WGH A;  1V89 A;  4ANW A;  1H4R A;  4OVV A;  3UIN B;  2Y8G A;  1UD7 A;  2JY6 A;  1XT9 B;  2V3S A;  2MDX A;  4HVB A;  3SUZ A;  3CMM B;  3DVN U;  1SIF A;  2KWU B;  2JRH A;  1E5W A;  3DBS A;  4E71 A;  3K9P B;  4M0W B;  3QWM A;  3RUI B;  1XR0 B;  3DXD A;  2KHW B;  4G11 A;  4DHZ E;  1WX8 A;  2LG1 A;  3V5W A;  1E8W A;  2C9W B;  2DYN A;  2A4Z A;  2KLC A;  2FNJ B;  3WAP A;  2ADZ A;  2DYQ A;  2GMI C;  4KIK A;  1RFA A;  1EGX A;  4IWP A;  3VTU A;  3VQI A;  4CHJ A;  1J8C A;  1UNQ A;  3ENB A;  4NY0 A;  2CB8 A;  2FUH B;  3ZNG C;  2ZCB A;  2VRR B;  3QBV B;  4Y94 A;  2RSU A;  1HB6 A;  1X1F A;  1RRB A;  1YD8 U;  1FGY A;  3WAL A;  2DZI A;  5D3X A;  1E7V A;  1XQQ A;  1TZ1 A;  1U29 A;  4ILH A;  2JZ3 B;  3VHT C;  3A8Q A;  4JKE A;  1WE6 A;  1ST7 A;  2COP A;  1AWE A;  2RR9 A;  2COD A;  3KW5 B;  1YIW A;  4WWN A;  1D3Z A;  1MK9 B;  1ZW7 A;  5DPR A;  1KBL A;  1S3S G;  3QAR A;  2K6Q A;  1LW3 A;  2DIK A;  2MFQ A;  4HB3 B;  2JP2 A;  1UEL A;  4EZK A;  2DYB A;  2HTH A;  4GXB A;  2Z59 B;  3QWZ B;  2UZR A;  2BYV E;  4NSW A;  1V5P A;  3BY4 B;  1L7Y A;  1BTN A;  3OLM D;  2EMS A;  2NMB A;  4KAX B;  4IWQ A;  2UYZ B;  2LJ5 A;  3RD2 A;  4RM9 A;  2MP2 A;  1ZKH A;  4W9D A;  1XX0 A;  5J3Q A;  2ABD A;  2UVM A;  4A6K A;  4KSL C;  5CLL B;  1I42 A;  2BKF A;  3V60 A;  3PSC A;  4F7G A;  5D7G A;  1WGQ A;  4TUU A;  5LXH A;  5E6P A;  1LB1 A;  3TIX A;  1KLV A;  3NZU A;  1DRO A;  2BPS A;  1A5R A;  2GBN A;  3KZ1 A;  3PRP B;  2HJ8 A;  4HAU B;  3ZTC A;  2YLM A;  2RGF A;  4KVG B;  2NBW B;  2M1M A;  2KQ7 A;  3N32 A;  1LM8 B;  4GMX B;  5D3V A;  4NAW A;  1P5T A;  2M0X A;  2XK5 A;  3L10 B;  1P98 A;  1FOE A;  3APD A;  2ROV A;  1DBH A;  4ICU A;  3L08 A;  3U7D A;  2MWN B;  3B0A A;  1KM7 A;  3APF A;  4CO7 A;  3W1Y A;  5CX3 A;  4BKS D;  1WJN A;  4WVF B;  2KX0 A;  2UZS A;  2K8B A;  4MEL A;  2O6V A;  1MIX A;  4HB0 B;  4JQW C;  2J0K A;  1ZSQ A;  3VVW B;  1WX9 A;  2J0J A;  2KOX A;  3WIM A;  2W2X D;  3WYF B;  3IG3 A;  1JDE A;  5J18 A;  1V80 A;  4WJQ A;  3TJP A;  4DWF A;  2IZV B;  1TGZ B;  1YX6 B;  5J17 A;  4EKU A;  3P7Z A;  3KH0 A;  5L81 A;  3PS6 A;  3WAM A;  4IOY X;  1BAK A;  1HE8 A;  3HIZ A;  5JZE B;  1GG3 A;  4FJV B;  2V76 A;  4HDQ A;  2CHZ A;  4IG7 B;  1WGD A;  1Q5W B;  1ZVR A;  2EJ8 A;  3OJ3 A;  3KUZ A;  1MKE A;  2KVR A;  3A9K B;  3RZW C;  2FID A;  2MBE A;  3L13 A;  1MG8 A;  4HB2 B;  3MDB C;  1WXA A;  4MGI E;  5IA7 A;  4L6E A;  1KOT A;  4GSW A;  2IO1 B;  2KDE B;  1K8R B;  3EPY A;  4NQK E;  1TQZ A;  4NAW B;  1Y5O A;  4AP4 C;  3KY9 A;  3ZVR A;  4IFS A;  2GBK A;  3O65 B;  3DBR I;  2CU1 A;  4A3O A;  1VBH A;  2LI5 A;  1V61 A;  3PRZ A;  3VH3 B;  2EMT A;  3D8D A;  2LVP A;  2KGX B;  2R0D A;  3GZN I;  3EFU A;  1EAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...