3ZDTA

Crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
368
structure length
326
Chain Sequence
ERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYKKSNYEVLEKDVGLRRFFPKSLLDSVAAATLAALIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPDYAEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 89
structure length 326
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3zdtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3zdtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdtA01
2Z0QA 3I3TB 1MK7B 5LXIB 3UINB 1UNPA 2NVUI 1FB8A 2RGFA 3GYPA 5DIFB 2FCQA 4HAWB 5CHWA 5IJMA 1WYWB 3P2BA 3DDCB 4IWOA 2ZJDA 1BTNA 1NTIA 2NS5A 3AXCA 4KDLB 1V88A 3VH3B 3RT3B 4WJ7A 4EUTA 4HB4B 1UH6A 5JLJB 2PE9A 5TR5A 3KZ1A 1HB8A 1RLFA 2LGYA 3NY5A 4WJQA 2C9WB 3U7DA 1J8CA 3FSSA 3JYUA 1F9JA 2W9NA 3X0WA 1BWNA 2YF0A 2GMIC 2HTHB 5J3TA 1XD4A 2CHZA 2I1JA 4HK2A 1SGHA 3KRXA 2QHOA 5AZGA 1UBQA 2D11A 2XEWA 4B9KA 2LULA 3PLVA 3IBEA 4IM0A 4D0NB 5KHOA 5CLQB 3ML4A 3A9KB 3UF8A 3L16A 2Z0OA 2MX2A 2RR9A 3DBSA 4EOYA 3B08A 3ZVRA 3L08A 1NVLA 4W9KA 1I35A 4MY6A 2KXJA 3DBHI 2KFKA 4HAZB 1WFYA 2NZ8B 4PYZA 4GSWA 1WZ3A 5KQ4A 4B6WA 5D2MB 3W1YA 3LJ3A 1IPGA 5C16A 2L0FA 1UNQA 4CHMA 5CTRC 2DA0A 1WJ4A 1W1DA 1V86A 1SIFA 4ZRKA 2RLOA 1SE9A 2J0MA 2MBHA 2DAJA 2OJRA 1TGZB 3HIZA 1WGGA 1Z87A 3PT2B 4KSLC 2E2XA 3AULA 1Y5OA 2KD0A 4W9DA 3TFMA 3PP2A 5J17A 3NZSA 4WAAA 2L7RA 3T9LA 3T06A 1P9DU 3QCAA 4G50A 3AI5A 3TW1A 2GCJA 4GDLB 4HDOA 3L0WB 1GC6A 3B0AA 1LQBA 3A8QA 2MLBA 4M8MA 4HPLB 2G3QB 3GYOA 1XT9B 2ROVA 2MFQA 2AEHA 1DDVA 1V6EA 4IM3A 1WXAA 2IO0B 1E90A 4ANXA 3CF6E 4AJYB 3SU8X 1WGUA 3H7PB 1YIWA 3SYXA 2NBVB 3WA0A 1E5WA 3DQVA 4BFRA 3L10B 1EF1A 2DN6A 3PRMB 3VOQA 4KIKB 2C7HA 2X18A 3ZVVA 3DVNU 2YRYA 2KHWB 3RUIB 3H9DA 3N7CA 1U2BA 2OOBB 2G4SA 2UVMA 2IBIB 3DBRI 3HQCA 4Z2NA 5GOWB 1UEFA 4KHBB 2FCNA 3WYFB 2R2QA 3DXEA 1VD2A 1U5EA 4GGQA 3KUDB 2H7EA 2W2WA 4MEMA 4K7SA 3SO6A 2YLMA 2RUKB 1LW3A 4KZ0A 1KZ7A 2HJ8A 3VTUA 1TTNA 3PEGA 4A6FA 1WGHA 4K2OA 4DBGA 4PNKA 3DOWA 2FJ9A 2GBMA 3VUWA 3X23A 2MP2A 3SV1A 2BGFA 1Z5SB 1WMHB 2CKHB 3KH0A 2W2XD 2IYBA 3LDZE 3VXWA 2D9ZA 4EZKA 2V76A 1NI2A 1K5DB 3SUZA 4WQOB 5DPWA 2NPTB 2KX0A 1MKEA 5J18A 1ZVRA 1V49A 2HE7A 2N23A 3PRZA 5L95C 1WM2A 3VAWA 4MJSB 2LXCA 2MWNB 1TBEA 2EMSA 4I6PA 1RRPB 2FJLA 2LJ5A 1J0WA 3FEHA 5KHQA 2UYZB 5LLIA 5JP4A 2JRHA 2LKOA 2K1FA 3ZNHB 1LFDA 4KSKC 3WALA 3U8ZA 2Z0DB 2KTFA 4A6KA 4EKUA 3F5RA 1D3ZA 3KUZA 2XK5A 2RVBB 1SHCA 3R7RA 1Y8RC 2BKFA 4BKTA 1UGMA 1WZ0A 3PZDA 1FHWA 3PRPB 2MBQA 4IAPA 1RFAA 4L6EA 1FAOA 4GN1A 5IA7A 4IUMB 3ZO5B 4MGIE 2K25A 1KM7A 4XWXA 4W9GA 4RMAA 1UD7A 5CHVC 3V5WA 3RULA 3RCZA 2KWVB 2DX1A 1BT0A 1P1AA 3L13A 1TQZA 3KYCD 3TMPB 4WJNA 3N30A 1ZW7A 2YS3A 4NSWA 1I2HA 2N7EA 3UIOB 2K39A 2N9XA 5D94A 1X1MA 2CY5A 3IHPC 3TO1A 5JHBA 1RRBA 1ISNA 4MT7A 2FAZA 2JT4B 2KK8A 3QIJA 2YT1A 2NBUA 4DBBA 2KDBA 4A3OA 4MGKE 4EZLA 3DXDA 4II3B 1J19A 4B6HA 4HB3B 4HVBA 5LXHA 1V5MA 3OANA 4BBNC 3APDA 1U5DA 4DDID 2ZZPB 1XR0B 1PFJA 2UWQA 2DZJA 2O2VB 2LRWA 1WVHA 1TJ6A 5FI0A 3OLMD 4K7WA 5HE0A 1XKEA 2KANA 3WAOA 2L8JA 3Q3FA 2V4LA 5DH9B 4IOYX 1Q1OA 4W9CA 2L76A 3IVFA 3VHTC 4BKSA 4G0NB 1XX0A 1L2NA 3VDZA 2EC1A 1U4AA 4IWPA 1IRSA 1J0GA 2B3AA 1BAKA 3TL5A 4TQ0A 3TCAA 3UQBA 2YS5A 1I7AA 4X57B 3RZWC 2UZRA 2LXAA 4MGZE 1GC7A 1X86A 3ONSA 3CIKA 4LJPB 3L17A 2A5UA 5DPRA 5LONB 2WYQA 3H7SA 3WIMA 1ST7A 4KAXB 2LI5A 1WJMA 1FHXA 4ZDVA 2JF5A 4TKNA 3DBLI 1IP9A 2CODA 2BWES 4PS8A 1B55A 3QQ8B 1E8WA 2LD9A 1YX6B 2C5LC 2C60A 2HTHA 2ABDA 4HB0B 3QWMA 3B1LX 2VRRB 1ZSQA 4BBNF 3QAQA 4II2B 2G35A 2YSZA 3GOEA 3PPAA 2DHIA 2DAFA 1W1GA 1ZKHA 2LRUA 2MRPA 3ZRCA 2K8HA 2QKMA 2NCNA 1OEYJ 4EZJA 3ULCA 2IYDB 4MSQB 4HXDA 2KJHB 4FLHA 2N1WA 4E71A 2A4ZA 1H10A 3EECA 4WWPA 2M17A 3C0RB 1AARA 3ZKJC 2W2XC 3PSEB 4OVUA 3KSYA 1L7YA 1FOEA 3OJ3A 1RJ2A 1P3QU 4TV3A 2AL6A 2L0TA 4W9JA 4PS7A 4F7HA 3EPYA 3PTFC 3JSVB 2O6VB 4J6IA 5EDSA 4DWFA 1VCBA 2KVRA 2YT0A 4XC2A 2BPSA 2WWZA 5C23A 4DX8A 3D8EA 2NBWB 3DVGX 1AWEA 2KLCA 2PEAA 3P6AA 2JY6A 1CMXB 3JW0X 1WM3A 1NTVA 3ULBA 1OMWA 2D9WA 2KKCA 3FLVA 3QBVB 2M4NA 5JHHA 3QARA 3A1QB 1I42A 1EO6A 4HB2B 3NHEB 4EEWA 3UQAA 2L1CA 5AZHA 1MPHA 2K6QA 4FN2A 3VFKA 4W9LA 2Y7BA 4CYEA 2I5CA 3WAMA 1WJUA 4GDLA 4NAWB 1WX7A 4GDKA 3ZNGC 3RCPA 3FP5A 5D3VA 3KY9A 1X05A 2D4QA 5DPSA 2AYOB 4GB9A 1Y19B 2KWUB 3CMMB 1V5PA 1ZC4B 4W9IA 4AUQC 1P3RA 1R4NI 3ZNZB 4ANVA 3H7PA 2DHJA 3VVWB 2DZIA 2JVCA 5CX3A 1JRUA 1P0RA 5C5BB 1K5GB 3LJUX 1WI1A 2ZEQA 1NU2A 2M38A 2DYOA 4W9EA 3NOBA 2MWSB 3IG3A 5D3WA 4KZCA 4JQWC 3ODWA 4PS3A 1X1FA 1PLSA 1V80A 3GZNI 3UGBB 2IY1B 1GNUA 1M7RA 1UNRA 4FJZA 4K7UA 3PV1A 3QC8B 4KDIC 2DYBA 1R4MI 2ZVNA 3AU4A 5DHAB 2DZKA 3ECIA 2KWCA 2CR5A 1E8YA 2MBEA 4ZRIA 3PVLA 2RSGA 3EHVA 2LGXA 2O6VD 2CHWA 2VKIA 4H8SA 1XODA 5BO4B 2FIDA 4NQLB 5KQ1A 2KDFB 2D2QA 2C7MB 2GBKA 2LGDA 4GMXB 1WXVA 3V61A 1WR1A 4GXBA 2R2OA 1WY8A 1EF5A 2Y8GA 2IZVB 1WMHA 2COAA 5GMVA 2IO3B 2LUEA 1ZM0A 2RD0A 2OQBA 2JXXA 1HB6A 1W1HA 2REXA 2DHKA 1RAXA 2OTXA 4JIOU 2JRIB 2NPTA 1V5UA 5C1ZA 5LOPB 3TVVA 1PMSA 2FCMA 2M1MA 1V5TA 5L81A 2V3SA 1NDDA 2KFJA 1ZC3B 4DK5A 4ANWA 1UBIA 1DROA 2ZVOA 3D32A 1H4RA 2V1YA 2XBBC 4HCPB 4F7ZA 2C7NB 1WRDB 1OQNA 5DPTA 3W1SC 3KW5B 4E3CA 2Z59B 1X1GA 2LWPA 4MGYE 2BF8B 1YX5B 4A6FB 3ZDTA 4F7GA 1ACAA 3APFA 3OJ4B 2KQSA 4CO7A 2M14A 3A8PA 2FCSA 3K9OB 4I6NB 3JVZX 4MM3A 1UZXB 3M62B 3NS8A 4K17A 4WSFA 2D9XA 1YJ1A 5DCNA 1LM8B 1WGRA 2H7DA 1XD3B 2PPHA 3F0WA 4FA6A 4ICUA 3P7ZA 4HPMB 3CSTA 2GBNA 5C79A 3RD2A 2Y5BB 2DX5A 3H1UA 4M8NA 1WJ1A 2ELBA 5FR6A 2P8VA 1QZEA 1WR6E 4FULA 4NJ6A 3ZUNA 4HAUB 3ZRFA 2Z0PA 1H8CA 1V61A 1E7VA 4PQ0A 3TBLD 3A9JB 4HAXB 4MDKE 1V89A 2N0YA 4KHAA 3N32A 4BKGA 4EJNA 3FM8C 4I6LB 2G45B 2KLGA 3UIPB 1OGWA 3A4SC 3QK0A 2DYMA 1E8ZA 2I5FA 1WE6A 3HM6X 3R7QA 2P0HA 1MK9B 2D9VA 5CLLB 2CB8A 2YS1A 3ZNID 4IM2A 2KTRB 3MJWA 2FIFA 2LBBA 2KMCA 2GCLA 1XCGA 2LYDA 2BYVE 5FI1A 2ASQA 3EFUA 2COCA 2COPA 1QQGA 2N9PC 4F8CB 1G6JA 1AQCA 2JWZA 2N4FA 2IFSA 1WG7A 1P6SA 1OQYA 4RM8A 4F1SA 2LZ6A 2EKEC 4GZUA 2M8SA 3VUXA 4HATB 3O96A 3QWZB 3HHMA 1MAIA 3QJZA 4YL8A 3CXBB 3VQIA 1WIAA 4PYUA 4DHJB 4CHKA 2J0JA 2DYQA 2RPQA 4M0WB 2M0XA 4A20A 3RYTA 2RGNB 3PGEA 3R3MA 2GJYA 2KDEB 3DXCA 2L3ZA 2N9EB 1MIZB 3M95A 2COFA 2G4DB 5HE1A 2BCJA 4FBJB 1KZGA 1EAZA 1WJ6A 2J0KA 2KGXB 3BJIA 1M7EA 1U5GA 4BVUC 2CS4A 4NJ7A 2N7DA 1X11A 1UPRA 4F7UP 1NBFC 3ZIMA 5HE3A 4HJKA 5EFXA 4W9FA 2KNBA 3VUYA 2ELAA 3T8MA 1V81A 4FHJA 3QHTA 2VRWB 3O65B 2R09A 1BTKA 3CSFA 4DHZB 1PQSA 1V9JA 4ANUA 3BY4B 3HW2B 2MW5A 3VTVA 1FGYA 1QC6A 4HDQA 2K8CA 2ADZA 1ZGUB 2WX0A 4K2PA 1V2YA 3QA8A 2KC1A 1C1YB 4HAYB 2KDIA 1WH3A 3SDLC 3ODOA 3HK0A 2KMAA 4XZ4A 3BINA 2N1VA 5D27A 1WJNA 2BWFA 2RQ1A 4FJVB 3A9KA 3PLUA 3JSVA 2O6VA 2K6DB 3PVWA 2Q13A 1U27A 4NQKE 2LVPA 3KVFB 4G11A 3MTNB 2DKPA 4NPNA 3UZTA 2DZMA 5E6OA 1DBHA 4A6HA 2GBJA 2ZPYA 3NSUA 2WX1A 1WF9A 3IFWB 2I1KA 4HHVA 4DHJD 2CU1A 3WANA 2KCJA 2HD5B 2CY4A 1Q67A 4DHZE 2L05A 4K81A 2JPHA 1YD8U 3A1QA 2KJRA 5L83A 3DCGA 4XX5A 1E7UA 5D3XA 3DPDA 3R66C 3ZTCA 3QX1A 5IAAC 2RSUA 4ASWC 4NAWA 4BBKA 2MQJA 3OAWA 2LOZA 5HE2A 5J3YA 4HLEA 1WXMA 1E8XA 2BYFA 3D8DA 2LVOA 3ML9A 2BYEA 1OEYA 2KFKB 1WE7A 3L54A 3V6CB 5C5BA 2KZRA 3NZUA 2EMTA 2WH5A 2KN5A 1LB1A 2JP2A 3PREA 4BKSD 4A5KA 1TXDA 2K2UA 2MA9B 4IG7B 3ENEA 1WGYA 3V60A 2P0DA 2K00A 3PVUA 4EMOA 4KIKA 1DDMA 4IW0A 5JHGA 3A33B 1EGXA 3K9PB 3MDBC 3VIAA 2KX3A 2BKRB 4GDKB 5D7GA 3PHXB 4YONA 3D8FA 5KCVA 2KO3A 4LDTB 3PHWB 5E6PA 5JZEB 2ZPNA 5DI9B 5G2NA 4MK0A 1U29A 3TJPA 1Q0WB 4MELA 1HE8A 4G3XB 4FADA 4JLCA 3G9WA 4NNJB 3ZDMC 2KC2A 4N9F4 3APCA 2D07B 2J59M 1GG3A 2LVQA 4AJWA 1MG8A 2MBOA 1T0YA 5HKHA 5G55A 4AP4C 2DKQA 3VH4B 4MSMB 1WXSA 1DDWA 2J7QB 4KV2A 3VTWA 4GU2A 3DVNV 4W9HA 4E74A 3TIXA 4B95A 3SHQA 2AL3A 2AWTA 3ML8A 3SNHA 2WDTB 4GOCA 2MCNB 4HCNB 2ZCCA 3PG7A 3MPXA 4WJPA 4DX90 2R0DA 2K8BA 4WJOA 5J2RA 1Q5WB 2LOXA 1S1QB 4MH0E 2ZCBA 3V62A 1WI0A 3S2AA 1K8RB 4MJSA 2YVCA 1V5OA 4A3PA 1YQBA 4NY0A 5D3YA 4IWQA 2NMBA 3AJ4A 1IYFA 1U5FA 5CHFA 4HWIB 3EC8A 1EUVB 5AEKB 2MBBB 1DYNA 4K1RB 4WVFB 3KRWA 4WWNA 2K2JA 5E6NA 4DXAB 2RNRB 3SD5A 1KOTA 2MKRA 2CAYA 4JL9A 2ROZB 4ZYNA 3H6NA 4BOZB 4EFOA 1KLVA 4GMVA 2MSED 4Y94A 2MP2B 1C3TA 1S3SG 5C6RA 2CRFA 2DYNA 2UZSA 4FHKA 2L2IA 3M1IB 1NTYA 4TUUA 4OVVA 1MIXA 2PZ1A 3PSCA 5D6JB 2VSZA 2JZZA 4LDTD 4GPTB 1WGQA 1WGDA 5AZFA 2LG1A 2JUOA 3A9JA 3A98B 3W1SA 3RZFA 3DVGY 3HM3A 2IO1B 3V6EB 2KUPA 4TQ1A 2XQNM 2Z0EB 4ZRJA 1UPQA 2GBRA 3ODXA 1OTRB 2KJ6A 2IY0B 2DHZA 1WX8A 3U30A 4CHJA 4WWOA 4ICVA 1WX9A 2DLWA 2KTRA 2CHXA 5JH5C 3A4RA 4BOSC 3ZW3A 2PE6B 3ZLZA 2XK5B 2KQ7A 2KOXA 4URKA 2DX5B 3MHSD 4AOFA 3ZTDA 1P5TA 2GOWA 1P98A 4HAVB 2QKLA 2ZNVC 4LJOB 3AU5A 2FDQA 2P0FA 3WAPA 3Q3JA 4RM9A 3KYDD 2D9YA 1UELA 1HBKA 4P7IA 1OY2A 2D3GA 4FJYA 2O2VA 1GUAB 2FUHB 4KHOA 1A5RA 4KVGB 2DENB 2CQUA 4AWJA 2PJHA 1LXDA 4C0AA 2GS0A 4TYZA 5DHFB 5J3QA 1Z2MA 4DDGD 1EVHA 2L00B 1M94A 4JGHB 1GJZA 3KUCB 5JHAA 3M3JA 1KI1B 2NR2A 2JZ3B 2HRJA 2DFKA 2Y8FA 3N3KB 1FXTB 1XQQA 4LCDE 2EJ8A 2IO2B 1KJTA 4GIVA 1TZ1A 1FGZA 3PS6A 2D10A 3ALBA 4IFSA 2FNJB 2ZNVB 1FHOA 4IC7B 1N3HA 3M63B 4Z2MB 2LASA 2DTCA 2MDXA
chains in the Genus database with same CATH superfamily
2Z0QA 2BS2B 3I3TB 2OJWA 1MK7B 5LXIB 3UINB 1UNPA 1LGRA 2NVUI 1FB8A 2R2YA 2RGFA 2X0SA 1FO4A 4XE0A 3I57A 3Q8CA 3GYPA 3ZXRA 5DIFB 2FCQA 4LNOA 4HAWB 2QDFA 1R4NB 5CHWA 5IJMA 1NYQA 4LNNA 3MP9A 3Q3MC 1WYWB 3P2BA 1QOAA 3DDCB 1I4QA 4IWOA 2ZJDA 1BTNA 1NTIA 3NW8A 2NS5A 1TS3A 4WH4A 3AXCA 4KDLB 1V88A 3VH3B 3RT3B 4WJ7A 3BWUD 4EUTA 3ZJUA 2JSVX 2MJDA 4HB4B 4DXGA 1UH6A 3FVCA 2WXLA 5JLJB 1F1HA 2PE9A 5FK9C 5TR5A 4ITKA 3KZ1A 2GI9A 1HB8A 1RLFA 1QOFA 2LGYA 3NY5A 4WJQA 3ETRA 3AEGB 2C9WB 3U7DA 2K9XA 5BMIA 3E9LA 1J8CA 3FSSA 4N58A 3JYUA 1F9JA 1D5XC 2W9NA 2AQ3B 4B0MA 4YXDB 3X0WA 1BWNA 2YF0A 2GMIC 2H88B 2HTHB 5J3TA 1XD4A 2CHZA 2WXQA 2I1JA 2DBYA 1SGHA 3KRXA 2QHOA 4HK2A 5AZGA 1UBQA 2D11A 2XEWA 2BBCA 1IGDA 2KACA 4B9KA 3U52E 1FRDA 1XLQA 2LULA 3PLVA 5IKCM 3IBEA 4IM0A 1ENFA 2BT6A 3N20C 4D0NB 3IAM1 2WHIA 5KHOA 5CLQB 3ML4A 1N62A 2LGSA 2XN9C 3A9KB 3UF8A 3L16A 2Z0OA 5I2SA 2MX2A 2RR9A 1N5XA 3SFDB 3DBSA 2JWUA 2KN4A 2RRFA 4ILGB 2IGHA 1MG4A 3B08A 4EOYA 2W55A 3ZYYX 3ZVRA 3L08A 4YSZB 3V3XA 5E6JA 3V05A 3KLSX 1J7BA 1NVLA 1SEBD 3B2FA 4W9KA 1I35A 4MY6A 1TJEA 2KXJA 3DBHI 3HSAA 2KFKA 3GE8C 4HAZB 1WFYA 2NZ8B 4PYZA 4GSWA 1WZ3A 1F0ZA 3AE8B 1VLBA 5KQ4A 3E9OA 3HVZA 4B6WA 5D2MB 3W1YA 3NZ3A 4YWGG 4ZRQA 3LJ3A 1IPGA 5C16A 4KX6B 2L0FA 1UNQA 4CHMA 5CTRC 2DA0A 1WJ4A 1W1DA 1V86A 4YTNB 1VBHA 1SIFA 3AEAB 4ZRKA 2RLOA 2Z8LA 2INPE 1SE9A 2J0MA 2MBHA 2DAJA 2OJRA 1TGZB 3HIZA 1WGGA 1Z87A 3PT2B 4KSLC 4MT5A 4IDIA 4JKCA 1KLGD 2K5PA 3ZJVA 2E2XA 3AULA 1Y5OA 2KD0A 3BK2A 2WXHA 4W9DA 2GLSA 3TFMA 3PP2A 5J17A 3NZSA 4WAAA 2L7RA 3T9LA 3GP7A 1BMLC 3T06A 1P9DU 4N6EB 3QCAA 4G50A 3AI5A 3DHIC 3TW1A 2GCJA 1D5ZC 2NMQA 4NAMA 4GDLB 4HDOA 3L0WB 4JKHA 1GC6A 3B0AA 1LQBA 3HUIA 3U2SC 1JQ4A 3A8QA 3EA6A 2MLBA 4M8MA 3T3NA 4HPLB 2G3QB 3GYOA 1SE3A 1XT9B 2ROVA 2MFQA 2AEHA 1DDVA 1FPYA 1V6EA 1FEHA 1WXAA 4IM3A 2IO0B 1J7CA 5HI1A 1E90A 4ANXA 1YN4A 3CF6E 4AJYB 3SU8X 1HEZE 3FILA 1WGUA 3H7PB 1YIWA 2L52A 3AE5B 1T5XD 3SYXA 2NBVB 3WA0A 1E5WA 1VZ7A 2BVCA 1N60A 3DQVA 4BFRA 3L10B 3I5JC 2J53A 1EF1A 2DN6A 2WDRB 3PRMB 3VOQA 4KIKB 2C7HA 2V9HA 1XF5L 2X18A 3ZVVA 3HIEA 4O1NA 3DVNU 2YRYA 1JWUD 3VRBB 4WIPA 1XEEA 2KHWB 5AUIA 2JYTA 3RUIB 3H9DA 3N7CA 2KWDA 1U2BA 2OOBB 2W3SA 2ZW1A 4P6VF 2G4SA 2UVMA 2IBIB 3DBRI 3HQCA 4Z2NA 1ROEA 3IAS1 5GOWB 5TSSA 1UEFA 4ARCA 4RGNA 4KHBB 2FCNA 3WYFB 2R2QA 2K0PA 1YNTE 3DXEA 1VD2A 1U5EA 4GGQA 2D3BA 4HEA1 3KUDB 3OHMB 2H7EA 2W2WA 3MFGA 4KGSA 4KGTA 4MEMA 3NVZA 4K7SA 3SO6A 2YLMA 2RUKB 3LXFA 1I7HA 1LW3A 1ZP0B 2Z59A 1KF6B 2INDC 4KZ0A 1KZ7A 2HJ8A 3VTUA 1TTNA 3PEGA 4A6FA 1WGHA 1I4XA 4K2OA 4OZAA 4DBGA 4MACA 4PNKA 3DOWA 2FJ9A 4C4VA 2GBMA 2BS4B 2KQ4X 1VRAB 2INCC 4RGOS 3OG5A 2FUG1 3VUWA 3X23A 3Q2AC 1WSPA 2MP2A 1GB4A 1MPEA 1MVKA 1TIFA 3SV1A 2BGFA 1Z5SB 2Y3AA 1WMHB 1YMHE 2CKHB 3KH0A 2W2XD 2IYBA 3LDZE 3RMKC 3TEWA 3VXWA 2D9ZA 4EZKA 2V76A 1NI2A 1K5DB 3SUZA 4WQOB 5DPWA 1VR9A 2NPTB 2KX0A 1MKEA 5J18A 1B1ZA 1TY2A 2IDYA 1ZVRA 1V49A 2HE7A 2N23A 4R3DA 4OZCA 3PRZA 5L95C 2LGIA 1WM2A 3VAWA 2GUMA 4MJSB 2LXCA 3W9CB 2MWNB 1TBEA 2EMSA 4I6PA 1RRPB 2FJLA 1E0ZA 5AUKA 2LJ5A 3VR9B 1J0WA 3FEHA 5KHQA 2UYZB 5LLIA 4N59A 1KTKA 5JP4A 2JRHA 2LJIA 1BXTA 2LKOA 2K1FA 3ZNHB 1LFDA 4KSKC 3WALA 3U8ZA 4RF0A 2Z0DB 4JKGB 2KTFA 5H8YE 4A6KA 4EKUA 3E9PA 3LB8C 3F5RA 2YT2A 4XGAB 1D3ZA 3KUZA 3E66A 2XK5A 2RVBB 1SHCA 1T3QA 3R7RA 1Y8RC 2D5GA 2BKFA 2KR0A 3DBLB 4ZHOA 4BKTA 1UGMA 1WZ0A 3PZDA 1FHWA 3SBGA 3PRPB 2MBQA 4IAPA 1RFAA 4L6EA 1FAOA 4GN1A 3NRZA 4IUMB 5IA7A 3ZO5B 4MGIE 2K25A 1KM7A 2NTSA 2WXNA 4XWXA 4W9GA 2GRIA 4RMAA 1UD7A 5CHVC 4JWUC 3V5WA 3RULA 5EE3A 2JZPA 3RCZA 2RDBC 2KWVB 2DX1A 2SEBD 1BT0A 1P1AA 3L13A 2QEJC 1TQZA 3KYCD 1PDXA 1ZXIA 3TMPB 4HJGE 4WJNA 3N30A 1ZW7A 2QC8A 2YS3A 4NSWA 1I2HA 2N7EA 3UIOB 1UUPA 2K39A 2N9XA 5D94A 1X1MA 2FJUB 2CY5A 2W3RA 4D2KA 3IHPC 3TO1A 5JHBA 1RRBA 5IP4D 1ISNA 4MT7A 1ZDXA 2FAZA 2JT4B 2KK8A 3QIJA 2YT1A 4UDUC 4USAA 1SXTA 1UF0A 2NBUA 4RGMA 1RFKA 4DBBA 2KDBA 4A3OA 1HA5A 4MGKE 1AW7A 4HKQA 4EZLA 3BYTB 2WXIA 3DXDA 1BUIC 2QJLA 4II3B 2CJNA 2QMTA 1J19A 2RDHA 1IBXB 4B6HA 1E6EB 4RNAA 3N1YC 1MFWA 4HB3B 4HVBA 5LXHA 1V5MA 3OANA 4BBNC 3NVWA 2AQ1B 1V97A 3APDA 1U5DA 4DDID 2ZZPB 3AH7A 1XR0B 4YSYB 2UU7A 1PFJA 3R2TA 1EWYC 1OQRA 2UWQA 2WXMA 2Z14A 2DZJA 2O2VB 2LRWA 3Q69A 3ZGZA 1WVHA 1TJ6A 5FI0A 3RNCC 4A90A 3OLMD 2L32A 4K7WA 5HE0A 1XKEA 2KANA 2WP9B 3WAOA 2L8JA 1TS2A 1KH0A 4ZOHC 3Q3FA 2V4LA 5DH9B 4IOYX 2K49A 1Q1OA 3L4PA 4QJ3B 2XNAC 1FFUA 1FNUA 2KDMA 2L76A 4W9CA 4ACFA 3IVFA 3VHTC 2J4XA 4BKSA 4G0NB 3AE1B 1F77A 1XX0A 1L2NA 2LUMA 1F52A 3VDZA 2EC1A 1U4AA 4IWPA 1IRSA 2CJOA 1SB3C 1J0GA 3Q8AA 3RNEC 1UGJA 2B3AA 1EU3A 1BAKA 3TL5A 4TQ0A 3TCAA 1KFYB 3UQBA 3J9CA 2YS5A 1I7AA 4X57B 3RZWC 2UZRA 2LXAA 4MGZE 4ARIA 1GC7A 4PK1A 1X86A 2OEDA 3ONSA 1HZ6A 2M0AA 3CIKA 3U4EG 2K8EA 4LJPB 4BAXA 1TS5A 3L17A 1ZPSA 2A5UA 5DPRA 5LONB 2WYQA 1M4VA 3H7SA 3WIMA 1HTQA 1ST7A 4KAXB 4B0EA 2W54A 1PUTA 4JKFA 2LI5A 1WJMA 1FHXA 2G1EA 1YN5A 4ZDVA 2Z13A 4TKNA 2JF5A 3DBLI 3W5UB 1I4GA 2WXFA 1YN3A 1IP9A 2CODA 3AE9B 3AM9A 2BWES 4PS8A 1B55A 4LLGM 1L6VA 3QQ8B 1E8WA 2LD9A 1YX6B 2C5LC 2C60A 2HTHA 3GZNB 2ABDA 4HB0B 3QWMA 1SJHD 2VRRB 3B1LX 1ZSQA 4YT0B 4BBNF 3QAQA 4II2B 2WDVB 2G35A 2YSZA 1HTOA 3GOEA 3PPAA 2DHIA 2DAFA 3C19A 1W1GA 1ZKHA 2LRUA 2MRPA 5EE9A 3ZRCA 2K8HA 2QKMA 3GB1A 2NCNA 1OEYJ 1R4MB 1AWDA 4EZJA 3ULCA 2IYDB 4MSQB 4HXDA 2KJHB 4FLHA 2N1WA 5G5HA 4E71A 2A4ZA 1RWSA 1H10A 1TKEA 3EECA 4WWPA 2M17A 3C0RB 2V3PA 3IT4B 1AARA 3ZKJC 2W2XC 3PSEB 4P16A 4OVUA 1WWTA 4M02A 3KSYA 1L7YA 1FOEA 3OJ3A 2INNE 1RJ2A 4P1BC 1P3QU 4WAFA 4TV3A 2KMMA 2AL6A 4AS1A 2L0TA 4W9JA 4PS7A 4F7HA 3Q6BA 3EPYA 3PTFC 3JSVB 2O6VB 4J6IA 4RF1A 5EDSA 5G5GA 4DWFA 2M56B 3NJTA 1FCLA 1VCBA 2VZKB 2KVRA 1QF6A 2PVOD 2YT0A 3I63C 4RCOA 4XC2A 2BPSA 2WWZA 5C23A 1EM7A 5IO9A 4DX8A 3D8EA 2NBWB 3DVGX 1AWEA 1DOIA 2KLCA 2PEAA 3P6AA 1N6ZA 2JY6A 2Y5CA 1CMXB 3JW0X 1WM3A 1NTVA 3ULBA 1OMWA 1TT5B 2D9WA 2KKCA 3FLVA 1TKYA 3N1ZC 3QBVB 2Y5PA 1NEKB 1TZOA 2M4NA 5JHHA 3QARA 3A1QB 1I42A 3RNGC 2RDGA 1EO6A 4HB2B 3NHEB 4EEWA 3UQAA 4H2AA 2L1CA 5AZHA 1MPHA 2K6QA 3RNBC 4FN2A 3VFKA 4W9LA 2Y7BA 4CYEA 1R7SA 2I5CA 3WAMA 1WJUA 4GDLA 1K53A 1V1PB 5EE1A 4NAWB 3B9JA 4ZYSA 1TYGB 1WX7A 2QSDA 4GDKA 3ZNGC 3RCPA 3FP5A 4US9A 5D3VA 3KY9A 2IGGA 2M19A 3DWMA 1X05A 2D4QA 5DPSA 2AYOB 3AEBB 4GB9A 1AN8A 1Y19B 2KWUB 3CMMB 1C77A 1V5PA 3EFCA 1ZC4B 4W9IA 3CWIA 4AUQC 1P3RA 1R4NI 1SBBB 3ZNZB 4ANVA 3W5VB 2MHJA 3H7PA 2DHJA 3VVWB 2DZIA 2JVCA 2ONQA 5CX3A 1GOZA 2NBVA 1JRUA 1UWMA 4WQMA 1P0RA 1YQ3B 5C5BB 1K5GB 3LJUX 1WI1A 2ZEQA 1NU2A 2M38A 2DYOA 2QCZA 4W9EA 1JCKB 3NOBA 2MWSB 4HPPA 4LNIA 1WGKA 3IG3A 2MEKA 5D3WA 4KZCA 3FAHA 1L6UA 3P4SB 1F2RC 4JQWC 3RFZB 3ODWA 3WCQA 4PS3A 1X1FA 1JRPA 1P7FA 1PLSA 1V80A 3GZNI 3UGBB 2IY1B 1GNUA 1SE2A 1TY0A 1M7RA 1C9FA 1UNRA 4FJZA 2EKIA 4K7UA 1VDVA 1T0QC 3NWFA 3PV1A 4KHBA 2N9LA 3QC8B 4KDIC 1MHHE 1E7PB 2DYBA 4A6QA 3TSSA 3DWGC 1R4MI 3PO0A 2ZVNA 3AU4A 5DHAB 3AE4B 5FR3A 3TEYA 2DZKA 3ECIA 2KWCA 2CR5A 1E8YA 2MBEA 4JK7A 4ZRIA 3PVLA 4NJCA 1CQVA 2RSGA 1UWXA 3EHVA 1NVID 3AE3B 2LGXA 2B76B 2O6VD 2CHWA 2VKIA 4H8SA 1XODA 2QIEB 2H89B 4JX1C 1V8CA 1PGBA 5BO4B 2FIDA 3U12A 4NQLB 2MJEA 1JWMD 4DIXA 5KQ1A 2KDFB 2VZKD 2D2QA 2C7MB 5JVLA 2GBKA 2LGDA 4GMXB 1WXVA 2V3NA 1L0VB 3V61A 1WR1A 4GXBA 2R2OA 2L83A 1JROA 1WY8A 1EF5A 2ICIA 2Y8GA 2IZVB 1WMHA 2COAA 5GMVA 2IO3B 2LUEA 1ZM0A 2RD0A 2OQBA 2JXXA 2BTEA 1HB6A 1W1HA 1KLUD 2REXA 2DHKA 1RAXA 2OTXA 4JIOU 4GOUA 2JRIB 1XCTL 1JDEA 1V5UA 1N61A 2NPTA 5LOPB 5C1ZA 3BVZA 3TVVA 4OT1A 1PMSA 2FCMA 2M1MA 2K3UA 1V5TA 1I4RA 5L81A 1OQQA 2V3SA 1NDDA 1ET6A 1DOXA 4LTUA 2KFJA 1ZC3B 4DK5A 3RNFC 1T6BX 3AE6B 5BYQA 3MJ5A 1KRHA 4ANWA 3N9YC 1KC7A 4WURA 2HTME 2IGDA 1UBIA 1DROA 2ZVOA 3D32A 1H4RA 2WXPA 2V1YA 2XBBC 4HCPB 4F7ZA 1EU4A 2C7NB 1PYWD 1WRDB 1OQNA 5DPTA 3RNAC 4S0RA 3W1SC 3KW5B 4E3CA 2Z59B 1X1GA 2LWPA 4MGYE 2BF8B 1YX5B 4IKGA 1LO5D 1FNVA 1XXGA 4A6FB 3ZDTA 4F7GA 1ACAA 2BQQA 3APFA 3DCXA 3OJ4B 2KQSA 4CO7A 2M14A 3A8PA 2FCSA 3K9OB 4I6NB 3JVZX 4MM3A 3NWDA 1UZXB 3AV8A 3M62B 3SBTA 4K17A 1K51A 3NS8A 4WSFA 2D9XA 1L4DB 4JKAA 1XO3A 1YJ1A 5DCNA 5D3DA 2I2YA 1LM8B 1WGRA 2H7DA 1XD3B 2GB1A 5LG4B 2PPHA 3P1MA 3F0WA 4FA6A 4ICUA 3P7ZA 4HPMB 4J3OD 3CSTA 3P4RB 2GBNA 5C79A 5H92C 2PKOA 3RD2A 1GGOA 2Y5BB 2DX5A 1D5MC 2V0GA 2D3AA 3VR8B 5LNK1 3H1UA 1SIJA 3RI7C 4M8NA 1WJ1A 2ELBA 1I4HA 5FR6A 3H8HA 2P8VA 4CSQA 2LEKA 1QZEA 1WR6E 5I4DA 1IUEA 4FULA 2TSSA 4NJ6A 2N0SB 4HAUB 3ZUNA 3ZRFA 2Z0PA 1H8CA 5D3IB 1V61A 1E7VA 4MH8A 4XYCA 4PQ0A 2BS3B 4KGRA 3TBLD 4C00A 3A9JB 4HAXB 4KKIA 4MDKE 1V89A 2N0YA 4KHAA 3N32A 4BKGA 4EJNA 3FM8C 4I6LB 2G45B 2KLGA 3UIPB 5T8IA 1OGWA 3A4SC 3QK0A 2X38A 2DYMA 1E8ZA 2I5FA 4D6WA 1WE6A 1STEA 3HM6X 1MI1A 3R7QA 2P0HA 1MK9B 2D9VA 5CLLB 2CB8A 2YS1A 2MH7A 3ZNID 2QILA 4IM2A 1ET9A 2KTRB 3MJWA 2FIFA 3NUHB 2RMMA 2LBBA 3MC8A 4YSXB 3AE2B 2KMCA 2GCLA 1XCGA 2WXRA 2LYDA 3NVYA 2BYVE 5FI1A 2ASQA 3EFUA 2COCA 2COPA 1QQGA 2WU5B 4OHJA 2N9PC 4C80A 4F8CB 1G6JA 1AQCA 3IXSA 1NI3A 2JWZA 2N4FA 3AEDB 4EE2A 2IFSA 2PVGC 3Q8EA 1WG7A 1QT9A 1P6SA 4QJ4B 1OQYA 1F2RI 4RM8A 4F1SA 2LZ6A 2FBWB 1YOVB 2EKEC 1A70A 1NYRA 1JALA 4JE3B 4GZUA 1DGJA 2M8SA 3VUXA 3P4QB 1QKZA 4HATB 3O96A 3QWZB 3HHMA 1MAIA 3B77A 3QJZA 1V1OA 2CU3A 3Q3NC 4YL8A 3CXBB 3VQIA 1WIAA 4PYUA 4YTPB 3PZ7A 4DHJB 3E9SA 4CHKA 2J0JA 2DYQA 4GLSC 3FKYA 2RPQA 3BVMA 4M0WB 2FE8A 2M0XA 4A20A 3RYTA 2RGNB 1VZ8A 3AMZA 3PGEA 1L4ZB 3R3MA 2GJYA 3AB5A 4OZBA 4HKZE 2KDEB 3DXCA 2L3ZA 2JX5A 2PW9A 2N9EB 1MIZB 3M95A 2COFA 1TS4A 2G4DB 5HE1A 2BCJA 4XWWA 4FBJB 1KZGA 1EAZA 2LHDA 1WJ6A 2J0KA 2KGXB 3T3OA 3BJIA 1M7EA 1U5GA 4BVUC 2CS4A 4NJ7A 2N7DA 1C76A 1X11A 1C79A 1WRIA 1UPRA 4F7UP 1NBFC 3ZIMA 5HE3A 4JPSA 4HJKA 5EFXA 4W9FA 5BYSA 2KNBA 3VUYA 2ELAA 3T8MA 5IRSA 1V81A 4LNFA 3CIRB 4FHJA 2LFIA 1HXYD 3QHTA 3AECB 2VRWB 3O65B 2R09A 2Q5WD 1XCQL 1BTKA 3CSFA 4DHZB 1PQSA 1V9JA 4ANUA 2V4IB 3BY4B 1Q10A 4JKBA 3HW2B 2MW5A 3VTVA 1FGYA 1QC6A 4HDQA 2K8CA 2ADZA 1ZGUB 3GE3C 2PLPA 2WX0A 4K2PA 1UNSA 1V2YA 1FNWA 2WGSA 4NZLB 3QA8A 2KC1A 1C1YB 4HAYB 2KDIA 1YQ4B 1WH3A 2AQ2B 2N7JA 3DHGC 3SDLC 3ODOA 4M01A 4JKDA 3HK0A 2WXJA 4HRSA 2KMAA 1QILA 4XZ4A 3BINA 1L0XB 2N1VA 5D27A 1WJNA 4L1RA 1VJKA 2BWFA 1ESFA 1J7AA 2RQ1A 2WXOA 4FJVB 3A9KA 3PLUA 2J52A 3JSVA 2O6VA 2K6DB 3PVWA 1ZOYB 4REZA 2Q13A 1GB1A 1U27A 4C7ZA 2LMCA 4NQKE 2LVPA 3KVFB 4G11A 3ZXVA 3MTNB 2DKPA 4NPNA 3UZTA 4DQOC 2DIKA 2K22A 2I38A 1QQRA 2JU6X 3BK1A 4QJ5B 2DZMA 4JWSC 1YJIA 5E6OA 1DBHA 4XDCA 2ON8A 4A6HA 2GBJA 2ZPYA 1P7EA 1K52A 3R2IA 3DBRB 3EGRA 3NS1A 3PZ8A 2NTTA 3NSUA 2WX1A 1WF9A 1C4CA 1MHXA 3IFWB 2I1KA 4HHVA 4BZAA 1Y56A 4DHJD 2BYTA 2CU1A 3Q14C 2KIEA 1YJJA 3WANA 2KCJA 2HD5B 1L5PA 4XDDA 2CY4A 1Q67A 4DHZE 2L05A 1E10A 4K81A 2JPHA 1YD8U 3A1QA 2KJRA 5L83A 3DCGA 2WS3B 4XX5A 1E7UA 3B2GA 5D3XA 4LNKA 3DPDA 2WLBA 3R66C 3ZTCA 3QX1A 5IAAC 2RSUA 2W82A 4C56C 1V1PA 4ASWC 4NAWA 5BYRA 4BBKA 1GAQB 2MQJA 3OAWA 2KUQA 2LOZA 1SF0A 5HE2A 2VH1A 3SFEB 5J3YA 4TMAB 3BZDB 4HLEA 3ZJTA 1WXMA 3W2DA 3SEBA 4WWMA 1E8XA 2BYFA 2E6XA 5FKAC 3D8DA 2LVOA 2DNFA 3ML9A 2BYEA 4XWTA 1OEYA 3RN9C 2KFKB 1WE7A 3AN1A 3L54A 3V6CB 5C5BA 3Q3OC 2KZRA 3NZUA 3URYA 2EMTA 2WXGA 2WH5A 4YTMB 2KN5A 5HFYA 3MHZA 1JWSD 1ACCA 1LB1A 5GXGB 2JP2A 3PREA 3MC0B 2PTLA 4BKSD 3A58A 4A5KA 1TXDA 4HSIA 4TSSA 1T77A 2OHFA 4A55A 3C8YA 4OW0A 1E9MA 2K2UA 2MA9B 2ACZB 4IG7B 2BB5A 3ENEA 3GS2A 2WNMA 1WGYA 3BIID 3V60A 2P0DA 2K00A 3PVUA 4EMOA 4KIKA 1DDMA 1JWAD 4IW0A 1HZ5A 4K3CA 5JHGA 3A33B 1EGXA 4L2YA 2LHEA 3K9PB 4RFBA 3MDBC 3VIAA 2KX3A 1ZE3D 2JYEA 2BKRB 2E3TA 4DXFA 4GDKB 5D7GA 2AX5A 3PHXB 4YONA 5IOIA 2HJ1A 3D8FA 5KCVA 2KO3A 4LDTB 4ZRPA 1FXAA 3PHWB 5E6PA 5JZEB 1FXIA 2ZPNA 3TEZA 5DI9B 5G2NA 4MK0A 1U29A 3TJPA 4AQ7A 1QOGA 1Q0WB 5JXVA 4MELA 1HE8A 4G3XB 4FADA 4JLCA 2EELA 4US8A 3G9WA 4NNJB 2BW2A 3ZDMC 2KC2A 4N9F4 3APCA 3MC9A 2D07B 2J59M 1GG3A 2LVQA 4AJWA 3P42A 4ILHA 1MG8A 1C78A 2MBOA 3Q8BA 1T0YA 1MJDA 2PMVA 3FILB 5HKHA 5G55A 3NG0A 4AP4C 1TKGA 2DKQA 3VH4B 4MSMB 1L0YB 5EE0A 2JXTA 3EUB2 3ENBA 1WXSA 1DDWA 2J7QB 4FXCA 4KV2A 5C2TB 3VTWA 1CK1A 4GU2A 3DVNV 1C4PA 4W9HA 4E74A 3TIXA 3KQ4A 5BMGA 4B95A 4OSNA 1DYQA 3SHQA 1N5WA 1XLOA 2AL3A 2AWTA 4PT5A 3ML8A 3SNHA 1VBGA 2WDTB 4GOCA 3I9V1 2MCNB 4HCNB 2ZCCA 3PG7A 3MPXA 4WJPA 3P4PB 4DX90 2BB6A 2R0DA 2K8BA 4WJOA 1SSNA 5J2RA 1Q5WB 2DWQA 2LOXA 5BMHA 1S1QB 4MH0E 2ZCBA 2R82A 2ZKMX 3V62A 1WI0A 3S2AA 1K8RB 2ZW0A 4MJSA 2YVCA 1V5OA 4A3PA 4RH6A 1YQBA 4NY0A 4K3BA 5D3YA 4QXAB 4IWQA 2NMBA 3AJ4A 1PGXA 1IYFA 1U5FA 5CHFA 3UI3A 4HWIB 1XLNA 4GNKB 3EC8A 1EUVB 1XLPA 5AEKB 1FM0D 2MBBB 4A9AA 1DYNA 4K1RB 4WVFB 1IGCA 5HG2A 1JWBD 3KRWA 4WWNA 2K2JA 5E6NA 2PIAA 1ZYIA 4DXAB 2RNRB 1C4AA 3SD5A 3TEXA 1KOTA 4JKGA 2MKRA 4L23A 2CAYA 1K50A 4JL9A 2YEPB 2ROZB 1SJED 1NENB 4C4VB 4ZYNA 1D4BA 3FC4A 2KAJA 3NVVA 3H6NA 4BOZB 4EFOA 1KLVA 4GMVA 1ZXHA 2MSED 3DHHC 1JW9D 4Y94A 2MP2B 1FRRA 3ABVB 1C3TA 4C7YA 1S3SG 5C6RA 2CRFA 2DYNA 4JK9A 4ZHPA 2UZSA 4FHKA 4KKJA 2L2IA 3M1IB 2JQRB 1ZDVA 1NTYA 4TUUA 3Q8FA 4OVVA 1MIXA 2YEPF 3AE7B 2PZ1A 3PSCA 3R8BA 1FD6A 5D6JB 2VSZA 2JZZA 4RGTA 4LDTD 4GPTB 1HQRD 1WGQA 1WGDA 3AEEB 2LG1A 2JUOA 2X8XX 3A9JA 3A98B 4IOIE 5AZFA 3W1SA 5IN7A 3HRDD 3IT6B 3RZFA 3DVGY 4JKEA 4M00A 2IJ0A 3HM3A 2IO1B 3V6EB 2KUPA 4TQ1A 1DOYA 2XQNM 2Z0EB 4ZRJA 1UPQA 4A8XC 2GBRA 3ODXA 1OTRB 4MM3B 2KJ6A 2WDQB 2IY0B 1MI0A 1FFVA 2DHZA 1WX8A 1B9RA 3U30A 4OVZA 4CHJA 3N1XC 4WWOA 4ICVA 1WX9A 2DLWA 2Z4DA 2KTRA 2CHXA 5JH5C 3A4RA 2WQYB 1RM6C 4BOSC 3ZW3A 3U7ZA 5HHDG 2PE6B 3ZLZA 2XK5B 1OFFA 4P1CC 2KIGA 2KQ7A 2KOXA 2MJ3A 4URKA 2DX5B 3MHSD 3P63A 4AOFA 3ZTDA 1P5TA 2GOWA 1P98A 1PGAA 1QOBA 4CQNA 1IBXA 2KYWA 1I4PA 4HAVB 3VRAB 2QKLA 1DIKA 2ZNVC 4LJOB 3AU5A 2FDQA 2P0FA 3WAPA 3Q3JA 1FMAD 4RM9A 3KYDD 2D9YA 2WXKA 1UELA 2N9KA 5M4YB 2G9HD 1HBKA 4P7IA 3HVDA 3AEFB 1RYJA 2DLBA 3SR6A 1OY2A 1GPXA 2D3GA 4FJYA 4QAYA 2O2VA 1GUAB 2FUHB 2KT7A 4KHOA 1A5RA 4KVGB 2DENB 2CQUA 4M0WA 4AWJA 2IPKD 2R61A 2PJHA 5C3JB 4S17A 2KVZA 1LXDA 4C0AA 2D3CA 2GS0A 4TYZA 5DHFB 5J3QA 3KWVA 1Z2MA 3BYYB 4L1BA 4DDGD 4HROA 1EVHA 2L00B 3NWAA 3ZQ4A 1CZPA 1M94A 5MPOA 4JGHB 3LYYA 1GJZA 1AYFA 3KUCB 5JHAA 1EWCA 3E56A 3M3JA 3DBHB 1KI1B 2NR2A 2JZ3B 2HRJA 2DFKA 2Y8FA 3N3KB 1FXTB 1FCCC 4LK0M 1XQQA 4LCDE 2EJ8A 1T0RC 3OWEB 2IO2B 1KJTA 3RPFC 4GIVA 1T0SC 1TZ1A 1WXQA 5I2MA 1FIQA 1JMLA 1FGZA 3PS6A 1D6EC 2SAKA 2HDEA 2D10A 1N63A 4ILJA 1WYGA 3ALBA 1VZ6A 3KWLA 4IFSA 2FNJB 4Q2JA 2ZNVB 1ZUD2 1FHOA 4JK8A 2L1AA 2VH2A 1CJEA 3O13A 2WU2B 2J42A 1QLBB 4IC7B 1N3HA 3M63B 3TUOA 3BVGA 1KBLA 4Z2MB 2LASA 2DTCA 2RPVA 2MDXA 1SE4A 1PFDA
chains in the Genus database with same CATH topology
2Z0QA 3I3TB 1MK7B 5LXIB 3UINB 1UNPA 2NVUI 1FB8A 2RGFA 2X0SA 3GYPA 5DIFB 2FCQA 4HAWB 5CHWA 5IJMA 1WYWB 3P2BA 3DDCB 4IWOA 2ZJDA 1BTNA 1NTIA 2NS5A 3AXCA 4KDLB 1V88A 3VH3B 3RT3B 4WJ7A 4EUTA 4HB4B 1UH6A 5JLJB 2PE9A 5TR5A 3KZ1A 1HB8A 1RLFA 2LGYA 3NY5A 4WJQA 2C9WB 3U7DA 3E9LA 1J8CA 3FSSA 3JYUA 1F9JA 2W9NA 3X0WA 1BWNA 2YF0A 2GMIC 2HTHB 5J3TA 1XD4A 2CHZA 2I1JA 4HK2A 1SGHA 3KRXA 2QHOA 5AZGA 1UBQA 2D11A 2XEWA 4B9KA 2LULA 3PLVA 3IBEA 4IM0A 4D0NB 5KHOA 5CLQB 3ML4A 3A9KB 3UF8A 3L16A 2Z0OA 2MX2A 2RR9A 3DBSA 4ILGB 3B08A 4EOYA 3ZVRA 3L08A 1NVLA 4W9KA 1I35A 4MY6A 2KXJA 3DBHI 2KFKA 4HAZB 1WFYA 2NZ8B 4PYZA 4GSWA 1WZ3A 5KQ4A 3E9OA 4B6WA 5D2MB 3W1YA 3LJ3A 1IPGA 5C16A 2L0FA 1UNQA 4CHMA 5CTRC 2DA0A 1WJ4A 1W1DA 1V86A 1VBHA 1SIFA 4ZRKA 2RLOA 1SE9A 2J0MA 2MBHA 2DAJA 2OJRA 1TGZB 3HIZA 1WGGA 1Z87A 3PT2B 4KSLC 4JKCA 2E2XA 3AULA 1Y5OA 2KD0A 4W9DA 3TFMA 3PP2A 5J17A 3NZSA 4WAAA 2L7RA 3T9LA 3T06A 1P9DU 3QCAA 4G50A 3AI5A 3TW1A 2GCJA 4GDLB 4HDOA 3L0WB 4JKHA 1GC6A 3B0AA 1LQBA 3A8QA 2MLBA 4M8MA 4HPLB 2G3QB 3GYOA 1XT9B 2ROVA 2MFQA 2AEHA 1DDVA 1V6EA 4IM3A 1WXAA 2IO0B 1E90A 4ANXA 3CF6E 4AJYB 3SU8X 1WGUA 3H7PB 1YIWA 3SYXA 2NBVB 3WA0A 1E5WA 3DQVA 4BFRA 3L10B 1EF1A 2DN6A 3PRMB 3VOQA 4KIKB 2C7HA 2X18A 3ZVVA 3DVNU 2YRYA 2KHWB 3RUIB 3H9DA 3N7CA 1U2BA 2OOBB 2G4SA 2UVMA 2IBIB 3DBRI 3HQCA 4Z2NA 5GOWB 1UEFA 4KHBB 2FCNA 3WYFB 2R2QA 3DXEA 1VD2A 1U5EA 4GGQA 3KUDB 2H7EA 2W2WA 4MEMA 4K7SA 3SO6A 2YLMA 2RUKB 1LW3A 4KZ0A 1KZ7A 2HJ8A 3VTUA 1TTNA 3PEGA 4A6FA 1WGHA 4K2OA 4DBGA 4PNKA 3DOWA 2FJ9A 2GBMA 3VUWA 3X23A 2MP2A 3SV1A 2BGFA 1Z5SB 1WMHB 2CKHB 3KH0A 2W2XD 2IYBA 3LDZE 3VXWA 2D9ZA 4EZKA 2V76A 1NI2A 1K5DB 3SUZA 4WQOB 5DPWA 2NPTB 2KX0A 1MKEA 5J18A 1ZVRA 1V49A 2HE7A 2N23A 3PRZA 5L95C 1WM2A 3VAWA 4MJSB 2LXCA 2MWNB 1TBEA 2EMSA 4I6PA 1RRPB 2FJLA 2LJ5A 1J0WA 3FEHA 5KHQA 2UYZB 5LLIA 5JP4A 2JRHA 2LKOA 2K1FA 3ZNHB 1LFDA 4KSKC 3WALA 3U8ZA 2Z0DB 4JKGB 2KTFA 4A6KA 4EKUA 3E9PA 3F5RA 1D3ZA 3KUZA 3E66A 2XK5A 2RVBB 1SHCA 3R7RA 1Y8RC 2BKFA 4BKTA 1UGMA 1WZ0A 3PZDA 1FHWA 3SBGA 3PRPB 2MBQA 4IAPA 1RFAA 4L6EA 1FAOA 4GN1A 5IA7A 4IUMB 3ZO5B 4MGIE 2K25A 1KM7A 4XWXA 4W9GA 4RMAA 1UD7A 5CHVC 3V5WA 3RULA 3RCZA 2KWVB 2DX1A 1BT0A 1P1AA 3L13A 1TQZA 3KYCD 3TMPB 4WJNA 3N30A 1ZW7A 2YS3A 4NSWA 1I2HA 2N7EA 3UIOB 2K39A 2N9XA 5D94A 1X1MA 2CY5A 3IHPC 3TO1A 5JHBA 1RRBA 1ISNA 4MT7A 2FAZA 2JT4B 2KK8A 3QIJA 2YT1A 2NBUA 4DBBA 2KDBA 4A3OA 4MGKE 4EZLA 3DXDA 4II3B 1J19A 4B6HA 4HB3B 4HVBA 5LXHA 1V5MA 3OANA 4BBNC 3APDA 1U5DA 4DDID 2ZZPB 1XR0B 1PFJA 2UWQA 2DZJA 2O2VB 2LRWA 1WVHA 1TJ6A 5FI0A 3OLMD 4K7WA 5HE0A 1XKEA 2KANA 3WAOA 2L8JA 3Q3FA 2V4LA 5DH9B 4IOYX 1Q1OA 4W9CA 2L76A 3IVFA 3VHTC 4BKSA 4G0NB 1XX0A 1L2NA 3VDZA 2EC1A 1U4AA 4IWPA 1IRSA 1J0GA 2B3AA 1BAKA 3TL5A 4TQ0A 3TCAA 3UQBA 2YS5A 1I7AA 4X57B 3RZWC 2UZRA 2LXAA 4MGZE 1GC7A 1X86A 3ONSA 3CIKA 4LJPB 3L17A 2A5UA 5DPRA 5LONB 2WYQA 3H7SA 3WIMA 1ST7A 4KAXB 4JKFA 2LI5A 1WJMA 1FHXA 4ZDVA 2JF5A 4TKNA 3DBLI 1IP9A 2CODA 2BWES 4PS8A 1B55A 3QQ8B 1E8WA 2LD9A 1YX6B 2C5LC 2C60A 2HTHA 2ABDA 4HB0B 3QWMA 3B1LX 2VRRB 1ZSQA 4BBNF 3QAQA 4II2B 2G35A 2YSZA 3GOEA 3PPAA 2DHIA 2DAFA 1W1GA 1ZKHA 2LRUA 2MRPA 3ZRCA 2K8HA 2QKMA 2NCNA 1OEYJ 4EZJA 3ULCA 2IYDB 4MSQB 4HXDA 2KJHB 4FLHA 2N1WA 4E71A 2A4ZA 1H10A 3EECA 4WWPA 2M17A 3C0RB 1AARA 3ZKJC 2W2XC 3PSEB 4OVUA 3KSYA 1L7YA 1FOEA 3OJ3A 1RJ2A 1P3QU 4TV3A 2AL6A 2L0TA 4W9JA 4PS7A 4F7HA 3EPYA 3PTFC 3JSVB 2O6VB 4J6IA 5EDSA 4DWFA 1VCBA 2KVRA 2YT0A 4XC2A 2BPSA 2WWZA 5C23A 4DX8A 3D8EA 2NBWB 3DVGX 1AWEA 2KLCA 2PEAA 3P6AA 2JY6A 1CMXB 3JW0X 1WM3A 1NTVA 3ULBA 1OMWA 2D9WA 2KKCA 3FLVA 3QBVB 2M4NA 5JHHA 3QARA 3A1QB 1I42A 1EO6A 4HB2B 3NHEB 4EEWA 3UQAA 2L1CA 5AZHA 1MPHA 2K6QA 4FN2A 3VFKA 4W9LA 2Y7BA 4CYEA 2I5CA 3WAMA 1WJUA 4GDLA 4NAWB 1WX7A 4GDKA 3ZNGC 3RCPA 3FP5A 5D3VA 3KY9A 1X05A 2D4QA 5DPSA 2AYOB 4GB9A 1Y19B 2KWUB 3CMMB 1V5PA 1ZC4B 4W9IA 4AUQC 1P3RA 1R4NI 3ZNZB 4ANVA 3H7PA 2DHJA 3VVWB 2DZIA 2JVCA 5CX3A 1JRUA 1P0RA 5C5BB 1K5GB 3LJUX 1WI1A 2ZEQA 1NU2A 2M38A 2DYOA 4W9EA 3NOBA 2MWSB 3IG3A 5D3WA 4KZCA 4JQWC 3ODWA 4PS3A 1X1FA 1PLSA 1V80A 3GZNI 3UGBB 2IY1B 1GNUA 1M7RA 1UNRA 4FJZA 4K7UA 3PV1A 3QC8B 4KDIC 2DYBA 1R4MI 2ZVNA 3AU4A 5DHAB 2DZKA 3ECIA 2KWCA 2CR5A 1E8YA 2MBEA 4JK7A 4ZRIA 3PVLA 2RSGA 3EHVA 2LGXA 2O6VD 2CHWA 2VKIA 4H8SA 1XODA 5BO4B 2FIDA 4NQLB 5KQ1A 2KDFB 2D2QA 2C7MB 5JVLA 2GBKA 2LGDA 4GMXB 1WXVA 3V61A 1WR1A 4GXBA 2R2OA 1WY8A 1EF5A 2Y8GA 2IZVB 1WMHA 2COAA 5GMVA 2IO3B 2LUEA 1ZM0A 2RD0A 2OQBA 2JXXA 1HB6A 1W1HA 2REXA 2DHKA 1RAXA 2OTXA 4JIOU 2JRIB 1JDEA 1V5UA 2NPTA 5C1ZA 5LOPB 3TVVA 1PMSA 2FCMA 2M1MA 1V5TA 5L81A 2V3SA 1NDDA 2KFJA 1ZC3B 4DK5A 4ANWA 1KC7A 1UBIA 1DROA 2ZVOA 3D32A 1H4RA 2V1YA 2XBBC 4HCPB 4F7ZA 2C7NB 1WRDB 1OQNA 5DPTA 3W1SC 3KW5B 4E3CA 2Z59B 1X1GA 2LWPA 4MGYE 2BF8B 1YX5B 4A6FB 3ZDTA 4F7GA 1ACAA 3APFA 3OJ4B 2KQSA 4CO7A 2M14A 3A8PA 2FCSA 3K9OB 4I6NB 3JVZX 4MM3A 1UZXB 3M62B 3SBTA 4K17A 3NS8A 4WSFA 2D9XA 4JKAA 1YJ1A 5DCNA 1LM8B 1WGRA 2H7DA 1XD3B 2PPHA 3F0WA 4FA6A 4ICUA 3P7ZA 4HPMB 3CSTA 2GBNA 5C79A 3RD2A 1GGOA 2Y5BB 2DX5A 3H1UA 4M8NA 1WJ1A 2ELBA 5FR6A 2P8VA 1QZEA 1WR6E 4FULA 4NJ6A 3ZUNA 4HAUB 3ZRFA 2Z0PA 1H8CA 1V61A 1E7VA 4PQ0A 3TBLD 3A9JB 4HAXB 4MDKE 1V89A 2N0YA 4KHAA 3N32A 4BKGA 4EJNA 3FM8C 4I6LB 2G45B 2KLGA 3UIPB 1OGWA 3A4SC 3QK0A 2DYMA 1E8ZA 2I5FA 1WE6A 3HM6X 3R7QA 2P0HA 1MK9B 2D9VA 5CLLB 2CB8A 2YS1A 3ZNID 4IM2A 2KTRB 3MJWA 2FIFA 2LBBA 2KMCA 2GCLA 1XCGA 2LYDA 2BYVE 5FI1A 2ASQA 3EFUA 2COCA 2COPA 1QQGA 2N9PC 4F8CB 1G6JA 1AQCA 2JWZA 2N4FA 2IFSA 1WG7A 1P6SA 1OQYA 4RM8A 4F1SA 2LZ6A 2EKEC 4GZUA 2M8SA 3VUXA 4HATB 3O96A 3QWZB 3HHMA 1MAIA 3QJZA 4YL8A 3CXBB 3VQIA 1WIAA 4PYUA 4DHJB 4CHKA 2J0JA 2DYQA 2RPQA 4M0WB 2M0XA 4A20A 3RYTA 2RGNB 3PGEA 3R3MA 2GJYA 2KDEB 3DXCA 2L3ZA 2N9EB 1MIZB 3M95A 2COFA 2G4DB 5HE1A 2BCJA 4FBJB 1KZGA 1EAZA 1WJ6A 2J0KA 2KGXB 3BJIA 1M7EA 1U5GA 4BVUC 2CS4A 4NJ7A 2N7DA 1X11A 1UPRA 4F7UP 1NBFC 3ZIMA 5HE3A 4HJKA 5EFXA 4W9FA 2KNBA 3VUYA 2ELAA 3T8MA 1V81A 4FHJA 3QHTA 2VRWB 3O65B 2R09A 1BTKA 3CSFA 4DHZB 1PQSA 1V9JA 4ANUA 3BY4B 4JKBA 3HW2B 2MW5A 3VTVA 1FGYA 1QC6A 4HDQA 2K8CA 2ADZA 1ZGUB 2WX0A 4K2PA 1V2YA 3QA8A 2KC1A 1C1YB 4HAYB 2KDIA 1WH3A 3SDLC 3ODOA 4JKDA 3HK0A 2KMAA 4XZ4A 3BINA 2N1VA 5D27A 1WJNA 2BWFA 2RQ1A 4FJVB 3A9KA 3PLUA 3JSVA 2O6VA 2K6DB 3PVWA 2Q13A 1U27A 4NQKE 2LVPA 3KVFB 4G11A 3MTNB 2DKPA 4NPNA 3UZTA 2DIKA 2DZMA 5E6OA 1DBHA 4A6HA 2GBJA 2ZPYA 3NSUA 2WX1A 1WF9A 3IFWB 2I1KA 4HHVA 4DHJD 2CU1A 3WANA 2KCJA 2HD5B 2CY4A 1Q67A 4DHZE 2L05A 4K81A 2JPHA 1YD8U 3A1QA 2KJRA 5L83A 3DCGA 4XX5A 1E7UA 5D3XA 3DPDA 3R66C 3ZTCA 3QX1A 5IAAC 2RSUA 4ASWC 4NAWA 4BBKA 2MQJA 3OAWA 2LOZA 5HE2A 5J3YA 4HLEA 1WXMA 1E8XA 2BYFA 3D8DA 2LVOA 3ML9A 2BYEA 1OEYA 2KFKB 1WE7A 3L54A 3V6CB 5C5BA 2KZRA 3NZUA 2EMTA 2WH5A 2KN5A 1LB1A 2JP2A 3PREA 4BKSD 4A5KA 1TXDA 2K2UA 2MA9B 4IG7B 3ENEA 1WGYA 3V60A 2P0DA 2K00A 3PVUA 4EMOA 4KIKA 1DDMA 4IW0A 5JHGA 3A33B 1EGXA 3K9PB 3MDBC 3VIAA 2KX3A 2BKRB 4GDKB 5D7GA 3PHXB 4YONA 3D8FA 5KCVA 2KO3A 4LDTB 3PHWB 5E6PA 5JZEB 2ZPNA 5DI9B 5G2NA 4MK0A 1U29A 3TJPA 1Q0WB 4MELA 1HE8A 4G3XB 4FADA 4JLCA 3G9WA 4NNJB 3ZDMC 2KC2A 4N9F4 3APCA 2D07B 2J59M 1GG3A 2LVQA 4AJWA 4ILHA 1MG8A 2MBOA 1T0YA 5HKHA 5G55A 4AP4C 2DKQA 3VH4B 4MSMB 3ENBA 1WXSA 1DDWA 2J7QB 4KV2A 3VTWA 4GU2A 3DVNV 4W9HA 4E74A 3TIXA 4B95A 3SHQA 2AL3A 2AWTA 3ML8A 3SNHA 1VBGA 2WDTB 4GOCA 2MCNB 4HCNB 2ZCCA 3PG7A 3MPXA 4WJPA 4DX90 2R0DA 2K8BA 4WJOA 5J2RA 1Q5WB 2LOXA 1S1QB 4MH0E 2ZCBA 2R82A 3V62A 1WI0A 3S2AA 1K8RB 4MJSA 2YVCA 1V5OA 4A3PA 1YQBA 4NY0A 5D3YA 4IWQA 2NMBA 3AJ4A 1IYFA 1U5FA 5CHFA 4HWIB 3EC8A 1EUVB 5AEKB 2MBBB 1DYNA 4K1RB 4WVFB 3KRWA 4WWNA 2K2JA 5E6NA 4DXAB 2RNRB 3SD5A 1KOTA 4JKGA 2MKRA 2CAYA 4JL9A 2ROZB 4ZYNA 3H6NA 4BOZB 4EFOA 1KLVA 4GMVA 2MSED 4Y94A 2MP2B 1C3TA 1S3SG 5C6RA 2CRFA 2DYNA 4JK9A 2UZSA 4FHKA 2L2IA 3M1IB 1NTYA 4TUUA 4OVVA 1MIXA 2PZ1A 3PSCA 5D6JB 2VSZA 2JZZA 4LDTD 4GPTB 1WGQA 1WGDA 5AZFA 2LG1A 2JUOA 3A9JA 3A98B 3W1SA 3RZFA 3DVGY 4JKEA 3HM3A 2IO1B 3V6EB 2KUPA 4TQ1A 2XQNM 2Z0EB 4ZRJA 1UPQA 2GBRA 3ODXA 1OTRB 2KJ6A 2IY0B 2DHZA 1WX8A 3U30A 4CHJA 4WWOA 4ICVA 1WX9A 2DLWA 2KTRA 2CHXA 5JH5C 3A4RA 4BOSC 3ZW3A 2PE6B 3ZLZA 2XK5B 2KQ7A 2KOXA 4URKA 2DX5B 3MHSD 4AOFA 3ZTDA 1P5TA 2GOWA 1P98A 4HAVB 2QKLA 1DIKA 2ZNVC 4LJOB 3AU5A 2FDQA 2P0FA 3WAPA 3Q3JA 4RM9A 3KYDD 2D9YA 1UELA 1HBKA 4P7IA 1OY2A 2D3GA 4FJYA 2O2VA 1GUAB 2FUHB 4KHOA 1A5RA 4KVGB 2DENB 2CQUA 4AWJA 2PJHA 1LXDA 4C0AA 2GS0A 4TYZA 5DHFB 5J3QA 1Z2MA 4DDGD 1EVHA 2L00B 1M94A 4JGHB 1GJZA 3KUCB 5JHAA 3M3JA 1KI1B 2NR2A 2JZ3B 2HRJA 2DFKA 2Y8FA 3N3KB 1FXTB 1XQQA 4LCDE 2EJ8A 2IO2B 1KJTA 4GIVA 1TZ1A 1FGZA 3PS6A 2D10A 4ILJA 3ALBA 4IFSA 2FNJB 2ZNVB 1FHOA 4JK8A 4IC7B 1N3HA 3M63B 1KBLA 4Z2MB 2LASA 2DTCA 2MDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Q A;  3I3T B;  1MK7 B;  5LXI B;  3UIN B;  1UNP A;  2NVU I;  1FB8 A;  2RGF A;  3GYP A;  5DIF B;  2FCQ A;  4HAW B;  5CHW A;  5IJM A;  1WYW B;  3P2B A;  3DDC B;  4IWO A;  2ZJD A;  1BTN A;  1NTI A;  2NS5 A;  3AXC A;  4KDL B;  1V88 A;  3VH3 B;  3RT3 B;  4WJ7 A;  4EUT A;  4HB4 B;  1UH6 A;  5JLJ B;  2PE9 A;  5TR5 A;  3KZ1 A;  1HB8 A;  1RLF A;  2LGY A;  3NY5 A;  4WJQ A;  2C9W B;  3U7D A;  1J8C A;  3FSS A;  3JYU A;  1F9J A;  2W9N A;  3X0W A;  1BWN A;  2YF0 A;  2GMI C;  2HTH B;  5J3T A;  1XD4 A;  2CHZ A;  2I1J A;  4HK2 A;  1SGH A;  3KRX A;  2QHO A;  5AZG A;  1UBQ A;  2D11 A;  2XEW A;  4B9K A;  2LUL A;  3PLV A;  3IBE A;  4IM0 A;  4D0N B;  5KHO A;  5CLQ B;  3ML4 A;  3A9K B;  3UF8 A;  3L16 A;  2Z0O A;  2MX2 A;  2RR9 A;  3DBS A;  4EOY A;  3B08 A;  3ZVR A;  3L08 A;  1NVL A;  4W9K A;  1I35 A;  4MY6 A;  2KXJ A;  3DBH I;  2KFK A;  4HAZ B;  1WFY A;  2NZ8 B;  4PYZ A;  4GSW A;  1WZ3 A;  5KQ4 A;  4B6W A;  5D2M B;  3W1Y A;  3LJ3 A;  1IPG A;  5C16 A;  2L0F A;  1UNQ A;  4CHM A;  5CTR C;  2DA0 A;  1WJ4 A;  1W1D A;  1V86 A;  1SIF A;  4ZRK A;  2RLO A;  1SE9 A;  2J0M A;  2MBH A;  2DAJ A;  2OJR A;  1TGZ B;  3HIZ A;  1WGG A;  1Z87 A;  3PT2 B;  4KSL C;  2E2X A;  3AUL A;  1Y5O A;  2KD0 A;  4W9D A;  3TFM A;  3PP2 A;  5J17 A;  3NZS A;  4WAA A;  2L7R A;  3T9L A;  3T06 A;  1P9D U;  3QCA A;  4G50 A;  3AI5 A;  3TW1 A;  2GCJ A;  4GDL B;  4HDO A;  3L0W B;  1GC6 A;  3B0A A;  1LQB A;  3A8Q A;  2MLB A;  4M8M A;  4HPL B;  2G3Q B;  3GYO A;  1XT9 B;  2ROV A;  2MFQ A;  2AEH A;  1DDV A;  1V6E A;  4IM3 A;  1WXA A;  2IO0 B;  1E90 A;  4ANX A;  3CF6 E;  4AJY B;  3SU8 X;  1WGU A;  3H7P B;  1YIW A;  3SYX A;  2NBV B;  3WA0 A;  1E5W A;  3DQV A;  4BFR A;  3L10 B;  1EF1 A;  2DN6 A;  3PRM B;  3VOQ A;  4KIK B;  2C7H A;  2X18 A;  3ZVV A;  3DVN U;  2YRY A;  2KHW B;  3RUI B;  3H9D A;  3N7C A;  1U2B A;  2OOB B;  2G4S A;  2UVM A;  2IBI B;  3DBR I;  3HQC A;  4Z2N A;  5GOW B;  1UEF A;  4KHB B;  2FCN A;  3WYF B;  2R2Q A;  3DXE A;  1VD2 A;  1U5E A;  4GGQ A;  3KUD B;  2H7E A;  2W2W A;  4MEM A;  4K7S A;  3SO6 A;  2YLM A;  2RUK B;  1LW3 A;  4KZ0 A;  1KZ7 A;  2HJ8 A;  3VTU A;  1TTN A;  3PEG A;  4A6F A;  1WGH A;  4K2O A;  4DBG A;  4PNK A;  3DOW A;  2FJ9 A;  2GBM A;  3VUW A;  3X23 A;  2MP2 A;  3SV1 A;  2BGF A;  1Z5S B;  1WMH B;  2CKH B;  3KH0 A;  2W2X D;  2IYB A;  3LDZ E;  3VXW A;  2D9Z A;  4EZK A;  2V76 A;  1NI2 A;  1K5D B;  3SUZ A;  4WQO B;  5DPW A;  2NPT B;  2KX0 A;  1MKE A;  5J18 A;  1ZVR A;  1V49 A;  2HE7 A;  2N23 A;  3PRZ A;  5L95 C;  1WM2 A;  3VAW A;  4MJS B;  2LXC A;  2MWN B;  1TBE A;  2EMS A;  4I6P A;  1RRP B;  2FJL A;  2LJ5 A;  1J0W A;  3FEH A;  5KHQ A;  2UYZ B;  5LLI A;  5JP4 A;  2JRH A;  2LKO A;  2K1F A;  3ZNH B;  1LFD A;  4KSK C;  3WAL A;  3U8Z A;  2Z0D B;  2KTF A;  4A6K A;  4EKU A;  3F5R A;  1D3Z A;  3KUZ A;  2XK5 A;  2RVB B;  1SHC A;  3R7R A;  1Y8R C;  2BKF A;  4BKT A;  1UGM A;  1WZ0 A;  3PZD A;  1FHW A;  3PRP B;  2MBQ A;  4IAP A;  1RFA A;  4L6E A;  1FAO A;  4GN1 A;  5IA7 A;  4IUM B;  3ZO5 B;  4MGI E;  2K25 A;  1KM7 A;  4XWX A;  4W9G A;  4RMA A;  1UD7 A;  5CHV C;  3V5W A;  3RUL A;  3RCZ A;  2KWV B;  2DX1 A;  1BT0 A;  1P1A A;  3L13 A;  1TQZ A;  3KYC D;  3TMP B;  4WJN A;  3N30 A;  1ZW7 A;  2YS3 A;  4NSW A;  1I2H A;  2N7E A;  3UIO B;  2K39 A;  2N9X A;  5D94 A;  1X1M A;  2CY5 A;  3IHP C;  3TO1 A;  5JHB A;  1RRB A;  1ISN A;  4MT7 A;  2FAZ A;  2JT4 B;  2KK8 A;  3QIJ A;  2YT1 A;  2NBU A;  4DBB A;  2KDB A;  4A3O A;  4MGK E;  4EZL A;  3DXD A;  4II3 B;  1J19 A;  4B6H A;  4HB3 B;  4HVB A;  5LXH A;  1V5M A;  3OAN A;  4BBN C;  3APD A;  1U5D A;  4DDI D;  2ZZP B;  1XR0 B;  1PFJ A;  2UWQ A;  2DZJ A;  2O2V B;  2LRW A;  1WVH A;  1TJ6 A;  5FI0 A;  3OLM D;  4K7W A;  5HE0 A;  1XKE A;  2KAN A;  3WAO A;  2L8J A;  3Q3F A;  2V4L A;  5DH9 B;  4IOY X;  1Q1O A;  4W9C A;  2L76 A;  3IVF A;  3VHT C;  4BKS A;  4G0N B;  1XX0 A;  1L2N A;  3VDZ A;  2EC1 A;  1U4A A;  4IWP A;  1IRS A;  1J0G A;  2B3A A;  1BAK A;  3TL5 A;  4TQ0 A;  3TCA A;  3UQB A;  2YS5 A;  1I7A A;  4X57 B;  3RZW C;  2UZR A;  2LXA A;  4MGZ E;  1GC7 A;  1X86 A;  3ONS A;  3CIK A;  4LJP B;  3L17 A;  2A5U A;  5DPR A;  5LON B;  2WYQ A;  3H7S A;  3WIM A;  1ST7 A;  4KAX B;  2LI5 A;  1WJM A;  1FHX A;  4ZDV A;  2JF5 A;  4TKN A;  3DBL I;  1IP9 A;  2COD A;  2BWE S;  4PS8 A;  1B55 A;  3QQ8 B;  1E8W A;  2LD9 A;  1YX6 B;  2C5L C;  2C60 A;  2HTH A;  2ABD A;  4HB0 B;  3QWM A;  3B1L X;  2VRR B;  1ZSQ A;  4BBN F;  3QAQ A;  4II2 B;  2G35 A;  2YSZ A;  3GOE A;  3PPA A;  2DHI A;  2DAF A;  1W1G A;  1ZKH A;  2LRU A;  2MRP A;  3ZRC A;  2K8H A;  2QKM A;  2NCN A;  1OEY J;  4EZJ A;  3ULC A;  2IYD B;  4MSQ B;  4HXD A;  2KJH B;  4FLH A;  2N1W A;  4E71 A;  2A4Z A;  1H10 A;  3EEC A;  4WWP A;  2M17 A;  3C0R B;  1AAR A;  3ZKJ C;  2W2X C;  3PSE B;  4OVU A;  3KSY A;  1L7Y A;  1FOE A;  3OJ3 A;  1RJ2 A;  1P3Q U;  4TV3 A;  2AL6 A;  2L0T A;  4W9J A;  4PS7 A;  4F7H A;  3EPY A;  3PTF C;  3JSV B;  2O6V B;  4J6I A;  5EDS A;  4DWF A;  1VCB A;  2KVR A;  2YT0 A;  4XC2 A;  2BPS A;  2WWZ A;  5C23 A;  4DX8 A;  3D8E A;  2NBW B;  3DVG X;  1AWE A;  2KLC A;  2PEA A;  3P6A A;  2JY6 A;  1CMX B;  3JW0 X;  1WM3 A;  1NTV A;  3ULB A;  1OMW A;  2D9W A;  2KKC A;  3FLV A;  3QBV B;  2M4N A;  5JHH A;  3QAR A;  3A1Q B;  1I42 A;  1EO6 A;  4HB2 B;  3NHE B;  4EEW A;  3UQA A;  2L1C A;  5AZH A;  1MPH A;  2K6Q A;  4FN2 A;  3VFK A;  4W9L A;  2Y7B A;  4CYE A;  2I5C A;  3WAM A;  1WJU A;  4GDL A;  4NAW B;  1WX7 A;  4GDK A;  3ZNG C;  3RCP A;  3FP5 A;  5D3V A;  3KY9 A;  1X05 A;  2D4Q A;  5DPS A;  2AYO B;  4GB9 A;  1Y19 B;  2KWU B;  3CMM B;  1V5P A;  1ZC4 B;  4W9I A;  4AUQ C;  1P3R A;  1R4N I;  3ZNZ B;  4ANV A;  3H7P A;  2DHJ A;  3VVW B;  2DZI A;  2JVC A;  5CX3 A;  1JRU A;  1P0R A;  5C5B B;  1K5G B;  3LJU X;  1WI1 A;  2ZEQ A;  1NU2 A;  2M38 A;  2DYO A;  4W9E A;  3NOB A;  2MWS B;  3IG3 A;  5D3W A;  4KZC A;  4JQW C;  3ODW A;  4PS3 A;  1X1F A;  1PLS A;  1V80 A;  3GZN I;  3UGB B;  2IY1 B;  1GNU A;  1M7R A;  1UNR A;  4FJZ A;  4K7U A;  3PV1 A;  3QC8 B;  4KDI C;  2DYB A;  1R4M I;  2ZVN A;  3AU4 A;  5DHA B;  2DZK A;  3ECI A;  2KWC A;  2CR5 A;  1E8Y A;  2MBE A;  4ZRI A;  3PVL A;  2RSG A;  3EHV A;  2LGX A;  2O6V D;  2CHW A;  2VKI A;  4H8S A;  1XOD A;  5BO4 B;  2FID A;  4NQL B;  5KQ1 A;  2KDF B;  2D2Q A;  2C7M B;  2GBK A;  2LGD A;  4GMX B;  1WXV A;  3V61 A;  1WR1 A;  4GXB A;  2R2O A;  1WY8 A;  1EF5 A;  2Y8G A;  2IZV B;  1WMH A;  2COA A;  5GMV A;  2IO3 B;  2LUE A;  1ZM0 A;  2RD0 A;  2OQB A;  2JXX A;  1HB6 A;  1W1H A;  2REX A;  2DHK A;  1RAX A;  2OTX A;  4JIO U;  2JRI B;  2NPT A;  1V5U A;  5C1Z A;  5LOP B;  3TVV A;  1PMS A;  2FCM A;  2M1M A;  1V5T A;  5L81 A;  2V3S A;  1NDD A;  2KFJ A;  1ZC3 B;  4DK5 A;  4ANW A;  1UBI A;  1DRO A;  2ZVO A;  3D32 A;  1H4R A;  2V1Y A;  2XBB C;  4HCP B;  4F7Z A;  2C7N B;  1WRD B;  1OQN A;  5DPT A;  3W1S C;  3KW5 B;  4E3C A;  2Z59 B;  1X1G A;  2LWP A;  4MGY E;  2BF8 B;  1YX5 B;  4A6F B;  3ZDT A;  4F7G A;  1ACA A;  3APF A;  3OJ4 B;  2KQS A;  4CO7 A;  2M14 A;  3A8P A;  2FCS A;  3K9O B;  4I6N B;  3JVZ X;  4MM3 A;  1UZX B;  3M62 B;  3NS8 A;  4K17 A;  4WSF A;  2D9X A;  1YJ1 A;  5DCN A;  1LM8 B;  1WGR A;  2H7D A;  1XD3 B;  2PPH A;  3F0W A;  4FA6 A;  4ICU A;  3P7Z A;  4HPM B;  3CST A;  2GBN A;  5C79 A;  3RD2 A;  2Y5B B;  2DX5 A;  3H1U A;  4M8N A;  1WJ1 A;  2ELB A;  5FR6 A;  2P8V A;  1QZE A;  1WR6 E;  4FUL A;  4NJ6 A;  3ZUN A;  4HAU B;  3ZRF A;  2Z0P A;  1H8C A;  1V61 A;  1E7V A;  4PQ0 A;  3TBL D;  3A9J B;  4HAX B;  4MDK E;  1V89 A;  2N0Y A;  4KHA A;  3N32 A;  4BKG A;  4EJN A;  3FM8 C;  4I6L B;  2G45 B;  2KLG A;  3UIP B;  1OGW A;  3A4S C;  3QK0 A;  2DYM A;  1E8Z A;  2I5F A;  1WE6 A;  3HM6 X;  3R7Q A;  2P0H A;  1MK9 B;  2D9V A;  5CLL B;  2CB8 A;  2YS1 A;  3ZNI D;  4IM2 A;  2KTR B;  3MJW A;  2FIF A;  2LBB A;  2KMC A;  2GCL A;  1XCG A;  2LYD A;  2BYV E;  5FI1 A;  2ASQ A;  3EFU A;  2COC A;  2COP A;  1QQG A;  2N9P C;  4F8C B;  1G6J A;  1AQC A;  2JWZ A;  2N4F A;  2IFS A;  1WG7 A;  1P6S A;  1OQY A;  4RM8 A;  4F1S A;  2LZ6 A;  2EKE C;  4GZU A;  2M8S A;  3VUX A;  4HAT B;  3O96 A;  3QWZ B;  3HHM A;  1MAI A;  3QJZ A;  4YL8 A;  3CXB B;  3VQI A;  1WIA A;  4PYU A;  4DHJ B;  4CHK A;  2J0J A;  2DYQ A;  2RPQ A;  4M0W B;  2M0X A;  4A20 A;  3RYT A;  2RGN B;  3PGE A;  3R3M A;  2GJY A;  2KDE B;  3DXC A;  2L3Z A;  2N9E B;  1MIZ B;  3M95 A;  2COF A;  2G4D B;  5HE1 A;  2BCJ A;  4FBJ B;  1KZG A;  1EAZ A;  1WJ6 A;  2J0K A;  2KGX B;  3BJI A;  1M7E A;  1U5G A;  4BVU C;  2CS4 A;  4NJ7 A;  2N7D A;  1X11 A;  1UPR A;  4F7U P;  1NBF C;  3ZIM A;  5HE3 A;  4HJK A;  5EFX A;  4W9F A;  2KNB A;  3VUY A;  2ELA A;  3T8M A;  1V81 A;  4FHJ A;  3QHT A;  2VRW B;  3O65 B;  2R09 A;  1BTK A;  3CSF A;  4DHZ B;  1PQS A;  1V9J A;  4ANU A;  3BY4 B;  3HW2 B;  2MW5 A;  3VTV A;  1FGY A;  1QC6 A;  4HDQ A;  2K8C A;  2ADZ A;  1ZGU B;  2WX0 A;  4K2P A;  1V2Y A;  3QA8 A;  2KC1 A;  1C1Y B;  4HAY B;  2KDI A;  1WH3 A;  3SDL C;  3ODO A;  3HK0 A;  2KMA A;  4XZ4 A;  3BIN A;  2N1V A;  5D27 A;  1WJN A;  2BWF A;  2RQ1 A;  4FJV B;  3A9K A;  3PLU A;  3JSV A;  2O6V A;  2K6D B;  3PVW A;  2Q13 A;  1U27 A;  4NQK E;  2LVP A;  3KVF B;  4G11 A;  3MTN B;  2DKP A;  4NPN A;  3UZT A;  2DZM A;  5E6O A;  1DBH A;  4A6H A;  2GBJ A;  2ZPY A;  3NSU A;  2WX1 A;  1WF9 A;  3IFW B;  2I1K A;  4HHV A;  4DHJ D;  2CU1 A;  3WAN A;  2KCJ A;  2HD5 B;  2CY4 A;  1Q67 A;  4DHZ E;  2L05 A;  4K81 A;  2JPH A;  1YD8 U;  3A1Q A;  2KJR A;  5L83 A;  3DCG A;  4XX5 A;  1E7U A;  5D3X A;  3DPD A;  3R66 C;  3ZTC A;  3QX1 A;  5IAA C;  2RSU A;  4ASW C;  4NAW A;  4BBK A;  2MQJ A;  3OAW A;  2LOZ A;  5HE2 A;  5J3Y A;  4HLE A;  1WXM A;  1E8X A;  2BYF A;  3D8D A;  2LVO A;  3ML9 A;  2BYE A;  1OEY A;  2KFK B;  1WE7 A;  3L54 A;  3V6C B;  5C5B A;  2KZR A;  3NZU A;  2EMT A;  2WH5 A;  2KN5 A;  1LB1 A;  2JP2 A;  3PRE A;  4BKS D;  4A5K A;  1TXD A;  2K2U A;  2MA9 B;  4IG7 B;  3ENE A;  1WGY A;  3V60 A;  2P0D A;  2K00 A;  3PVU A;  4EMO A;  4KIK A;  1DDM A;  4IW0 A;  5JHG A;  3A33 B;  1EGX A;  3K9P B;  3MDB C;  3VIA A;  2KX3 A;  2BKR B;  4GDK B;  5D7G A;  3PHX B;  4YON A;  3D8F A;  5KCV A;  2KO3 A;  4LDT B;  3PHW B;  5E6P A;  5JZE B;  2ZPN A;  5DI9 B;  5G2N A;  4MK0 A;  1U29 A;  3TJP A;  1Q0W B;  4MEL A;  1HE8 A;  4G3X B;  4FAD A;  4JLC A;  3G9W A;  4NNJ B;  3ZDM C;  2KC2 A;  4N9F 4;  3APC A;  2D07 B;  2J59 M;  1GG3 A;  2LVQ A;  4AJW A;  1MG8 A;  2MBO A;  1T0Y A;  5HKH A;  5G55 A;  4AP4 C;  2DKQ A;  3VH4 B;  4MSM B;  1WXS A;  1DDW A;  2J7Q B;  4KV2 A;  3VTW A;  4GU2 A;  3DVN V;  4W9H A;  4E74 A;  3TIX A;  4B95 A;  3SHQ A;  2AL3 A;  2AWT A;  3ML8 A;  3SNH A;  2WDT B;  4GOC A;  2MCN B;  4HCN B;  2ZCC A;  3PG7 A;  3MPX A;  4WJP A;  4DX9 0;  2R0D A;  2K8B A;  4WJO A;  5J2R A;  1Q5W B;  2LOX A;  1S1Q B;  4MH0 E;  2ZCB A;  3V62 A;  1WI0 A;  3S2A A;  1K8R B;  4MJS A;  2YVC A;  1V5O A;  4A3P A;  1YQB A;  4NY0 A;  5D3Y A;  4IWQ A;  2NMB A;  3AJ4 A;  1IYF A;  1U5F A;  5CHF A;  4HWI B;  3EC8 A;  1EUV B;  5AEK B;  2MBB B;  1DYN A;  4K1R B;  4WVF B;  3KRW A;  4WWN A;  2K2J A;  5E6N A;  4DXA B;  2RNR B;  3SD5 A;  1KOT A;  2MKR A;  2CAY A;  4JL9 A;  2ROZ B;  4ZYN A;  3H6N A;  4BOZ B;  4EFO A;  1KLV A;  4GMV A;  2MSE D;  4Y94 A;  2MP2 B;  1C3T A;  1S3S G;  5C6R A;  2CRF A;  2DYN A;  2UZS A;  4FHK A;  2L2I A;  3M1I B;  1NTY A;  4TUU A;  4OVV A;  1MIX A;  2PZ1 A;  3PSC A;  5D6J B;  2VSZ A;  2JZZ A;  4LDT D;  4GPT B;  1WGQ A;  1WGD A;  5AZF A;  2LG1 A;  2JUO A;  3A9J A;  3A98 B;  3W1S A;  3RZF A;  3DVG Y;  3HM3 A;  2IO1 B;  3V6E B;  2KUP A;  4TQ1 A;  2XQN M;  2Z0E B;  4ZRJ A;  1UPQ A;  2GBR A;  3ODX A;  1OTR B;  2KJ6 A;  2IY0 B;  2DHZ A;  1WX8 A;  3U30 A;  4CHJ A;  4WWO A;  4ICV A;  1WX9 A;  2DLW A;  2KTR A;  2CHX A;  5JH5 C;  3A4R A;  4BOS C;  3ZW3 A;  2PE6 B;  3ZLZ A;  2XK5 B;  2KQ7 A;  2KOX A;  4URK A;  2DX5 B;  3MHS D;  4AOF A;  3ZTD A;  1P5T A;  2GOW A;  1P98 A;  4HAV B;  2QKL A;  2ZNV C;  4LJO B;  3AU5 A;  2FDQ A;  2P0F A;  3WAP A;  3Q3J A;  4RM9 A;  3KYD D;  2D9Y A;  1UEL A;  1HBK A;  4P7I A;  1OY2 A;  2D3G A;  4FJY A;  2O2V A;  1GUA B;  2FUH B;  4KHO A;  1A5R A;  4KVG B;  2DEN B;  2CQU A;  4AWJ A;  2PJH A;  1LXD A;  4C0A A;  2GS0 A;  4TYZ A;  5DHF B;  5J3Q A;  1Z2M A;  4DDG D;  1EVH A;  2L00 B;  1M94 A;  4JGH B;  1GJZ A;  3KUC B;  5JHA A;  3M3J A;  1KI1 B;  2NR2 A;  2JZ3 B;  2HRJ A;  2DFK A;  2Y8F A;  3N3K B;  1FXT B;  1XQQ A;  4LCD E;  2EJ8 A;  2IO2 B;  1KJT A;  4GIV A;  1TZ1 A;  1FGZ A;  3PS6 A;  2D10 A;  3ALB A;  4IFS A;  2FNJ B;  2ZNV B;  1FHO A;  4IC7 B;  1N3H A;  3M63 B;  4Z2M B;  2LAS A;  2DTC A;  2MDX A; 
#chains in the Genus database with same CATH topology
 2Z0Q A;  2BS2 B;  3I3T B;  2OJW A;  1MK7 B;  5LXI B;  3UIN B;  1UNP A;  1LGR A;  2NVU I;  1FB8 A;  2R2Y A;  2RGF A;  2X0S A;  1FO4 A;  4XE0 A;  3I57 A;  3Q8C A;  3GYP A;  3ZXR A;  5DIF B;  2FCQ A;  4LNO A;  4HAW B;  2QDF A;  1R4N B;  5CHW A;  5IJM A;  1NYQ A;  4LNN A;  3MP9 A;  3Q3M C;  1WYW B;  3P2B A;  1QOA A;  3DDC B;  1I4Q A;  4IWO A;  2ZJD A;  1BTN A;  1NTI A;  3NW8 A;  2NS5 A;  1TS3 A;  4WH4 A;  3AXC A;  4KDL B;  1V88 A;  3VH3 B;  3RT3 B;  4WJ7 A;  3BWU D;  4EUT A;  3ZJU A;  2JSV X;  2MJD A;  4HB4 B;  4DXG A;  1UH6 A;  3FVC A;  2WXL A;  5JLJ B;  1F1H A;  2PE9 A;  5FK9 C;  5TR5 A;  4ITK A;  3KZ1 A;  2GI9 A;  1HB8 A;  1RLF A;  1QOF A;  2LGY A;  3NY5 A;  4WJQ A;  3ETR A;  3AEG B;  2C9W B;  3U7D A;  2K9X A;  5BMI A;  3E9L A;  1J8C A;  3FSS A;  4N58 A;  3JYU A;  1F9J A;  1D5X C;  2W9N A;  2AQ3 B;  4B0M A;  4YXD B;  3X0W A;  1BWN A;  2YF0 A;  2GMI C;  2H88 B;  2HTH B;  5J3T A;  1XD4 A;  2CHZ A;  2WXQ A;  2I1J A;  2DBY A;  1SGH A;  3KRX A;  2QHO A;  4HK2 A;  5AZG A;  1UBQ A;  2D11 A;  2XEW A;  2BBC A;  1IGD A;  2KAC A;  4B9K A;  3U52 E;  1FRD A;  1XLQ A;  2LUL A;  3PLV A;  5IKC M;  3IBE A;  4IM0 A;  1ENF A;  2BT6 A;  3N20 C;  4D0N B;  3IAM 1;  2WHI A;  5KHO A;  5CLQ B;  3ML4 A;  1N62 A;  2LGS A;  2XN9 C;  3A9K B;  3UF8 A;  3L16 A;  2Z0O A;  5I2S A;  2MX2 A;  2RR9 A;  1N5X A;  3SFD B;  3DBS A;  2JWU A;  2KN4 A;  2RRF A;  4ILG B;  2IGH A;  1MG4 A;  3B08 A;  4EOY A;  2W55 A;  3ZYY X;  3ZVR A;  3L08 A;  4YSZ B;  3V3X A;  5E6J A;  3V05 A;  3KLS X;  1J7B A;  1NVL A;  1SEB D;  3B2F A;  4W9K A;  1I35 A;  4MY6 A;  1TJE A;  2KXJ A;  3DBH I;  3HSA A;  2KFK A;  3GE8 C;  4HAZ B;  1WFY A;  2NZ8 B;  4PYZ A;  4GSW A;  1WZ3 A;  1F0Z A;  3AE8 B;  1VLB A;  5KQ4 A;  3E9O A;  3HVZ A;  4B6W A;  5D2M B;  3W1Y A;  3NZ3 A;  4YWG G;  4ZRQ A;  3LJ3 A;  1IPG A;  5C16 A;  4KX6 B;  2L0F A;  1UNQ A;  4CHM A;  5CTR C;  2DA0 A;  1WJ4 A;  1W1D A;  1V86 A;  4YTN B;  1VBH A;  1SIF A;  3AEA B;  4ZRK A;  2RLO A;  2Z8L A;  2INP E;  1SE9 A;  2J0M A;  2MBH A;  2DAJ A;  2OJR A;  1TGZ B;  3HIZ A;  1WGG A;  1Z87 A;  3PT2 B;  4KSL C;  4MT5 A;  4IDI A;  4JKC A;  1KLG D;  2K5P A;  3ZJV A;  2E2X A;  3AUL A;  1Y5O A;  2KD0 A;  3BK2 A;  2WXH A;  4W9D A;  2GLS A;  3TFM A;  3PP2 A;  5J17 A;  3NZS A;  4WAA A;  2L7R A;  3T9L A;  3GP7 A;  1BML C;  3T06 A;  1P9D U;  4N6E B;  3QCA A;  4G50 A;  3AI5 A;  3DHI C;  3TW1 A;  2GCJ A;  1D5Z C;  2NMQ A;  4NAM A;  4GDL B;  4HDO A;  3L0W B;  4JKH A;  1GC6 A;  3B0A A;  1LQB A;  3HUI A;  3U2S C;  1JQ4 A;  3A8Q A;  3EA6 A;  2MLB A;  4M8M A;  3T3N A;  4HPL B;  2G3Q B;  3GYO A;  1SE3 A;  1XT9 B;  2ROV A;  2MFQ A;  2AEH A;  1DDV A;  1FPY A;  1V6E A;  1FEH A;  1WXA A;  4IM3 A;  2IO0 B;  1J7C A;  5HI1 A;  1E90 A;  4ANX A;  1YN4 A;  3CF6 E;  4AJY B;  3SU8 X;  1HEZ E;  3FIL A;  1WGU A;  3H7P B;  1YIW A;  2L52 A;  3AE5 B;  1T5X D;  3SYX A;  2NBV B;  3WA0 A;  1E5W A;  1VZ7 A;  2BVC A;  1N60 A;  3DQV A;  4BFR A;  3L10 B;  3I5J C;  2J53 A;  1EF1 A;  2DN6 A;  2WDR B;  3PRM B;  3VOQ A;  4KIK B;  2C7H A;  2V9H A;  1XF5 L;  2X18 A;  3ZVV A;  3HIE A;  4O1N A;  3DVN U;  2YRY A;  1JWU D;  3VRB B;  4WIP A;  1XEE A;  2KHW B;  5AUI A;  2JYT A;  3RUI B;  3H9D A;  3N7C A;  2KWD A;  1U2B A;  2OOB B;  2W3S A;  2ZW1 A;  4P6V F;  2G4S A;  2UVM A;  2IBI B;  3DBR I;  3HQC A;  4Z2N A;  1ROE A;  3IAS 1;  5GOW B;  5TSS A;  1UEF A;  4ARC A;  4RGN A;  4KHB B;  2FCN A;  3WYF B;  2R2Q A;  2K0P A;  1YNT E;  3DXE A;  1VD2 A;  1U5E A;  4GGQ A;  2D3B A;  4HEA 1;  3KUD B;  3OHM B;  2H7E A;  2W2W A;  3MFG A;  4KGS A;  4KGT A;  4MEM A;  3NVZ A;  4K7S A;  3SO6 A;  2YLM A;  2RUK B;  3LXF A;  1I7H A;  1LW3 A;  1ZP0 B;  2Z59 A;  1KF6 B;  2IND C;  4KZ0 A;  1KZ7 A;  2HJ8 A;  3VTU A;  1TTN A;  3PEG A;  4A6F A;  1WGH A;  1I4X A;  4K2O A;  4OZA A;  4DBG A;  4MAC A;  4PNK A;  3DOW A;  2FJ9 A;  4C4V A;  2GBM A;  2BS4 B;  2KQ4 X;  1VRA B;  2INC C;  4RGO S;  3OG5 A;  2FUG 1;  3VUW A;  3X23 A;  3Q2A C;  1WSP A;  2MP2 A;  1GB4 A;  1MPE A;  1MVK A;  1TIF A;  3SV1 A;  2BGF A;  1Z5S B;  2Y3A A;  1WMH B;  1YMH E;  2CKH B;  3KH0 A;  2W2X D;  2IYB A;  3LDZ E;  3RMK C;  3TEW A;  3VXW A;  2D9Z A;  4EZK A;  2V76 A;  1NI2 A;  1K5D B;  3SUZ A;  4WQO B;  5DPW A;  1VR9 A;  2NPT B;  2KX0 A;  1MKE A;  5J18 A;  1B1Z A;  1TY2 A;  2IDY A;  1ZVR A;  1V49 A;  2HE7 A;  2N23 A;  4R3D A;  4OZC A;  3PRZ A;  5L95 C;  2LGI A;  1WM2 A;  3VAW A;  2GUM A;  4MJS B;  2LXC A;  3W9C B;  2MWN B;  1TBE A;  2EMS A;  4I6P A;  1RRP B;  2FJL A;  1E0Z A;  5AUK A;  2LJ5 A;  3VR9 B;  1J0W A;  3FEH A;  5KHQ A;  2UYZ B;  5LLI A;  4N59 A;  1KTK A;  5JP4 A;  2JRH A;  2LJI A;  1BXT A;  2LKO A;  2K1F A;  3ZNH B;  1LFD A;  4KSK C;  3WAL A;  3U8Z A;  4RF0 A;  2Z0D B;  4JKG B;  2KTF A;  5H8Y E;  4A6K A;  4EKU A;  3E9P A;  3LB8 C;  3F5R A;  2YT2 A;  4XGA B;  1D3Z A;  3KUZ A;  3E66 A;  2XK5 A;  2RVB B;  1SHC A;  1T3Q A;  3R7R A;  1Y8R C;  2D5G A;  2BKF A;  2KR0 A;  3DBL B;  4ZHO A;  4BKT A;  1UGM A;  1WZ0 A;  3PZD A;  1FHW A;  3SBG A;  3PRP B;  2MBQ A;  4IAP A;  1RFA A;  4L6E A;  1FAO A;  4GN1 A;  3NRZ A;  4IUM B;  5IA7 A;  3ZO5 B;  4MGI E;  2K25 A;  1KM7 A;  2NTS A;  2WXN A;  4XWX A;  4W9G A;  2GRI A;  4RMA A;  1UD7 A;  5CHV C;  4JWU C;  3V5W A;  3RUL A;  5EE3 A;  2JZP A;  3RCZ A;  2RDB C;  2KWV B;  2DX1 A;  2SEB D;  1BT0 A;  1P1A A;  3L13 A;  2QEJ C;  1TQZ A;  3KYC D;  1PDX A;  1ZXI A;  3TMP B;  4HJG E;  4WJN A;  3N30 A;  1ZW7 A;  2QC8 A;  2YS3 A;  4NSW A;  1I2H A;  2N7E A;  3UIO B;  1UUP A;  2K39 A;  2N9X A;  5D94 A;  1X1M A;  2FJU B;  2CY5 A;  2W3R A;  4D2K A;  3IHP C;  3TO1 A;  5JHB A;  1RRB A;  5IP4 D;  1ISN A;  4MT7 A;  1ZDX A;  2FAZ A;  2JT4 B;  2KK8 A;  3QIJ A;  2YT1 A;  4UDU C;  4USA A;  1SXT A;  1UF0 A;  2NBU A;  4RGM A;  1RFK A;  4DBB A;  2KDB A;  4A3O A;  1HA5 A;  4MGK E;  1AW7 A;  4HKQ A;  4EZL A;  3BYT B;  2WXI A;  3DXD A;  1BUI C;  2QJL A;  4II3 B;  2CJN A;  2QMT A;  1J19 A;  2RDH A;  1IBX B;  4B6H A;  1E6E B;  4RNA A;  3N1Y C;  1MFW A;  4HB3 B;  4HVB A;  5LXH A;  1V5M A;  3OAN A;  4BBN C;  3NVW A;  2AQ1 B;  1V97 A;  3APD A;  1U5D A;  4DDI D;  2ZZP B;  3AH7 A;  1XR0 B;  4YSY B;  2UU7 A;  1PFJ A;  3R2T A;  1EWY C;  1OQR A;  2UWQ A;  2WXM A;  2Z14 A;  2DZJ A;  2O2V B;  2LRW A;  3Q69 A;  3ZGZ A;  1WVH A;  1TJ6 A;  5FI0 A;  3RNC C;  4A90 A;  3OLM D;  2L32 A;  4K7W A;  5HE0 A;  1XKE A;  2KAN A;  2WP9 B;  3WAO A;  2L8J A;  1TS2 A;  1KH0 A;  4ZOH C;  3Q3F A;  2V4L A;  5DH9 B;  4IOY X;  2K49 A;  1Q1O A;  3L4P A;  4QJ3 B;  2XNA C;  1FFU A;  1FNU A;  2KDM A;  2L76 A;  4W9C A;  4ACF A;  3IVF A;  3VHT C;  2J4X A;  4BKS A;  4G0N B;  3AE1 B;  1F77 A;  1XX0 A;  1L2N A;  2LUM A;  1F52 A;  3VDZ A;  2EC1 A;  1U4A A;  4IWP A;  1IRS A;  2CJO A;  1SB3 C;  1J0G A;  3Q8A A;  3RNE C;  1UGJ A;  2B3A A;  1EU3 A;  1BAK A;  3TL5 A;  4TQ0 A;  3TCA A;  1KFY B;  3UQB A;  3J9C A;  2YS5 A;  1I7A A;  4X57 B;  3RZW C;  2UZR A;  2LXA A;  4MGZ E;  4ARI A;  1GC7 A;  4PK1 A;  1X86 A;  2OED A;  3ONS A;  1HZ6 A;  2M0A A;  3CIK A;  3U4E G;  2K8E A;  4LJP B;  4BAX A;  1TS5 A;  3L17 A;  1ZPS A;  2A5U A;  5DPR A;  5LON B;  2WYQ A;  1M4V A;  3H7S A;  3WIM A;  1HTQ A;  1ST7 A;  4KAX B;  4B0E A;  2W54 A;  1PUT A;  4JKF A;  2LI5 A;  1WJM A;  1FHX A;  2G1E A;  1YN5 A;  4ZDV A;  2Z13 A;  4TKN A;  2JF5 A;  3DBL I;  3W5U B;  1I4G A;  2WXF A;  1YN3 A;  1IP9 A;  2COD A;  3AE9 B;  3AM9 A;  2BWE S;  4PS8 A;  1B55 A;  4LLG M;  1L6V A;  3QQ8 B;  1E8W A;  2LD9 A;  1YX6 B;  2C5L C;  2C60 A;  2HTH A;  3GZN B;  2ABD A;  4HB0 B;  3QWM A;  1SJH D;  2VRR B;  3B1L X;  1ZSQ A;  4YT0 B;  4BBN F;  3QAQ A;  4II2 B;  2WDV B;  2G35 A;  2YSZ A;  1HTO A;  3GOE A;  3PPA A;  2DHI A;  2DAF A;  3C19 A;  1W1G A;  1ZKH A;  2LRU A;  2MRP A;  5EE9 A;  3ZRC A;  2K8H A;  2QKM A;  3GB1 A;  2NCN A;  1OEY J;  1R4M B;  1AWD A;  4EZJ A;  3ULC A;  2IYD B;  4MSQ B;  4HXD A;  2KJH B;  4FLH A;  2N1W A;  5G5H A;  4E71 A;  2A4Z A;  1RWS A;  1H10 A;  1TKE A;  3EEC A;  4WWP A;  2M17 A;  3C0R B;  2V3P A;  3IT4 B;  1AAR A;  3ZKJ C;  2W2X C;  3PSE B;  4P16 A;  4OVU A;  1WWT A;  4M02 A;  3KSY A;  1L7Y A;  1FOE A;  3OJ3 A;  2INN E;  1RJ2 A;  4P1B C;  1P3Q U;  4WAF A;  4TV3 A;  2KMM A;  2AL6 A;  4AS1 A;  2L0T A;  4W9J A;  4PS7 A;  4F7H A;  3Q6B A;  3EPY A;  3PTF C;  3JSV B;  2O6V B;  4J6I A;  4RF1 A;  5EDS A;  5G5G A;  4DWF A;  2M56 B;  3NJT A;  1FCL A;  1VCB A;  2VZK B;  2KVR A;  1QF6 A;  2PVO D;  2YT0 A;  3I63 C;  4RCO A;  4XC2 A;  2BPS A;  2WWZ A;  5C23 A;  1EM7 A;  5IO9 A;  4DX8 A;  3D8E A;  2NBW B;  3DVG X;  1AWE A;  1DOI A;  2KLC A;  2PEA A;  3P6A A;  1N6Z A;  2JY6 A;  2Y5C A;  1CMX B;  3JW0 X;  1WM3 A;  1NTV A;  3ULB A;  1OMW A;  1TT5 B;  2D9W A;  2KKC A;  3FLV A;  1TKY A;  3N1Z C;  3QBV B;  2Y5P A;  1NEK B;  1TZO A;  2M4N A;  5JHH A;  3QAR A;  3A1Q B;  1I42 A;  3RNG C;  2RDG A;  1EO6 A;  4HB2 B;  3NHE B;  4EEW A;  3UQA A;  4H2A A;  2L1C A;  5AZH A;  1MPH A;  2K6Q A;  3RNB C;  4FN2 A;  3VFK A;  4W9L A;  2Y7B A;  4CYE A;  1R7S A;  2I5C A;  3WAM A;  1WJU A;  4GDL A;  1K53 A;  1V1P B;  5EE1 A;  4NAW B;  3B9J A;  4ZYS A;  1TYG B;  1WX7 A;  2QSD A;  4GDK A;  3ZNG C;  3RCP A;  3FP5 A;  4US9 A;  5D3V A;  3KY9 A;  2IGG A;  2M19 A;  3DWM A;  1X05 A;  2D4Q A;  5DPS A;  2AYO B;  3AEB B;  4GB9 A;  1AN8 A;  1Y19 B;  2KWU B;  3CMM B;  1C77 A;  1V5P A;  3EFC A;  1ZC4 B;  4W9I A;  3CWI A;  4AUQ C;  1P3R A;  1R4N I;  1SBB B;  3ZNZ B;  4ANV A;  3W5V B;  2MHJ A;  3H7P A;  2DHJ A;  3VVW B;  2DZI A;  2JVC A;  2ONQ A;  5CX3 A;  1GOZ A;  2NBV A;  1JRU A;  1UWM A;  4WQM A;  1P0R A;  1YQ3 B;  5C5B B;  1K5G B;  3LJU X;  1WI1 A;  2ZEQ A;  1NU2 A;  2M38 A;  2DYO A;  2QCZ A;  4W9E A;  1JCK B;  3NOB A;  2MWS B;  4HPP A;  4LNI A;  1WGK A;  3IG3 A;  2MEK A;  5D3W A;  4KZC A;  3FAH A;  1L6U A;  3P4S B;  1F2R C;  4JQW C;  3RFZ B;  3ODW A;  3WCQ A;  4PS3 A;  1X1F A;  1JRP A;  1P7F A;  1PLS A;  1V80 A;  3GZN I;  3UGB B;  2IY1 B;  1GNU A;  1SE2 A;  1TY0 A;  1M7R A;  1C9F A;  1UNR A;  4FJZ A;  2EKI A;  4K7U A;  1VDV A;  1T0Q C;  3NWF A;  3PV1 A;  4KHB A;  2N9L A;  3QC8 B;  4KDI C;  1MHH E;  1E7P B;  2DYB A;  4A6Q A;  3TSS A;  3DWG C;  1R4M I;  3PO0 A;  2ZVN A;  3AU4 A;  5DHA B;  3AE4 B;  5FR3 A;  3TEY A;  2DZK A;  3ECI A;  2KWC A;  2CR5 A;  1E8Y A;  2MBE A;  4JK7 A;  4ZRI A;  3PVL A;  4NJC A;  1CQV A;  2RSG A;  1UWX A;  3EHV A;  1NVI D;  3AE3 B;  2LGX A;  2B76 B;  2O6V D;  2CHW A;  2VKI A;  4H8S A;  1XOD A;  2QIE B;  2H89 B;  4JX1 C;  1V8C A;  1PGB A;  5BO4 B;  2FID A;  3U12 A;  4NQL B;  2MJE A;  1JWM D;  4DIX A;  5KQ1 A;  2KDF B;  2VZK D;  2D2Q A;  2C7M B;  5JVL A;  2GBK A;  2LGD A;  4GMX B;  1WXV A;  2V3N A;  1L0V B;  3V61 A;  1WR1 A;  4GXB A;  2R2O A;  2L83 A;  1JRO A;  1WY8 A;  1EF5 A;  2ICI A;  2Y8G A;  2IZV B;  1WMH A;  2COA A;  5GMV A;  2IO3 B;  2LUE A;  1ZM0 A;  2RD0 A;  2OQB A;  2JXX A;  2BTE A;  1HB6 A;  1W1H A;  1KLU D;  2REX A;  2DHK A;  1RAX A;  2OTX A;  4JIO U;  4GOU A;  2JRI B;  1XCT L;  1JDE A;  1V5U A;  1N61 A;  2NPT A;  5LOP B;  5C1Z A;  3BVZ A;  3TVV A;  4OT1 A;  1PMS A;  2FCM A;  2M1M A;  2K3U A;  1V5T A;  1I4R A;  5L81 A;  1OQQ A;  2V3S A;  1NDD A;  1ET6 A;  1DOX A;  4LTU A;  2KFJ A;  1ZC3 B;  4DK5 A;  3RNF C;  1T6B X;  3AE6 B;  5BYQ A;  3MJ5 A;  1KRH A;  4ANW A;  3N9Y C;  1KC7 A;  4WUR A;  2HTM E;  2IGD A;  1UBI A;  1DRO A;  2ZVO A;  3D32 A;  1H4R A;  2WXP A;  2V1Y A;  2XBB C;  4HCP B;  4F7Z A;  1EU4 A;  2C7N B;  1PYW D;  1WRD B;  1OQN A;  5DPT A;  3RNA C;  4S0R A;  3W1S C;  3KW5 B;  4E3C A;  2Z59 B;  1X1G A;  2LWP A;  4MGY E;  2BF8 B;  1YX5 B;  4IKG A;  1LO5 D;  1FNV A;  1XXG A;  4A6F B;  3ZDT A;  4F7G A;  1ACA A;  2BQQ A;  3APF A;  3DCX A;  3OJ4 B;  2KQS A;  4CO7 A;  2M14 A;  3A8P A;  2FCS A;  3K9O B;  4I6N B;  3JVZ X;  4MM3 A;  3NWD A;  1UZX B;  3AV8 A;  3M62 B;  3SBT A;  4K17 A;  1K51 A;  3NS8 A;  4WSF A;  2D9X A;  1L4D B;  4JKA A;  1XO3 A;  1YJ1 A;  5DCN A;  5D3D A;  2I2Y A;  1LM8 B;  1WGR A;  2H7D A;  1XD3 B;  2GB1 A;  5LG4 B;  2PPH A;  3P1M A;  3F0W A;  4FA6 A;  4ICU A;  3P7Z A;  4HPM B;  4J3O D;  3CST A;  3P4R B;  2GBN A;  5C79 A;  5H92 C;  2PKO A;  3RD2 A;  1GGO A;  2Y5B B;  2DX5 A;  1D5M C;  2V0G A;  2D3A A;  3VR8 B;  5LNK 1;  3H1U A;  1SIJ A;  3RI7 C;  4M8N A;  1WJ1 A;  2ELB A;  1I4H A;  5FR6 A;  3H8H A;  2P8V A;  4CSQ A;  2LEK A;  1QZE A;  1WR6 E;  5I4D A;  1IUE A;  4FUL A;  2TSS A;  4NJ6 A;  2N0S B;  4HAU B;  3ZUN A;  3ZRF A;  2Z0P A;  1H8C A;  5D3I B;  1V61 A;  1E7V A;  4MH8 A;  4XYC A;  4PQ0 A;  2BS3 B;  4KGR A;  3TBL D;  4C00 A;  3A9J B;  4HAX B;  4KKI A;  4MDK E;  1V89 A;  2N0Y A;  4KHA A;  3N32 A;  4BKG A;  4EJN A;  3FM8 C;  4I6L B;  2G45 B;  2KLG A;  3UIP B;  5T8I A;  1OGW A;  3A4S C;  3QK0 A;  2X38 A;  2DYM A;  1E8Z A;  2I5F A;  4D6W A;  1WE6 A;  1STE A;  3HM6 X;  1MI1 A;  3R7Q A;  2P0H A;  1MK9 B;  2D9V A;  5CLL B;  2CB8 A;  2YS1 A;  2MH7 A;  3ZNI D;  2QIL A;  4IM2 A;  1ET9 A;  2KTR B;  3MJW A;  2FIF A;  3NUH B;  2RMM A;  2LBB A;  3MC8 A;  4YSX B;  3AE2 B;  2KMC A;  2GCL A;  1XCG A;  2WXR A;  2LYD A;  3NVY A;  2BYV E;  5FI1 A;  2ASQ A;  3EFU A;  2COC A;  2COP A;  1QQG A;  2WU5 B;  4OHJ A;  2N9P C;  4C80 A;  4F8C B;  1G6J A;  1AQC A;  3IXS A;  1NI3 A;  2JWZ A;  2N4F A;  3AED B;  4EE2 A;  2IFS A;  2PVG C;  3Q8E A;  1WG7 A;  1QT9 A;  1P6S A;  4QJ4 B;  1OQY A;  1F2R I;  4RM8 A;  4F1S A;  2LZ6 A;  2FBW B;  1YOV B;  2EKE C;  1A70 A;  1NYR A;  1JAL A;  4JE3 B;  4GZU A;  1DGJ A;  2M8S A;  3VUX A;  3P4Q B;  1QKZ A;  4HAT B;  3O96 A;  3QWZ B;  3HHM A;  1MAI A;  3B77 A;  3QJZ A;  1V1O A;  2CU3 A;  3Q3N C;  4YL8 A;  3CXB B;  3VQI A;  1WIA A;  4PYU A;  4YTP B;  3PZ7 A;  4DHJ B;  3E9S A;  4CHK A;  2J0J A;  2DYQ A;  4GLS C;  3FKY A;  2RPQ A;  3BVM A;  4M0W B;  2FE8 A;  2M0X A;  4A20 A;  3RYT A;  2RGN B;  1VZ8 A;  3AMZ A;  3PGE A;  1L4Z B;  3R3M A;  2GJY A;  3AB5 A;  4OZB A;  4HKZ E;  2KDE B;  3DXC A;  2L3Z A;  2JX5 A;  2PW9 A;  2N9E B;  1MIZ B;  3M95 A;  2COF A;  1TS4 A;  2G4D B;  5HE1 A;  2BCJ A;  4XWW A;  4FBJ B;  1KZG A;  1EAZ A;  2LHD A;  1WJ6 A;  2J0K A;  2KGX B;  3T3O A;  3BJI A;  1M7E A;  1U5G A;  4BVU C;  2CS4 A;  4NJ7 A;  2N7D A;  1C76 A;  1X11 A;  1C79 A;  1WRI A;  1UPR A;  4F7U P;  1NBF C;  3ZIM A;  5HE3 A;  4JPS A;  4HJK A;  5EFX A;  4W9F A;  5BYS A;  2KNB A;  3VUY A;  2ELA A;  3T8M A;  5IRS A;  1V81 A;  4LNF A;  3CIR B;  4FHJ A;  2LFI A;  1HXY D;  3QHT A;  3AEC B;  2VRW B;  3O65 B;  2R09 A;  2Q5W D;  1XCQ L;  1BTK A;  3CSF A;  4DHZ B;  1PQS A;  1V9J A;  4ANU A;  2V4I B;  3BY4 B;  1Q10 A;  4JKB A;  3HW2 B;  2MW5 A;  3VTV A;  1FGY A;  1QC6 A;  4HDQ A;  2K8C A;  2ADZ A;  1ZGU B;  3GE3 C;  2PLP A;  2WX0 A;  4K2P A;  1UNS A;  1V2Y A;  1FNW A;  2WGS A;  4NZL B;  3QA8 A;  2KC1 A;  1C1Y B;  4HAY B;  2KDI A;  1YQ4 B;  1WH3 A;  2AQ2 B;  2N7J A;  3DHG C;  3SDL C;  3ODO A;  4M01 A;  4JKD A;  3HK0 A;  2WXJ A;  4HRS A;  2KMA A;  1QIL A;  4XZ4 A;  3BIN A;  1L0X B;  2N1V A;  5D27 A;  1WJN A;  4L1R A;  1VJK A;  2BWF A;  1ESF A;  1J7A A;  2RQ1 A;  2WXO A;  4FJV B;  3A9K A;  3PLU A;  2J52 A;  3JSV A;  2O6V A;  2K6D B;  3PVW A;  1ZOY B;  4REZ A;  2Q13 A;  1GB1 A;  1U27 A;  4C7Z A;  2LMC A;  4NQK E;  2LVP A;  3KVF B;  4G11 A;  3ZXV A;  3MTN B;  2DKP A;  4NPN A;  3UZT A;  4DQO C;  2DIK A;  2K22 A;  2I38 A;  1QQR A;  2JU6 X;  3BK1 A;  4QJ5 B;  2DZM A;  4JWS C;  1YJI A;  5E6O A;  1DBH A;  4XDC A;  2ON8 A;  4A6H A;  2GBJ A;  2ZPY A;  1P7E A;  1K52 A;  3R2I A;  3DBR B;  3EGR A;  3NS1 A;  3PZ8 A;  2NTT A;  3NSU A;  2WX1 A;  1WF9 A;  1C4C A;  1MHX A;  3IFW B;  2I1K A;  4HHV A;  4BZA A;  1Y56 A;  4DHJ D;  2BYT A;  2CU1 A;  3Q14 C;  2KIE A;  1YJJ A;  3WAN A;  2KCJ A;  2HD5 B;  1L5P A;  4XDD A;  2CY4 A;  1Q67 A;  4DHZ E;  2L05 A;  1E10 A;  4K81 A;  2JPH A;  1YD8 U;  3A1Q A;  2KJR A;  5L83 A;  3DCG A;  2WS3 B;  4XX5 A;  1E7U A;  3B2G A;  5D3X A;  4LNK A;  3DPD A;  2WLB A;  3R66 C;  3ZTC A;  3QX1 A;  5IAA C;  2RSU A;  2W82 A;  4C56 C;  1V1P A;  4ASW C;  4NAW A;  5BYR A;  4BBK A;  1GAQ B;  2MQJ A;  3OAW A;  2KUQ A;  2LOZ A;  1SF0 A;  5HE2 A;  2VH1 A;  3SFE B;  5J3Y A;  4TMA B;  3BZD B;  4HLE A;  3ZJT A;  1WXM A;  3W2D A;  3SEB A;  4WWM A;  1E8X A;  2BYF A;  2E6X A;  5FKA C;  3D8D A;  2LVO A;  2DNF A;  3ML9 A;  2BYE A;  4XWT A;  1OEY A;  3RN9 C;  2KFK B;  1WE7 A;  3AN1 A;  3L54 A;  3V6C B;  5C5B A;  3Q3O C;  2KZR A;  3NZU A;  3URY A;  2EMT A;  2WXG A;  2WH5 A;  4YTM B;  2KN5 A;  5HFY A;  3MHZ A;  1JWS D;  1ACC A;  1LB1 A;  5GXG B;  2JP2 A;  3PRE A;  3MC0 B;  2PTL A;  4BKS D;  3A58 A;  4A5K A;  1TXD A;  4HSI A;  4TSS A;  1T77 A;  2OHF A;  4A55 A;  3C8Y A;  4OW0 A;  1E9M A;  2K2U A;  2MA9 B;  2ACZ B;  4IG7 B;  2BB5 A;  3ENE A;  3GS2 A;  2WNM A;  1WGY A;  3BII D;  3V60 A;  2P0D A;  2K00 A;  3PVU A;  4EMO A;  4KIK A;  1DDM A;  1JWA D;  4IW0 A;  1HZ5 A;  4K3C A;  5JHG A;  3A33 B;  1EGX A;  4L2Y A;  2LHE A;  3K9P B;  4RFB A;  3MDB C;  3VIA A;  2KX3 A;  1ZE3 D;  2JYE A;  2BKR B;  2E3T A;  4DXF A;  4GDK B;  5D7G A;  2AX5 A;  3PHX B;  4YON A;  5IOI A;  2HJ1 A;  3D8F A;  5KCV A;  2KO3 A;  4LDT B;  4ZRP A;  1FXA A;  3PHW B;  5E6P A;  5JZE B;  1FXI A;  2ZPN A;  3TEZ A;  5DI9 B;  5G2N A;  4MK0 A;  1U29 A;  3TJP A;  4AQ7 A;  1QOG A;  1Q0W B;  5JXV A;  4MEL A;  1HE8 A;  4G3X B;  4FAD A;  4JLC A;  2EEL A;  4US8 A;  3G9W A;  4NNJ B;  2BW2 A;  3ZDM C;  2KC2 A;  4N9F 4;  3APC A;  3MC9 A;  2D07 B;  2J59 M;  1GG3 A;  2LVQ A;  4AJW A;  3P42 A;  4ILH A;  1MG8 A;  1C78 A;  2MBO A;  3Q8B A;  1T0Y A;  1MJD A;  2PMV A;  3FIL B;  5HKH A;  5G55 A;  3NG0 A;  4AP4 C;  1TKG A;  2DKQ A;  3VH4 B;  4MSM B;  1L0Y B;  5EE0 A;  2JXT A;  3EUB 2;  3ENB A;  1WXS A;  1DDW A;  2J7Q B;  4FXC A;  4KV2 A;  5C2T B;  3VTW A;  1CK1 A;  4GU2 A;  3DVN V;  1C4P A;  4W9H A;  4E74 A;  3TIX A;  3KQ4 A;  5BMG A;  4B95 A;  4OSN A;  1DYQ A;  3SHQ A;  1N5W A;  1XLO A;  2AL3 A;  2AWT A;  4PT5 A;  3ML8 A;  3SNH A;  1VBG A;  2WDT B;  4GOC A;  3I9V 1;  2MCN B;  4HCN B;  2ZCC A;  3PG7 A;  3MPX A;  4WJP A;  3P4P B;  4DX9 0;  2BB6 A;  2R0D A;  2K8B A;  4WJO A;  1SSN A;  5J2R A;  1Q5W B;  2DWQ A;  2LOX A;  5BMH A;  1S1Q B;  4MH0 E;  2ZCB A;  2R82 A;  2ZKM X;  3V62 A;  1WI0 A;  3S2A A;  1K8R B;  2ZW0 A;  4MJS A;  2YVC A;  1V5O A;  4A3P A;  4RH6 A;  1YQB A;  4NY0 A;  4K3B A;  5D3Y A;  4QXA B;  4IWQ A;  2NMB A;  3AJ4 A;  1PGX A;  1IYF A;  1U5F A;  5CHF A;  3UI3 A;  4HWI B;  1XLN A;  4GNK B;  3EC8 A;  1EUV B;  1XLP A;  5AEK B;  1FM0 D;  2MBB B;  4A9A A;  1DYN A;  4K1R B;  4WVF B;  1IGC A;  5HG2 A;  1JWB D;  3KRW A;  4WWN A;  2K2J A;  5E6N A;  2PIA A;  1ZYI A;  4DXA B;  2RNR B;  1C4A A;  3SD5 A;  3TEX A;  1KOT A;  4JKG A;  2MKR A;  4L23 A;  2CAY A;  1K50 A;  4JL9 A;  2YEP B;  2ROZ B;  1SJE D;  1NEN B;  4C4V B;  4ZYN A;  1D4B A;  3FC4 A;  2KAJ A;  3NVV A;  3H6N A;  4BOZ B;  4EFO A;  1KLV A;  4GMV A;  1ZXH A;  2MSE D;  3DHH C;  1JW9 D;  4Y94 A;  2MP2 B;  1FRR A;  3ABV B;  1C3T A;  4C7Y A;  1S3S G;  5C6R A;  2CRF A;  2DYN A;  4JK9 A;  4ZHP A;  2UZS A;  4FHK A;  4KKJ A;  2L2I A;  3M1I B;  2JQR B;  1ZDV A;  1NTY A;  4TUU A;  3Q8F A;  4OVV A;  1MIX A;  2YEP F;  3AE7 B;  2PZ1 A;  3PSC A;  3R8B A;  1FD6 A;  5D6J B;  2VSZ A;  2JZZ A;  4RGT A;  4LDT D;  4GPT B;  1HQR D;  1WGQ A;  1WGD A;  3AEE B;  2LG1 A;  2JUO A;  2X8X X;  3A9J A;  3A98 B;  4IOI E;  5AZF A;  3W1S A;  5IN7 A;  3HRD D;  3IT6 B;  3RZF A;  3DVG Y;  4JKE A;  4M00 A;  2IJ0 A;  3HM3 A;  2IO1 B;  3V6E B;  2KUP A;  4TQ1 A;  1DOY A;  2XQN M;  2Z0E B;  4ZRJ A;  1UPQ A;  4A8X C;  2GBR A;  3ODX A;  1OTR B;  4MM3 B;  2KJ6 A;  2WDQ B;  2IY0 B;  1MI0 A;  1FFV A;  2DHZ A;  1WX8 A;  1B9R A;  3U30 A;  4OVZ A;  4CHJ A;  3N1X C;  4WWO A;  4ICV A;  1WX9 A;  2DLW A;  2Z4D A;  2KTR A;  2CHX A;  5JH5 C;  3A4R A;  2WQY B;  1RM6 C;  4BOS C;  3ZW3 A;  3U7Z A;  5HHD G;  2PE6 B;  3ZLZ A;  2XK5 B;  1OFF A;  4P1C C;  2KIG A;  2KQ7 A;  2KOX A;  2MJ3 A;  4URK A;  2DX5 B;  3MHS D;  3P63 A;  4AOF A;  3ZTD A;  1P5T A;  2GOW A;  1P98 A;  1PGA A;  1QOB A;  4CQN A;  1IBX A;  2KYW A;  1I4P A;  4HAV B;  3VRA B;  2QKL A;  1DIK A;  2ZNV C;  4LJO B;  3AU5 A;  2FDQ A;  2P0F A;  3WAP A;  3Q3J A;  1FMA D;  4RM9 A;  3KYD D;  2D9Y A;  2WXK A;  1UEL A;  2N9K A;  5M4Y B;  2G9H D;  1HBK A;  4P7I A;  3HVD A;  3AEF B;  1RYJ A;  2DLB A;  3SR6 A;  1OY2 A;  1GPX A;  2D3G A;  4FJY A;  4QAY A;  2O2V A;  1GUA B;  2FUH B;  2KT7 A;  4KHO A;  1A5R A;  4KVG B;  2DEN B;  2CQU A;  4M0W A;  4AWJ A;  2IPK D;  2R61 A;  2PJH A;  5C3J B;  4S17 A;  2KVZ A;  1LXD A;  4C0A A;  2D3C A;  2GS0 A;  4TYZ A;  5DHF B;  5J3Q A;  3KWV A;  1Z2M A;  3BYY B;  4L1B A;  4DDG D;  4HRO A;  1EVH A;  2L00 B;  3NWA A;  3ZQ4 A;  1CZP A;  1M94 A;  5MPO A;  4JGH B;  3LYY A;  1GJZ A;  1AYF A;  3KUC B;  5JHA A;  1EWC A;  3E56 A;  3M3J A;  3DBH B;  1KI1 B;  2NR2 A;  2JZ3 B;  2HRJ A;  2DFK A;  2Y8F A;  3N3K B;  1FXT B;  1FCC C;  4LK0 M;  1XQQ A;  4LCD E;  2EJ8 A;  1T0R C;  3OWE B;  2IO2 B;  1KJT A;  3RPF C;  4GIV A;  1T0S C;  1TZ1 A;  1WXQ A;  5I2M A;  1FIQ A;  1JML A;  1FGZ A;  3PS6 A;  1D6E C;  2SAK A;  2HDE A;  2D10 A;  1N63 A;  4ILJ A;  1WYG A;  3ALB A;  1VZ6 A;  3KWL A;  4IFS A;  2FNJ B;  4Q2J A;  2ZNV B;  1ZUD 2;  1FHO A;  4JK8 A;  2L1A A;  2VH2 A;  1CJE A;  3O13 A;  2WU2 B;  2J42 A;  1QLB B;  4IC7 B;  1N3H A;  3M63 B;  3TUO A;  3BVG A;  1KBL A;  4Z2M B;  2LAS A;  2DTC A;  2RPV A;  2MDX A;  1SE4 A;  1PFD A; 
#chains in the Genus database with same CATH homology
 2Z0Q A;  3I3T B;  1MK7 B;  5LXI B;  3UIN B;  1UNP A;  2NVU I;  1FB8 A;  2RGF A;  2X0S A;  3GYP A;  5DIF B;  2FCQ A;  4HAW B;  5CHW A;  5IJM A;  1WYW B;  3P2B A;  3DDC B;  4IWO A;  2ZJD A;  1BTN A;  1NTI A;  2NS5 A;  3AXC A;  4KDL B;  1V88 A;  3VH3 B;  3RT3 B;  4WJ7 A;  4EUT A;  4HB4 B;  1UH6 A;  5JLJ B;  2PE9 A;  5TR5 A;  3KZ1 A;  1HB8 A;  1RLF A;  2LGY A;  3NY5 A;  4WJQ A;  2C9W B;  3U7D A;  3E9L A;  1J8C A;  3FSS A;  3JYU A;  1F9J A;  2W9N A;  3X0W A;  1BWN A;  2YF0 A;  2GMI C;  2HTH B;  5J3T A;  1XD4 A;  2CHZ A;  2I1J A;  4HK2 A;  1SGH A;  3KRX A;  2QHO A;  5AZG A;  1UBQ A;  2D11 A;  2XEW A;  4B9K A;  2LUL A;  3PLV A;  3IBE A;  4IM0 A;  4D0N B;  5KHO A;  5CLQ B;  3ML4 A;  3A9K B;  3UF8 A;  3L16 A;  2Z0O A;  2MX2 A;  2RR9 A;  3DBS A;  4ILG B;  3B08 A;  4EOY A;  3ZVR A;  3L08 A;  1NVL A;  4W9K A;  1I35 A;  4MY6 A;  2KXJ A;  3DBH I;  2KFK A;  4HAZ B;  1WFY A;  2NZ8 B;  4PYZ A;  4GSW A;  1WZ3 A;  5KQ4 A;  3E9O A;  4B6W A;  5D2M B;  3W1Y A;  3LJ3 A;  1IPG A;  5C16 A;  2L0F A;  1UNQ A;  4CHM A;  5CTR C;  2DA0 A;  1WJ4 A;  1W1D A;  1V86 A;  1VBH A;  1SIF A;  4ZRK A;  2RLO A;  1SE9 A;  2J0M A;  2MBH A;  2DAJ A;  2OJR A;  1TGZ B;  3HIZ A;  1WGG A;  1Z87 A;  3PT2 B;  4KSL C;  4JKC A;  2E2X A;  3AUL A;  1Y5O A;  2KD0 A;  4W9D A;  3TFM A;  3PP2 A;  5J17 A;  3NZS A;  4WAA A;  2L7R A;  3T9L A;  3T06 A;  1P9D U;  3QCA A;  4G50 A;  3AI5 A;  3TW1 A;  2GCJ A;  4GDL B;  4HDO A;  3L0W B;  4JKH A;  1GC6 A;  3B0A A;  1LQB A;  3A8Q A;  2MLB A;  4M8M A;  4HPL B;  2G3Q B;  3GYO A;  1XT9 B;  2ROV A;  2MFQ A;  2AEH A;  1DDV A;  1V6E A;  4IM3 A;  1WXA A;  2IO0 B;  1E90 A;  4ANX A;  3CF6 E;  4AJY B;  3SU8 X;  1WGU A;  3H7P B;  1YIW A;  3SYX A;  2NBV B;  3WA0 A;  1E5W A;  3DQV A;  4BFR A;  3L10 B;  1EF1 A;  2DN6 A;  3PRM B;  3VOQ A;  4KIK B;  2C7H A;  2X18 A;  3ZVV A;  3DVN U;  2YRY A;  2KHW B;  3RUI B;  3H9D A;  3N7C A;  1U2B A;  2OOB B;  2G4S A;  2UVM A;  2IBI B;  3DBR I;  3HQC A;  4Z2N A;  5GOW B;  1UEF A;  4KHB B;  2FCN A;  3WYF B;  2R2Q A;  3DXE A;  1VD2 A;  1U5E A;  4GGQ A;  3KUD B;  2H7E A;  2W2W A;  4MEM A;  4K7S A;  3SO6 A;  2YLM A;  2RUK B;  1LW3 A;  4KZ0 A;  1KZ7 A;  2HJ8 A;  3VTU A;  1TTN A;  3PEG A;  4A6F A;  1WGH A;  4K2O A;  4DBG A;  4PNK A;  3DOW A;  2FJ9 A;  2GBM A;  3VUW A;  3X23 A;  2MP2 A;  3SV1 A;  2BGF A;  1Z5S B;  1WMH B;  2CKH B;  3KH0 A;  2W2X D;  2IYB A;  3LDZ E;  3VXW A;  2D9Z A;  4EZK A;  2V76 A;  1NI2 A;  1K5D B;  3SUZ A;  4WQO B;  5DPW A;  2NPT B;  2KX0 A;  1MKE A;  5J18 A;  1ZVR A;  1V49 A;  2HE7 A;  2N23 A;  3PRZ A;  5L95 C;  1WM2 A;  3VAW A;  4MJS B;  2LXC A;  2MWN B;  1TBE A;  2EMS A;  4I6P A;  1RRP B;  2FJL A;  2LJ5 A;  1J0W A;  3FEH A;  5KHQ A;  2UYZ B;  5LLI A;  5JP4 A;  2JRH A;  2LKO A;  2K1F A;  3ZNH B;  1LFD A;  4KSK C;  3WAL A;  3U8Z A;  2Z0D B;  4JKG B;  2KTF A;  4A6K A;  4EKU A;  3E9P A;  3F5R A;  1D3Z A;  3KUZ A;  3E66 A;  2XK5 A;  2RVB B;  1SHC A;  3R7R A;  1Y8R C;  2BKF A;  4BKT A;  1UGM A;  1WZ0 A;  3PZD A;  1FHW A;  3SBG A;  3PRP B;  2MBQ A;  4IAP A;  1RFA A;  4L6E A;  1FAO A;  4GN1 A;  5IA7 A;  4IUM B;  3ZO5 B;  4MGI E;  2K25 A;  1KM7 A;  4XWX A;  4W9G A;  4RMA A;  1UD7 A;  5CHV C;  3V5W A;  3RUL A;  3RCZ A;  2KWV B;  2DX1 A;  1BT0 A;  1P1A A;  3L13 A;  1TQZ A;  3KYC D;  3TMP B;  4WJN A;  3N30 A;  1ZW7 A;  2YS3 A;  4NSW A;  1I2H A;  2N7E A;  3UIO B;  2K39 A;  2N9X A;  5D94 A;  1X1M A;  2CY5 A;  3IHP C;  3TO1 A;  5JHB A;  1RRB A;  1ISN A;  4MT7 A;  2FAZ A;  2JT4 B;  2KK8 A;  3QIJ A;  2YT1 A;  2NBU A;  4DBB A;  2KDB A;  4A3O A;  4MGK E;  4EZL A;  3DXD A;  4II3 B;  1J19 A;  4B6H A;  4HB3 B;  4HVB A;  5LXH A;  1V5M A;  3OAN A;  4BBN C;  3APD A;  1U5D A;  4DDI D;  2ZZP B;  1XR0 B;  1PFJ A;  2UWQ A;  2DZJ A;  2O2V B;  2LRW A;  1WVH A;  1TJ6 A;  5FI0 A;  3OLM D;  4K7W A;  5HE0 A;  1XKE A;  2KAN A;  3WAO A;  2L8J A;  3Q3F A;  2V4L A;  5DH9 B;  4IOY X;  1Q1O A;  4W9C A;  2L76 A;  3IVF A;  3VHT C;  4BKS A;  4G0N B;  1XX0 A;  1L2N A;  3VDZ A;  2EC1 A;  1U4A A;  4IWP A;  1IRS A;  1J0G A;  2B3A A;  1BAK A;  3TL5 A;  4TQ0 A;  3TCA A;  3UQB A;  2YS5 A;  1I7A A;  4X57 B;  3RZW C;  2UZR A;  2LXA A;  4MGZ E;  1GC7 A;  1X86 A;  3ONS A;  3CIK A;  4LJP B;  3L17 A;  2A5U A;  5DPR A;  5LON B;  2WYQ A;  3H7S A;  3WIM A;  1ST7 A;  4KAX B;  4JKF A;  2LI5 A;  1WJM A;  1FHX A;  4ZDV A;  2JF5 A;  4TKN A;  3DBL I;  1IP9 A;  2COD A;  2BWE S;  4PS8 A;  1B55 A;  3QQ8 B;  1E8W A;  2LD9 A;  1YX6 B;  2C5L C;  2C60 A;  2HTH A;  2ABD A;  4HB0 B;  3QWM A;  3B1L X;  2VRR B;  1ZSQ A;  4BBN F;  3QAQ A;  4II2 B;  2G35 A;  2YSZ A;  3GOE A;  3PPA A;  2DHI A;  2DAF A;  1W1G A;  1ZKH A;  2LRU A;  2MRP A;  3ZRC A;  2K8H A;  2QKM A;  2NCN A;  1OEY J;  4EZJ A;  3ULC A;  2IYD B;  4MSQ B;  4HXD A;  2KJH B;  4FLH A;  2N1W A;  4E71 A;  2A4Z A;  1H10 A;  3EEC A;  4WWP A;  2M17 A;  3C0R B;  1AAR A;  3ZKJ C;  2W2X C;  3PSE B;  4OVU A;  3KSY A;  1L7Y A;  1FOE A;  3OJ3 A;  1RJ2 A;  1P3Q U;  4TV3 A;  2AL6 A;  2L0T A;  4W9J A;  4PS7 A;  4F7H A;  3EPY A;  3PTF C;  3JSV B;  2O6V B;  4J6I A;  5EDS A;  4DWF A;  1VCB A;  2KVR A;  2YT0 A;  4XC2 A;  2BPS A;  2WWZ A;  5C23 A;  4DX8 A;  3D8E A;  2NBW B;  3DVG X;  1AWE A;  2KLC A;  2PEA A;  3P6A A;  2JY6 A;  1CMX B;  3JW0 X;  1WM3 A;  1NTV A;  3ULB A;  1OMW A;  2D9W A;  2KKC A;  3FLV A;  3QBV B;  2M4N A;  5JHH A;  3QAR A;  3A1Q B;  1I42 A;  1EO6 A;  4HB2 B;  3NHE B;  4EEW A;  3UQA A;  2L1C A;  5AZH A;  1MPH A;  2K6Q A;  4FN2 A;  3VFK A;  4W9L A;  2Y7B A;  4CYE A;  2I5C A;  3WAM A;  1WJU A;  4GDL A;  4NAW B;  1WX7 A;  4GDK A;  3ZNG C;  3RCP A;  3FP5 A;  5D3V A;  3KY9 A;  1X05 A;  2D4Q A;  5DPS A;  2AYO B;  4GB9 A;  1Y19 B;  2KWU B;  3CMM B;  1V5P A;  1ZC4 B;  4W9I A;  4AUQ C;  1P3R A;  1R4N I;  3ZNZ B;  4ANV A;  3H7P A;  2DHJ A;  3VVW B;  2DZI A;  2JVC A;  5CX3 A;  1JRU A;  1P0R A;  5C5B B;  1K5G B;  3LJU X;  1WI1 A;  2ZEQ A;  1NU2 A;  2M38 A;  2DYO A;  4W9E A;  3NOB A;  2MWS B;  3IG3 A;  5D3W A;  4KZC A;  4JQW C;  3ODW A;  4PS3 A;  1X1F A;  1PLS A;  1V80 A;  3GZN I;  3UGB B;  2IY1 B;  1GNU A;  1M7R A;  1UNR A;  4FJZ A;  4K7U A;  3PV1 A;  3QC8 B;  4KDI C;  2DYB A;  1R4M I;  2ZVN A;  3AU4 A;  5DHA B;  2DZK A;  3ECI A;  2KWC A;  2CR5 A;  1E8Y A;  2MBE A;  4JK7 A;  4ZRI A;  3PVL A;  2RSG A;  3EHV A;  2LGX A;  2O6V D;  2CHW A;  2VKI A;  4H8S A;  1XOD A;  5BO4 B;  2FID A;  4NQL B;  5KQ1 A;  2KDF B;  2D2Q A;  2C7M B;  5JVL A;  2GBK A;  2LGD A;  4GMX B;  1WXV A;  3V61 A;  1WR1 A;  4GXB A;  2R2O A;  1WY8 A;  1EF5 A;  2Y8G A;  2IZV B;  1WMH A;  2COA A;  5GMV A;  2IO3 B;  2LUE A;  1ZM0 A;  2RD0 A;  2OQB A;  2JXX A;  1HB6 A;  1W1H A;  2REX A;  2DHK A;  1RAX A;  2OTX A;  4JIO U;  2JRI B;  1JDE A;  1V5U A;  2NPT A;  5C1Z A;  5LOP B;  3TVV A;  1PMS A;  2FCM A;  2M1M A;  1V5T A;  5L81 A;  2V3S A;  1NDD A;  2KFJ A;  1ZC3 B;  4DK5 A;  4ANW A;  1KC7 A;  1UBI A;  1DRO A;  2ZVO A;  3D32 A;  1H4R A;  2V1Y A;  2XBB C;  4HCP B;  4F7Z A;  2C7N B;  1WRD B;  1OQN A;  5DPT A;  3W1S C;  3KW5 B;  4E3C A;  2Z59 B;  1X1G A;  2LWP A;  4MGY E;  2BF8 B;  1YX5 B;  4A6F B;  3ZDT A;  4F7G A;  1ACA A;  3APF A;  3OJ4 B;  2KQS A;  4CO7 A;  2M14 A;  3A8P A;  2FCS A;  3K9O B;  4I6N B;  3JVZ X;  4MM3 A;  1UZX B;  3M62 B;  3SBT A;  4K17 A;  3NS8 A;  4WSF A;  2D9X A;  4JKA A;  1YJ1 A;  5DCN A;  1LM8 B;  1WGR A;  2H7D A;  1XD3 B;  2PPH A;  3F0W A;  4FA6 A;  4ICU A;  3P7Z A;  4HPM B;  3CST A;  2GBN A;  5C79 A;  3RD2 A;  1GGO A;  2Y5B B;  2DX5 A;  3H1U A;  4M8N A;  1WJ1 A;  2ELB A;  5FR6 A;  2P8V A;  1QZE A;  1WR6 E;  4FUL A;  4NJ6 A;  3ZUN A;  4HAU B;  3ZRF A;  2Z0P A;  1H8C A;  1V61 A;  1E7V A;  4PQ0 A;  3TBL D;  3A9J B;  4HAX B;  4MDK E;  1V89 A;  2N0Y A;  4KHA A;  3N32 A;  4BKG A;  4EJN A;  3FM8 C;  4I6L B;  2G45 B;  2KLG A;  3UIP B;  1OGW A;  3A4S C;  3QK0 A;  2DYM A;  1E8Z A;  2I5F A;  1WE6 A;  3HM6 X;  3R7Q A;  2P0H A;  1MK9 B;  2D9V A;  5CLL B;  2CB8 A;  2YS1 A;  3ZNI D;  4IM2 A;  2KTR B;  3MJW A;  2FIF A;  2LBB A;  2KMC A;  2GCL A;  1XCG A;  2LYD A;  2BYV E;  5FI1 A;  2ASQ A;  3EFU A;  2COC A;  2COP A;  1QQG A;  2N9P C;  4F8C B;  1G6J A;  1AQC A;  2JWZ A;  2N4F A;  2IFS A;  1WG7 A;  1P6S A;  1OQY A;  4RM8 A;  4F1S A;  2LZ6 A;  2EKE C;  4GZU A;  2M8S A;  3VUX A;  4HAT B;  3O96 A;  3QWZ B;  3HHM A;  1MAI A;  3QJZ A;  4YL8 A;  3CXB B;  3VQI A;  1WIA A;  4PYU A;  4DHJ B;  4CHK A;  2J0J A;  2DYQ A;  2RPQ A;  4M0W B;  2M0X A;  4A20 A;  3RYT A;  2RGN B;  3PGE A;  3R3M A;  2GJY A;  2KDE B;  3DXC A;  2L3Z A;  2N9E B;  1MIZ B;  3M95 A;  2COF A;  2G4D B;  5HE1 A;  2BCJ A;  4FBJ B;  1KZG A;  1EAZ A;  1WJ6 A;  2J0K A;  2KGX B;  3BJI A;  1M7E A;  1U5G A;  4BVU C;  2CS4 A;  4NJ7 A;  2N7D A;  1X11 A;  1UPR A;  4F7U P;  1NBF C;  3ZIM A;  5HE3 A;  4HJK A;  5EFX A;  4W9F A;  2KNB A;  3VUY A;  2ELA A;  3T8M A;  1V81 A;  4FHJ A;  3QHT A;  2VRW B;  3O65 B;  2R09 A;  1BTK A;  3CSF A;  4DHZ B;  1PQS A;  1V9J A;  4ANU A;  3BY4 B;  4JKB A;  3HW2 B;  2MW5 A;  3VTV A;  1FGY A;  1QC6 A;  4HDQ A;  2K8C A;  2ADZ A;  1ZGU B;  2WX0 A;  4K2P A;  1V2Y A;  3QA8 A;  2KC1 A;  1C1Y B;  4HAY B;  2KDI A;  1WH3 A;  3SDL C;  3ODO A;  4JKD A;  3HK0 A;  2KMA A;  4XZ4 A;  3BIN A;  2N1V A;  5D27 A;  1WJN A;  2BWF A;  2RQ1 A;  4FJV B;  3A9K A;  3PLU A;  3JSV A;  2O6V A;  2K6D B;  3PVW A;  2Q13 A;  1U27 A;  4NQK E;  2LVP A;  3KVF B;  4G11 A;  3MTN B;  2DKP A;  4NPN A;  3UZT A;  2DIK A;  2DZM A;  5E6O A;  1DBH A;  4A6H A;  2GBJ A;  2ZPY A;  3NSU A;  2WX1 A;  1WF9 A;  3IFW B;  2I1K A;  4HHV A;  4DHJ D;  2CU1 A;  3WAN A;  2KCJ A;  2HD5 B;  2CY4 A;  1Q67 A;  4DHZ E;  2L05 A;  4K81 A;  2JPH A;  1YD8 U;  3A1Q A;  2KJR A;  5L83 A;  3DCG A;  4XX5 A;  1E7U A;  5D3X A;  3DPD A;  3R66 C;  3ZTC A;  3QX1 A;  5IAA C;  2RSU A;  4ASW C;  4NAW A;  4BBK A;  2MQJ A;  3OAW A;  2LOZ A;  5HE2 A;  5J3Y A;  4HLE A;  1WXM A;  1E8X A;  2BYF A;  3D8D A;  2LVO A;  3ML9 A;  2BYE A;  1OEY A;  2KFK B;  1WE7 A;  3L54 A;  3V6C B;  5C5B A;  2KZR A;  3NZU A;  2EMT A;  2WH5 A;  2KN5 A;  1LB1 A;  2JP2 A;  3PRE A;  4BKS D;  4A5K A;  1TXD A;  2K2U A;  2MA9 B;  4IG7 B;  3ENE A;  1WGY A;  3V60 A;  2P0D A;  2K00 A;  3PVU A;  4EMO A;  4KIK A;  1DDM A;  4IW0 A;  5JHG A;  3A33 B;  1EGX A;  3K9P B;  3MDB C;  3VIA A;  2KX3 A;  2BKR B;  4GDK B;  5D7G A;  3PHX B;  4YON A;  3D8F A;  5KCV A;  2KO3 A;  4LDT B;  3PHW B;  5E6P A;  5JZE B;  2ZPN A;  5DI9 B;  5G2N A;  4MK0 A;  1U29 A;  3TJP A;  1Q0W B;  4MEL A;  1HE8 A;  4G3X B;  4FAD A;  4JLC A;  3G9W A;  4NNJ B;  3ZDM C;  2KC2 A;  4N9F 4;  3APC A;  2D07 B;  2J59 M;  1GG3 A;  2LVQ A;  4AJW A;  4ILH A;  1MG8 A;  2MBO A;  1T0Y A;  5HKH A;  5G55 A;  4AP4 C;  2DKQ A;  3VH4 B;  4MSM B;  3ENB A;  1WXS A;  1DDW A;  2J7Q B;  4KV2 A;  3VTW A;  4GU2 A;  3DVN V;  4W9H A;  4E74 A;  3TIX A;  4B95 A;  3SHQ A;  2AL3 A;  2AWT A;  3ML8 A;  3SNH A;  1VBG A;  2WDT B;  4GOC A;  2MCN B;  4HCN B;  2ZCC A;  3PG7 A;  3MPX A;  4WJP A;  4DX9 0;  2R0D A;  2K8B A;  4WJO A;  5J2R A;  1Q5W B;  2LOX A;  1S1Q B;  4MH0 E;  2ZCB A;  2R82 A;  3V62 A;  1WI0 A;  3S2A A;  1K8R B;  4MJS A;  2YVC A;  1V5O A;  4A3P A;  1YQB A;  4NY0 A;  5D3Y A;  4IWQ A;  2NMB A;  3AJ4 A;  1IYF A;  1U5F A;  5CHF A;  4HWI B;  3EC8 A;  1EUV B;  5AEK B;  2MBB B;  1DYN A;  4K1R B;  4WVF B;  3KRW A;  4WWN A;  2K2J A;  5E6N A;  4DXA B;  2RNR B;  3SD5 A;  1KOT A;  4JKG A;  2MKR A;  2CAY A;  4JL9 A;  2ROZ B;  4ZYN A;  3H6N A;  4BOZ B;  4EFO A;  1KLV A;  4GMV A;  2MSE D;  4Y94 A;  2MP2 B;  1C3T A;  1S3S G;  5C6R A;  2CRF A;  2DYN A;  4JK9 A;  2UZS A;  4FHK A;  2L2I A;  3M1I B;  1NTY A;  4TUU A;  4OVV A;  1MIX A;  2PZ1 A;  3PSC A;  5D6J B;  2VSZ A;  2JZZ A;  4LDT D;  4GPT B;  1WGQ A;  1WGD A;  5AZF A;  2LG1 A;  2JUO A;  3A9J A;  3A98 B;  3W1S A;  3RZF A;  3DVG Y;  4JKE A;  3HM3 A;  2IO1 B;  3V6E B;  2KUP A;  4TQ1 A;  2XQN M;  2Z0E B;  4ZRJ A;  1UPQ A;  2GBR A;  3ODX A;  1OTR B;  2KJ6 A;  2IY0 B;  2DHZ A;  1WX8 A;  3U30 A;  4CHJ A;  4WWO A;  4ICV A;  1WX9 A;  2DLW A;  2KTR A;  2CHX A;  5JH5 C;  3A4R A;  4BOS C;  3ZW3 A;  2PE6 B;  3ZLZ A;  2XK5 B;  2KQ7 A;  2KOX A;  4URK A;  2DX5 B;  3MHS D;  4AOF A;  3ZTD A;  1P5T A;  2GOW A;  1P98 A;  4HAV B;  2QKL A;  1DIK A;  2ZNV C;  4LJO B;  3AU5 A;  2FDQ A;  2P0F A;  3WAP A;  3Q3J A;  4RM9 A;  3KYD D;  2D9Y A;  1UEL A;  1HBK A;  4P7I A;  1OY2 A;  2D3G A;  4FJY A;  2O2V A;  1GUA B;  2FUH B;  4KHO A;  1A5R A;  4KVG B;  2DEN B;  2CQU A;  4AWJ A;  2PJH A;  1LXD A;  4C0A A;  2GS0 A;  4TYZ A;  5DHF B;  5J3Q A;  1Z2M A;  4DDG D;  1EVH A;  2L00 B;  1M94 A;  4JGH B;  1GJZ A;  3KUC B;  5JHA A;  3M3J A;  1KI1 B;  2NR2 A;  2JZ3 B;  2HRJ A;  2DFK A;  2Y8F A;  3N3K B;  1FXT B;  1XQQ A;  4LCD E;  2EJ8 A;  2IO2 B;  1KJT A;  4GIV A;  1TZ1 A;  1FGZ A;  3PS6 A;  2D10 A;  4ILJ A;  3ALB A;  4IFS A;  2FNJ B;  2ZNV B;  1FHO A;  4JK8 A;  4IC7 B;  1N3H A;  3M63 B;  1KBL A;  4Z2M B;  2LAS A;  2DTC A;  2MDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...