3ZDTA

Crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
368
structure length
326
Chain Sequence
b'ERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYKKSNYEVLEKDVGLRRFFPKSLLDSVAAATLAALIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPDYAEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 89
structure length 326
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3zdtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3zdtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdtA01
5J3YA 1J0GA 2OTXA 2NPTB 2ADZA 2O6VD 3TW1A 3ZLZA 1U2BA 2KTRB 2JF5A 4MH0E 3VHTC 3ZRCA 2KK8A 2KGXB 2GCJA 2WH5A 4DDGD 1V5MA 4A3PA 1R4MI 4KAXB 4B9KA 2RR9A 4ZRJA 1OY2A 2C5LC 3F5RA 2MX2A 1HBKA 4GIVA 2DTCA 1P5TA 4M0WB 3QA8A 1MK7B 1TTNA 1HB6A 4HB2B 1E8YA 2KJ6A 4KHBB 2IYDB 3JW0X 4P7IA 2O6VB 1GC7A 3NSUA 1NBFC 2DAFA 5C23A 2LXCA 2K8HA 1C3TA 4II2B 1UELA 2DAJA 2YLMA 5J2RA 5LXIB 3TMPB 4ANXA 2KLGA 5LXHA 4HXDA 1OQNA 3HK0A 1ZKHA 3U30A 1EF1A 4FLHA 1RRPB 1N3HA 2VRRB 1YD8U 3ML8A 2DHKA 2Z0DB 1OTRB 2XQNM 1SHCA 2QKLA 3JYUA 4F7GA 5HE0A 1XT9B 2NBVB 3BJIA 5D7GA 4K17A 2G3QB 3VUWA 2M8SA 4LJPB 3ZTCA 3PTFC 5D94A 1NTYA 5D3XA 1S3SG 2COAA 3BY4B 4BOSC 3D8DA 3SYXA 1FHOA 1OEYJ 2AWTA 3H7PA 5D3YA 2C7MB 4DX90 3R3MA 4I6NB 3VUXA 2HE7A 3L13A 2C7NB 2KWUB 4K7SA 1U4AA 2REXA 2LVOA 4GZUA 3VTUA 1FGYA 3SD5A 3WALA 4E3CA 3RCZA 2JXXA 4BKTA 4LDTD 3QCAA 3FLVA 1C1YB 3SNHA 2Y8GA 3DXEA 1ACAA 3H1UA 2LGDA 3HHMA 2MQJA 1KI1B 4ZYNA 2KFJA 3QHTA 2RSUA 3ZNID 2DKQA 3PVWA 3ZIMA 1WJ4A 2N1VA 4PS7A 2JZ3B 1X05A 5KQ4A 2JPHA 3H7PB 3OAWA 4F7HA 4LDTB 3PVLA 2FCNA 5TR5A 1Q67A 2YS1A 5DPWA 5FI0A 1KM7A 3PSCA 1WYWB 1QC6A 3PSEB 2LJ5A 2D9ZA 3H7SA 1UD7A 2KC1A 2KCJA 1EF5A 2L8JA 1EGXA 3A8QA 2AL6A 3L08A 5C6RA 2LKOA 3CMMB 3HW2B 3MPXA 3EHVA 3RULA 4KHAA 4MEMA 1WGRA 1MAIA 3Q3JA 2CR5A 3VAWA 1ZC3B 2DYBA 3KYCD 4HPMB 1ZGUB 4KZ0A 2L00B 3WIMA 2NR2A 2MBEA 5GMVA 2JP2A 1V5OA 2KFKA 2MA9B 2KXJA 5AZHA 1IYFA 2L1CA 2HRJA 5DHFB 4A6KA 4HCNB 2IO2B 4F8CB 2K8BA 1WXMA 3U7DA 3V6CB 1NVLA 2KTFA 3TIXA 4HVBA 4EJNA 2LXAA 4XWXA 1WGGA 2H7DA 1WGHA 1WMHA 4HB0B 3VIAA 1GUAB 3PLVA 3W1SC 1U29A 2GBKA 1BAKA 5E6OA 1OEYA 3DQVA 2K2UA 2MFQA 4IM0A 4W9CA 3W1SA 1L7YA 2I5FA 3RZFA 2H7EA 2COCA 2ZNVC 2FIDA 3APCA 3PLUA 2KNBA 1I35A 1Q5WB 3ZDMC 2LULA 2KFKB 3KSYA 3KYDD 3NZSA 3HM3A 3P6AA 3T9LA 2DX5B 4XC2A 5J18A 1UBQA 2OQBA 5DHAB 4IM2A 3V61A 1FXTB 1P0RA 5JHBA 3CIKA 2WX1A 1WMHB 3MTNB 2MBOA 2L7RA 2D3GA 3A1QA 3WAMA 4ZDVA 3CSTA 2N7DA 4FBJB 2JWZA 2C7HA 2E2XA 1VCBA 2RGFA 5L95C 3VDZA 2DA0A 5L81A 4NQLB 3RD2A 2KDEB 4RM9A 4MJSA 1WZ3A 3L16A 4GB9A 4GDKB 1RRBA 4M8MA 4NJ6A 4ANWA 3L10B 2ZNVB 3KW5B 4GDLB 2I5CA 2G4DB 4HB4B 4W9GA 2FUHB 4CO7A 5HE2A 2MW5A 1P3RA 4HPLB 3N7CA 3X0WA 1W1DA 3JVZX 4E74A 4DHJD 2M4NA 5CX3A 1UPRA 3EFUA 3OLMD 1T0YA 2J59M 4WQOB 5DCNA 3A1QB 1ZM0A 1WJ6A 1V81A 3QAQA 4OVVA 4FADA 1V86A 4MJSB 4TUUA 3DXDA 4B95A 2Z0EB 3GYPA 2CRFA 2RPQA 1DDMA 1PLSA 3AXCA 2YT1A 2KD0A 1B55A 3SDLC 5AZFA 4GGQA 2UZRA 3L54A 4K7WA 1V89A 2LOZA 2CHXA 3ZW3A 2KDBA 1M94A 2EKEC 4H8SA 1XD4A 1WIAA 5DH9B 3DBHI 1WR6E 3ZKJC 5KHOA 4GMVA 4NJ7A 1FHWA 1J0WA 2EMSA 2ZVNA 2KANA 3ONSA 3A4SC 1AARA 2FCQA 5KCVA 2LG1A 1PFJA 2MWSB 2O6VA 3N30A 2VRWB 1I2HA 1WGYA 4I6PA 2IFSA 3DOWA 2KQ7A 2XK5A 1K5GB 2HTHA 3PG7A 3UF8A 1E8ZA 3SUZA 1Q1OA 1Z5SB 2DZJA 3RZWC 3DVGX 1TJ6A 2D9WA 2KZRA 2G4SA 1XCGA 2VSZA 4FHKA 5KHQA 4ANVA 2FJLA 4M8NA 1DYNA 3ZDTA 1QQGA 4OVUA 3IHPC 2KMCA 3DCGA 1TBEA 3VUYA 5BO4B 1H10A 2BF8B 2COFA 4DK5A 1YJ1A 4HCPB 5C1ZA 4EEWA 2N1WA 2CQUA 4CYEA 2K2JA 3K9OB 1DDVA 3M3JA 2XK5B 2HTHB 4W9KA 2NCNA 1W1HA 1EVHA 1YX6B 2KMAA 3M62B 3IVFA 5DPTA 2DFKA 2GCLA 2BKFA 2JY6A 2D10A 4WSFA 3AJ4A 4GXBA 4EZKA 2R2QA 2BWFA 2J0KA 1WXVA 1MKEA 2LRWA 1KJTA 4BBKA 2CAYA 3ENEA 1OMWA 4F7UP 1GC6A 2GS0A 4A6FA 2LGYA 3Q3FA 2WDTB 2IYBA 2CY4A 4DX8A 5L83A 1LQBA 4EFOA 5D6JB 4ZRKA 4AWJA 1V80A 3NS8A 3NHEB 2R0DA 2N9PC 2MBBB 4IWQA 2ROZB 4TYZA 4BOZB 3PT2B 4F7ZA 4GN1A 2N9EB 2V4LA 1I7AA 4FHJA 4NNJB 2P0DA 1HB8A 2R09A 1TGZB 1E90A 4W9HA 2FDQA 5CTRC 2JT4B 1WX9A 2IO3B 1WRDB 2ELBA 3TCAA 1I42A 1WG7A 2BKRB 3N3KB 2YF0A 3VH4B 4B6HA 4A6FB 1E7VA 3M95A 3DXCA 1AWEA 1U5EA 1BT0A 4HATB 1WE6A 4HAYB 1FGZA 3ODWA 1Y5OA 3FM8C 4W9JA 2DZIA 2KDFB 1HE8A 5GOWB 2K39A 1W1GA 3U8ZA 2V76A 1Y19B 2W9NA 1U27A 2MWNB 1K5DB 2N9XA 2LBBA 2Z0OA 1V61A 3D8FA 3DVGY 4X57B 2GBMA 5G2NA 3DVNV 1P9DU 2IY0B 1UZXB 1H4RA 2J0MA 4ICUA 2MRPA 3APFA 3TO1A 3NY5A 1MK9B 1WE7A 2GJYA 2UVMA 3HIZA 2FNJB 3X23A 5J3QA 5FR6A 2KJHB 4PYUA 4TKNA 3UIPB 3S2AA 5LOPB 3QK0A 2MP2A 4MELA 3KZ1A 2VKIA 4JLCA 4IC7B 4HLEA 3F0WA 4PQ0A 3ML9A 3LJ3A 2YS5A 1MG8A 5DPSA 1E8WA 4WWOA 5JH5C 1D3ZA 5CHFA 2EJ8A 2MKRA 3T8MA 1WXAA 4WWNA 2DHIA 2DX5A 5D3WA 4URKA 3BINA 1V5PA 4ICVA 2MDXA 2D11A 2CS4A 2UYZB 2K6QA 4BKSD 3M1IB 2DZMA 1DROA 3B0AA 1YX5B 2EMTA 4MGZE 4GSWA 2WYQA 2FCSA 4I6LB 1LB1A 5DI9B 3DPDA 4HHVA 2MP2B 3R7RA 1U5FA 1P1AA 4GDKA 3RCPA 3PGEA 3A98B 2PE9A 5JHAA 4YONA 4Z2NA 1WVHA 1KZGA 2DYNA 2ZVOA 4GDLA 3WAOA 1A5RA 3O96A 4KDLB 3TBLD 4DDID 2CODA 3VOQA 3ULCA 1ZC4B 3KRXA 2L3ZA 1X1GA 2IO0B 1WGQA 1RLFA 3B08A 1DDWA 1XX0A 3VTVA 2K00A 4XX5A 1SE9A 2BYEA 4G0NB 2DENB 2DHJA 3MJWA 1ZVRA 3FSSA 5JHGA 2OJRA 4AOFA 2BGFA 2FIFA 3D8EA 1S1QB 1KOTA 2V3SA 4L6EA 3IG3A 2G35A 2A4ZA 2ZJDA 3VH3B 1V49A 2K6DB 5J3TA 2NS5A 2RLOA 3A9KA 2MBHA 3QJZA 2RQ1A 3O65B 3ALBA 4DWFA 1KLVA 3CXBB 2KVRA 2PEAA 2I1KA 1CMXB 2RUKB 3VVWB 4DBGA 4IFSA 2KDIA 2IO1B 3DVNU 1MPHA 2CHWA 4A3OA 1BTNA 4JQWC 2YRYA 1WR1A 3RT3B 2KKCA 5D2MB 3KUDB 1WJMA 3K9PB 4HDQA 1OQYA 4MGYE 2MLBA 1WGUA 3V6EB 4PS3A 2AYOB 1V5UA 1E5WA 1ZSQA 2YSZA 4J6IA 5CHWA 2P0FA 5CLLB 2UWQA 1TQZA 4TV3A 1ST7A 3A9KB 5FI1A 3ZNZB 2LVQA 1WI1A 4KDIC 2GBRA 5C5BA 1LW3A 2PPHA 2GBJA 3EECA 3M63B 1WM2A 4DHJB 1FOEA 3DBRI 4PS8A 2ZZPB 1GG3A 3B1LX 3GYOA 2M14A 4CHJA 1WX7A 2M38A 4C0AA 1WXSA 4WJOA 2KHWB 4MGKE 4K81A 4BKGA 4F1SA 1LFDA 3DBLI 3HM6X 4BVUC 3WA0A 2L0FA 3SU8X 4W9EA 4G50A 3A33B 1G6JA 1IRSA 3PRMB 4IOYX 3ZNHB 1V6EA 4RM8A 2KLCA 2LOXA 2D9YA 2DX1A 3VFKA 3SO6A 3D32A 4WJNA 2ELAA 5C5BB 4JIOU 2ZEQA 2MBQA 3PEGA 4EMOA 4A6HA 2ASQA 2M17A 4EUTA 1DBHA 1XQQA 2DYQA 2Z0PA 2OOBB 4W9LA 4Z2MB 3MHSD 2WWZA 4PNKA 2NBWB 3PVUA 4MSMB 3PV1A 3UINB 3G9WA 3KH0A 3P7ZA 3SV1A 3KRWA 1NI2A 3V5WA 4AJWA 4FJVB 3ODXA 1LM8B 1WY8A 2KX3A 2IZVB 2QKMA 2ROVA 3PREA 4IG7B 1GNUA 3AU5A 2LI5A 5J17A 1YQBA 2V1YA 1L2NA 5G55A 4EOYA 1BWNA 4W9IA 4EZLA 2KN5A 2QHOA 3CF6E 1Z2MA 1WH3A 5EFXA 1J8CA 4FJYA 3W1YA 4HAVB 4AJYB 2Y8FA 2CU1A 4DXAB 2RSGA 3OJ4B 2Z0QA 3NOBA 2KO3A 4KIKA 4LJOB 2NZ8B 3AU4A 1FHXA 2BYFA 3SHQA 4MSQB 1U5DA 4KVGB 3OANA 1UNPA 4Y94A 1V9JA 1M7RA 4BBNC 1V2YA 2C9WB 2J0JA 5DPRA 3ZO5B 4NPNA 3RUIB 2WX0A 1XR0B 3T06A 1WX8A 1NTIA 4A5KA 4HAWB 3ZVRA 4IUMB 4BBNF 1QZEA 3WAPA 2PE6B 3FP5A 5HE3A 2CB8A 1X1FA 2LWPA 2XBBC 5DIFB 1X86A 3PS6A 2N0YA 2LD9A 4GU2A 3QWZB 4KIKB 1M7EA 1F9JA 1Z87A 3PPAA 4YL8A 3V60A 2Q13A 4MDKE 3I3TB 2YT0A 4GOCA 4MM3A 2RGNB 2GMIC 2Z59B 1P6SA 2UZSA 4IWPA 1AQCA 1XODA 2L05A 2MCNB 4IM3A 3V62A 3L0WB 3MDBC 3IFWB 1WM3A 4HAUB 1Y8RC 3UIOB 2LASA 1WJ1A 1LXDA 2BPSA 4RMAA 1XD3B 2RVBB 4E71A 2M0XA 3TJPA 3ZRFA 3ZVVA 3QC8B 1UNQA 4WJ7A 2BYVE 3C0RB 5HE1A 2CHZA 2COPA 2CY5A 2KJRA 2FAZA 4IAPA 5JP4A 2L76A 1WGDA 3PHWB 4DHZB 2AL3A 2L2IA 3WANA 4KSLC 2DN6A 4ZRIA 3RYTA 1H8CA 2KWVB 2K1FA 1J19A 2K25A 5D3VA 3HQCA 1E7UA 2O2VA 2DYMA 3KUCB 2LZ6A 3R66C 3EC8A 4HAXB 2BCJA 3LDZE 1WJUA 3ODOA 5C79A 5E6NA 2CKHB 2IY1B 2R2OA 4NAWA 2D9VA 1WFYA 4DHZE 2GOWA 4AUQC 4WVFB 1K8RB 1X11A 4MGIE 5IJMA 2J7QB 1NU2A 1NDDA 3UGBB 2DYOA 2W2WA 2JUOA 3P2BA 3CSFA 2KX0A 4CHMA 1JRUA 1IPGA 4BKSA 3IBEA 3TVVA 3QQ8B 2JZZA 1IP9A 2X18A 2LUEA 1YIWA 4KZCA 2JVCA 2O2VB 4HAZB 4KHOA 2DHZA 2I1JA 3ULBA 2DKPA 3KUZA 1UEFA 4D0NB 2KUPA 4NAWB 1MIZB 2KQSA 3UZTA 1WZ0A 2LYDA 3DDCB 3KY9A 1VD2A 2GBNA 1RAXA 3NZUA 4K2OA 4MT7A 1SIFA 5C16A 2BWES 3H6NA 3GZNI 2KOXA 3ML4A 5HKHA 2XEWA 2NVUI 4HWIB 2RD0A 3TL5A 4EKUA 2IBIB 2HD5B 2Y7BA 1TZ1A 3VXWA 4PYZA 1EUVB 1PMSA 1V88A 4IWOA 5IA7A 3ECIA 3UQAA 4WJQA 1FAOA 5JLJB 3QWMA 3AI5A 1OGWA 3N32A 5E6PA 4WWPA 3A4RA 4CHKA 5CHVC 1ISNA 2P0HA 4TQ1A 4KSKC 4LCDE 4ASWC 4MK0A 4B6WA 3EPYA 4BFRA 4TQ0A 5KQ1A 2DZKA 1EO6A 3WYFB 3JSVA 4JL9A 4EZJA 3AULA 2D2QA 2LVPA 4A20A 2FJ9A 1BTKA 5LLIA 5LONB 1U5GA 3L17A 2N7EA 4II3B 3QX1A 1E8XA 4IW0A 2LGXA 3QARA 2MSED 3QIJA 2ZPYA 4W9DA 3PZDA 1WI0A 4HDOA 3GOEA 1EAZA 2EC1A 3PRZA 3KVFB 4HB3B 3ZTDA 3R7QA 2ZCCA 2L0TA 4G3XB 1PQSA 2N23A 4XZ4A 2HJ8A 2NBUA 3PHXB 4K7UA 2YVCA 3ZUNA 5JZEB 3JSVB 1WF9A 4GPTB 2W2XC 4GMXB 4G11A 4DBBA 3A9JA 1RJ2A 2KC2A 5AZGA 2JRHA 3QBVB 2DLWA 3OJ3A 2M1MA 5CLQB 2A5UA 1P3QU 2C60A 1ZW7A 4AP4C 2RNRB 4FJZA 1MIXA 1GJZA 1FB8A 1XKEA 4W9FA 4MY6A 4FA6A 1TXDA 2FCMA 2P8VA 3VTWA 2W2XD 3LJUX 1UH6A 4NSWA 1NTVA 3ZNGC 3VQIA 2D07B 2AEHA 1UNRA 2LRUA 4K1RB 2NMBA 2NPTA 4ANUA 2ZPNA 1V5TA 1P98A 5IAAC 4FN2A 4WJPA 3TFMA 1SGHA 2KTRA 3FEHA 3DBSA 2YS3A 4HJKA 2K8CA 4KV2A 4N9F4 2PJHA 3PP2A 2PZ1A 2G45B 2ZCBA 3A9JB 2N4FA 4K2PA 1RFAA 2ABDA 3APDA 2D4QA 4HK2A 5D27A 4WAAA 5EDSA 2KWCA 1WJNA 1KZ7A 3UQBA 4NQKE 5JHHA 1UGMA 2Y5BB 4NY0A 4FULA 2D9XA 1UPQA 1R4NI 1Q0WB 3A8PA 3H9DA 1UBIA 2B3AA 5AEKB 3PRPB 1X1MA 2JRIB 4JGHB
chains in the Genus database with same CATH superfamily
5J3YA 2JYEA 3Q3MC 1J0GA 2OTXA 2HTME 3AE8B 2NPTB 2ADZA 2O6VD 3TW1A 3ZLZA 1U2BA 2KTRB 2JF5A 4MH0E 3VHTC 3ZRCA 1JWSD 2KK8A 2KGXB 2V4IB 2GCJA 2WH5A 4DDGD 2PW9A 1V5MA 4A3PA 2V3PA 1R4MI 4KAXB 4B9KA 3NVYA 4NAMA 2RR9A 4ZRJA 1OY2A 2C5LC 2NBVA 3F5RA 2MX2A 2MEKA 2YT2A 1NYQA 1HBKA 4GIVA 2DTCA 1FFUA 1P5TA 4M0WB 3QA8A 3TEWA 1MK7B 1TTNA 1HB6A 4HB2B 1ZP0B 1E8YA 4KX6B 2KJ6A 4KHBB 2KACA 2YEPF 1BMLC 2IYDB 3JW0X 4ILHA 5TSSA 4P7IA 2O6VB 1GC7A 3NSUA 1NBFC 1ENFA 2DAFA 3FKYA 2WQYB 5C23A 4TMAB 2LXCA 1VZ7A 2K8HA 1AYFA 1TYGB 1E7PB 1C3TA 4II2B 1UELA 2DAJA 3NWAA 2YLMA 5J2RA 5LXIB 3TMPB 4ANXA 2KLGA 5LXHA 4HXDA 1OQNA 3HK0A 1ZKHA 1CZPA 5IOIA 3U30A 1EF1A 1I7HA 4XE0A 1TY2A 1YN4A 4FLHA 4C4VA 1N5XA 1XCQL 1RRPB 1N3HA 2VRRB 1T3QA 1YD8U 2KT7A 3ML8A 2DHKA 2Z0DB 1OTRB 2XQNM 1SHCA 3BYTB 2QKLA 3R2IA 1JWUD 3JYUA 1EM7A 4F7GA 5HE0A 1XT9B 2NBVB 3BJIA 5D7GA 5BYRA 4K17A 2G3QB 3VUWA 2M8SA 4LJPB 3ZTCA 1FNUA 3PTFC 5D94A 1T77A 2JZPA 3L4PA 2KVZA 1NTYA 2FJUB 2TSSA 1KC7A 5HHDG 5D3XA 1I4PA 2CU3A 1SJHD 2R82A 4NZLB 3ZJTA 1S3SG 2COAA 3BY4B 5D3DA 3E56A 4BOSC 1P7EA 3D8DA 3SYXA 3KWLA 1E0ZA 2KYWA 4RGOS 3RI7C 1FHOA 4JK8A 1OEYJ 3GE8C 1EWCA 3NZ3A 3I57A 2AWTA 4C4VB 3H7PA 5D3YA 3P1MA 2C7MB 4DX90 1HTOA 3R3MA 4I6NB 4C00A 4RF0A 1XXGA 3RNAC 3VUXA 2HE7A 2LEKA 2EELA 4YTPB 2K0PA 3L13A 2C7NB 2KWUB 4K7SA 1U4AA 1UGJA 2REXA 2LVOA 4GZUA 1VLBA 1FGYA 3VTUA 3SD5A 3WALA 4E3CA 3RCZA 2JXXA 3ETRA 4BKTA 1YQ4B 4LDTD 3QCAA 3FLVA 1C1YB 2BT6A 3SNHA 1KFYB 2Y8GA 1T0QC 4KGRA 3DXEA 1ACAA 3H1UA 4ZRPA 2LGDA 3HHMA 2MQJA 1KI1B 2Z13A 4ZYNA 2BQQA 2KFJA 3QHTA 1C4PA 3NG0A 2RSUA 3ZNID 5HFYA 1C4CA 2BYTA 2DKQA 5LG4B 3PVWA 3ZIMA 3RNBC 3FC4A 3MC8A 3NWDA 1WJ4A 1GB4A 2N1VA 4PS7A 2JZ3B 1X05A 5KQ4A 2JPHA 2V3NA 3H7PB 3OAWA 4H2AA 4F7HA 1SE2A 2PVOD 3PVLA 4LDTB 1JWMD 2FCNA 2G1EA 5TR5A 1Q67A 2YS1A 4QJ4B 5DPWA 5FI0A 1F0ZA 4XDCA 1KM7A 3PSCA 3AH7A 3ZJUA 3PO0A 1WYWB 1QC6A 3PSEB 1AW7A 1QILA 3BYYB 2LJ5A 1FEHA 2D9ZA 3H7SA 1UD7A 2AQ3B 2KC1A 2KCJA 1EF5A 2L8JA 3P4QB 3P4RB 1EGXA 2N9KA 3A8QA 2LFIA 2AL6A 3L08A 4JWSC 1XLNA 5C6RA 4US8A 2LKOA 3CMMB 3HW2B 3MPXA 3EHVA 3RULA 4C7YA 1VR9A 3ABVB 4KHAA 3NVWA 4RCOA 4MEMA 1WGRA 1MAIA 3Q3JA 2VZKB 2CR5A 3VAWA 1ZC3B 2DYBA 2DNFA 2NTTA 3KYCD 4HPMB 1Y56A 2ONQA 2WXRA 1ZGUB 4KZ0A 2L00B 1DOXA 3EFCA 3WIMA 5JXVA 2NR2A 1EWYC 2MBEA 3Q6BA 3NVVA 5GMVA 2JP2A 1V5OA 2KFKA 2MA9B 2KXJA 5AZHA 1IYFA 4HJGE 2L1CA 2HRJA 3NUHB 1FFVA 1L6UA 5DHFB 4A6KA 4HCNB 3IT4B 2IO2B 1T5XD 4F8CB 1F52A 2K8BA 1WXMA 3U7DA 3V6CB 3FVCA 4KGTA 3DWGC 1NVLA 2KTFA 3TIXA 4HVBA 4EJNA 4DQOC 2LXAA 4XWXA 5IP4D 3HRDD 1WGGA 2QJLA 2H7DA 1WGHA 1WMHA 4HB0B 3VIAA 1GUAB 3PLVA 3W1SC 1U29A 1BXTA 2LGSA 1HTQA 2GBKA 3CIRB 1BAKA 5E6OA 2Y3AA 1OEYA 3Q8FA 3DQVA 3GZNB 1YJJA 2K2UA 2V0GA 2MFQA 4IM0A 5BYQA 2Y5PA 2J52A 4MT5A 4W9CA 3W1SA 1L7YA 2RPVA 2WU5B 2KDMA 2I5FA 3RZFA 2H7EA 2E3TA 2SAKA 2KIGA 2COCA 2ZNVC 2FIDA 3APCA 3PLUA 2KNBA 1I35A 1Q5WB 3FAHA 1KH0A 1JWBD 2IGDA 3ZDMC 2LULA 2KFKB 1UF0A 2ACZB 3KSYA 3KYDD 3DCXA 3NZSA 1K53A 3HM3A 3P6AA 3SFDB 3T9LA 2DX5B 4XC2A 4HEA1 1VZ8A 5J18A 3VR9B 1UBQA 2OQBA 5DHAB 1FCCC 4IM2A 3V61A 1FXTB 1P0RA 5JHBA 5C2TB 3B9JA 3CIKA 4C80A 4LK0M 2WX1A 1WMHB 3MTNB 2WU2B 1NI3A 2WXKA 1XLPA 2MBOA 2R2YA 1F2RC 2L7RA 2JXTA 2D3GA 2WXLA 3A1QA 5IRSA 3WAMA 4ZDVA 3CSTA 2N7DA 4FBJB 2JWZA 4MH8A 2C7HA 2E2XA 2RMMA 1VCBA 2RGFA 1KLUD 5L95C 1MJDA 3GE3C 4JK7A 3VDZA 2DA0A 3NWFA 5L81A 4NQLB 3RD2A 2KDEB 1OQRA 1WZ3A 4KGSA 4MJSA 4RM9A 3L16A 1MHXA 5AUIA 2OJWA 2VH2A 4GB9A 4GDKB 5JVLA 1RRBA 3SEBA 4R3DA 4LNFA 2DWQA 3Q8BA 3BVGA 4M8MA 4NJ6A 4ANWA 3L10B 2ZNVB 2AQ1B 3KW5B 4GDLB 2I5CA 2G4DB 4HB4B 1GGOA 4OZBA 4W9GA 4XYCA 2FUHB 1VDVA 4CO7A 2X38A 5HE2A 2MW5A 1P3RA 3FILA 4HPLB 3C19A 3N7CA 3X0WA 1W1DA 2GI9A 3JVZX 5G5HA 4E74A 1VRAB 2M4NA 4DHJD 5CX3A 1UPRA 4LNIA 5IO9A 2BB6A 3EFUA 1YN3A 3OLMD 5I2MA 3I9V1 1TS5A 1T0YA 2J59M 4WQOB 4RF1A 5DCNA 2B76B 3A1QB 2PVGC 1ZM0A 1WJ6A 1IBXA 4ITKA 1PFDA 1V81A 3QAQA 4OVVA 4FADA 1HEZE 1V86A 2EKIA 4MJSB 2KIEA 1HA5A 4TUUA 1FCLA 3LB8C 5FK9C 3DXDA 2N0SB 1YOVB 3BZDB 4B95A 2Z0EB 3GYPA 2CRFA 2RPQA 2LGIA 2PIAA 3SBTA 1DDMA 5D3IB 4ILGB 5HG2A 1PLSA 3AXCA 2YT1A 2KD0A 2QDFA 1B55A 3Q8CA 3SDLC 1I4RA 5AZFA 4GGQA 2WXIA 2UZRA 1MG4A 3L54A 4K7WA 1V89A 2LOZA 2CHXA 1WWTA 4ACFA 2HJ1A 3FILB 4A6QA 2N9LA 1FIQA 3ZW3A 2KDBA 1AN8A 2IDYA 1M94A 2EKEC 4H8SA 1XD4A 5BMHA 1WIAA 1ZUD2 4JKHA 5DH9B 5IKCM 3DBHI 1WR6E 3ZKJC 4DIXA 1FRDA 3TUOA 4RGTA 1D6EC 3CWIA 5KHOA 4GMVA 1MHHE 3KWVA 1RM6C 1IBXB 4NJ7A 2K3UA 4BZAA 1FHWA 1J0WA 2BB5A 2EMSA 2ZVNA 2DIKA 2KANA 3ONSA 3ZXRA 1BUIC 3A4SC 3OG5A 1AARA 2FCQA 3W9CB 5KCVA 2LG1A 1PFJA 1ROEA 2MWSB 2O6VA 1ESFA 3N30A 1I4HA 2VRWB 1I2HA 1R4NB 4KKIA 1WGYA 1L6VA 4I6PA 2IFSA 1NYRA 2BTEA 3DOWA 1SXTA 2KQ7A 1K5GB 2XK5A 1QOBA 2HTHA 2M56B 3PG7A 2INPE 3UF8A 1E8ZA 3SUZA 1FRRA 1Q1OA 1Z5SB 2DZJA 3RZWC 3DVGX 1TJ6A 2WLBA 2D9WA 2KQ4X 2KZRA 1T0SC 2G4SA 2FUG1 5HI1A 3WCQA 1ZPSA 1XCGA 2VSZA 4FHKA 5KHQA 4ANVA 2FJLA 4RNAA 2D3CA 4M8NA 1JDEA 3IXSA 1DYNA 3ZDTA 1QQGA 4OVUA 3IHPC 4A55A 2KMCA 2W3SA 3DCGA 1TBEA 3TEXA 3VUYA 3RMKC 5BO4B 1H10A 4QXAB 1ZXIA 2BF8B 4JPSA 2COFA 2X8XX 4JK9A 4DK5A 4HRSA 4JWUC 3Q8EA 2INDC 1YJ1A 2D3AA 4HCPB 5C1ZA 4EEWA 4QJ3B 3AEDB 2WXJA 1QOFA 2N1WA 2CQUA 4CYEA 3RN9C 2K2JA 3K9OB 1DDVA 3U7ZA 3BK1A 3M3JA 1QOAA 2XK5B 2HTHB 4W9KA 2NCNA 1W1HA 1EVHA 4HROA 2JQRB 2RRFA 1YX6B 3E9OA 3V05A 2KMAA 3M62B 3IVFA 2K8EA 5DPTA 4A8XC 1SF0A 2DFKA 2GCLA 4OHJA 1WGKA 5MPOA 1V1OA 2BKFA 2JY6A 1SBBB 2PTLA 4RGMA 2D10A 4WSFA 3AE9B 4GXBA 3AJ4A 4EZKA 2R2QA 2Z8LA 1E6EB 2BWFA 2J0KA 1WXVA 1MKEA 2LRWA 1KJTA 3ZGZA 2K49A 4BBKA 2CAYA 4IDIA 3ENEA 1OMWA 4F7UP 1GC6A 3AMZA 2KAJA 2GS0A 4A6FA 3N9YC 1KBLA 2LGYA 2WDQB 3Q3FA 2WDTB 1STEA 2IYBA 2CY4A 4D6WA 4DX8A 1ET6A 1LQBA 5L83A 1XF5L 2ZW1A 4EFOA 5D6JB 2J53A 4ZRKA 4AWJA 2LMCA 1V80A 1YN5A 3NS8A 3NHEB 2R0DA 2N9PC 3RNEC 2MBBB 2WDRB 4IWQA 1RFKA 3BVZA 2ROZB 3BVMA 2V9HA 4TYZA 1C78A 2KR0A 2L83A 3PT2B 4BOZB 4F7ZA 3LYYA 4GN1A 2N9EB 1TJEA 2V4LA 4REZA 1I7AA 4FHJA 2IPKD 4NNJB 1DYQA 2P0DA 1HB8A 2R09A 3O13A 4AS1A 1TGZB 1E90A 3GP7A 4W9HA 1CK1A 2FDQA 5CTRC 2JT4B 1WX9A 4A9AA 2IO3B 1WRDB 1TKGA 2J42A 2ELBA 3TCAA 1I42A 2BVCA 1WG7A 2BKRB 3N3KB 2YF0A 2BS2B 2W3RA 4JKDA 2K5PA 5LNK1 3VH4B 4B6HA 4A6FB 1E7VA 3M95A 3DXCA 2W55A 4WAFA 3B77A 1AWEA 1U5EA 1BT0A 4HATB 1WE6A 1QOGA 1IGCA 4HAYB 4DXGA 1FGZA 3ODWA 1E10A 1Y5OA 3FM8C 2OEDA 1C9FA 4W9JA 2BBCA 2DZIA 3C8YA 3UI3A 3H8HA 2MJ3A 2KDFB 1HE8A 1V97A 5GOWB 1GAQB 2K39A 1W1GA 3U8ZA 3DHGC 2E6XA 2V76A 1Y19B 2WXGA 3AEBB 4J3OD 2W9NA 1U27A 2MWNB 1K5DB 2N9XA 2LBBA 2Z0OA 1V61A 3D8FA 2IGHA 1C77A 3DVGY 4X57B 2GBMA 5G2NA 3DVNV 1P9DU 1KLGD 1TY0A 1DOIA 2IY0B 1UZXB 1H4RA 2J0MA 4ICUA 1LGRA 3RFZB 4NJCA 2MRPA 3APFA 4IOIE 3TO1A 2LUMA 1YQ3B 3NY5A 4OZCA 1MK9B 1WE7A 3VRBB 4US9A 2GJYA 2UVMA 4ARCA 3HSAA 1N60A 3HIZA 2SEBD 1FXAA 3B2FA 2XNAC 2FNJB 1UUPA 4JKAA 3NVZA 3X23A 5J3QA 5FR6A 2KJHB 2L32A 5GXGB 4PYUA 1PGBA 4WIPA 3OWEB 4TKNA 3UIPB 3BWUD 3S2AA 1HZ5A 5LOPB 3QK0A 1C76A 1GPXA 5H8YE 2MP2A 4MELA 4HSIA 3KZ1A 2VKIA 4JLCA 4IC7B 4HLEA 3F0WA 4PQ0A 3ML9A 3LJ3A 2YS5A 1MG8A 5DPSA 1E8WA 4WWOA 5JH5C 1D3ZA 2DLBA 3E9PA 5CHFA 2EJ8A 4O1NA 2MKRA 3T8MA 3U2SC 1YNTE 1WXAA 4WWNA 2DHIA 2FE8A 2DX5A 3DHHC 4B0EA 1SB3C 5D3WA 3NW8A 4USAA 4URKA 1PYWD 3BINA 1V5PA 1A70A 4ICVA 4K3CA 2MDXA 5G5GA 1ZOYB 4GNKB 2D11A 2CS4A 1C79A 2UYZB 2K6QA 4BKSD 3M1IB 2DZMA 3RNFC 1DROA 4XDDA 3B0AA 3AN1A 1FNWA 1YX5B 2CJOA 4WQMA 3P4PB 2EMTA 2N7JA 1P7FA 4MGZE 4GSWA 2WYQA 2FCSA 4I6LB 1LB1A 5DI9B 4S17A 5I2SA 3GS2A 4YTNB 3DPDA 4HHVA 2MP2B 3R7RA 1U5FA 3R8BA 5EE0A 1P1AA 4GDKA 3RCPA 4RGNA 3PGEA 3A98B 2PE9A 5JHAA 4YONA 4Z2NA 1WVHA 2KUQA 1KZGA 2DYNA 1ACCA 1MFWA 5BMIA 2JWUA 2ZVOA 3Q3OC 4GDLA 3WAOA 3TSSA 2WXQA 1A5RA 3HVDA 2PMVA 3O96A 4KDLB 3TBLD 2BS4B 4P16A 4DDID 1NEKB 2CODA 3VOQA 3ULCA 1ZC4B 3KRXA 2L3ZA 1X1GA 2ZKMX 2IGGA 2IO0B 2QC8A 1FM0D 2ON8A 2VH1A 4OZAA 1WGQA 1RLFA 4P1CC 3B08A 1DDWA 3R2TA 1XX0A 2BS3B 3VTVA 2K00A 4XX5A 1SE9A 2BYEA 4G0NB 1ZXHA 2DENB 2DHJA 3RNCC 3MJWA 1ZVRA 3FSSA 5JHGA 1ZDXA 2OJRA 2QEJC 2JU6X 4AOFA 2BGFA 2FIFA 3D8EA 1S1QB 1KOTA 2V3SA 4L6EA 1ZE3D 2G35A 3IG3A 3N1ZC 2MHJA 2A4ZA 4LNNA 1PGXA 2ZJDA 2WXMA 3HUIA 3VH3B 1V49A 2K6DB 5J3TA 2NS5A 1JQ4A 1L4DB 3P63A 2RLOA 1I4XA 1PDXA 3A58A 3A9KA 4HPPA 2MBHA 4OSNA 3Q14C 4WURA 3QJZA 2RQ1A 3O65B 4GOUA 1N62A 3ALBA 4DWFA 1KLVA 3CXBB 2KVRA 2PEAA 2XN9C 2I1KA 1CMXB 2M19A 2RUKB 3VVWB 1XLOA 4DBGA 3OHMB 4IFSA 3T3NA 2W82A 2KDIA 2IO1B 3DVNU 1MPHA 1QQRA 2CHWA 4A3OA 1BTNA 4JQWC 2YRYA 1WR1A 3RT3B 1I4QA 3AECB 2KKCA 2WXOA 5D2MB 4OT1A 3KUDB 1WJMA 2J4XA 3K9PB 4HDQA 2AX5A 2RDHA 3LXFA 2OHFA 1OQYA 4MGYE 2MLBA 2M0AA 3AE7B 4XWTA 1LO5D 1WGUA 1MI1A 3V6EB 4PS3A 2AYOB 1V5UA 1E5WA 1ZSQA 2YSZA 4J6IA 5CHWA 1WSPA 2P0FA 5CLLB 2UWQA 1TQZA 1SEBD 4TV3A 1GB1A 1ST7A 3A9KB 5FI1A 3ZNZB 2LVQA 1WI1A 1K50A 4KDIC 1N6ZA 2GBRA 3E66A 5C5BA 1LW3A 2Z4DA 4ILJA 2PPHA 2GBJA 3EECA 3M63B 3AE6B 1WM2A 4DHJB 1FOEA 3DBRI 4PS8A 2ZZPB 1GG3A 3B1LX 1L0XB 3GYOA 2M14A 4WWMA 1Q10A 4CHJA 4JKCA 5BYSA 1WX7A 5I4DA 2M38A 1FPYA 4C0AA 4KKJA 1WXSA 4WJOA 3KLSX 2KHWB 4MGKE 4K81A 4BKGA 4F1SA 1LFDA 4ZHPA 3DBLI 5IN7A 3HM6X 4BVUC 5EE9A 3WA0A 2NMQA 2L0FA 3SU8X 5H92C 4W9EA 4G50A 2DBYA 3A33B 1YJIA 4ZHOA 4YSZB 2G9HD 1G6JA 1IRSA 3RNGC 3PRMB 4IOYX 4JKGA 2Y5CA 1OFFA 3ZNHB 1KF6B 2GB1A 1V6EA 4RM8A 4PK1A 2QCZA 2KLCA 2LOXA 2D9YA 2DX1A 3VFKA 2FBWB 1WXQA 2GRIA 2K22A 3SO6A 3TEYA 5T8IA 3D32A 4WJNA 2ELAA 5C5BB 2GUMA 4JIOU 2ZEQA 2MBQA 3PEGA 2MJDA 3SR6A 4EMOA 4A6HA 2ASQA 2M17A 1XCTL 4EUTA 2ICIA 1FXIA 1DBHA 1VZ6A 4S0RA 1XQQA 2DYQA 2Z0PA 2OOBB 3U4EG 4W9LA 4Z2MB 3P4SB 3MFGA 2WWZA 3MHSD 5C3JB 4CQNA 1F1HA 4PNKA 2NBWB 3PVUA 4L1RA 2KWDA 4MSMB 4CSQA 3Q3NC 3PV1A 4LNOA 3G9WA 3UINB 3MC0B 3KH0A 3P7ZA 3SV1A 3KRWA 1NI2A 4TSSA 3V5WA 1R4MB 4AJWA 3KQ4A 4FJVB 1NVID 1IGDA 3ODXA 1LM8B 2Q5WD 1WY8A 2KX3A 2IZVB 2QKMA 2ROVA 3PREA 4IG7B 1GNUA 4M01A 4JKGB 3AU5A 2LI5A 5J17A 4JKFA 3AEAB 3AEFB 4Q2JA 1YQBA 2V1YA 1L2NA 5G55A 4EOYA 5FR3A 4M02A 3VRAB 1BWNA 4W9IA 3SFEB 4EZLA 2KN5A 2QHOA 3CF6E 1Z2MA 1WH3A 5EFXA 1J8CA 2JYTA 2L1AA 4L2YA 3AE2B 4FJYA 3W1YA 4HAVB 3DHIC 4AJYB 3J9CA 2Y8FA 3GB1A 2CJNA 4L23A 2CU1A 3AB5A 4DXAB 2RSGA 1T6BX 3I5JC 2Z0QA 3NOBA 3OJ4B 4LTUA 4QAYA 2KO3A 4KIKA 4LJOB 2NZ8B 4OVZA 1D5ZC 3AU4A 1FHXA 3T3OA 3E9LA 1JCKB 1CQVA 4JKBA 2BYFA 3SHQA 2R61A 4MSQB 2RDBC 2W54A 1U5DA 2Z59A 1HZ6A 3AE4B 3IAM1 4KVGB 3OANA 1RWSA 1UNPA 4Y94A 3DWMA 1V9JA 1M7RA 2PKOA 1SE3A 4BBNC 3V3XA 1V2YA 2C9WB 2J0JA 2AQ2B 5DPRA 3ZO5B 4NPNA 4ZYSA 3RUIB 2QILA 2WX0A 1L5PA 1XR0B 3T06A 4YT0B 1QT9A 1WX8A 1NTIA 4A5KA 1J7CA 4HAWB 3ZVRA 2X0SA 4IUMB 4BBNF 1QZEA 3WAPA 3MP9A 2PE6B 3FP5A 2YEPB 2MJEA 2JSVX 3AEEB 5BMGA 1JMLA 5HE3A 2CB8A 1X1FA 2LWPA 2XBBC 1J7BA 5DIFB 3U52E 1X86A 2N0YA 2LD9A 3PS6A 3MHZA 4GU2A 1V1PA 1WYGA 3QWZB 4KIKB 2IJ0A 1M7EA 2WP9B 1OQQA 1F9JA 1Z87A 3PPAA 4YL8A 3V60A 2Q13A 4MDKE 2KMMA 1TZOA 2YT0A 3I3TB 3EUB2 4GOCA 4AQ7A 4MM3A 2RGNB 2GMIC 4LNKA 3MJ5A 1I4GA 1B1ZA 4DXFA 2Z59B 1P6SA 2UZSA 1UNSA 4IWPA 4RFBA 1N63A 1AQCA 1XODA 2L05A 1L4ZB 2MCNB 1FNVA 2UU7A 2WXPA 4IM3A 3V62A 3Q69A 3L0WB 1SJED 1EU4A 3MDBC 3IFWB 4JX1C 1WM3A 5FKAC 4HAUB 1Y8RC 3UIOB 3BIID 2LASA 5E6JA 1WJ1A 1LXDA 2BPSA 4RMAA 1XD3B 1PUTA 2WXHA 2RVBB 4E71A 3I63C 2KN4A 2M0XA 4B0MA 3TJPA 3ZRFA 3ZVVA 3QC8B 1UNQA 2I38A 4WJ7A 4P1BC 2BYVE 1V1PB 3C0RB 3EGRA 5HE1A 2CHZA 4QJ5B 4OW0A 2COPA 1L0YB 2CY5A 3AV8A 1D4BA 1TKEA 2KJRA 1D5XC 2FAZA 1J7AA 4IAPA 5JP4A 2L76A 1WGDA 1D5MC 4MM3B 3PHWB 1M4VA 4DHZB 4GLSC 2AL3A 2L2IA 3WANA 4KSLC 2DN6A 4A90A 4K3BA 4ZRIA 3RYTA 1H8CA 2KWVB 2VZKD 1QLBB 1EU3A 2WNMA 2K1FA 1J19A 2K25A 5D3VA 3W5UB 3N1YC 3ZXVA 2NTSA 3HQCA 1E7UA 4XWWA 2O2VA 1PGAA 2DYMA 3KUCB 2LZ6A 1R7SA 3R66C 3EC8A 3HVZA 4HAXB 3PZ7A 2BCJA 3LDZE 5M4YB 1WJUA 3ODOA 5C79A 5E6NA 2CKHB 2IY1B 2R2OA 1MVKA 4NAWA 2QIEB 2D5GA 1TT5B 1FD6A 2D9VA 3Q8AA 1WFYA 4DHZE 2LJIA 4YTMB 2GOWA 4AUQC 4WVFB 2INNE 3TEZA 4L1BA 1K8RB 1X11A 4MGIE 5IJMA 2J7QB 1NU2A 1NDDA 3UGBB 2DYOA 2W2WA 2JUOA 3P2BA 3E9SA 3EA6A 3CSFA 2KX0A 4RH6A 4CHMA 1JRUA 3IT6B 1IPGA 1HXYD 4YSXB 4BKSA 3IBEA 2BW2A 3TVVA 3QQ8B 1DIKA 1XLQA 2JZZA 2I2YA 3Q2AC 1WRIA 1IP9A 2X18A 2H88B 2L52A 4JKEA 2LUEA 1YIWA 4KZCA 2GLSA 2JVCA 4P6VF 2O2VB 1ZYIA 4HAZB 1CJEA 4KHOA 2DHZA 2I1JA 1L0VB 4EE2A 3ULBA 2DKPA 3KUZA 1UEFA 4D0NB 1N5WA 1SE4A 4BAXA 2KUPA 4NAWB 1MIZB 2KQSA 1KRHA 3UZTA 4UDUC 1WZ0A 2LYDA 3DDCB 3KY9A 1VD2A 2GBNA 1RAXA 4K2OA 4MT7A 1SIFA 5C16A 2BWES 3H6NA 3NZUA 3GZNI 2KOXA 3ML4A 5HKHA 1C4AA 2XEWA 1B9RA 1IUEA 3N1XC 4YXDB 2ZW0A 1TS3A 2NVUI 4HWIB 4C56C 1VBGA 2RD0A 3TL5A 4EKUA 4N58A 2IBIB 3AE5B 2HD5B 2Y7BA 1TZ1A 2HDEA 3VXWA 4PYZA 1EUVB 1N61A 1PMSA 1GOZA 1V88A 4IWOA 5IA7A 3ECIA 3UQAA 4WJQA 1FAOA 5JLJB 3QWMA 3AI5A 1OGWA 3N32A 5E6PA 4WWPA 3A4RA 3IAS1 4CHKA 5CHVC 1ISNA 2P0HA 4TQ1A 4KSKC 1F77A 4LCDE 1TIFA 4MK0A 1VJKA 4ASWC 3EPYA 4B6WA 4BFRA 4TQ0A 5KQ1A 2DZKA 3NS1A 1EO6A 3WYFB 3JSVA 4JL9A 3RPFC 4EZJA 1NENB 3AULA 2D2QA 1FO4A 2LVPA 3HIEA 3VR8B 3BK2A 4A20A 4HKQA 2FJ9A 1BTKA 5LLIA 1AWDA 5LONB 3MC9A 1U5GA 3L17A 2N7EA 4II3B 3QX1A 3AEGB 1E8XA 4ARIA 4IW0A 2LGXA 2H89B 3QARA 3ENBA 2MSED 4D2KA 3AE3B 3QIJA 1DOYA 2ZPYA 4W9DA 4HKZE 3W2DA 3PZDA 3U12A 1TS2A 3P42A 4ZRQA 1WI0A 4HDOA 1E9MA 2LHDA 3NJTA 4IKGA 3GOEA 1EAZA 1V8CA 3ZYYX 2WHIA 1ET9A 1SIJA 2EC1A 2PLPA 3PRZA 2WXNA 3KVFB 2WDVB 4HB3B 3ZTDA 1JALA 3R7QA 3ZJVA 2ZCCA 2L0TA 4G3XB 1VBHA 1DGJA 1PQSA 2N23A 4XZ4A 2HJ8A 2NBUA 1TKYA 3PHXB 4C7ZA 4K7UA 2YVCA 1XO3A 3ZUNA 5JZEB 3JSVB 1WF9A 4GPTB 1MPEA 2W2XC 4GMXB 1KTKA 4G11A 4PT5A 4DBBA 1JROA 3A9JA 1SSNA 1RJ2A 2KC2A 4LLGM 2QSDA 5AZGA 2JRHA 3QBVB 1JRPA 2Z14A 3PZ8A 1F2RI 2DLWA 3OJ3A 2M1MA 5CLQB 4WH4A 2A5UA 1T0RC 1P3QU 1YMHE 4FXCA 2C60A 3AM9A 1ZW7A 4AP4C 2RNRB 4FJZA 1MIXA 1GJZA 3AE1B 1FB8A 1XKEA 2D3BA 4MY6A 1K51A 4N6EB 4W9FA 4FA6A 3DBRB 4N59A 1TXDA 2FCMA 2P8VA 4XGAB 3VTWA 2W2XD 4ZOHC 1K52A 3LJUX 1UH6A 4NSWA 1NTVA 1HQRD 4M00A 5EE1A 2WS3B 2WGSA 3ZNGC 3SBGA 3VQIA 1ZDVA 2D07B 2AEHA 1UNRA 2LRUA 4K1RB 5EE3A 2NMBA 1RYJA 1TS4A 2NPTA 3DBHB 4MACA 2ZPNA 1V5TA 2QMTA 3DBLB 4ANUA 1P98A 5IAAC 4FN2A 4WJPA 3TFMA 1SGHA 2KTRA 3FEHA 1JW9D 4YSYB 3DBSA 2YS3A 3NRZA 4JE3B 4HJKA 2K8CA 4KV2A 4N9F4 2K9XA 2PJHA 3PP2A 4YWGG 3W5VB 2PZ1A 2G45B 2ZCBA 2MH7A 3ZQ4A 1MI0A 2INCC 2N4FA 3A9JB 4K2PA 3N20C 1RFAA 2ABDA 3APDA 2D4QA 2JX5A 4HK2A 5D27A 1QF6A 4WAAA 1UWXA 5EDSA 3URYA 2LHEA 2KWCA 1WJNA 4M0WA 1KZ7A 2WXFA 3UQBA 4NQKE 5JHHA 1UGMA 2RDGA 4KHBA 2Y5BB 1XEEA 4NY0A 1QKZA 4FULA 5AUKA 2D9XA 1UPQA 1R4NI 1Q0WB 3A8PA 3H9DA 1UBIA 3B2GA 2B3AA 5AEKB 1JWAD 3PRPB 1X1MA 2JRIB 1UWMA 4JGHB 1FMAD
chains in the Genus database with same CATH topology
5J3YA 1J0GA 2OTXA 2NPTB 2ADZA 2O6VD 3TW1A 3ZLZA 1U2BA 2KTRB 2JF5A 4MH0E 3VHTC 3ZRCA 2KK8A 2KGXB 2GCJA 2WH5A 4DDGD 1V5MA 4A3PA 1R4MI 4KAXB 4B9KA 2RR9A 4ZRJA 1OY2A 2C5LC 3F5RA 2MX2A 1HBKA 4GIVA 2DTCA 1P5TA 4M0WB 3QA8A 1MK7B 1TTNA 1HB6A 4HB2B 1E8YA 2KJ6A 4KHBB 2IYDB 3JW0X 4ILHA 4P7IA 2O6VB 1GC7A 3NSUA 1NBFC 2DAFA 5C23A 2LXCA 2K8HA 1C3TA 4II2B 1UELA 2DAJA 2YLMA 5J2RA 5LXIB 3TMPB 4ANXA 2KLGA 5LXHA 4HXDA 1OQNA 3HK0A 1ZKHA 3U30A 1EF1A 4FLHA 1RRPB 1N3HA 2VRRB 1YD8U 3ML8A 2DHKA 2Z0DB 1OTRB 2XQNM 1SHCA 2QKLA 3JYUA 4F7GA 5HE0A 1XT9B 2NBVB 3BJIA 5D7GA 4K17A 2G3QB 3VUWA 2M8SA 4LJPB 3ZTCA 3PTFC 5D94A 1NTYA 1KC7A 5D3XA 2R82A 1S3SG 2COAA 3BY4B 4BOSC 3D8DA 3SYXA 1FHOA 4JK8A 1OEYJ 2AWTA 3H7PA 5D3YA 2C7MB 4DX90 3R3MA 4I6NB 3VUXA 2HE7A 3L13A 2C7NB 2KWUB 4K7SA 1U4AA 2REXA 2LVOA 4GZUA 3VTUA 1FGYA 3SD5A 3WALA 4E3CA 3RCZA 2JXXA 4BKTA 4LDTD 3QCAA 3FLVA 1C1YB 3SNHA 2Y8GA 3DXEA 1ACAA 3H1UA 2LGDA 3HHMA 2MQJA 1KI1B 4ZYNA 2KFJA 3QHTA 2RSUA 3ZNID 2DKQA 3PVWA 3ZIMA 1WJ4A 2N1VA 4PS7A 2JZ3B 1X05A 5KQ4A 2JPHA 3H7PB 3OAWA 4F7HA 4LDTB 3PVLA 2FCNA 5TR5A 1Q67A 2YS1A 5DPWA 5FI0A 1KM7A 3PSCA 1WYWB 1QC6A 3PSEB 2LJ5A 2D9ZA 3H7SA 1UD7A 2KC1A 2KCJA 1EF5A 2L8JA 1EGXA 3A8QA 2AL6A 3L08A 5C6RA 2LKOA 3CMMB 3HW2B 3MPXA 3EHVA 3RULA 4KHAA 4MEMA 1WGRA 1MAIA 3Q3JA 2CR5A 3VAWA 1ZC3B 2DYBA 3KYCD 4HPMB 1ZGUB 4KZ0A 2L00B 3WIMA 2NR2A 2MBEA 5GMVA 2JP2A 1V5OA 2KFKA 2MA9B 2KXJA 5AZHA 1IYFA 2L1CA 2HRJA 5DHFB 4A6KA 4HCNB 2IO2B 4F8CB 2K8BA 1WXMA 3U7DA 3V6CB 1NVLA 2KTFA 3TIXA 4HVBA 4EJNA 2LXAA 4XWXA 1WGGA 2H7DA 1WGHA 1WMHA 4HB0B 3VIAA 1GUAB 3PLVA 3W1SC 1U29A 2GBKA 1BAKA 5E6OA 1OEYA 3DQVA 2K2UA 2MFQA 4IM0A 4W9CA 3W1SA 1L7YA 2I5FA 3RZFA 2H7EA 2COCA 2ZNVC 2FIDA 3APCA 3PLUA 2KNBA 1I35A 1Q5WB 3ZDMC 2LULA 2KFKB 3KSYA 3KYDD 3NZSA 3HM3A 3P6AA 3T9LA 2DX5B 4XC2A 5J18A 1UBQA 2OQBA 5DHAB 4IM2A 3V61A 1FXTB 1P0RA 5JHBA 3CIKA 2WX1A 1WMHB 3MTNB 2MBOA 2L7RA 2D3GA 3A1QA 3WAMA 4ZDVA 3CSTA 2N7DA 4FBJB 2JWZA 2C7HA 2E2XA 1VCBA 2RGFA 5L95C 3VDZA 4JK7A 2DA0A 5L81A 4NQLB 3RD2A 2KDEB 4RM9A 4MJSA 1WZ3A 3L16A 4GB9A 4GDKB 5JVLA 1RRBA 4M8MA 4NJ6A 4ANWA 3L10B 2ZNVB 3KW5B 4GDLB 2I5CA 2G4DB 4HB4B 1GGOA 4W9GA 2FUHB 4CO7A 5HE2A 2MW5A 1P3RA 4HPLB 3N7CA 3X0WA 1W1DA 3JVZX 4E74A 4DHJD 2M4NA 5CX3A 1UPRA 3EFUA 3OLMD 1T0YA 2J59M 4WQOB 5DCNA 3A1QB 1ZM0A 1WJ6A 1V81A 3QAQA 4OVVA 4FADA 1V86A 4MJSB 4TUUA 3DXDA 4B95A 2Z0EB 3GYPA 2CRFA 2RPQA 3SBTA 1DDMA 4ILGB 1PLSA 3AXCA 2YT1A 2KD0A 1B55A 3SDLC 5AZFA 4GGQA 2UZRA 3L54A 4K7WA 1V89A 2LOZA 2CHXA 3ZW3A 2KDBA 1M94A 2EKEC 4H8SA 1XD4A 1WIAA 4JKHA 5DH9B 3DBHI 1WR6E 3ZKJC 5KHOA 4GMVA 4NJ7A 1FHWA 1J0WA 2EMSA 2ZVNA 2DIKA 2KANA 3ONSA 3A4SC 1AARA 2FCQA 5KCVA 2LG1A 1PFJA 2MWSB 2O6VA 3N30A 2VRWB 1I2HA 1WGYA 4I6PA 2IFSA 3DOWA 2KQ7A 2XK5A 1K5GB 2HTHA 3PG7A 3UF8A 1E8ZA 3SUZA 1Q1OA 1Z5SB 2DZJA 3RZWC 3DVGX 1TJ6A 2D9WA 2KZRA 2G4SA 1XCGA 2VSZA 4FHKA 5KHQA 4ANVA 2FJLA 4M8NA 1JDEA 1DYNA 3ZDTA 1QQGA 4OVUA 3IHPC 2KMCA 3DCGA 1TBEA 3VUYA 5BO4B 1H10A 2BF8B 2COFA 4JK9A 4DK5A 1YJ1A 4HCPB 5C1ZA 4EEWA 2N1WA 2CQUA 4CYEA 2K2JA 3K9OB 1DDVA 3M3JA 2XK5B 2HTHB 4W9KA 2NCNA 1W1HA 1EVHA 1YX6B 3E9OA 2KMAA 3M62B 3IVFA 5DPTA 2DFKA 2GCLA 2BKFA 2JY6A 2D10A 4WSFA 4GXBA 3AJ4A 4EZKA 2R2QA 2BWFA 2J0KA 1WXVA 1MKEA 2LRWA 1KJTA 4BBKA 2CAYA 3ENEA 1OMWA 4F7UP 1GC6A 2GS0A 4A6FA 1KBLA 2LGYA 3Q3FA 2WDTB 2IYBA 2CY4A 4DX8A 5L83A 1LQBA 4EFOA 5D6JB 4ZRKA 4AWJA 1V80A 3NS8A 3NHEB 2R0DA 2N9PC 2MBBB 4IWQA 2ROZB 4TYZA 4BOZB 3PT2B 4F7ZA 4GN1A 2N9EB 2V4LA 1I7AA 4FHJA 4NNJB 2P0DA 1HB8A 2R09A 1TGZB 1E90A 4W9HA 2FDQA 5CTRC 2JT4B 1WX9A 2IO3B 1WRDB 2ELBA 3TCAA 1I42A 1WG7A 2BKRB 3N3KB 2YF0A 4JKDA 3VH4B 4B6HA 4A6FB 1E7VA 3M95A 3DXCA 1AWEA 1U5EA 1BT0A 4HATB 1WE6A 4HAYB 1FGZA 3ODWA 1Y5OA 3FM8C 4W9JA 2DZIA 2KDFB 1HE8A 5GOWB 2K39A 1W1GA 3U8ZA 2V76A 1Y19B 2W9NA 1U27A 2MWNB 1K5DB 2N9XA 2LBBA 2Z0OA 1V61A 3D8FA 3DVGY 4X57B 2GBMA 5G2NA 3DVNV 1P9DU 2IY0B 1UZXB 1H4RA 2J0MA 4ICUA 2MRPA 3APFA 3TO1A 3NY5A 1MK9B 1WE7A 2GJYA 2UVMA 3HIZA 2FNJB 4JKAA 3X23A 5J3QA 5FR6A 2KJHB 4PYUA 4TKNA 3UIPB 3S2AA 5LOPB 3QK0A 2MP2A 4MELA 3KZ1A 2VKIA 4JLCA 4IC7B 4HLEA 3F0WA 4PQ0A 3ML9A 3LJ3A 2YS5A 1MG8A 5DPSA 1E8WA 4WWOA 5JH5C 1D3ZA 3E9PA 5CHFA 2EJ8A 2MKRA 3T8MA 1WXAA 4WWNA 2DHIA 2DX5A 5D3WA 4URKA 3BINA 1V5PA 4ICVA 2MDXA 2D11A 2CS4A 2UYZB 2K6QA 4BKSD 3M1IB 2DZMA 1DROA 3B0AA 1YX5B 2EMTA 4MGZE 4GSWA 2WYQA 2FCSA 4I6LB 1LB1A 5DI9B 3DPDA 4HHVA 2MP2B 3R7RA 1U5FA 1P1AA 4GDKA 3RCPA 3PGEA 3A98B 2PE9A 5JHAA 4YONA 4Z2NA 1WVHA 1KZGA 2DYNA 2ZVOA 4GDLA 3WAOA 1A5RA 3O96A 4KDLB 3TBLD 4DDID 2CODA 3VOQA 3ULCA 1ZC4B 3KRXA 2L3ZA 1X1GA 2IO0B 1WGQA 1RLFA 3B08A 1DDWA 1XX0A 3VTVA 2K00A 4XX5A 1SE9A 2BYEA 4G0NB 2DENB 2DHJA 3MJWA 1ZVRA 3FSSA 5JHGA 2OJRA 4AOFA 2BGFA 2FIFA 3D8EA 1S1QB 1KOTA 2V3SA 4L6EA 3IG3A 2G35A 2A4ZA 2ZJDA 3VH3B 1V49A 2K6DB 5J3TA 2NS5A 2RLOA 3A9KA 2MBHA 3QJZA 2RQ1A 3O65B 3ALBA 4DWFA 1KLVA 3CXBB 2KVRA 2PEAA 2I1KA 1CMXB 2RUKB 3VVWB 4DBGA 4IFSA 2KDIA 2IO1B 3DVNU 1MPHA 2CHWA 4A3OA 1BTNA 4JQWC 2YRYA 1WR1A 3RT3B 2KKCA 5D2MB 3KUDB 1WJMA 3K9PB 4HDQA 1OQYA 4MGYE 2MLBA 1WGUA 3V6EB 4PS3A 2AYOB 1V5UA 1E5WA 1ZSQA 2YSZA 4J6IA 5CHWA 2P0FA 5CLLB 2UWQA 1TQZA 4TV3A 1ST7A 3A9KB 5FI1A 3ZNZB 2LVQA 1WI1A 4KDIC 2GBRA 3E66A 5C5BA 1LW3A 4ILJA 2PPHA 2GBJA 3EECA 3M63B 1WM2A 4DHJB 1FOEA 3DBRI 4PS8A 2ZZPB 1GG3A 3B1LX 3GYOA 2M14A 4CHJA 4JKCA 1WX7A 2M38A 4C0AA 1WXSA 4WJOA 2KHWB 4MGKE 4K81A 4BKGA 4F1SA 1LFDA 3DBLI 3HM6X 4BVUC 3WA0A 2L0FA 3SU8X 4W9EA 4G50A 3A33B 1G6JA 1IRSA 3PRMB 4IOYX 4JKGA 3ZNHB 1V6EA 4RM8A 2KLCA 2LOXA 2D9YA 2DX1A 3VFKA 3SO6A 3D32A 4WJNA 2ELAA 5C5BB 4JIOU 2ZEQA 2MBQA 3PEGA 4EMOA 4A6HA 2ASQA 2M17A 4EUTA 1DBHA 1XQQA 2DYQA 2Z0PA 2OOBB 4W9LA 4Z2MB 3MHSD 2WWZA 4PNKA 2NBWB 3PVUA 4MSMB 3PV1A 3UINB 3G9WA 3KH0A 3P7ZA 3SV1A 3KRWA 1NI2A 3V5WA 4AJWA 4FJVB 3ODXA 1LM8B 1WY8A 2KX3A 2IZVB 2QKMA 2ROVA 3PREA 4IG7B 1GNUA 4JKGB 3AU5A 2LI5A 5J17A 4JKFA 1YQBA 2V1YA 1L2NA 5G55A 4EOYA 1BWNA 4W9IA 4EZLA 2KN5A 2QHOA 3CF6E 1Z2MA 1WH3A 5EFXA 1J8CA 4FJYA 3W1YA 4HAVB 4AJYB 2Y8FA 2CU1A 4DXAB 2RSGA 3OJ4B 2Z0QA 3NOBA 2KO3A 4KIKA 4LJOB 2NZ8B 3AU4A 1FHXA 3E9LA 4JKBA 2BYFA 3SHQA 4MSQB 1U5DA 4KVGB 3OANA 1UNPA 4Y94A 1V9JA 1M7RA 4BBNC 1V2YA 2C9WB 2J0JA 5DPRA 3ZO5B 4NPNA 3RUIB 2WX0A 1XR0B 3T06A 1WX8A 1NTIA 4A5KA 4HAWB 3ZVRA 2X0SA 4IUMB 4BBNF 1QZEA 3WAPA 2PE6B 3FP5A 5HE3A 2CB8A 1X1FA 2LWPA 2XBBC 5DIFB 1X86A 3PS6A 2N0YA 2LD9A 4GU2A 3QWZB 4KIKB 1M7EA 1F9JA 1Z87A 3PPAA 4YL8A 3V60A 2Q13A 4MDKE 3I3TB 2YT0A 4GOCA 4MM3A 2RGNB 2GMIC 2Z59B 1P6SA 2UZSA 4IWPA 1AQCA 1XODA 2L05A 2MCNB 4IM3A 3V62A 3L0WB 3MDBC 3IFWB 1WM3A 4HAUB 1Y8RC 3UIOB 2LASA 1WJ1A 1LXDA 2BPSA 4RMAA 1XD3B 2RVBB 4E71A 2M0XA 3TJPA 3ZRFA 3ZVVA 3QC8B 1UNQA 4WJ7A 2BYVE 3C0RB 5HE1A 2CHZA 2COPA 2CY5A 2KJRA 2FAZA 4IAPA 5JP4A 2L76A 1WGDA 3PHWB 4DHZB 2AL3A 2L2IA 3WANA 4KSLC 2DN6A 4ZRIA 3RYTA 1H8CA 2KWVB 2K1FA 1J19A 2K25A 5D3VA 3HQCA 1E7UA 2O2VA 2DYMA 3KUCB 2LZ6A 3R66C 3EC8A 4HAXB 2BCJA 3LDZE 1WJUA 3ODOA 5C79A 5E6NA 2CKHB 2IY1B 2R2OA 4NAWA 2D9VA 1WFYA 4DHZE 2GOWA 4AUQC 4WVFB 1K8RB 1X11A 4MGIE 5IJMA 2J7QB 1NU2A 1NDDA 3UGBB 2DYOA 2W2WA 2JUOA 3P2BA 3CSFA 2KX0A 4CHMA 1JRUA 1IPGA 4BKSA 3IBEA 3TVVA 3QQ8B 1DIKA 2JZZA 1IP9A 2X18A 4JKEA 2LUEA 1YIWA 4KZCA 2JVCA 2O2VB 4HAZB 4KHOA 2DHZA 2I1JA 3ULBA 2DKPA 3KUZA 1UEFA 4D0NB 2KUPA 4NAWB 1MIZB 2KQSA 3UZTA 1WZ0A 2LYDA 3DDCB 3KY9A 1VD2A 2GBNA 1RAXA 3NZUA 4K2OA 4MT7A 1SIFA 5C16A 2BWES 3H6NA 3GZNI 2KOXA 3ML4A 5HKHA 2XEWA 2NVUI 4HWIB 1VBGA 2RD0A 3TL5A 4EKUA 2IBIB 2HD5B 2Y7BA 1TZ1A 3VXWA 4PYZA 1EUVB 1PMSA 1V88A 4IWOA 5IA7A 3ECIA 3UQAA 4WJQA 1FAOA 5JLJB 3QWMA 3AI5A 1OGWA 3N32A 5E6PA 4WWPA 3A4RA 4CHKA 5CHVC 1ISNA 2P0HA 4TQ1A 4KSKC 4LCDE 4ASWC 4MK0A 4B6WA 3EPYA 4BFRA 4TQ0A 5KQ1A 2DZKA 1EO6A 3WYFB 3JSVA 4JL9A 4EZJA 3AULA 2D2QA 2LVPA 4A20A 2FJ9A 1BTKA 5LLIA 5LONB 1U5GA 3L17A 2N7EA 4II3B 3QX1A 1E8XA 4IW0A 2LGXA 3QARA 3ENBA 2MSED 3QIJA 2ZPYA 4W9DA 3PZDA 1WI0A 4HDOA 3GOEA 1EAZA 2EC1A 3PRZA 3KVFB 4HB3B 3ZTDA 3R7QA 2ZCCA 2L0TA 4G3XB 1VBHA 1PQSA 2N23A 4XZ4A 2HJ8A 2NBUA 3PHXB 4K7UA 2YVCA 3ZUNA 5JZEB 3JSVB 1WF9A 4GPTB 2W2XC 4GMXB 4G11A 4DBBA 3A9JA 1RJ2A 2KC2A 5AZGA 2JRHA 3QBVB 2DLWA 3OJ3A 2M1MA 5CLQB 2A5UA 1P3QU 2C60A 1ZW7A 4AP4C 2RNRB 4FJZA 1MIXA 1GJZA 1FB8A 1XKEA 4W9FA 4MY6A 4FA6A 1TXDA 2FCMA 2P8VA 3VTWA 2W2XD 3LJUX 1UH6A 4NSWA 1NTVA 3ZNGC 3SBGA 3VQIA 2D07B 2AEHA 1UNRA 2LRUA 4K1RB 2NMBA 2NPTA 4ANUA 2ZPNA 1V5TA 1P98A 5IAAC 4FN2A 4WJPA 3TFMA 1SGHA 2KTRA 3FEHA 3DBSA 2YS3A 4HJKA 2K8CA 4KV2A 4N9F4 2PJHA 3PP2A 2PZ1A 2G45B 2ZCBA 3A9JB 2N4FA 4K2PA 1RFAA 2ABDA 3APDA 2D4QA 4HK2A 5D27A 4WAAA 5EDSA 2KWCA 1WJNA 1KZ7A 3UQBA 4NQKE 5JHHA 1UGMA 2Y5BB 4NY0A 4FULA 2D9XA 1UPQA 1R4NI 1Q0WB 3A8PA 3H9DA 1UBIA 2B3AA 5AEKB 3PRPB 1X1MA 2JRIB 4JGHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Y A;  1J0G A;  2OTX A;  2NPT B;  2ADZ A;  2O6V D;  3TW1 A;  3ZLZ A;  1U2B A;  2KTR B;  2JF5 A;  4MH0 E;  3VHT C;  3ZRC A;  2KK8 A;  2KGX B;  2GCJ A;  2WH5 A;  4DDG D;  1V5M A;  4A3P A;  1R4M I;  4KAX B;  4B9K A;  2RR9 A;  4ZRJ A;  1OY2 A;  2C5L C;  3F5R A;  2MX2 A;  1HBK A;  4GIV A;  2DTC A;  1P5T A;  4M0W B;  3QA8 A;  1MK7 B;  1TTN A;  1HB6 A;  4HB2 B;  1E8Y A;  2KJ6 A;  4KHB B;  2IYD B;  3JW0 X;  4P7I A;  2O6V B;  1GC7 A;  3NSU A;  1NBF C;  2DAF A;  5C23 A;  2LXC A;  2K8H A;  1C3T A;  4II2 B;  1UEL A;  2DAJ A;  2YLM A;  5J2R A;  5LXI B;  3TMP B;  4ANX A;  2KLG A;  5LXH A;  4HXD A;  1OQN A;  3HK0 A;  1ZKH A;  3U30 A;  1EF1 A;  4FLH A;  1RRP B;  1N3H A;  2VRR B;  1YD8 U;  3ML8 A;  2DHK A;  2Z0D B;  1OTR B;  2XQN M;  1SHC A;  2QKL A;  3JYU A;  4F7G A;  5HE0 A;  1XT9 B;  2NBV B;  3BJI A;  5D7G A;  4K17 A;  2G3Q B;  3VUW A;  2M8S A;  4LJP B;  3ZTC A;  3PTF C;  5D94 A;  1NTY A;  5D3X A;  1S3S G;  2COA A;  3BY4 B;  4BOS C;  3D8D A;  3SYX A;  1FHO A;  1OEY J;  2AWT A;  3H7P A;  5D3Y A;  2C7M B;  4DX9 0;  3R3M A;  4I6N B;  3VUX A;  2HE7 A;  3L13 A;  2C7N B;  2KWU B;  4K7S A;  1U4A A;  2REX A;  2LVO A;  4GZU A;  3VTU A;  1FGY A;  3SD5 A;  3WAL A;  4E3C A;  3RCZ A;  2JXX A;  4BKT A;  4LDT D;  3QCA A;  3FLV A;  1C1Y B;  3SNH A;  2Y8G A;  3DXE A;  1ACA A;  3H1U A;  2LGD A;  3HHM A;  2MQJ A;  1KI1 B;  4ZYN A;  2KFJ A;  3QHT A;  2RSU A;  3ZNI D;  2DKQ A;  3PVW A;  3ZIM A;  1WJ4 A;  2N1V A;  4PS7 A;  2JZ3 B;  1X05 A;  5KQ4 A;  2JPH A;  3H7P B;  3OAW A;  4F7H A;  4LDT B;  3PVL A;  2FCN A;  5TR5 A;  1Q67 A;  2YS1 A;  5DPW A;  5FI0 A;  1KM7 A;  3PSC A;  1WYW B;  1QC6 A;  3PSE B;  2LJ5 A;  2D9Z A;  3H7S A;  1UD7 A;  2KC1 A;  2KCJ A;  1EF5 A;  2L8J A;  1EGX A;  3A8Q A;  2AL6 A;  3L08 A;  5C6R A;  2LKO A;  3CMM B;  3HW2 B;  3MPX A;  3EHV A;  3RUL A;  4KHA A;  4MEM A;  1WGR A;  1MAI A;  3Q3J A;  2CR5 A;  3VAW A;  1ZC3 B;  2DYB A;  3KYC D;  4HPM B;  1ZGU B;  4KZ0 A;  2L00 B;  3WIM A;  2NR2 A;  2MBE A;  5GMV A;  2JP2 A;  1V5O A;  2KFK A;  2MA9 B;  2KXJ A;  5AZH A;  1IYF A;  2L1C A;  2HRJ A;  5DHF B;  4A6K A;  4HCN B;  2IO2 B;  4F8C B;  2K8B A;  1WXM A;  3U7D A;  3V6C B;  1NVL A;  2KTF A;  3TIX A;  4HVB A;  4EJN A;  2LXA A;  4XWX A;  1WGG A;  2H7D A;  1WGH A;  1WMH A;  4HB0 B;  3VIA A;  1GUA B;  3PLV A;  3W1S C;  1U29 A;  2GBK A;  1BAK A;  5E6O A;  1OEY A;  3DQV A;  2K2U A;  2MFQ A;  4IM0 A;  4W9C A;  3W1S A;  1L7Y A;  2I5F A;  3RZF A;  2H7E A;  2COC A;  2ZNV C;  2FID A;  3APC A;  3PLU A;  2KNB A;  1I35 A;  1Q5W B;  3ZDM C;  2LUL A;  2KFK B;  3KSY A;  3KYD D;  3NZS A;  3HM3 A;  3P6A A;  3T9L A;  2DX5 B;  4XC2 A;  5J18 A;  1UBQ A;  2OQB A;  5DHA B;  4IM2 A;  3V61 A;  1FXT B;  1P0R A;  5JHB A;  3CIK A;  2WX1 A;  1WMH B;  3MTN B;  2MBO A;  2L7R A;  2D3G A;  3A1Q A;  3WAM A;  4ZDV A;  3CST A;  2N7D A;  4FBJ B;  2JWZ A;  2C7H A;  2E2X A;  1VCB A;  2RGF A;  5L95 C;  3VDZ A;  2DA0 A;  5L81 A;  4NQL B;  3RD2 A;  2KDE B;  4RM9 A;  4MJS A;  1WZ3 A;  3L16 A;  4GB9 A;  4GDK B;  1RRB A;  4M8M A;  4NJ6 A;  4ANW A;  3L10 B;  2ZNV B;  3KW5 B;  4GDL B;  2I5C A;  2G4D B;  4HB4 B;  4W9G A;  2FUH B;  4CO7 A;  5HE2 A;  2MW5 A;  1P3R A;  4HPL B;  3N7C A;  3X0W A;  1W1D A;  3JVZ X;  4E74 A;  4DHJ D;  2M4N A;  5CX3 A;  1UPR A;  3EFU A;  3OLM D;  1T0Y A;  2J59 M;  4WQO B;  5DCN A;  3A1Q B;  1ZM0 A;  1WJ6 A;  1V81 A;  3QAQ A;  4OVV A;  4FAD A;  1V86 A;  4MJS B;  4TUU A;  3DXD A;  4B95 A;  2Z0E B;  3GYP A;  2CRF A;  2RPQ A;  1DDM A;  1PLS A;  3AXC A;  2YT1 A;  2KD0 A;  1B55 A;  3SDL C;  5AZF A;  4GGQ A;  2UZR A;  3L54 A;  4K7W A;  1V89 A;  2LOZ A;  2CHX A;  3ZW3 A;  2KDB A;  1M94 A;  2EKE C;  4H8S A;  1XD4 A;  1WIA A;  5DH9 B;  3DBH I;  1WR6 E;  3ZKJ C;  5KHO A;  4GMV A;  4NJ7 A;  1FHW A;  1J0W A;  2EMS A;  2ZVN A;  2KAN A;  3ONS A;  3A4S C;  1AAR A;  2FCQ A;  5KCV A;  2LG1 A;  1PFJ A;  2MWS B;  2O6V A;  3N30 A;  2VRW B;  1I2H A;  1WGY A;  4I6P A;  2IFS A;  3DOW A;  2KQ7 A;  2XK5 A;  1K5G B;  2HTH A;  3PG7 A;  3UF8 A;  1E8Z A;  3SUZ A;  1Q1O A;  1Z5S B;  2DZJ A;  3RZW C;  3DVG X;  1TJ6 A;  2D9W A;  2KZR A;  2G4S A;  1XCG A;  2VSZ A;  4FHK A;  5KHQ A;  4ANV A;  2FJL A;  4M8N A;  1DYN A;  3ZDT A;  1QQG A;  4OVU A;  3IHP C;  2KMC A;  3DCG A;  1TBE A;  3VUY A;  5BO4 B;  1H10 A;  2BF8 B;  2COF A;  4DK5 A;  1YJ1 A;  4HCP B;  5C1Z A;  4EEW A;  2N1W A;  2CQU A;  4CYE A;  2K2J A;  3K9O B;  1DDV A;  3M3J A;  2XK5 B;  2HTH B;  4W9K A;  2NCN A;  1W1H A;  1EVH A;  1YX6 B;  2KMA A;  3M62 B;  3IVF A;  5DPT A;  2DFK A;  2GCL A;  2BKF A;  2JY6 A;  2D10 A;  4WSF A;  3AJ4 A;  4GXB A;  4EZK A;  2R2Q A;  2BWF A;  2J0K A;  1WXV A;  1MKE A;  2LRW A;  1KJT A;  4BBK A;  2CAY A;  3ENE A;  1OMW A;  4F7U P;  1GC6 A;  2GS0 A;  4A6F A;  2LGY A;  3Q3F A;  2WDT B;  2IYB A;  2CY4 A;  4DX8 A;  5L83 A;  1LQB A;  4EFO A;  5D6J B;  4ZRK A;  4AWJ A;  1V80 A;  3NS8 A;  3NHE B;  2R0D A;  2N9P C;  2MBB B;  4IWQ A;  2ROZ B;  4TYZ A;  4BOZ B;  3PT2 B;  4F7Z A;  4GN1 A;  2N9E B;  2V4L A;  1I7A A;  4FHJ A;  4NNJ B;  2P0D A;  1HB8 A;  2R09 A;  1TGZ B;  1E90 A;  4W9H A;  2FDQ A;  5CTR C;  2JT4 B;  1WX9 A;  2IO3 B;  1WRD B;  2ELB A;  3TCA A;  1I42 A;  1WG7 A;  2BKR B;  3N3K B;  2YF0 A;  3VH4 B;  4B6H A;  4A6F B;  1E7V A;  3M95 A;  3DXC A;  1AWE A;  1U5E A;  1BT0 A;  4HAT B;  1WE6 A;  4HAY B;  1FGZ A;  3ODW A;  1Y5O A;  3FM8 C;  4W9J A;  2DZI A;  2KDF B;  1HE8 A;  5GOW B;  2K39 A;  1W1G A;  3U8Z A;  2V76 A;  1Y19 B;  2W9N A;  1U27 A;  2MWN B;  1K5D B;  2N9X A;  2LBB A;  2Z0O A;  1V61 A;  3D8F A;  3DVG Y;  4X57 B;  2GBM A;  5G2N A;  3DVN V;  1P9D U;  2IY0 B;  1UZX B;  1H4R A;  2J0M A;  4ICU A;  2MRP A;  3APF A;  3TO1 A;  3NY5 A;  1MK9 B;  1WE7 A;  2GJY A;  2UVM A;  3HIZ A;  2FNJ B;  3X23 A;  5J3Q A;  5FR6 A;  2KJH B;  4PYU A;  4TKN A;  3UIP B;  3S2A A;  5LOP B;  3QK0 A;  2MP2 A;  4MEL A;  3KZ1 A;  2VKI A;  4JLC A;  4IC7 B;  4HLE A;  3F0W A;  4PQ0 A;  3ML9 A;  3LJ3 A;  2YS5 A;  1MG8 A;  5DPS A;  1E8W A;  4WWO A;  5JH5 C;  1D3Z A;  5CHF A;  2EJ8 A;  2MKR A;  3T8M A;  1WXA A;  4WWN A;  2DHI A;  2DX5 A;  5D3W A;  4URK A;  3BIN A;  1V5P A;  4ICV A;  2MDX A;  2D11 A;  2CS4 A;  2UYZ B;  2K6Q A;  4BKS D;  3M1I B;  2DZM A;  1DRO A;  3B0A A;  1YX5 B;  2EMT A;  4MGZ E;  4GSW A;  2WYQ A;  2FCS A;  4I6L B;  1LB1 A;  5DI9 B;  3DPD A;  4HHV A;  2MP2 B;  3R7R A;  1U5F A;  1P1A A;  4GDK A;  3RCP A;  3PGE A;  3A98 B;  2PE9 A;  5JHA A;  4YON A;  4Z2N A;  1WVH A;  1KZG A;  2DYN A;  2ZVO A;  4GDL A;  3WAO A;  1A5R A;  3O96 A;  4KDL B;  3TBL D;  4DDI D;  2COD A;  3VOQ A;  3ULC A;  1ZC4 B;  3KRX A;  2L3Z A;  1X1G A;  2IO0 B;  1WGQ A;  1RLF A;  3B08 A;  1DDW A;  1XX0 A;  3VTV A;  2K00 A;  4XX5 A;  1SE9 A;  2BYE A;  4G0N B;  2DEN B;  2DHJ A;  3MJW A;  1ZVR A;  3FSS A;  5JHG A;  2OJR A;  4AOF A;  2BGF A;  2FIF A;  3D8E A;  1S1Q B;  1KOT A;  2V3S A;  4L6E A;  3IG3 A;  2G35 A;  2A4Z A;  2ZJD A;  3VH3 B;  1V49 A;  2K6D B;  5J3T A;  2NS5 A;  2RLO A;  3A9K A;  2MBH A;  3QJZ A;  2RQ1 A;  3O65 B;  3ALB A;  4DWF A;  1KLV A;  3CXB B;  2KVR A;  2PEA A;  2I1K A;  1CMX B;  2RUK B;  3VVW B;  4DBG A;  4IFS A;  2KDI A;  2IO1 B;  3DVN U;  1MPH A;  2CHW A;  4A3O A;  1BTN A;  4JQW C;  2YRY A;  1WR1 A;  3RT3 B;  2KKC A;  5D2M B;  3KUD B;  1WJM A;  3K9P B;  4HDQ A;  1OQY A;  4MGY E;  2MLB A;  1WGU A;  3V6E B;  4PS3 A;  2AYO B;  1V5U A;  1E5W A;  1ZSQ A;  2YSZ A;  4J6I A;  5CHW A;  2P0F A;  5CLL B;  2UWQ A;  1TQZ A;  4TV3 A;  1ST7 A;  3A9K B;  5FI1 A;  3ZNZ B;  2LVQ A;  1WI1 A;  4KDI C;  2GBR A;  5C5B A;  1LW3 A;  2PPH A;  2GBJ A;  3EEC A;  3M63 B;  1WM2 A;  4DHJ B;  1FOE A;  3DBR I;  4PS8 A;  2ZZP B;  1GG3 A;  3B1L X;  3GYO A;  2M14 A;  4CHJ A;  1WX7 A;  2M38 A;  4C0A A;  1WXS A;  4WJO A;  2KHW B;  4MGK E;  4K81 A;  4BKG A;  4F1S A;  1LFD A;  3DBL I;  3HM6 X;  4BVU C;  3WA0 A;  2L0F A;  3SU8 X;  4W9E A;  4G50 A;  3A33 B;  1G6J A;  1IRS A;  3PRM B;  4IOY X;  3ZNH B;  1V6E A;  4RM8 A;  2KLC A;  2LOX A;  2D9Y A;  2DX1 A;  3VFK A;  3SO6 A;  3D32 A;  4WJN A;  2ELA A;  5C5B B;  4JIO U;  2ZEQ A;  2MBQ A;  3PEG A;  4EMO A;  4A6H A;  2ASQ A;  2M17 A;  4EUT A;  1DBH A;  1XQQ A;  2DYQ A;  2Z0P A;  2OOB B;  4W9L A;  4Z2M B;  3MHS D;  2WWZ A;  4PNK A;  2NBW B;  3PVU A;  4MSM B;  3PV1 A;  3UIN B;  3G9W A;  3KH0 A;  3P7Z A;  3SV1 A;  3KRW A;  1NI2 A;  3V5W A;  4AJW A;  4FJV B;  3ODX A;  1LM8 B;  1WY8 A;  2KX3 A;  2IZV B;  2QKM A;  2ROV A;  3PRE A;  4IG7 B;  1GNU A;  3AU5 A;  2LI5 A;  5J17 A;  1YQB A;  2V1Y A;  1L2N A;  5G55 A;  4EOY A;  1BWN A;  4W9I A;  4EZL A;  2KN5 A;  2QHO A;  3CF6 E;  1Z2M A;  1WH3 A;  5EFX A;  1J8C A;  4FJY A;  3W1Y A;  4HAV B;  4AJY B;  2Y8F A;  2CU1 A;  4DXA B;  2RSG A;  3OJ4 B;  2Z0Q A;  3NOB A;  2KO3 A;  4KIK A;  4LJO B;  2NZ8 B;  3AU4 A;  1FHX A;  2BYF A;  3SHQ A;  4MSQ B;  1U5D A;  4KVG B;  3OAN A;  1UNP A;  4Y94 A;  1V9J A;  1M7R A;  4BBN C;  1V2Y A;  2C9W B;  2J0J A;  5DPR A;  3ZO5 B;  4NPN A;  3RUI B;  2WX0 A;  1XR0 B;  3T06 A;  1WX8 A;  1NTI A;  4A5K A;  4HAW B;  3ZVR A;  4IUM B;  4BBN F;  1QZE A;  3WAP A;  2PE6 B;  3FP5 A;  5HE3 A;  2CB8 A;  1X1F A;  2LWP A;  2XBB C;  5DIF B;  1X86 A;  3PS6 A;  2N0Y A;  2LD9 A;  4GU2 A;  3QWZ B;  4KIK B;  1M7E A;  1F9J A;  1Z87 A;  3PPA A;  4YL8 A;  3V60 A;  2Q13 A;  4MDK E;  3I3T B;  2YT0 A;  4GOC A;  4MM3 A;  2RGN B;  2GMI C;  2Z59 B;  1P6S A;  2UZS A;  4IWP A;  1AQC A;  1XOD A;  2L05 A;  2MCN B;  4IM3 A;  3V62 A;  3L0W B;  3MDB C;  3IFW B;  1WM3 A;  4HAU B;  1Y8R C;  3UIO B;  2LAS A;  1WJ1 A;  1LXD A;  2BPS A;  4RMA A;  1XD3 B;  2RVB B;  4E71 A;  2M0X A;  3TJP A;  3ZRF A;  3ZVV A;  3QC8 B;  1UNQ A;  4WJ7 A;  2BYV E;  3C0R B;  5HE1 A;  2CHZ A;  2COP A;  2CY5 A;  2KJR A;  2FAZ A;  4IAP A;  5JP4 A;  2L76 A;  1WGD A;  3PHW B;  4DHZ B;  2AL3 A;  2L2I A;  3WAN A;  4KSL C;  2DN6 A;  4ZRI A;  3RYT A;  1H8C A;  2KWV B;  2K1F A;  1J19 A;  2K25 A;  5D3V A;  3HQC A;  1E7U A;  2O2V A;  2DYM A;  3KUC B;  2LZ6 A;  3R66 C;  3EC8 A;  4HAX B;  2BCJ A;  3LDZ E;  1WJU A;  3ODO A;  5C79 A;  5E6N A;  2CKH B;  2IY1 B;  2R2O A;  4NAW A;  2D9V A;  1WFY A;  4DHZ E;  2GOW A;  4AUQ C;  4WVF B;  1K8R B;  1X11 A;  4MGI E;  5IJM A;  2J7Q B;  1NU2 A;  1NDD A;  3UGB B;  2DYO A;  2W2W A;  2JUO A;  3P2B A;  3CSF A;  2KX0 A;  4CHM A;  1JRU A;  1IPG A;  4BKS A;  3IBE A;  3TVV A;  3QQ8 B;  2JZZ A;  1IP9 A;  2X18 A;  2LUE A;  1YIW A;  4KZC A;  2JVC A;  2O2V B;  4HAZ B;  4KHO A;  2DHZ A;  2I1J A;  3ULB A;  2DKP A;  3KUZ A;  1UEF A;  4D0N B;  2KUP A;  4NAW B;  1MIZ B;  2KQS A;  3UZT A;  1WZ0 A;  2LYD A;  3DDC B;  3KY9 A;  1VD2 A;  2GBN A;  1RAX A;  3NZU A;  4K2O A;  4MT7 A;  1SIF A;  5C16 A;  2BWE S;  3H6N A;  3GZN I;  2KOX A;  3ML4 A;  5HKH A;  2XEW A;  2NVU I;  4HWI B;  2RD0 A;  3TL5 A;  4EKU A;  2IBI B;  2HD5 B;  2Y7B A;  1TZ1 A;  3VXW A;  4PYZ A;  1EUV B;  1PMS A;  1V88 A;  4IWO A;  5IA7 A;  3ECI A;  3UQA A;  4WJQ A;  1FAO A;  5JLJ B;  3QWM A;  3AI5 A;  1OGW A;  3N32 A;  5E6P A;  4WWP A;  3A4R A;  4CHK A;  5CHV C;  1ISN A;  2P0H A;  4TQ1 A;  4KSK C;  4LCD E;  4ASW C;  4MK0 A;  4B6W A;  3EPY A;  4BFR A;  4TQ0 A;  5KQ1 A;  2DZK A;  1EO6 A;  3WYF B;  3JSV A;  4JL9 A;  4EZJ A;  3AUL A;  2D2Q A;  2LVP A;  4A20 A;  2FJ9 A;  1BTK A;  5LLI A;  5LON B;  1U5G A;  3L17 A;  2N7E A;  4II3 B;  3QX1 A;  1E8X A;  4IW0 A;  2LGX A;  3QAR A;  2MSE D;  3QIJ A;  2ZPY A;  4W9D A;  3PZD A;  1WI0 A;  4HDO A;  3GOE A;  1EAZ A;  2EC1 A;  3PRZ A;  3KVF B;  4HB3 B;  3ZTD A;  3R7Q A;  2ZCC A;  2L0T A;  4G3X B;  1PQS A;  2N23 A;  4XZ4 A;  2HJ8 A;  2NBU A;  3PHX B;  4K7U A;  2YVC A;  3ZUN A;  5JZE B;  3JSV B;  1WF9 A;  4GPT B;  2W2X C;  4GMX B;  4G11 A;  4DBB A;  3A9J A;  1RJ2 A;  2KC2 A;  5AZG A;  2JRH A;  3QBV B;  2DLW A;  3OJ3 A;  2M1M A;  5CLQ B;  2A5U A;  1P3Q U;  2C60 A;  1ZW7 A;  4AP4 C;  2RNR B;  4FJZ A;  1MIX A;  1GJZ A;  1FB8 A;  1XKE A;  4W9F A;  4MY6 A;  4FA6 A;  1TXD A;  2FCM A;  2P8V A;  3VTW A;  2W2X D;  3LJU X;  1UH6 A;  4NSW A;  1NTV A;  3ZNG C;  3VQI A;  2D07 B;  2AEH A;  1UNR A;  2LRU A;  4K1R B;  2NMB A;  2NPT A;  4ANU A;  2ZPN A;  1V5T A;  1P98 A;  5IAA C;  4FN2 A;  4WJP A;  3TFM A;  1SGH A;  2KTR A;  3FEH A;  3DBS A;  2YS3 A;  4HJK A;  2K8C A;  4KV2 A;  4N9F 4;  2PJH A;  3PP2 A;  2PZ1 A;  2G45 B;  2ZCB A;  3A9J B;  2N4F A;  4K2P A;  1RFA A;  2ABD A;  3APD A;  2D4Q A;  4HK2 A;  5D27 A;  4WAA A;  5EDS A;  2KWC A;  1WJN A;  1KZ7 A;  3UQB A;  4NQK E;  5JHH A;  1UGM A;  2Y5B B;  4NY0 A;  4FUL A;  2D9X A;  1UPQ A;  1R4N I;  1Q0W B;  3A8P A;  3H9D A;  1UBI A;  2B3A A;  5AEK B;  3PRP B;  1X1M A;  2JRI B;  4JGH B; 
#chains in the Genus database with same CATH topology
 5J3Y A;  2JYE A;  3Q3M C;  1J0G A;  2OTX A;  2HTM E;  3AE8 B;  2NPT B;  2ADZ A;  2O6V D;  3TW1 A;  3ZLZ A;  1U2B A;  2KTR B;  2JF5 A;  4MH0 E;  3VHT C;  3ZRC A;  1JWS D;  2KK8 A;  2KGX B;  2V4I B;  2GCJ A;  2WH5 A;  4DDG D;  2PW9 A;  1V5M A;  4A3P A;  2V3P A;  1R4M I;  4KAX B;  4B9K A;  3NVY A;  4NAM A;  2RR9 A;  4ZRJ A;  1OY2 A;  2C5L C;  2NBV A;  3F5R A;  2MX2 A;  2MEK A;  2YT2 A;  1NYQ A;  1HBK A;  4GIV A;  2DTC A;  1FFU A;  1P5T A;  4M0W B;  3QA8 A;  3TEW A;  1MK7 B;  1TTN A;  1HB6 A;  4HB2 B;  1ZP0 B;  1E8Y A;  4KX6 B;  2KJ6 A;  4KHB B;  2KAC A;  2YEP F;  1BML C;  2IYD B;  3JW0 X;  4ILH A;  5TSS A;  4P7I A;  2O6V B;  1GC7 A;  3NSU A;  1NBF C;  1ENF A;  2DAF A;  3FKY A;  2WQY B;  5C23 A;  4TMA B;  2LXC A;  1VZ7 A;  2K8H A;  1AYF A;  1TYG B;  1E7P B;  1C3T A;  4II2 B;  1UEL A;  2DAJ A;  3NWA A;  2YLM A;  5J2R A;  5LXI B;  3TMP B;  4ANX A;  2KLG A;  5LXH A;  4HXD A;  1OQN A;  3HK0 A;  1ZKH A;  1CZP A;  5IOI A;  3U30 A;  1EF1 A;  1I7H A;  4XE0 A;  1TY2 A;  1YN4 A;  4FLH A;  4C4V A;  1N5X A;  1XCQ L;  1RRP B;  1N3H A;  2VRR B;  1T3Q A;  1YD8 U;  2KT7 A;  3ML8 A;  2DHK A;  2Z0D B;  1OTR B;  2XQN M;  1SHC A;  3BYT B;  2QKL A;  3R2I A;  1JWU D;  3JYU A;  1EM7 A;  4F7G A;  5HE0 A;  1XT9 B;  2NBV B;  3BJI A;  5D7G A;  5BYR A;  4K17 A;  2G3Q B;  3VUW A;  2M8S A;  4LJP B;  3ZTC A;  1FNU A;  3PTF C;  5D94 A;  1T77 A;  2JZP A;  3L4P A;  2KVZ A;  1NTY A;  2FJU B;  2TSS A;  1KC7 A;  5HHD G;  5D3X A;  1I4P A;  2CU3 A;  1SJH D;  2R82 A;  4NZL B;  3ZJT A;  1S3S G;  2COA A;  3BY4 B;  5D3D A;  3E56 A;  4BOS C;  1P7E A;  3D8D A;  3SYX A;  3KWL A;  1E0Z A;  2KYW A;  4RGO S;  3RI7 C;  1FHO A;  4JK8 A;  1OEY J;  3GE8 C;  1EWC A;  3NZ3 A;  3I57 A;  2AWT A;  4C4V B;  3H7P A;  5D3Y A;  3P1M A;  2C7M B;  4DX9 0;  1HTO A;  3R3M A;  4I6N B;  4C00 A;  4RF0 A;  1XXG A;  3RNA C;  3VUX A;  2HE7 A;  2LEK A;  2EEL A;  4YTP B;  2K0P A;  3L13 A;  2C7N B;  2KWU B;  4K7S A;  1U4A A;  1UGJ A;  2REX A;  2LVO A;  4GZU A;  1VLB A;  1FGY A;  3VTU A;  3SD5 A;  3WAL A;  4E3C A;  3RCZ A;  2JXX A;  3ETR A;  4BKT A;  1YQ4 B;  4LDT D;  3QCA A;  3FLV A;  1C1Y B;  2BT6 A;  3SNH A;  1KFY B;  2Y8G A;  1T0Q C;  4KGR A;  3DXE A;  1ACA A;  3H1U A;  4ZRP A;  2LGD A;  3HHM A;  2MQJ A;  1KI1 B;  2Z13 A;  4ZYN A;  2BQQ A;  2KFJ A;  3QHT A;  1C4P A;  3NG0 A;  2RSU A;  3ZNI D;  5HFY A;  1C4C A;  2BYT A;  2DKQ A;  5LG4 B;  3PVW A;  3ZIM A;  3RNB C;  3FC4 A;  3MC8 A;  3NWD A;  1WJ4 A;  1GB4 A;  2N1V A;  4PS7 A;  2JZ3 B;  1X05 A;  5KQ4 A;  2JPH A;  2V3N A;  3H7P B;  3OAW A;  4H2A A;  4F7H A;  1SE2 A;  2PVO D;  3PVL A;  4LDT B;  1JWM D;  2FCN A;  2G1E A;  5TR5 A;  1Q67 A;  2YS1 A;  4QJ4 B;  5DPW A;  5FI0 A;  1F0Z A;  4XDC A;  1KM7 A;  3PSC A;  3AH7 A;  3ZJU A;  3PO0 A;  1WYW B;  1QC6 A;  3PSE B;  1AW7 A;  1QIL A;  3BYY B;  2LJ5 A;  1FEH A;  2D9Z A;  3H7S A;  1UD7 A;  2AQ3 B;  2KC1 A;  2KCJ A;  1EF5 A;  2L8J A;  3P4Q B;  3P4R B;  1EGX A;  2N9K A;  3A8Q A;  2LFI A;  2AL6 A;  3L08 A;  4JWS C;  1XLN A;  5C6R A;  4US8 A;  2LKO A;  3CMM B;  3HW2 B;  3MPX A;  3EHV A;  3RUL A;  4C7Y A;  1VR9 A;  3ABV B;  4KHA A;  3NVW A;  4RCO A;  4MEM A;  1WGR A;  1MAI A;  3Q3J A;  2VZK B;  2CR5 A;  3VAW A;  1ZC3 B;  2DYB A;  2DNF A;  2NTT A;  3KYC D;  4HPM B;  1Y56 A;  2ONQ A;  2WXR A;  1ZGU B;  4KZ0 A;  2L00 B;  1DOX A;  3EFC A;  3WIM A;  5JXV A;  2NR2 A;  1EWY C;  2MBE A;  3Q6B A;  3NVV A;  5GMV A;  2JP2 A;  1V5O A;  2KFK A;  2MA9 B;  2KXJ A;  5AZH A;  1IYF A;  4HJG E;  2L1C A;  2HRJ A;  3NUH B;  1FFV A;  1L6U A;  5DHF B;  4A6K A;  4HCN B;  3IT4 B;  2IO2 B;  1T5X D;  4F8C B;  1F52 A;  2K8B A;  1WXM A;  3U7D A;  3V6C B;  3FVC A;  4KGT A;  3DWG C;  1NVL A;  2KTF A;  3TIX A;  4HVB A;  4EJN A;  4DQO C;  2LXA A;  4XWX A;  5IP4 D;  3HRD D;  1WGG A;  2QJL A;  2H7D A;  1WGH A;  1WMH A;  4HB0 B;  3VIA A;  1GUA B;  3PLV A;  3W1S C;  1U29 A;  1BXT A;  2LGS A;  1HTQ A;  2GBK A;  3CIR B;  1BAK A;  5E6O A;  2Y3A A;  1OEY A;  3Q8F A;  3DQV A;  3GZN B;  1YJJ A;  2K2U A;  2V0G A;  2MFQ A;  4IM0 A;  5BYQ A;  2Y5P A;  2J52 A;  4MT5 A;  4W9C A;  3W1S A;  1L7Y A;  2RPV A;  2WU5 B;  2KDM A;  2I5F A;  3RZF A;  2H7E A;  2E3T A;  2SAK A;  2KIG A;  2COC A;  2ZNV C;  2FID A;  3APC A;  3PLU A;  2KNB A;  1I35 A;  1Q5W B;  3FAH A;  1KH0 A;  1JWB D;  2IGD A;  3ZDM C;  2LUL A;  2KFK B;  1UF0 A;  2ACZ B;  3KSY A;  3KYD D;  3DCX A;  3NZS A;  1K53 A;  3HM3 A;  3P6A A;  3SFD B;  3T9L A;  2DX5 B;  4XC2 A;  4HEA 1;  1VZ8 A;  5J18 A;  3VR9 B;  1UBQ A;  2OQB A;  5DHA B;  1FCC C;  4IM2 A;  3V61 A;  1FXT B;  1P0R A;  5JHB A;  5C2T B;  3B9J A;  3CIK A;  4C80 A;  4LK0 M;  2WX1 A;  1WMH B;  3MTN B;  2WU2 B;  1NI3 A;  2WXK A;  1XLP A;  2MBO A;  2R2Y A;  1F2R C;  2L7R A;  2JXT A;  2D3G A;  2WXL A;  3A1Q A;  5IRS A;  3WAM A;  4ZDV A;  3CST A;  2N7D A;  4FBJ B;  2JWZ A;  4MH8 A;  2C7H A;  2E2X A;  2RMM A;  1VCB A;  2RGF A;  1KLU D;  5L95 C;  1MJD A;  3GE3 C;  4JK7 A;  3VDZ A;  2DA0 A;  3NWF A;  5L81 A;  4NQL B;  3RD2 A;  2KDE B;  1OQR A;  1WZ3 A;  4KGS A;  4MJS A;  4RM9 A;  3L16 A;  1MHX A;  5AUI A;  2OJW A;  2VH2 A;  4GB9 A;  4GDK B;  5JVL A;  1RRB A;  3SEB A;  4R3D A;  4LNF A;  2DWQ A;  3Q8B A;  3BVG A;  4M8M A;  4NJ6 A;  4ANW A;  3L10 B;  2ZNV B;  2AQ1 B;  3KW5 B;  4GDL B;  2I5C A;  2G4D B;  4HB4 B;  1GGO A;  4OZB A;  4W9G A;  4XYC A;  2FUH B;  1VDV A;  4CO7 A;  2X38 A;  5HE2 A;  2MW5 A;  1P3R A;  3FIL A;  4HPL B;  3C19 A;  3N7C A;  3X0W A;  1W1D A;  2GI9 A;  3JVZ X;  5G5H A;  4E74 A;  1VRA B;  2M4N A;  4DHJ D;  5CX3 A;  1UPR A;  4LNI A;  5IO9 A;  2BB6 A;  3EFU A;  1YN3 A;  3OLM D;  5I2M A;  3I9V 1;  1TS5 A;  1T0Y A;  2J59 M;  4WQO B;  4RF1 A;  5DCN A;  2B76 B;  3A1Q B;  2PVG C;  1ZM0 A;  1WJ6 A;  1IBX A;  4ITK A;  1PFD A;  1V81 A;  3QAQ A;  4OVV A;  4FAD A;  1HEZ E;  1V86 A;  2EKI A;  4MJS B;  2KIE A;  1HA5 A;  4TUU A;  1FCL A;  3LB8 C;  5FK9 C;  3DXD A;  2N0S B;  1YOV B;  3BZD B;  4B95 A;  2Z0E B;  3GYP A;  2CRF A;  2RPQ A;  2LGI A;  2PIA A;  3SBT A;  1DDM A;  5D3I B;  4ILG B;  5HG2 A;  1PLS A;  3AXC A;  2YT1 A;  2KD0 A;  2QDF A;  1B55 A;  3Q8C A;  3SDL C;  1I4R A;  5AZF A;  4GGQ A;  2WXI A;  2UZR A;  1MG4 A;  3L54 A;  4K7W A;  1V89 A;  2LOZ A;  2CHX A;  1WWT A;  4ACF A;  2HJ1 A;  3FIL B;  4A6Q A;  2N9L A;  1FIQ A;  3ZW3 A;  2KDB A;  1AN8 A;  2IDY A;  1M94 A;  2EKE C;  4H8S A;  1XD4 A;  5BMH A;  1WIA A;  1ZUD 2;  4JKH A;  5DH9 B;  5IKC M;  3DBH I;  1WR6 E;  3ZKJ C;  4DIX A;  1FRD A;  3TUO A;  4RGT A;  1D6E C;  3CWI A;  5KHO A;  4GMV A;  1MHH E;  3KWV A;  1RM6 C;  1IBX B;  4NJ7 A;  2K3U A;  4BZA A;  1FHW A;  1J0W A;  2BB5 A;  2EMS A;  2ZVN A;  2DIK A;  2KAN A;  3ONS A;  3ZXR A;  1BUI C;  3A4S C;  3OG5 A;  1AAR A;  2FCQ A;  3W9C B;  5KCV A;  2LG1 A;  1PFJ A;  1ROE A;  2MWS B;  2O6V A;  1ESF A;  3N30 A;  1I4H A;  2VRW B;  1I2H A;  1R4N B;  4KKI A;  1WGY A;  1L6V A;  4I6P A;  2IFS A;  1NYR A;  2BTE A;  3DOW A;  1SXT A;  2KQ7 A;  1K5G B;  2XK5 A;  1QOB A;  2HTH A;  2M56 B;  3PG7 A;  2INP E;  3UF8 A;  1E8Z A;  3SUZ A;  1FRR A;  1Q1O A;  1Z5S B;  2DZJ A;  3RZW C;  3DVG X;  1TJ6 A;  2WLB A;  2D9W A;  2KQ4 X;  2KZR A;  1T0S C;  2G4S A;  2FUG 1;  5HI1 A;  3WCQ A;  1ZPS A;  1XCG A;  2VSZ A;  4FHK A;  5KHQ A;  4ANV A;  2FJL A;  4RNA A;  2D3C A;  4M8N A;  1JDE A;  3IXS A;  1DYN A;  3ZDT A;  1QQG A;  4OVU A;  3IHP C;  4A55 A;  2KMC A;  2W3S A;  3DCG A;  1TBE A;  3TEX A;  3VUY A;  3RMK C;  5BO4 B;  1H10 A;  4QXA B;  1ZXI A;  2BF8 B;  4JPS A;  2COF A;  2X8X X;  4JK9 A;  4DK5 A;  4HRS A;  4JWU C;  3Q8E A;  2IND C;  1YJ1 A;  2D3A A;  4HCP B;  5C1Z A;  4EEW A;  4QJ3 B;  3AED B;  2WXJ A;  1QOF A;  2N1W A;  2CQU A;  4CYE A;  3RN9 C;  2K2J A;  3K9O B;  1DDV A;  3U7Z A;  3BK1 A;  3M3J A;  1QOA A;  2XK5 B;  2HTH B;  4W9K A;  2NCN A;  1W1H A;  1EVH A;  4HRO A;  2JQR B;  2RRF A;  1YX6 B;  3E9O A;  3V05 A;  2KMA A;  3M62 B;  3IVF A;  2K8E A;  5DPT A;  4A8X C;  1SF0 A;  2DFK A;  2GCL A;  4OHJ A;  1WGK A;  5MPO A;  1V1O A;  2BKF A;  2JY6 A;  1SBB B;  2PTL A;  4RGM A;  2D10 A;  4WSF A;  3AE9 B;  4GXB A;  3AJ4 A;  4EZK A;  2R2Q A;  2Z8L A;  1E6E B;  2BWF A;  2J0K A;  1WXV A;  1MKE A;  2LRW A;  1KJT A;  3ZGZ A;  2K49 A;  4BBK A;  2CAY A;  4IDI A;  3ENE A;  1OMW A;  4F7U P;  1GC6 A;  3AMZ A;  2KAJ A;  2GS0 A;  4A6F A;  3N9Y C;  1KBL A;  2LGY A;  2WDQ B;  3Q3F A;  2WDT B;  1STE A;  2IYB A;  2CY4 A;  4D6W A;  4DX8 A;  1ET6 A;  1LQB A;  5L83 A;  1XF5 L;  2ZW1 A;  4EFO A;  5D6J B;  2J53 A;  4ZRK A;  4AWJ A;  2LMC A;  1V80 A;  1YN5 A;  3NS8 A;  3NHE B;  2R0D A;  2N9P C;  3RNE C;  2MBB B;  2WDR B;  4IWQ A;  1RFK A;  3BVZ A;  2ROZ B;  3BVM A;  2V9H A;  4TYZ A;  1C78 A;  2KR0 A;  2L83 A;  3PT2 B;  4BOZ B;  4F7Z A;  3LYY A;  4GN1 A;  2N9E B;  1TJE A;  2V4L A;  4REZ A;  1I7A A;  4FHJ A;  2IPK D;  4NNJ B;  1DYQ A;  2P0D A;  1HB8 A;  2R09 A;  3O13 A;  4AS1 A;  1TGZ B;  1E90 A;  3GP7 A;  4W9H A;  1CK1 A;  2FDQ A;  5CTR C;  2JT4 B;  1WX9 A;  4A9A A;  2IO3 B;  1WRD B;  1TKG A;  2J42 A;  2ELB A;  3TCA A;  1I42 A;  2BVC A;  1WG7 A;  2BKR B;  3N3K B;  2YF0 A;  2BS2 B;  2W3R A;  4JKD A;  2K5P A;  5LNK 1;  3VH4 B;  4B6H A;  4A6F B;  1E7V A;  3M95 A;  3DXC A;  2W55 A;  4WAF A;  3B77 A;  1AWE A;  1U5E A;  1BT0 A;  4HAT B;  1WE6 A;  1QOG A;  1IGC A;  4HAY B;  4DXG A;  1FGZ A;  3ODW A;  1E10 A;  1Y5O A;  3FM8 C;  2OED A;  1C9F A;  4W9J A;  2BBC A;  2DZI A;  3C8Y A;  3UI3 A;  3H8H A;  2MJ3 A;  2KDF B;  1HE8 A;  1V97 A;  5GOW B;  1GAQ B;  2K39 A;  1W1G A;  3U8Z A;  3DHG C;  2E6X A;  2V76 A;  1Y19 B;  2WXG A;  3AEB B;  4J3O D;  2W9N A;  1U27 A;  2MWN B;  1K5D B;  2N9X A;  2LBB A;  2Z0O A;  1V61 A;  3D8F A;  2IGH A;  1C77 A;  3DVG Y;  4X57 B;  2GBM A;  5G2N A;  3DVN V;  1P9D U;  1KLG D;  1TY0 A;  1DOI A;  2IY0 B;  1UZX B;  1H4R A;  2J0M A;  4ICU A;  1LGR A;  3RFZ B;  4NJC A;  2MRP A;  3APF A;  4IOI E;  3TO1 A;  2LUM A;  1YQ3 B;  3NY5 A;  4OZC A;  1MK9 B;  1WE7 A;  3VRB B;  4US9 A;  2GJY A;  2UVM A;  4ARC A;  3HSA A;  1N60 A;  3HIZ A;  2SEB D;  1FXA A;  3B2F A;  2XNA C;  2FNJ B;  1UUP A;  4JKA A;  3NVZ A;  3X23 A;  5J3Q A;  5FR6 A;  2KJH B;  2L32 A;  5GXG B;  4PYU A;  1PGB A;  4WIP A;  3OWE B;  4TKN A;  3UIP B;  3BWU D;  3S2A A;  1HZ5 A;  5LOP B;  3QK0 A;  1C76 A;  1GPX A;  5H8Y E;  2MP2 A;  4MEL A;  4HSI A;  3KZ1 A;  2VKI A;  4JLC A;  4IC7 B;  4HLE A;  3F0W A;  4PQ0 A;  3ML9 A;  3LJ3 A;  2YS5 A;  1MG8 A;  5DPS A;  1E8W A;  4WWO A;  5JH5 C;  1D3Z A;  2DLB A;  3E9P A;  5CHF A;  2EJ8 A;  4O1N A;  2MKR A;  3T8M A;  3U2S C;  1YNT E;  1WXA A;  4WWN A;  2DHI A;  2FE8 A;  2DX5 A;  3DHH C;  4B0E A;  1SB3 C;  5D3W A;  3NW8 A;  4USA A;  4URK A;  1PYW D;  3BIN A;  1V5P A;  1A70 A;  4ICV A;  4K3C A;  2MDX A;  5G5G A;  1ZOY B;  4GNK B;  2D11 A;  2CS4 A;  1C79 A;  2UYZ B;  2K6Q A;  4BKS D;  3M1I B;  2DZM A;  3RNF C;  1DRO A;  4XDD A;  3B0A A;  3AN1 A;  1FNW A;  1YX5 B;  2CJO A;  4WQM A;  3P4P B;  2EMT A;  2N7J A;  1P7F A;  4MGZ E;  4GSW A;  2WYQ A;  2FCS A;  4I6L B;  1LB1 A;  5DI9 B;  4S17 A;  5I2S A;  3GS2 A;  4YTN B;  3DPD A;  4HHV A;  2MP2 B;  3R7R A;  1U5F A;  3R8B A;  5EE0 A;  1P1A A;  4GDK A;  3RCP A;  4RGN A;  3PGE A;  3A98 B;  2PE9 A;  5JHA A;  4YON A;  4Z2N A;  1WVH A;  2KUQ A;  1KZG A;  2DYN A;  1ACC A;  1MFW A;  5BMI A;  2JWU A;  2ZVO A;  3Q3O C;  4GDL A;  3WAO A;  3TSS A;  2WXQ A;  1A5R A;  3HVD A;  2PMV A;  3O96 A;  4KDL B;  3TBL D;  2BS4 B;  4P16 A;  4DDI D;  1NEK B;  2COD A;  3VOQ A;  3ULC A;  1ZC4 B;  3KRX A;  2L3Z A;  1X1G A;  2ZKM X;  2IGG A;  2IO0 B;  2QC8 A;  1FM0 D;  2ON8 A;  2VH1 A;  4OZA A;  1WGQ A;  1RLF A;  4P1C C;  3B08 A;  1DDW A;  3R2T A;  1XX0 A;  2BS3 B;  3VTV A;  2K00 A;  4XX5 A;  1SE9 A;  2BYE A;  4G0N B;  1ZXH A;  2DEN B;  2DHJ A;  3RNC C;  3MJW A;  1ZVR A;  3FSS A;  5JHG A;  1ZDX A;  2OJR A;  2QEJ C;  2JU6 X;  4AOF A;  2BGF A;  2FIF A;  3D8E A;  1S1Q B;  1KOT A;  2V3S A;  4L6E A;  1ZE3 D;  2G35 A;  3IG3 A;  3N1Z C;  2MHJ A;  2A4Z A;  4LNN A;  1PGX A;  2ZJD A;  2WXM A;  3HUI A;  3VH3 B;  1V49 A;  2K6D B;  5J3T A;  2NS5 A;  1JQ4 A;  1L4D B;  3P63 A;  2RLO A;  1I4X A;  1PDX A;  3A58 A;  3A9K A;  4HPP A;  2MBH A;  4OSN A;  3Q14 C;  4WUR A;  3QJZ A;  2RQ1 A;  3O65 B;  4GOU A;  1N62 A;  3ALB A;  4DWF A;  1KLV A;  3CXB B;  2KVR A;  2PEA A;  2XN9 C;  2I1K A;  1CMX B;  2M19 A;  2RUK B;  3VVW B;  1XLO A;  4DBG A;  3OHM B;  4IFS A;  3T3N A;  2W82 A;  2KDI A;  2IO1 B;  3DVN U;  1MPH A;  1QQR A;  2CHW A;  4A3O A;  1BTN A;  4JQW C;  2YRY A;  1WR1 A;  3RT3 B;  1I4Q A;  3AEC B;  2KKC A;  2WXO A;  5D2M B;  4OT1 A;  3KUD B;  1WJM A;  2J4X A;  3K9P B;  4HDQ A;  2AX5 A;  2RDH A;  3LXF A;  2OHF A;  1OQY A;  4MGY E;  2MLB A;  2M0A A;  3AE7 B;  4XWT A;  1LO5 D;  1WGU A;  1MI1 A;  3V6E B;  4PS3 A;  2AYO B;  1V5U A;  1E5W A;  1ZSQ A;  2YSZ A;  4J6I A;  5CHW A;  1WSP A;  2P0F A;  5CLL B;  2UWQ A;  1TQZ A;  1SEB D;  4TV3 A;  1GB1 A;  1ST7 A;  3A9K B;  5FI1 A;  3ZNZ B;  2LVQ A;  1WI1 A;  1K50 A;  4KDI C;  1N6Z A;  2GBR A;  3E66 A;  5C5B A;  1LW3 A;  2Z4D A;  4ILJ A;  2PPH A;  2GBJ A;  3EEC A;  3M63 B;  3AE6 B;  1WM2 A;  4DHJ B;  1FOE A;  3DBR I;  4PS8 A;  2ZZP B;  1GG3 A;  3B1L X;  1L0X B;  3GYO A;  2M14 A;  4WWM A;  1Q10 A;  4CHJ A;  4JKC A;  5BYS A;  1WX7 A;  5I4D A;  2M38 A;  1FPY A;  4C0A A;  4KKJ A;  1WXS A;  4WJO A;  3KLS X;  2KHW B;  4MGK E;  4K81 A;  4BKG A;  4F1S A;  1LFD A;  4ZHP A;  3DBL I;  5IN7 A;  3HM6 X;  4BVU C;  5EE9 A;  3WA0 A;  2NMQ A;  2L0F A;  3SU8 X;  5H92 C;  4W9E A;  4G50 A;  2DBY A;  3A33 B;  1YJI A;  4ZHO A;  4YSZ B;  2G9H D;  1G6J A;  1IRS A;  3RNG C;  3PRM B;  4IOY X;  4JKG A;  2Y5C A;  1OFF A;  3ZNH B;  1KF6 B;  2GB1 A;  1V6E A;  4RM8 A;  4PK1 A;  2QCZ A;  2KLC A;  2LOX A;  2D9Y A;  2DX1 A;  3VFK A;  2FBW B;  1WXQ A;  2GRI A;  2K22 A;  3SO6 A;  3TEY A;  5T8I A;  3D32 A;  4WJN A;  2ELA A;  5C5B B;  2GUM A;  4JIO U;  2ZEQ A;  2MBQ A;  3PEG A;  2MJD A;  3SR6 A;  4EMO A;  4A6H A;  2ASQ A;  2M17 A;  1XCT L;  4EUT A;  2ICI A;  1FXI A;  1DBH A;  1VZ6 A;  4S0R A;  1XQQ A;  2DYQ A;  2Z0P A;  2OOB B;  3U4E G;  4W9L A;  4Z2M B;  3P4S B;  3MFG A;  2WWZ A;  3MHS D;  5C3J B;  4CQN A;  1F1H A;  4PNK A;  2NBW B;  3PVU A;  4L1R A;  2KWD A;  4MSM B;  4CSQ A;  3Q3N C;  3PV1 A;  4LNO A;  3G9W A;  3UIN B;  3MC0 B;  3KH0 A;  3P7Z A;  3SV1 A;  3KRW A;  1NI2 A;  4TSS A;  3V5W A;  1R4M B;  4AJW A;  3KQ4 A;  4FJV B;  1NVI D;  1IGD A;  3ODX A;  1LM8 B;  2Q5W D;  1WY8 A;  2KX3 A;  2IZV B;  2QKM A;  2ROV A;  3PRE A;  4IG7 B;  1GNU A;  4M01 A;  4JKG B;  3AU5 A;  2LI5 A;  5J17 A;  4JKF A;  3AEA B;  3AEF B;  4Q2J A;  1YQB A;  2V1Y A;  1L2N A;  5G55 A;  4EOY A;  5FR3 A;  4M02 A;  3VRA B;  1BWN A;  4W9I A;  3SFE B;  4EZL A;  2KN5 A;  2QHO A;  3CF6 E;  1Z2M A;  1WH3 A;  5EFX A;  1J8C A;  2JYT A;  2L1A A;  4L2Y A;  3AE2 B;  4FJY A;  3W1Y A;  4HAV B;  3DHI C;  4AJY B;  3J9C A;  2Y8F A;  3GB1 A;  2CJN A;  4L23 A;  2CU1 A;  3AB5 A;  4DXA B;  2RSG A;  1T6B X;  3I5J C;  2Z0Q A;  3NOB A;  3OJ4 B;  4LTU A;  4QAY A;  2KO3 A;  4KIK A;  4LJO B;  2NZ8 B;  4OVZ A;  1D5Z C;  3AU4 A;  1FHX A;  3T3O A;  3E9L A;  1JCK B;  1CQV A;  4JKB A;  2BYF A;  3SHQ A;  2R61 A;  4MSQ B;  2RDB C;  2W54 A;  1U5D A;  2Z59 A;  1HZ6 A;  3AE4 B;  3IAM 1;  4KVG B;  3OAN A;  1RWS A;  1UNP A;  4Y94 A;  3DWM A;  1V9J A;  1M7R A;  2PKO A;  1SE3 A;  4BBN C;  3V3X A;  1V2Y A;  2C9W B;  2J0J A;  2AQ2 B;  5DPR A;  3ZO5 B;  4NPN A;  4ZYS A;  3RUI B;  2QIL A;  2WX0 A;  1L5P A;  1XR0 B;  3T06 A;  4YT0 B;  1QT9 A;  1WX8 A;  1NTI A;  4A5K A;  1J7C A;  4HAW B;  3ZVR A;  2X0S A;  4IUM B;  4BBN F;  1QZE A;  3WAP A;  3MP9 A;  2PE6 B;  3FP5 A;  2YEP B;  2MJE A;  2JSV X;  3AEE B;  5BMG A;  1JML A;  5HE3 A;  2CB8 A;  1X1F A;  2LWP A;  2XBB C;  1J7B A;  5DIF B;  3U52 E;  1X86 A;  2N0Y A;  2LD9 A;  3PS6 A;  3MHZ A;  4GU2 A;  1V1P A;  1WYG A;  3QWZ B;  4KIK B;  2IJ0 A;  1M7E A;  2WP9 B;  1OQQ A;  1F9J A;  1Z87 A;  3PPA A;  4YL8 A;  3V60 A;  2Q13 A;  4MDK E;  2KMM A;  1TZO A;  2YT0 A;  3I3T B;  3EUB 2;  4GOC A;  4AQ7 A;  4MM3 A;  2RGN B;  2GMI C;  4LNK A;  3MJ5 A;  1I4G A;  1B1Z A;  4DXF A;  2Z59 B;  1P6S A;  2UZS A;  1UNS A;  4IWP A;  4RFB A;  1N63 A;  1AQC A;  1XOD A;  2L05 A;  1L4Z B;  2MCN B;  1FNV A;  2UU7 A;  2WXP A;  4IM3 A;  3V62 A;  3Q69 A;  3L0W B;  1SJE D;  1EU4 A;  3MDB C;  3IFW B;  4JX1 C;  1WM3 A;  5FKA C;  4HAU B;  1Y8R C;  3UIO B;  3BII D;  2LAS A;  5E6J A;  1WJ1 A;  1LXD A;  2BPS A;  4RMA A;  1XD3 B;  1PUT A;  2WXH A;  2RVB B;  4E71 A;  3I63 C;  2KN4 A;  2M0X A;  4B0M A;  3TJP A;  3ZRF A;  3ZVV A;  3QC8 B;  1UNQ A;  2I38 A;  4WJ7 A;  4P1B C;  2BYV E;  1V1P B;  3C0R B;  3EGR A;  5HE1 A;  2CHZ A;  4QJ5 B;  4OW0 A;  2COP A;  1L0Y B;  2CY5 A;  3AV8 A;  1D4B A;  1TKE A;  2KJR A;  1D5X C;  2FAZ A;  1J7A A;  4IAP A;  5JP4 A;  2L76 A;  1WGD A;  1D5M C;  4MM3 B;  3PHW B;  1M4V A;  4DHZ B;  4GLS C;  2AL3 A;  2L2I A;  3WAN A;  4KSL C;  2DN6 A;  4A90 A;  4K3B A;  4ZRI A;  3RYT A;  1H8C A;  2KWV B;  2VZK D;  1QLB B;  1EU3 A;  2WNM A;  2K1F A;  1J19 A;  2K25 A;  5D3V A;  3W5U B;  3N1Y C;  3ZXV A;  2NTS A;  3HQC A;  1E7U A;  4XWW A;  2O2V A;  1PGA A;  2DYM A;  3KUC B;  2LZ6 A;  1R7S A;  3R66 C;  3EC8 A;  3HVZ A;  4HAX B;  3PZ7 A;  2BCJ A;  3LDZ E;  5M4Y B;  1WJU A;  3ODO A;  5C79 A;  5E6N A;  2CKH B;  2IY1 B;  2R2O A;  1MVK A;  4NAW A;  2QIE B;  2D5G A;  1TT5 B;  1FD6 A;  2D9V A;  3Q8A A;  1WFY A;  4DHZ E;  2LJI A;  4YTM B;  2GOW A;  4AUQ C;  4WVF B;  2INN E;  3TEZ A;  4L1B A;  1K8R B;  1X11 A;  4MGI E;  5IJM A;  2J7Q B;  1NU2 A;  1NDD A;  3UGB B;  2DYO A;  2W2W A;  2JUO A;  3P2B A;  3E9S A;  3EA6 A;  3CSF A;  2KX0 A;  4RH6 A;  4CHM A;  1JRU A;  3IT6 B;  1IPG A;  1HXY D;  4YSX B;  4BKS A;  3IBE A;  2BW2 A;  3TVV A;  3QQ8 B;  1DIK A;  1XLQ A;  2JZZ A;  2I2Y A;  3Q2A C;  1WRI A;  1IP9 A;  2X18 A;  2H88 B;  2L52 A;  4JKE A;  2LUE A;  1YIW A;  4KZC A;  2GLS A;  2JVC A;  4P6V F;  2O2V B;  1ZYI A;  4HAZ B;  1CJE A;  4KHO A;  2DHZ A;  2I1J A;  1L0V B;  4EE2 A;  3ULB A;  2DKP A;  3KUZ A;  1UEF A;  4D0N B;  1N5W A;  1SE4 A;  4BAX A;  2KUP A;  4NAW B;  1MIZ B;  2KQS A;  1KRH A;  3UZT A;  4UDU C;  1WZ0 A;  2LYD A;  3DDC B;  3KY9 A;  1VD2 A;  2GBN A;  1RAX A;  4K2O A;  4MT7 A;  1SIF A;  5C16 A;  2BWE S;  3H6N A;  3NZU A;  3GZN I;  2KOX A;  3ML4 A;  5HKH A;  1C4A A;  2XEW A;  1B9R A;  1IUE A;  3N1X C;  4YXD B;  2ZW0 A;  1TS3 A;  2NVU I;  4HWI B;  4C56 C;  1VBG A;  2RD0 A;  3TL5 A;  4EKU A;  4N58 A;  2IBI B;  3AE5 B;  2HD5 B;  2Y7B A;  1TZ1 A;  2HDE A;  3VXW A;  4PYZ A;  1EUV B;  1N61 A;  1PMS A;  1GOZ A;  1V88 A;  4IWO A;  5IA7 A;  3ECI A;  3UQA A;  4WJQ A;  1FAO A;  5JLJ B;  3QWM A;  3AI5 A;  1OGW A;  3N32 A;  5E6P A;  4WWP A;  3A4R A;  3IAS 1;  4CHK A;  5CHV C;  1ISN A;  2P0H A;  4TQ1 A;  4KSK C;  1F77 A;  4LCD E;  1TIF A;  4MK0 A;  1VJK A;  4ASW C;  3EPY A;  4B6W A;  4BFR A;  4TQ0 A;  5KQ1 A;  2DZK A;  3NS1 A;  1EO6 A;  3WYF B;  3JSV A;  4JL9 A;  3RPF C;  4EZJ A;  1NEN B;  3AUL A;  2D2Q A;  1FO4 A;  2LVP A;  3HIE A;  3VR8 B;  3BK2 A;  4A20 A;  4HKQ A;  2FJ9 A;  1BTK A;  5LLI A;  1AWD A;  5LON B;  3MC9 A;  1U5G A;  3L17 A;  2N7E A;  4II3 B;  3QX1 A;  3AEG B;  1E8X A;  4ARI A;  4IW0 A;  2LGX A;  2H89 B;  3QAR A;  3ENB A;  2MSE D;  4D2K A;  3AE3 B;  3QIJ A;  1DOY A;  2ZPY A;  4W9D A;  4HKZ E;  3W2D A;  3PZD A;  3U12 A;  1TS2 A;  3P42 A;  4ZRQ A;  1WI0 A;  4HDO A;  1E9M A;  2LHD A;  3NJT A;  4IKG A;  3GOE A;  1EAZ A;  1V8C A;  3ZYY X;  2WHI A;  1ET9 A;  1SIJ A;  2EC1 A;  2PLP A;  3PRZ A;  2WXN A;  3KVF B;  2WDV B;  4HB3 B;  3ZTD A;  1JAL A;  3R7Q A;  3ZJV A;  2ZCC A;  2L0T A;  4G3X B;  1VBH A;  1DGJ A;  1PQS A;  2N23 A;  4XZ4 A;  2HJ8 A;  2NBU A;  1TKY A;  3PHX B;  4C7Z A;  4K7U A;  2YVC A;  1XO3 A;  3ZUN A;  5JZE B;  3JSV B;  1WF9 A;  4GPT B;  1MPE A;  2W2X C;  4GMX B;  1KTK A;  4G11 A;  4PT5 A;  4DBB A;  1JRO A;  3A9J A;  1SSN A;  1RJ2 A;  2KC2 A;  4LLG M;  2QSD A;  5AZG A;  2JRH A;  3QBV B;  1JRP A;  2Z14 A;  3PZ8 A;  1F2R I;  2DLW A;  3OJ3 A;  2M1M A;  5CLQ B;  4WH4 A;  2A5U A;  1T0R C;  1P3Q U;  1YMH E;  4FXC A;  2C60 A;  3AM9 A;  1ZW7 A;  4AP4 C;  2RNR B;  4FJZ A;  1MIX A;  1GJZ A;  3AE1 B;  1FB8 A;  1XKE A;  2D3B A;  4MY6 A;  1K51 A;  4N6E B;  4W9F A;  4FA6 A;  3DBR B;  4N59 A;  1TXD A;  2FCM A;  2P8V A;  4XGA B;  3VTW A;  2W2X D;  4ZOH C;  1K52 A;  3LJU X;  1UH6 A;  4NSW A;  1NTV A;  1HQR D;  4M00 A;  5EE1 A;  2WS3 B;  2WGS A;  3ZNG C;  3SBG A;  3VQI A;  1ZDV A;  2D07 B;  2AEH A;  1UNR A;  2LRU A;  4K1R B;  5EE3 A;  2NMB A;  1RYJ A;  1TS4 A;  2NPT A;  3DBH B;  4MAC A;  2ZPN A;  1V5T A;  2QMT A;  3DBL B;  4ANU A;  1P98 A;  5IAA C;  4FN2 A;  4WJP A;  3TFM A;  1SGH A;  2KTR A;  3FEH A;  1JW9 D;  4YSY B;  3DBS A;  2YS3 A;  3NRZ A;  4JE3 B;  4HJK A;  2K8C A;  4KV2 A;  4N9F 4;  2K9X A;  2PJH A;  3PP2 A;  4YWG G;  3W5V B;  2PZ1 A;  2G45 B;  2ZCB A;  2MH7 A;  3ZQ4 A;  1MI0 A;  2INC C;  2N4F A;  3A9J B;  4K2P A;  3N20 C;  1RFA A;  2ABD A;  3APD A;  2D4Q A;  2JX5 A;  4HK2 A;  5D27 A;  1QF6 A;  4WAA A;  1UWX A;  5EDS A;  3URY A;  2LHE A;  2KWC A;  1WJN A;  4M0W A;  1KZ7 A;  2WXF A;  3UQB A;  4NQK E;  5JHH A;  1UGM A;  2RDG A;  4KHB A;  2Y5B B;  1XEE A;  4NY0 A;  1QKZ A;  4FUL A;  5AUK A;  2D9X A;  1UPQ A;  1R4N I;  1Q0W B;  3A8P A;  3H9D A;  1UBI A;  3B2G A;  2B3A A;  5AEK B;  1JWA D;  3PRP B;  1X1M A;  2JRI B;  1UWM A;  4JGH B;  1FMA D; 
#chains in the Genus database with same CATH homology
 5J3Y A;  1J0G A;  2OTX A;  2NPT B;  2ADZ A;  2O6V D;  3TW1 A;  3ZLZ A;  1U2B A;  2KTR B;  2JF5 A;  4MH0 E;  3VHT C;  3ZRC A;  2KK8 A;  2KGX B;  2GCJ A;  2WH5 A;  4DDG D;  1V5M A;  4A3P A;  1R4M I;  4KAX B;  4B9K A;  2RR9 A;  4ZRJ A;  1OY2 A;  2C5L C;  3F5R A;  2MX2 A;  1HBK A;  4GIV A;  2DTC A;  1P5T A;  4M0W B;  3QA8 A;  1MK7 B;  1TTN A;  1HB6 A;  4HB2 B;  1E8Y A;  2KJ6 A;  4KHB B;  2IYD B;  3JW0 X;  4ILH A;  4P7I A;  2O6V B;  1GC7 A;  3NSU A;  1NBF C;  2DAF A;  5C23 A;  2LXC A;  2K8H A;  1C3T A;  4II2 B;  1UEL A;  2DAJ A;  2YLM A;  5J2R A;  5LXI B;  3TMP B;  4ANX A;  2KLG A;  5LXH A;  4HXD A;  1OQN A;  3HK0 A;  1ZKH A;  3U30 A;  1EF1 A;  4FLH A;  1RRP B;  1N3H A;  2VRR B;  1YD8 U;  3ML8 A;  2DHK A;  2Z0D B;  1OTR B;  2XQN M;  1SHC A;  2QKL A;  3JYU A;  4F7G A;  5HE0 A;  1XT9 B;  2NBV B;  3BJI A;  5D7G A;  4K17 A;  2G3Q B;  3VUW A;  2M8S A;  4LJP B;  3ZTC A;  3PTF C;  5D94 A;  1NTY A;  1KC7 A;  5D3X A;  2R82 A;  1S3S G;  2COA A;  3BY4 B;  4BOS C;  3D8D A;  3SYX A;  1FHO A;  4JK8 A;  1OEY J;  2AWT A;  3H7P A;  5D3Y A;  2C7M B;  4DX9 0;  3R3M A;  4I6N B;  3VUX A;  2HE7 A;  3L13 A;  2C7N B;  2KWU B;  4K7S A;  1U4A A;  2REX A;  2LVO A;  4GZU A;  3VTU A;  1FGY A;  3SD5 A;  3WAL A;  4E3C A;  3RCZ A;  2JXX A;  4BKT A;  4LDT D;  3QCA A;  3FLV A;  1C1Y B;  3SNH A;  2Y8G A;  3DXE A;  1ACA A;  3H1U A;  2LGD A;  3HHM A;  2MQJ A;  1KI1 B;  4ZYN A;  2KFJ A;  3QHT A;  2RSU A;  3ZNI D;  2DKQ A;  3PVW A;  3ZIM A;  1WJ4 A;  2N1V A;  4PS7 A;  2JZ3 B;  1X05 A;  5KQ4 A;  2JPH A;  3H7P B;  3OAW A;  4F7H A;  4LDT B;  3PVL A;  2FCN A;  5TR5 A;  1Q67 A;  2YS1 A;  5DPW A;  5FI0 A;  1KM7 A;  3PSC A;  1WYW B;  1QC6 A;  3PSE B;  2LJ5 A;  2D9Z A;  3H7S A;  1UD7 A;  2KC1 A;  2KCJ A;  1EF5 A;  2L8J A;  1EGX A;  3A8Q A;  2AL6 A;  3L08 A;  5C6R A;  2LKO A;  3CMM B;  3HW2 B;  3MPX A;  3EHV A;  3RUL A;  4KHA A;  4MEM A;  1WGR A;  1MAI A;  3Q3J A;  2CR5 A;  3VAW A;  1ZC3 B;  2DYB A;  3KYC D;  4HPM B;  1ZGU B;  4KZ0 A;  2L00 B;  3WIM A;  2NR2 A;  2MBE A;  5GMV A;  2JP2 A;  1V5O A;  2KFK A;  2MA9 B;  2KXJ A;  5AZH A;  1IYF A;  2L1C A;  2HRJ A;  5DHF B;  4A6K A;  4HCN B;  2IO2 B;  4F8C B;  2K8B A;  1WXM A;  3U7D A;  3V6C B;  1NVL A;  2KTF A;  3TIX A;  4HVB A;  4EJN A;  2LXA A;  4XWX A;  1WGG A;  2H7D A;  1WGH A;  1WMH A;  4HB0 B;  3VIA A;  1GUA B;  3PLV A;  3W1S C;  1U29 A;  2GBK A;  1BAK A;  5E6O A;  1OEY A;  3DQV A;  2K2U A;  2MFQ A;  4IM0 A;  4W9C A;  3W1S A;  1L7Y A;  2I5F A;  3RZF A;  2H7E A;  2COC A;  2ZNV C;  2FID A;  3APC A;  3PLU A;  2KNB A;  1I35 A;  1Q5W B;  3ZDM C;  2LUL A;  2KFK B;  3KSY A;  3KYD D;  3NZS A;  3HM3 A;  3P6A A;  3T9L A;  2DX5 B;  4XC2 A;  5J18 A;  1UBQ A;  2OQB A;  5DHA B;  4IM2 A;  3V61 A;  1FXT B;  1P0R A;  5JHB A;  3CIK A;  2WX1 A;  1WMH B;  3MTN B;  2MBO A;  2L7R A;  2D3G A;  3A1Q A;  3WAM A;  4ZDV A;  3CST A;  2N7D A;  4FBJ B;  2JWZ A;  2C7H A;  2E2X A;  1VCB A;  2RGF A;  5L95 C;  3VDZ A;  4JK7 A;  2DA0 A;  5L81 A;  4NQL B;  3RD2 A;  2KDE B;  4RM9 A;  4MJS A;  1WZ3 A;  3L16 A;  4GB9 A;  4GDK B;  5JVL A;  1RRB A;  4M8M A;  4NJ6 A;  4ANW A;  3L10 B;  2ZNV B;  3KW5 B;  4GDL B;  2I5C A;  2G4D B;  4HB4 B;  1GGO A;  4W9G A;  2FUH B;  4CO7 A;  5HE2 A;  2MW5 A;  1P3R A;  4HPL B;  3N7C A;  3X0W A;  1W1D A;  3JVZ X;  4E74 A;  4DHJ D;  2M4N A;  5CX3 A;  1UPR A;  3EFU A;  3OLM D;  1T0Y A;  2J59 M;  4WQO B;  5DCN A;  3A1Q B;  1ZM0 A;  1WJ6 A;  1V81 A;  3QAQ A;  4OVV A;  4FAD A;  1V86 A;  4MJS B;  4TUU A;  3DXD A;  4B95 A;  2Z0E B;  3GYP A;  2CRF A;  2RPQ A;  3SBT A;  1DDM A;  4ILG B;  1PLS A;  3AXC A;  2YT1 A;  2KD0 A;  1B55 A;  3SDL C;  5AZF A;  4GGQ A;  2UZR A;  3L54 A;  4K7W A;  1V89 A;  2LOZ A;  2CHX A;  3ZW3 A;  2KDB A;  1M94 A;  2EKE C;  4H8S A;  1XD4 A;  1WIA A;  4JKH A;  5DH9 B;  3DBH I;  1WR6 E;  3ZKJ C;  5KHO A;  4GMV A;  4NJ7 A;  1FHW A;  1J0W A;  2EMS A;  2ZVN A;  2DIK A;  2KAN A;  3ONS A;  3A4S C;  1AAR A;  2FCQ A;  5KCV A;  2LG1 A;  1PFJ A;  2MWS B;  2O6V A;  3N30 A;  2VRW B;  1I2H A;  1WGY A;  4I6P A;  2IFS A;  3DOW A;  2KQ7 A;  2XK5 A;  1K5G B;  2HTH A;  3PG7 A;  3UF8 A;  1E8Z A;  3SUZ A;  1Q1O A;  1Z5S B;  2DZJ A;  3RZW C;  3DVG X;  1TJ6 A;  2D9W A;  2KZR A;  2G4S A;  1XCG A;  2VSZ A;  4FHK A;  5KHQ A;  4ANV A;  2FJL A;  4M8N A;  1JDE A;  1DYN A;  3ZDT A;  1QQG A;  4OVU A;  3IHP C;  2KMC A;  3DCG A;  1TBE A;  3VUY A;  5BO4 B;  1H10 A;  2BF8 B;  2COF A;  4JK9 A;  4DK5 A;  1YJ1 A;  4HCP B;  5C1Z A;  4EEW A;  2N1W A;  2CQU A;  4CYE A;  2K2J A;  3K9O B;  1DDV A;  3M3J A;  2XK5 B;  2HTH B;  4W9K A;  2NCN A;  1W1H A;  1EVH A;  1YX6 B;  3E9O A;  2KMA A;  3M62 B;  3IVF A;  5DPT A;  2DFK A;  2GCL A;  2BKF A;  2JY6 A;  2D10 A;  4WSF A;  4GXB A;  3AJ4 A;  4EZK A;  2R2Q A;  2BWF A;  2J0K A;  1WXV A;  1MKE A;  2LRW A;  1KJT A;  4BBK A;  2CAY A;  3ENE A;  1OMW A;  4F7U P;  1GC6 A;  2GS0 A;  4A6F A;  1KBL A;  2LGY A;  3Q3F A;  2WDT B;  2IYB A;  2CY4 A;  4DX8 A;  5L83 A;  1LQB A;  4EFO A;  5D6J B;  4ZRK A;  4AWJ A;  1V80 A;  3NS8 A;  3NHE B;  2R0D A;  2N9P C;  2MBB B;  4IWQ A;  2ROZ B;  4TYZ A;  4BOZ B;  3PT2 B;  4F7Z A;  4GN1 A;  2N9E B;  2V4L A;  1I7A A;  4FHJ A;  4NNJ B;  2P0D A;  1HB8 A;  2R09 A;  1TGZ B;  1E90 A;  4W9H A;  2FDQ A;  5CTR C;  2JT4 B;  1WX9 A;  2IO3 B;  1WRD B;  2ELB A;  3TCA A;  1I42 A;  1WG7 A;  2BKR B;  3N3K B;  2YF0 A;  4JKD A;  3VH4 B;  4B6H A;  4A6F B;  1E7V A;  3M95 A;  3DXC A;  1AWE A;  1U5E A;  1BT0 A;  4HAT B;  1WE6 A;  4HAY B;  1FGZ A;  3ODW A;  1Y5O A;  3FM8 C;  4W9J A;  2DZI A;  2KDF B;  1HE8 A;  5GOW B;  2K39 A;  1W1G A;  3U8Z A;  2V76 A;  1Y19 B;  2W9N A;  1U27 A;  2MWN B;  1K5D B;  2N9X A;  2LBB A;  2Z0O A;  1V61 A;  3D8F A;  3DVG Y;  4X57 B;  2GBM A;  5G2N A;  3DVN V;  1P9D U;  2IY0 B;  1UZX B;  1H4R A;  2J0M A;  4ICU A;  2MRP A;  3APF A;  3TO1 A;  3NY5 A;  1MK9 B;  1WE7 A;  2GJY A;  2UVM A;  3HIZ A;  2FNJ B;  4JKA A;  3X23 A;  5J3Q A;  5FR6 A;  2KJH B;  4PYU A;  4TKN A;  3UIP B;  3S2A A;  5LOP B;  3QK0 A;  2MP2 A;  4MEL A;  3KZ1 A;  2VKI A;  4JLC A;  4IC7 B;  4HLE A;  3F0W A;  4PQ0 A;  3ML9 A;  3LJ3 A;  2YS5 A;  1MG8 A;  5DPS A;  1E8W A;  4WWO A;  5JH5 C;  1D3Z A;  3E9P A;  5CHF A;  2EJ8 A;  2MKR A;  3T8M A;  1WXA A;  4WWN A;  2DHI A;  2DX5 A;  5D3W A;  4URK A;  3BIN A;  1V5P A;  4ICV A;  2MDX A;  2D11 A;  2CS4 A;  2UYZ B;  2K6Q A;  4BKS D;  3M1I B;  2DZM A;  1DRO A;  3B0A A;  1YX5 B;  2EMT A;  4MGZ E;  4GSW A;  2WYQ A;  2FCS A;  4I6L B;  1LB1 A;  5DI9 B;  3DPD A;  4HHV A;  2MP2 B;  3R7R A;  1U5F A;  1P1A A;  4GDK A;  3RCP A;  3PGE A;  3A98 B;  2PE9 A;  5JHA A;  4YON A;  4Z2N A;  1WVH A;  1KZG A;  2DYN A;  2ZVO A;  4GDL A;  3WAO A;  1A5R A;  3O96 A;  4KDL B;  3TBL D;  4DDI D;  2COD A;  3VOQ A;  3ULC A;  1ZC4 B;  3KRX A;  2L3Z A;  1X1G A;  2IO0 B;  1WGQ A;  1RLF A;  3B08 A;  1DDW A;  1XX0 A;  3VTV A;  2K00 A;  4XX5 A;  1SE9 A;  2BYE A;  4G0N B;  2DEN B;  2DHJ A;  3MJW A;  1ZVR A;  3FSS A;  5JHG A;  2OJR A;  4AOF A;  2BGF A;  2FIF A;  3D8E A;  1S1Q B;  1KOT A;  2V3S A;  4L6E A;  3IG3 A;  2G35 A;  2A4Z A;  2ZJD A;  3VH3 B;  1V49 A;  2K6D B;  5J3T A;  2NS5 A;  2RLO A;  3A9K A;  2MBH A;  3QJZ A;  2RQ1 A;  3O65 B;  3ALB A;  4DWF A;  1KLV A;  3CXB B;  2KVR A;  2PEA A;  2I1K A;  1CMX B;  2RUK B;  3VVW B;  4DBG A;  4IFS A;  2KDI A;  2IO1 B;  3DVN U;  1MPH A;  2CHW A;  4A3O A;  1BTN A;  4JQW C;  2YRY A;  1WR1 A;  3RT3 B;  2KKC A;  5D2M B;  3KUD B;  1WJM A;  3K9P B;  4HDQ A;  1OQY A;  4MGY E;  2MLB A;  1WGU A;  3V6E B;  4PS3 A;  2AYO B;  1V5U A;  1E5W A;  1ZSQ A;  2YSZ A;  4J6I A;  5CHW A;  2P0F A;  5CLL B;  2UWQ A;  1TQZ A;  4TV3 A;  1ST7 A;  3A9K B;  5FI1 A;  3ZNZ B;  2LVQ A;  1WI1 A;  4KDI C;  2GBR A;  3E66 A;  5C5B A;  1LW3 A;  4ILJ A;  2PPH A;  2GBJ A;  3EEC A;  3M63 B;  1WM2 A;  4DHJ B;  1FOE A;  3DBR I;  4PS8 A;  2ZZP B;  1GG3 A;  3B1L X;  3GYO A;  2M14 A;  4CHJ A;  4JKC A;  1WX7 A;  2M38 A;  4C0A A;  1WXS A;  4WJO A;  2KHW B;  4MGK E;  4K81 A;  4BKG A;  4F1S A;  1LFD A;  3DBL I;  3HM6 X;  4BVU C;  3WA0 A;  2L0F A;  3SU8 X;  4W9E A;  4G50 A;  3A33 B;  1G6J A;  1IRS A;  3PRM B;  4IOY X;  4JKG A;  3ZNH B;  1V6E A;  4RM8 A;  2KLC A;  2LOX A;  2D9Y A;  2DX1 A;  3VFK A;  3SO6 A;  3D32 A;  4WJN A;  2ELA A;  5C5B B;  4JIO U;  2ZEQ A;  2MBQ A;  3PEG A;  4EMO A;  4A6H A;  2ASQ A;  2M17 A;  4EUT A;  1DBH A;  1XQQ A;  2DYQ A;  2Z0P A;  2OOB B;  4W9L A;  4Z2M B;  3MHS D;  2WWZ A;  4PNK A;  2NBW B;  3PVU A;  4MSM B;  3PV1 A;  3UIN B;  3G9W A;  3KH0 A;  3P7Z A;  3SV1 A;  3KRW A;  1NI2 A;  3V5W A;  4AJW A;  4FJV B;  3ODX A;  1LM8 B;  1WY8 A;  2KX3 A;  2IZV B;  2QKM A;  2ROV A;  3PRE A;  4IG7 B;  1GNU A;  4JKG B;  3AU5 A;  2LI5 A;  5J17 A;  4JKF A;  1YQB A;  2V1Y A;  1L2N A;  5G55 A;  4EOY A;  1BWN A;  4W9I A;  4EZL A;  2KN5 A;  2QHO A;  3CF6 E;  1Z2M A;  1WH3 A;  5EFX A;  1J8C A;  4FJY A;  3W1Y A;  4HAV B;  4AJY B;  2Y8F A;  2CU1 A;  4DXA B;  2RSG A;  3OJ4 B;  2Z0Q A;  3NOB A;  2KO3 A;  4KIK A;  4LJO B;  2NZ8 B;  3AU4 A;  1FHX A;  3E9L A;  4JKB A;  2BYF A;  3SHQ A;  4MSQ B;  1U5D A;  4KVG B;  3OAN A;  1UNP A;  4Y94 A;  1V9J A;  1M7R A;  4BBN C;  1V2Y A;  2C9W B;  2J0J A;  5DPR A;  3ZO5 B;  4NPN A;  3RUI B;  2WX0 A;  1XR0 B;  3T06 A;  1WX8 A;  1NTI A;  4A5K A;  4HAW B;  3ZVR A;  2X0S A;  4IUM B;  4BBN F;  1QZE A;  3WAP A;  2PE6 B;  3FP5 A;  5HE3 A;  2CB8 A;  1X1F A;  2LWP A;  2XBB C;  5DIF B;  1X86 A;  3PS6 A;  2N0Y A;  2LD9 A;  4GU2 A;  3QWZ B;  4KIK B;  1M7E A;  1F9J A;  1Z87 A;  3PPA A;  4YL8 A;  3V60 A;  2Q13 A;  4MDK E;  3I3T B;  2YT0 A;  4GOC A;  4MM3 A;  2RGN B;  2GMI C;  2Z59 B;  1P6S A;  2UZS A;  4IWP A;  1AQC A;  1XOD A;  2L05 A;  2MCN B;  4IM3 A;  3V62 A;  3L0W B;  3MDB C;  3IFW B;  1WM3 A;  4HAU B;  1Y8R C;  3UIO B;  2LAS A;  1WJ1 A;  1LXD A;  2BPS A;  4RMA A;  1XD3 B;  2RVB B;  4E71 A;  2M0X A;  3TJP A;  3ZRF A;  3ZVV A;  3QC8 B;  1UNQ A;  4WJ7 A;  2BYV E;  3C0R B;  5HE1 A;  2CHZ A;  2COP A;  2CY5 A;  2KJR A;  2FAZ A;  4IAP A;  5JP4 A;  2L76 A;  1WGD A;  3PHW B;  4DHZ B;  2AL3 A;  2L2I A;  3WAN A;  4KSL C;  2DN6 A;  4ZRI A;  3RYT A;  1H8C A;  2KWV B;  2K1F A;  1J19 A;  2K25 A;  5D3V A;  3HQC A;  1E7U A;  2O2V A;  2DYM A;  3KUC B;  2LZ6 A;  3R66 C;  3EC8 A;  4HAX B;  2BCJ A;  3LDZ E;  1WJU A;  3ODO A;  5C79 A;  5E6N A;  2CKH B;  2IY1 B;  2R2O A;  4NAW A;  2D9V A;  1WFY A;  4DHZ E;  2GOW A;  4AUQ C;  4WVF B;  1K8R B;  1X11 A;  4MGI E;  5IJM A;  2J7Q B;  1NU2 A;  1NDD A;  3UGB B;  2DYO A;  2W2W A;  2JUO A;  3P2B A;  3CSF A;  2KX0 A;  4CHM A;  1JRU A;  1IPG A;  4BKS A;  3IBE A;  3TVV A;  3QQ8 B;  1DIK A;  2JZZ A;  1IP9 A;  2X18 A;  4JKE A;  2LUE A;  1YIW A;  4KZC A;  2JVC A;  2O2V B;  4HAZ B;  4KHO A;  2DHZ A;  2I1J A;  3ULB A;  2DKP A;  3KUZ A;  1UEF A;  4D0N B;  2KUP A;  4NAW B;  1MIZ B;  2KQS A;  3UZT A;  1WZ0 A;  2LYD A;  3DDC B;  3KY9 A;  1VD2 A;  2GBN A;  1RAX A;  3NZU A;  4K2O A;  4MT7 A;  1SIF A;  5C16 A;  2BWE S;  3H6N A;  3GZN I;  2KOX A;  3ML4 A;  5HKH A;  2XEW A;  2NVU I;  4HWI B;  1VBG A;  2RD0 A;  3TL5 A;  4EKU A;  2IBI B;  2HD5 B;  2Y7B A;  1TZ1 A;  3VXW A;  4PYZ A;  1EUV B;  1PMS A;  1V88 A;  4IWO A;  5IA7 A;  3ECI A;  3UQA A;  4WJQ A;  1FAO A;  5JLJ B;  3QWM A;  3AI5 A;  1OGW A;  3N32 A;  5E6P A;  4WWP A;  3A4R A;  4CHK A;  5CHV C;  1ISN A;  2P0H A;  4TQ1 A;  4KSK C;  4LCD E;  4ASW C;  4MK0 A;  4B6W A;  3EPY A;  4BFR A;  4TQ0 A;  5KQ1 A;  2DZK A;  1EO6 A;  3WYF B;  3JSV A;  4JL9 A;  4EZJ A;  3AUL A;  2D2Q A;  2LVP A;  4A20 A;  2FJ9 A;  1BTK A;  5LLI A;  5LON B;  1U5G A;  3L17 A;  2N7E A;  4II3 B;  3QX1 A;  1E8X A;  4IW0 A;  2LGX A;  3QAR A;  3ENB A;  2MSE D;  3QIJ A;  2ZPY A;  4W9D A;  3PZD A;  1WI0 A;  4HDO A;  3GOE A;  1EAZ A;  2EC1 A;  3PRZ A;  3KVF B;  4HB3 B;  3ZTD A;  3R7Q A;  2ZCC A;  2L0T A;  4G3X B;  1VBH A;  1PQS A;  2N23 A;  4XZ4 A;  2HJ8 A;  2NBU A;  3PHX B;  4K7U A;  2YVC A;  3ZUN A;  5JZE B;  3JSV B;  1WF9 A;  4GPT B;  2W2X C;  4GMX B;  4G11 A;  4DBB A;  3A9J A;  1RJ2 A;  2KC2 A;  5AZG A;  2JRH A;  3QBV B;  2DLW A;  3OJ3 A;  2M1M A;  5CLQ B;  2A5U A;  1P3Q U;  2C60 A;  1ZW7 A;  4AP4 C;  2RNR B;  4FJZ A;  1MIX A;  1GJZ A;  1FB8 A;  1XKE A;  4W9F A;  4MY6 A;  4FA6 A;  1TXD A;  2FCM A;  2P8V A;  3VTW A;  2W2X D;  3LJU X;  1UH6 A;  4NSW A;  1NTV A;  3ZNG C;  3SBG A;  3VQI A;  2D07 B;  2AEH A;  1UNR A;  2LRU A;  4K1R B;  2NMB A;  2NPT A;  4ANU A;  2ZPN A;  1V5T A;  1P98 A;  5IAA C;  4FN2 A;  4WJP A;  3TFM A;  1SGH A;  2KTR A;  3FEH A;  3DBS A;  2YS3 A;  4HJK A;  2K8C A;  4KV2 A;  4N9F 4;  2PJH A;  3PP2 A;  2PZ1 A;  2G45 B;  2ZCB A;  3A9J B;  2N4F A;  4K2P A;  1RFA A;  2ABD A;  3APD A;  2D4Q A;  4HK2 A;  5D27 A;  4WAA A;  5EDS A;  2KWC A;  1WJN A;  1KZ7 A;  3UQB A;  4NQK E;  5JHH A;  1UGM A;  2Y5B B;  4NY0 A;  4FUL A;  2D9X A;  1UPQ A;  1R4N I;  1Q0W B;  3A8P A;  3H9D A;  1UBI A;  2B3A A;  5AEK B;  3PRP B;  1X1M A;  2JRI B;  4JGH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...