3ZDTA

Crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
368
structure length
326
Chain Sequence
ERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYKKSNYEVLEKDVGLRRFFPKSLLDSVAAATLAALIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPDYAEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 89
structure length 326
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3zdtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3zdtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdtA01
2VSZA 2VRRB 3MTNB 3KH0A 4DDGD 3UIOB 2VKIA 2NBVB 3A1QA 4NQKE 3PEGA 4KHAA 3PVUA 2M14A 4EZJA 4A5KA 1GNUA 5E6OA 2IZVB 3A33B 4IG7B 3U30A 2KFKB 3RCZA 2I5FA 2BYVE 3TIXA 3R7RA 4DK5A 2BWES 3PREA 4EUTA 5G2NA 4DHZE 3AI5A 3T9LA 3RUIB 1OMWA 3OAWA 4WJ7A 1Y19B 5JH5C 2KX0A 3PP2A 3DVNU 3PS6A 5EDSA 2L1CA 3ZNZB 2JY6A 1VD2A 4XZ4A 2MQJA 3SO6A 2K8CA 1EO6A 1GC6A 3M62B 4BFRA 2KOXA 2KWUB 4GMVA 4PYUA 3ZNID 2K8BA 3PVLA 1I35A 3P6AA 4GB9A 2HRJA 4IM3A 4IC7B 1D3ZA 4KAXB 1H8CA 3RCPA 3OANA 2KN5A 2G3QB 4MM3A 3IVFA 2B3AA 3SHQA 1UGMA 5JLJB 4RM8A 1YX6B 1LW3A 1C3TA 5C5BB 2D4QA 1PQSA 3NSUA 4XC2A 4KVGB 5JZEB 4GIVA 2YS1A 2LASA 2CODA 4A6FB 2KKCA 5D2MB 4G11A 3ZDMC 5J18A 5IAAC 4HCPB 4OVVA 5L83A 5HE2A 1UBIA 4AJYB 4NY0A 2RUKB 2IY1B 2LJ5A 1Q0WB 2LGYA 2EJ8A 2FCQA 4HAUB 2O2VA 2YT1A 2CY5A 3HHMA 4URKA 2COFA 1FHWA 2K1FA 3CXBB 3N32A 1WH3A 2JF5A 1K8RB 2ASQA 5GMVA 3VH3B 3L08A 1WF9A 5DCNA 2EKEC 4HXDA 3IFWB 4GXBA 3H6NA 4G3XB 3P7ZA 5FI0A 1WR6E 3BINA 2UZSA 4HB3B 1WJNA 2N7DA 2V1YA 4YONA 2YRYA 2YVCA 2ZCBA 1RJ2A 2J0JA 1VCBA 4IAPA 3C0RB 3KYDD 2P0HA 3PSEB 3IBEA 3W1SA 2LGXA 1W1HA 4K7WA 3B1LX 5D94A 4ZRIA 3SUZA 1UNRA 3HIZA 4GSWA 1X1GA 1OTRB 3PHXB 2DHJA 3D8EA 4K2PA 4B6WA 2G4SA 2DX5B 1BTKA 1UNPA 3ZUNA 3EFUA 1SIFA 4HB2B 2DENB 2AL3A 4NAWA 1J19A 2KVRA 3KVFB 3AJ4A 5IJMA 1WJ1A 2M38A 1DBHA 4GMXB 3DDCB 3H1UA 3O65B 4WWOA 2ZCCA 3DXCA 3T8MA 3SD5A 4HLEA 2HTHA 2DZMA 2KZRA 2MBEA 4FHJA 5AZGA 3ZDTA 4NSWA 4FADA 4GPTB 2KLGA 2FIFA 3KW5B 2KDIA 5IA7A 4C0AA 4XWXA 2C60A 2DZKA 1V6EA 2V76A 4WJNA 2P0DA 5J3TA 4TKNA 4RMAA 2CHWA 2JP2A 2L76A 3RD2A 3PZDA 5HKHA 3ML8A 3X0WA 2JT4B 5CHWA 3QC8B 2CQUA 3QWZB 3JSVA 1Z87A 4F8CB 1UPRA 3WA0A 5DPSA 3TFMA 4MK0A 5LXHA 1QQGA 3ZVRA 2MDXA 3MJWA 5DHAB 3JVZX 2CB8A 1P9DU 1KZGA 4IW0A 2KDFB 2LKOA 1LQBA 3QIJA 3A8PA 1GG3A 3L17A 1E8YA 1UELA 2Z0DB 3EHVA 1OQNA 1P1AA 2MFQA 4KZ0A 4E74A 1MIXA 4HAZB 2ZPYA 3CIKA 2GBJA 3KYCD 4IFSA 3GYPA 4TYZA 1WMHB 3QA8A 3M3JA 1V9JA 3HM6X 3SYXA 1V5MA 1X1MA 3GZNI 3OLMD 3UQBA 1OY2A 3MHSD 3ZO5B 4MJSB 2JRHA 3PRZA 4HAYB 3B0AA 4NNJB 1MPHA 1PLSA 2K6DB 2BGFA 2C7NB 2G35A 5HE3A 1LXDA 1NVLA 5DI9B 2YSZA 4KSLC 2LI5A 5HE0A 4A6FA 1P3RA 4ICVA 3LJ3A 4EFOA 1HB8A 4HHVA 4HJKA 2O6VA 2CHXA 2A4ZA 2KK8A 5L81A 4AJWA 3L0WB 4DWFA 4L6EA 3UIPB 3DVGY 4NJ7A 3M95A 1WI1A 3N30A 4W9LA 3DBLI 2BKRB 2WX0A 3NZSA 2K6QA 2LD9A 2IO3B 3Q3FA 3A8QA 4DHJD 3RT3B 2UWQA 2JZ3B 5CLLB 4F7UP 5J17A 4GDLA 1LM8B 3DQVA 3M63B 1J0WA 2RD0A 3KUCB 2LZ6A 2COAA 4FHKA 2ZNVB 5AZHA 4KHOA 2RNRB 2NMBA 2BPSA 2JUOA 3CSTA 2WH5A 2GCJA 1WXMA 1TTNA 1IPGA 3WANA 2KFJA 4PS3A 1N3HA 4IM0A 1PMSA 4A6HA 3DBRI 1ACAA 2BKFA 4MGKE 4LDTD 3D8DA 2BCJA 2WYQA 2LUEA 2KD0A 1OGWA 1WXVA 4HWIB 1IP9A 3P2BA 4DHZB 5KQ1A 4ANXA 5HE1A 3ODWA 2D9YA 2LXAA 5EFXA 1OEYJ 3PPAA 1FOEA 4K2OA 2KJHB 3TBLD 2DN6A 1UPQA 2MSED 2DHIA 2DYNA 5C1ZA 3EPYA 2HD5B 2N0YA 1G6JA 1Y8RC 5JHBA 5FI1A 3H9DA 1DYNA 2AWTA 4NJ6A 2CRFA 4IWOA 4MT7A 2I1JA 3R66C 4EMOA 4LCDE 3TL5A 4PQ0A 1EVHA 4YL8A 3ZRCA 2RGNB 1U29A 1WX9A 1QZEA 3CMMB 1WX8A 1WRDB 3H7SA 5D27A 3N7CA 2KTRA 2LRUA 2ZZPB 1YJ1A 3EC8A 4HAVB 1WJ6A 3KRWA 2Y5BB 4DHJB 2N9EB 3T06A 2K8HA 1FB8A 3A9JB 5CHFA 1BT0A 1HBKA 3IG3A 3TO1A 4WWPA 3DCGA 4PYZA 3MPXA 2LBBA 4ZRKA 3ENEA 4W9FA 4K7UA 4W9CA 4LJPB 2DYBA 1K5GB 1KI1B 1ISNA 4K1RB 2DYOA 3DBSA 5DPTA 3FLVA 4W9IA 4AWJA 4CHJA 1RRBA 3NZUA 4EZLA 2DHKA 2UVMA 3VFKA 4II3B 1MG8A 4M8MA 2D9ZA 1J0GA 2KJRA 3QX1A 4WSFA 1WX7A 1WJ4A 5LXIB 1V49A 3ZNGC 3VVWB 3F0WA 3RZFA 2L0TA 2ABDA 2ZVOA 1GUAB 1WYWB 2ROZB 2FCNA 2NS5A 2YS3A 4EKUA 4GDKB 5L95C 2D07B 4AOFA 4MJSA 2Z59B 2C7HA 3NHEB 3VHTC 2QKLA 3WALA 1OEYA 4OVUA 3APDA 2WWZA 3PLUA 3SU8X 4MDKE 2LVQA 4JLCA 3QWMA 3ZTCA 3RYTA 1GC7A 3L10B 2XK5A 1YIWA 2MBBB 2R0DA 1ST7A 2NR2A 2RQ1A 1NTYA 3ULCA 1L7YA 3KUDB 1FHOA 4CHKA 2PE9A 1V80A 3CF6E 2J59M 1XCGA 3AU4A 1EF5A 2D9VA 2CR5A 3DVNV 3VTVA 2ROVA 3Q3JA 1WGUA 4ICUA 1WVHA 2H7DA 2ZNVC 4I6PA 1IYFA 2QKMA 3OJ4B 2MBHA 4HATB 1BWNA 1X86A 4ASWC 3TJPA 5AZFA 3VXWA 1NU2A 1TJ6A 4JIOU 1HB6A 3I3TB 1X11A 4TUUA 1W1GA 3K9PB 1KZ7A 1RRPB 4HAXB 3ZLZA 2YF0A 2LVOA 2DX1A 3ODOA 3PT2B 4BVUC 3BJIA 1M94A 2OTXA 4KIKA 2IBIB 1WZ3A 4FULA 4FJYA 1IRSA 3H7PA 3NY5A 2HJ8A 2GJYA 2N9XA 3TW1A 2RVBB 2YS5A 1SGHA 3SDLC 4EJNA 2JRIB 3PSCA 1NTVA 2W2XC 1DROA 2R09A 3VUWA 1UD7A 4HPMB 4Z2NA 2DZIA 1MK9B 1WY8A 1WE7A 2KNBA 2AL6A 3ZVVA 2YLMA 4WJQA 1I42A 3V61A 4HDOA 2UZRA 3FP5A 1EGXA 2JXXA 5FR6A 1PFJA 3VUXA 1P98A 4WJPA 2D10A 2DYQA 4LJOB 5JHGA 3UGBB 1U27A 3SNHA 2DA0A 5DIFB 2K39A 3L54A 3PGEA 2C5LC 2KFKA 3DOWA 2H7EA 1MAIA 1UNQA 5CTRC 4I6LB 2XBBC 2MBQA 1QC6A 2PPHA 1H10A 3KSYA 4D0NB 4WJOA 1WZ0A 1ZW7A 1FAOA 1E7UA 3PHWB 4BOSC 3V6EB 1XKEA 2KJ6A 2RPQA 2KMAA 2HE7A 3QHTA 4HB4B 4WVFB 4B6HA 2K2JA 3VOQA 1Z2MA 2N7EA 2NPTB 3TMPB 2N4FA 4NQLB 5C23A 1WI0A 2MLBA 2FJ9A 2LWPA 5C5BA 4BBNC 4FLHA 2RSGA 2NZ8B 2DFKA 5JHHA 1E8ZA 2KTFA 3ZNHB 5D3XA 2M17A 2NCNA 1WJMA 2I5CA 4DDID 1MK7B 1OQYA 1MIZB 4ANWA 1Z5SB 4HAWB 3PLVA 2D11A 2KANA 1WGHA 2FNJB 3HK0A 2CS4A 1ZKHA 3FEHA 3K9OB 2LRWA 1FXTB 1P6SA 3FSSA 2LVPA 2M4NA 2K25A 1Q5WB 1XD3B 3HM3A 1XT9B 5TR5A 1E7VA 2MW5A 3PV1A 3V6CB 4DX8A 4ZYNA 4BBNF 3DPDA 2FJLA 4TQ1A 2Z0EB 3L16A 2OQBA 4K17A 2ELBA 3VAWA 3WAOA 4HDQA 1WG7A 2DKPA 4DX90 4DXAB 1TXDA 1WR1A 4FA6A 1XQQA 2C7MB 1EF1A 2P8VA 5C16A 3M1IB 3IHPC 5CLQB 3HQCA 4MSQB 4PS7A 1SHCA 4GU2A 5JHAA 1NBFC 2RLOA 1S1QB 4W9GA 1YX5B 1E90A 4H8SA 1C1YB 1W1DA 4ZRJA 3A4SC 4CHMA 4RM9A 2KDEB 4JL9A 5LLIA 3DXDA 5DPRA 4E71A 1Q1OA 2EMTA 1UEFA 2J0KA 1XD4A 2HTHB 4II2B 4MH0E 3ALBA 4F7GA 1LB1A 3MDBC 1WGRA 2O6VD 1FGYA 1BTNA 2V4LA 3RULA 2DX5A 1FGZA 1V5UA 2KX3A 1I2HA 3DVGX 3A9KB 1NI2A 4N9F4 2X18A 3OJ3A 3UINB 2N1WA 2DYMA 2Z0PA 2KO3A 2RGFA 4HVBA 3D32A 2GBNA 2D9XA 4GZUA 3ZKJC 4W9KA 5KHOA 2KMCA 4DBGA 1U5GA 3QK0A 2ADZA 2M8SA 2J0MA 4KZCA 5KQ4A 2MA9B 5E6PA 1UBQA 3JSVB 2DLWA 4P7IA 4EOYA 4HK2A 3NOBA 1ZC4B 2L8JA 1V61A 2IFSA 3ML4A 1GJZA 1V89A 5KCVA 2WDTB 4A3OA 3QJZA 2W2WA 2WX1A 3KRXA 2P0FA 3WAMA 2DAFA 4B95A 1P3QU 4JGHB 2G4DB 4HB0B 2ELAA 1F9JA 4Z2MB 2BWFA 1WXSA 2MWSB 3B08A 5BO4B 4IM2A 2L0FA 4MY6A 2LULA 2FIDA 4LDTB 3W1YA 1DDMA 2MP2B 3L13A 1KM7A 5D6JB 3VDZA 1ZSQA 2IO0B 4WWNA 2MWNB 2MBOA 2D2QA 1KJTA 1RFAA 3S2AA 1YQBA 1L2NA 5GOWB 2CY4A 1J8CA 3WAPA 2DHZA 2LOXA 3PTFC 1WE6A 2O6VB 1AARA 3PRMB 1M7RA 2CAYA 1WMHA 3TVVA 1TQZA 1EUVB 3QAQA 4F1SA 1R4MI 1E8XA 2L3ZA 4W9DA 3SV1A 2UYZB 1B55A 3EECA 2NPTA 2COCA 3KY9A 2RSUA 2XEWA 1BAKA 1Y5OA 3RZWC 1I7AA 3O96A 3APFA 2BF8B 2QHOA 5J3YA 4W9JA 1WJUA 2J7QB 5D3YA 2NVUI 3R3MA 2AEHA 3BY4B 1WXAA 4EZKA 2MKRA 3JYUA 2NBUA 4GDLB 3X23A 4AUQC 3VTWA 1FHXA 1U5FA 2GCLA 2CU1A 2KLCA 1WIAA 4KHBB 2EC1A 4MGIE 5J2RA 3GYOA 4K7SA 5C79A 2ZVNA 3LDZE 1V81A 1S3SG 2R2QA 2IYBA 2GBKA 2ZPNA 1V2YA 1KOTA 2IO2B 3UF8A 1WGQA 1SE9A 2KQ7A 3W1SC 2CHZA 1AWEA 2M0XA 2OOBB 2LOZA 3U8ZA 4M8NA 2E2XA 4NPNA 2MRPA 5C6RA 4A20A 3GOEA 1P0RA 2FCSA 4HPLB 4W9HA 4BKSA 1U5EA 2FDQA 2I1KA 1XR0B 2N23A 2Y8GA 4ANVA 3NS8A 3U7DA 2KC2A 2Z0QA 2KCJA 4A6KA 1V5PA 1A5RA 2Y8FA 3A1QB 2AYOB 3VIAA 4J6IA 3PG7A 2IYDB 4MEMA 2FUHB 1CMXB 2DZJA 4AP4C 2D9WA 5CHVC 1KLVA 2LXCA 2RR9A 1LFDA 2GOWA 2KTRB 1U4AA 2KWVB 4HCNB 2GBRA 3UQAA 2Y7BA 4IUMB 1WFYA 4GN1A 3AU5A 5D3WA 1EAZA 4M0WB 3QBVB 1TBEA 3DBHI 3A9KA 3ML9A 2R2OA 2Q13A 5DH9B 2PE6B 4PNKA 5LOPB 3A98B 1ZGUB 2GBMA 1UH6A 3WYFB 3G9WA 2K00A 2CKHB 4CYEA 3PRPB 1RAXA 5G55A 4FBJB 3AXCA 2NBWB 5D7GA 5D3VA 3QARA 2W9NA 4K81A 3LJUX 1V86A 1UZXB 2GMIC 4Y94A 2EMSA 4G50A 5DPWA 3CSFA 5CX3A 2LGDA 1HE8A 2OJRA 4KSKC 4W9EA 2KWCA 2LYDA 1JRUA 2L2IA 3A9JA 4GOCA 4BKSD 3V5WA 2DKQA 1TZ1A 3TCAA 2V3SA 4MELA 4IWPA 2FAZA 1YD8U 2REXA 2K2UA 5JP4A 4B9KA 2VRWB 1XODA 4FJVB 2PZ1A 3F5RA 5KHQA 5LONB 3ZTDA 1Q67A 1X1FA 3ZW3A 1X05A 1WGGA 1V88A 2O2VB 2YT0A 1RLFA 5E6NA 2D3GA 1M7EA 4IWQA 2MP2A 1XX0A 2M1MA 2N1VA 4MGYE 3PVWA 3VQIA 3AULA 2DTCA 2KDBA 3D8FA 2C9WB 2W2XD 4FJZA 2IY0B 4DBBA 2XK5B 3V60A 2A5UA 3HW2B 2FCMA 5DHFB 3ECIA 3WIMA 4ANUA 3KUZA 2LG1A 3N3KB 4X57B 4GDKA 2KXJA 4I6NB 3KZ1A 2ZJDA 4MSMB 3V62A 2JZZA 2KQSA 2XQNM 1WGYA 3UZTA 4IOYX 1MKEA 2Z0OA 2BYEA 4F7HA 3R7QA 1DDVA 1K5DB 4WQOB 2JPHA 1E5WA 4PS8A 2L00B 2ZEQA 4EEWA 4MGZE 4BKGA 4BBKA 3VH4B 1E8WA 4KDLB 4TQ0A 5AEKB 1WM2A 4A3PA 4FN2A 2L7RA 4CO7A 1NTIA 4BKTA 2MX2A 1DDWA 5J3QA 2DAJA 1T0YA 1U2BA 4NAWB 1ZC3B 3ZRFA 3VUYA 2KGXB 3APCA 4XX5A 4GGQA 4JQWC 4WAAA 3FM8C 1V5OA 1U5DA 1R4NI 2MCNB 4KIKB 1ZM0A 4KDIC 2JWZA 2KC1A 2COPA 4G0NB 1H4RA 1WGDA 3H7PB 3QQ8B 4F7ZA 4E3CA 1WM3A 1P5TA 3ULBA 3QCAA 2BYFA 2IO1B 2G45B 1TGZB 3JW0X 2PEAA 3ONSA 3VTUA 1AQCA 2GS0A 2N9PC 4TV3A 2JVCA 2KUPA 4KV2A 2KHWB 1NDDA 3DXEA 4BOZB 4ZDVA 1ZVRA 2PJHA 3ODXA 2L05A 1V5TA 3ZIMA 3A4RA
chains in the Genus database with same CATH superfamily
2VSZA 2VRRB 3MTNB 4N59A 3KH0A 4DDGD 3UIOB 2VKIA 2NBVB 3A1QA 4NQKE 3PEGA 4KHAA 3PVUA 2M14A 4EZJA 4A5KA 1GNUA 2M56B 5E6OA 2NTSA 2IZVB 1SJED 3A33B 1R4MB 4IG7B 5AUKA 3U30A 2KFKB 1QOAA 3RCZA 2I5FA 2BYVE 2WXHA 3TIXA 3R7RA 4DK5A 1MFWA 2WDVB 2L1AA 2BWES 3GE3C 3PREA 4EUTA 5G2NA 4DHZE 3AI5A 1RFKA 1DGJA 2WXIA 4NJCA 3T9LA 3RUIB 1OMWA 3OAWA 4M0WA 4WJ7A 1Y19B 4BZAA 2KX0A 1R7SA 5JH5C 3PP2A 3DVNU 3AE3B 3PS6A 2L1CA 4O1NA 2WHIA 3ZNZB 5EDSA 4RNAA 2WXJA 2JY6A 1VD2A 4XZ4A 2MQJA 3SO6A 2K8CA 2JX5A 1EO6A 5IO9A 1GC6A 4JKBA 3M62B 4BFRA 1FMAD 3SR6A 2KOXA 2KWUB 2INNE 2WLBA 4GMVA 4RFBA 4PYUA 3ZNID 1FNWA 1F2RI 2K8BA 2GLSA 3PVLA 1I35A 3P6AA 4WWMA 4GB9A 2HRJA 1CQVA 4IM3A 1CZPA 4IC7B 1D3ZA 4KAXB 4YWGG 1H8CA 3RCPA 3OANA 2KN5A 2G3QB 1YNTE 4MM3A 5EE0A 1QQRA 3IVFA 2WXNA 5LNK1 4ZRQA 2GB1A 1UWMA 2X38A 1VZ8A 2B3AA 2WXMA 3SHQA 1UGMA 5BYQA 1N60A 5JLJB 5BMIA 4RM8A 1YX6B 1IGDA 4OSNA 1LW3A 1C3TA 4PT5A 5C5BB 2D4QA 1PQSA 3NSUA 2V3NA 4XC2A 4KVGB 5JZEB 4GIVA 2YS1A 2LASA 5JXVA 2CODA 1JALA 1GPXA 3NVYA 4A6FB 2KKCA 1AW7A 4QXAB 3RNAC 5D2MB 2X0SA 4G11A 3ZDMC 3C8YA 5J18A 5IAAC 3E9OA 2CU3A 4HCPB 4OVVA 5L83A 5HE2A 1UBIA 3ABVB 4AJYB 4NY0A 5HG2A 2RUKB 2ZW1A 2IY1B 1F1HA 2LJ5A 4KGSA 1CJEA 1Q0WB 2LGYA 3J9CA 2EJ8A 2FCQA 4HAUB 2D3BA 2O2VA 1GGOA 3FILA 4R3DA 1KLUD 4XYCA 2YT1A 2CY5A 3KQ4A 3HHMA 1D5XC 4URKA 2COFA 1FHWA 1RYJA 2K1FA 3CXBB 3N32A 3W5VB 4B0MA 1WH3A 2JF5A 2ZKMX 1K8RB 2ASQA 3BYTB 5GMVA 3VH3B 2KYWA 3L08A 1WF9A 5DCNA 1I4GA 1PFDA 2JU6X 5D3DA 2EKEC 4HXDA 2GRIA 3BK2A 3IFWB 1YQ3B 4JPSA 2SEBD 4GXBA 1UNSA 3H6NA 4G3XB 2R2YA 3P7ZA 5FI0A 1WR6E 3BINA 2UZSA 4HB3B 3DBHB 3FVCA 1WJNA 2N7DA 2V1YA 4YONA 2YRYA 4ILHA 1ACCA 2YVCA 2ZCBA 1RJ2A 2J0JA 4RCOA 1VCBA 4IAPA 1WSPA 2KMMA 2PMVA 4PK1A 1MHXA 4JKFA 1PGAA 3CIRB 3C0RB 3KYDD 2P0HA 4A6QA 3PSEB 3IBEA 3W1SA 1FCLA 2LGXA 1W1HA 4K7WA 3B1LX 3R2IA 5D94A 4LNOA 2V9HA 4KKJA 4ZRIA 1ZDVA 3SUZA 1UNRA 4ZOHC 3HIZA 4GSWA 4WIPA 1X1GA 1OTRB 2QEJC 3PHXB 2DHJA 3P4PB 1SSNA 3D8EA 4K2PA 4B6WA 2G4SA 1E7PB 2DX5B 1BTKA 1UNPA 3ZUNA 3EFUA 1MPEA 1SIFA 2K22A 2RDBC 4HB2B 2N9KA 2DENB 2AL3A 4C7ZA 1FPYA 3I57A 4NAWA 1V97A 1J19A 3P63A 4LNKA 2KVRA 3KVFB 3AJ4A 1VDVA 5IJMA 3PZ8A 1WJ1A 2M38A 1DBHA 4GMXB 3DDCB 3H1UA 3NWAA 3O65B 4WWOA 1ZYIA 2WU5B 2ZCCA 3DXCA 1ROEA 3T8MA 2I2YA 2NTTA 3SD5A 4HLEA 2HTHA 4C4VB 1N61A 2DZMA 3B77A 3FKYA 2KZRA 2SAKA 2MBEA 4FHJA 1T5XD 5AZGA 3ZDTA 5C2TB 4NSWA 4MH8A 1HTQA 3AE1B 4GPTB 2FBWB 2KLGA 4FADA 2FIFA 1N6ZA 3SFDB 3KW5B 4HSIA 3C19A 2KDIA 1D5ZC 5IA7A 4C0AA 4AS1A 4ARIA 4XWXA 2C60A 4CSQA 2DZKA 1V6EA 2V76A 3BVZA 2P0DA 5J3TA 4WJNA 5D3IB 4YT0B 1DOYA 4TKNA 4RMAA 1QF6A 2CHWA 2JP2A 2L76A 3RD2A 3PZDA 5HKHA 3DHGC 3ML8A 3Q3NC 3X0WA 1F0ZA 4JE3B 2JT4B 3DHHC 5CHWA 3QC8B 2CQUA 5EE9A 2KVZA 3QWZB 3JSVA 1Z87A 1ZDXA 4F8CB 1UPRA 3WA0A 1TZOA 5DPSA 3TFMA 1XXGA 4MK0A 2VH1A 5LXHA 1QQGA 3ZVRA 2MDXA 2WXLA 2QCZA 4C80A 3MJWA 5DHAB 3JVZX 2CB8A 1P9DU 1KZGA 1V1PB 4IW0A 2KDFB 3EGRA 2LKOA 1LQBA 3QIJA 2H88B 3R8BA 3A8PA 3BWUD 1GG3A 3L17A 5MPOA 1E8YA 5M4YB 1UELA 2Z0DB 1PDXA 3EHVA 3N9YC 4WURA 3NVWA 4L23A 2M0AA 1OQNA 1P1AA 2MFQA 4KZ0A 4E74A 1MIXA 4HAZB 2ZPYA 3CIKA 2GBJA 3KYCD 4IFSA 3GYPA 4TYZA 1DYQA 4DXGA 3VR9B 4YSXB 1WMHB 3QA8A 1EU3A 3M3JA 1V9JA 3HM6X 1HZ6A 3SYXA 1V5MA 1X1MA 3GZNI 3OLMD 3UQBA 4N58A 3AEGB 1OY2A 3DCXA 3MHSD 3ZO5B 4MJSB 4JK7A 2JRHA 3AEBB 4YTMB 5I2MA 3LB8C 3PRZA 4HAYB 3W5UB 3B0AA 4NNJB 1MPHA 1PLSA 2K6DB 2WGSA 2BGFA 1R4NB 2C7NB 1SE3A 2G35A 5HE3A 1LXDA 1NVLA 5DI9B 4A55A 2YSZA 4KSLC 2ZW0A 2LI5A 5HE0A 4A6FA 1P3RA 4ICVA 1YJIA 3LJ3A 4EFOA 3Q8CA 1HB8A 4HHVA 2J42A 1ZXIA 2O6VA 4HJKA 2CHXA 2A4ZA 2KK8A 5L81A 2W3SA 4AJWA 3L0WB 1M4VA 4DWFA 4L6EA 2HTME 3UIPB 3DVGY 4NJ7A 4HKZE 3ZXVA 5IRSA 4ZYSA 3M95A 1WI1A 3N30A 1TT5B 2BT6A 4W9LA 3DBLI 2BKRB 1LGRA 2LHDA 3NRZA 2WX0A 4L1RA 3NZSA 2K6QA 2LD9A 2IO3B 4JKCA 4NZLB 3HUIA 3Q3FA 3A8QA 4DHJD 2EKIA 2Z14A 2IGHA 3RT3B 2UWQA 2XN9C 2J4XA 2JZ3B 2VH2A 5CLLB 3AE5B 4F7UP 3AE9B 5J17A 4GDLA 4HPPA 1LM8B 2LHEA 2DBYA 3DQVA 3M63B 3ZYYX 1HEZE 3RNEC 1J0WA 1TS2A 2V0GA 3AE2B 2RD0A 1K52A 3KUCB 2LZ6A 2RMMA 2COAA 4FHKA 1E6EB 2BBCA 2ZNVB 5AZHA 4KHOA 2RNRB 2NMBA 1VR9A 2BPSA 1I4XA 2JUOA 3CSTA 2WH5A 1MI1A 2GCJA 2KQ4X 5EE3A 1WXMA 5FKAC 1TTNA 3ZQ4A 1IPGA 2JZPA 3WANA 2KFJA 3TEZA 2QSDA 4PS3A 1N3HA 2Y3AA 4IM0A 1UUPA 1PMSA 4A6HA 3DBRI 3R2TA 1ACAA 1FIQA 2INDC 4OVZA 2BKFA 4MGKE 4LDTD 3D8DA 1AYFA 2BCJA 2WYQA 1EU4A 2LUEA 2KD0A 4P16A 3T3OA 2BB6A 1OGWA 1WXVA 4HWIB 1IP9A 3P2BA 4DHZB 4JKHA 5KQ1A 4ANXA 5HE1A 3ODWA 1SF0A 1F52A 2D9YA 4BAXA 2LXAA 5EFXA 1FRDA 4JX1C 1OEYJ 3PPAA 3MJ5A 1JROA 1FOEA 4K2OA 2KJHB 3TBLD 2DN6A 2Z13A 1UPQA 2MSED 2DHIA 2DYNA 1L0YB 2L52A 2YT2A 5C1ZA 3EPYA 2ON8A 2HD5B 1ESFA 2N0YA 1BMLC 1G6JA 1Y8RC 5JHBA 1K50A 5FI1A 3N1XC 3H9DA 1K53A 1XF5L 1DYNA 3KLSX 2AWTA 3NUHB 2LFIA 4NJ6A 2CRFA 4IWOA 4MT7A 2I1JA 1C4AA 3R66C 2V3PA 4EMOA 1LO5D 4L2YA 4XE0A 4LCDE 3TL5A 4PQ0A 1EVHA 4WH4A 4YL8A 3ZRCA 2RGNB 1XCQL 1U29A 3ZJTA 1WX9A 1QZEA 3CMMB 1WX8A 1WRDB 3H7SA 5D27A 1N5WA 1QOFA 3N7CA 2KTRA 2LRUA 2ZZPB 3GS2A 1E0ZA 4A9AA 1UWXA 4XDCA 3AN1A 1YJ1A 3EC8A 4HAVB 4LLGM 1WJ6A 3KRWA 3NJTA 2Y5BB 1NENB 4HRSA 4DHJB 2N9EB 2E3TA 3T06A 5AUIA 3EFCA 2K8HA 2WU2B 1JMLA 1FB8A 4LK0M 3A9JB 5CHFA 1BT0A 1WYGA 1HBKA 4JK9A 3IG3A 4K3CA 3V3XA 2BYTA 3Q14C 3TO1A 3TEWA 4WWPA 1PGXA 3DCGA 4PYZA 3MPXA 2QC8A 5C3JB 2LBBA 4ZRKA 3ENEA 1CK1A 4W9FA 4K7UA 2WDQB 4W9CA 4LJPB 1WWTA 2DYBA 1K5GB 2JYEA 3Q2AC 1KI1B 1ISNA 4K1RB 4C56C 2DYOA 3DBSA 5DPTA 3FLVA 4W9IA 4AWJA 4CHJA 1RRBA 1KLGD 2ONQA 2D3CA 3IT6B 3NZUA 4EZLA 1QOGA 2DHKA 2UVMA 1MVKA 4XGAB 3VFKA 4RGTA 4II3B 2KR0A 1MG8A 4M8MA 2KDMA 4US9A 2D9ZA 3U12A 2WS3B 2J52A 4OT1A 1J0GA 2KJRA 3QX1A 4WSFA 4MACA 2BB5A 2OJWA 1ENFA 1WX7A 1HQRD 1WJ4A 5LXIB 1V49A 4L1BA 3AECB 3ZNGC 4KGTA 3VVWB 3F0WA 2BVCA 3RZFA 1NYRA 2ABDA 2L0TA 2ZVOA 1YJJA 1GUAB 1WYWB 3DWGC 4QJ4B 4ARCA 1QLBB 2ROZB 2FCNA 2NS5A 2YS3A 4EKUA 3OWEB 4GDKB 5L95C 1I7HA 1C9FA 2D07B 4AOFA 4MJSA 1NI3A 2Z59B 1JWMD 2C7HA 3NHEB 2DIKA 2YEPB 3AB5A 3VHTC 1MG4A 2QKLA 3WALA 1OEYA 2VZKD 2BQQA 4OVUA 3APDA 2WWZA 3PLUA 3SU8X 4MDKE 2LVQA 4JKGA 4JLCA 1FM0D 1VJKA 3QWMA 2WXPA 3ZTCA 3RYTA 1GC7A 3L10B 1B1ZA 2XK5A 4OZCA 1YIWA 1DIKA 2MBBB 3IAM1 2PKOA 2R0DA 1AWDA 1ST7A 3DWMA 3Q8BA 4C00A 2MJEA 3H8HA 2NR2A 1XLOA 2RQ1A 1NTYA 3LXFA 3ULCA 4TMAB 1L7YA 3KUDB 1FHOA 4CHKA 1PUTA 1C76A 2PE9A 1V80A 4NAMA 3CF6E 4AQ7A 1T0RC 4WAFA 2J59M 2ACZB 1C4PA 2G1EA 1XCGA 4LNFA 3AU4A 1SXTA 1EF5A 2D9VA 1T0SC 2KIEA 2CR5A 3DVNV 2Z4DA 3VTVA 2ROVA 3Q3JA 1WGUA 3HVDA 2D3AA 3SBTA 1WVHA 4ICUA 2H7DA 2ZNVC 4I6PA 1IYFA 2QKMA 3OJ4B 2MBHA 1VZ6A 4LNNA 4HATB 2CJNA 1BWNA 1X86A 4ASWC 4RF1A 3TJPA 5BMHA 2IJ0A 5AZFA 1NU2A 3VXWA 1TJ6A 4JIOU 2RDGA 3Q6BA 2EELA 4M00A 1HB6A 1KF6B 3I3TB 4P6VF 1X11A 2JSVX 4TUUA 2FUG1 1W1GA 3K9PB 1KZ7A 3ETRA 1RRPB 4HAXB 1ET9A 3RPFC 3ZLZA 2YF0A 3Q8EA 2LVOA 2DX1A 3OHMB 3ODOA 3PT2B 4BVUC 3BJIA 1PGBA 4UDUC 1M94A 2OTXA 1F2RC 4KIKA 3W9CB 2FE8A 1EM7A 2IBIB 4US8A 1WZ3A 1C79A 3P4RB 3E9PA 4FULA 4FJYA 3E66A 5LG4B 1IRSA 3H7PA 1SBBB 3NY5A 4M02A 2HJ8A 4QAYA 1EWCA 2WNMA 2GJYA 2N9XA 1L0XB 3Q69A 1JWAD 3KWVA 2L32A 3TW1A 1N5XA 2RVBB 3T3NA 2WXFA 2YS5A 1SGHA 3SDLC 4EJNA 3Q3MC 3GZNB 2JRIB 3PSCA 1NTVA 3AMZA 2W2XC 1JWUD 5HFYA 1DROA 3AE4B 2R09A 2KACA 3VUWA 1I4HA 1UD7A 4HPMB 4Z2NA 2DZIA 2WXOA 1MK9B 1WY8A 1WE7A 2KNBA 2AL6A 3ZVVA 2YLMA 4WJQA 1I42A 3V61A 4HDOA 2UZRA 3FP5A 1EGXA 3E9LA 1T3QA 2LEKA 2JXXA 2PLPA 3AE6B 5FR6A 2KUQA 2INCC 1PFJA 3VUXA 1P98A 4WJPA 1K51A 4JWUC 2KT7A 1JDEA 2D10A 1T77A 1SIJA 5FK9C 2DYQA 2NBVA 3GP7A 3P1MA 4LJOB 1RM6C 5IOIA 5JHGA 3WCQA 1STEA 1TY2A 3UGBB 1FO4A 2WXRA 1KH0A 1U27A 3SNHA 3NW8A 2DA0A 5DIFB 2K39A 3L54A 3AEAB 3PGEA 2C5LC 2KFKA 1VBGA 3DOWA 1VZ7A 3BVMA 2H7EA 3BYYB 1MAIA 1UNQA 5CTRC 4I6LB 2XBBC 3DBLB 2MBQA 1QC6A 2PPHA 1H10A 3NVVA 2N7JA 3KSYA 4D0NB 2PVOD 4WJOA 1WZ0A 1ZW7A 1SEBD 1TKEA 1FAOA 1VRAB 1GB4A 1E7UA 3E56A 1Q10A 3PHWB 1RWSA 4S0RA 4BOSC 3DHIC 3V6EB 1XKEA 1YMHE 4Q2JA 2KJ6A 2RPQA 1PYWD 2KMAA 2HE7A 5JVLA 3QHTA 4HB4B 4WVFB 1HXYD 1FCCC 5BYRA 4B6HA 1TIFA 1SJHD 2K2JA 4RGNA 2K49A 3URYA 4KKIA 3VOQA 1Z2MA 2N7EA 2NPTB 3TMPB 2H89B 4P1CC 3U4EG 2N4FA 4NQLB 5C23A 1WI0A 2MLBA 3SEBA 2BTEA 2FJ9A 5IN7A 3DBRB 2LWPA 5C5BA 4BBNC 2Y5PA 4FLHA 2RSGA 2NZ8B 1TKGA 2DFKA 3SFEB 2MEKA 5JHHA 1E8ZA 2KTFA 3ZNHB 5D3XA 1L4DB 1SE4A 2M17A 2NCNA 1WJMA 2I5CA 4N6EB 1V1OA 4DDID 1MK7B 3VRBB 1OQYA 2NMQA 3FAHA 1MIZB 4ANWA 1EWYC 4HROA 1Z5SB 2UU7A 4HEA1 4HAWB 3PLVA 2BS4B 2E6XA 2D11A 2KANA 1WGHA 5G5HA 2LUMA 2FNJB 2K0PA 3HK0A 2CS4A 2HDEA 3BK1A 4KGRA 2R61A 2K5PA 3AH7A 1T6BX 1ZKHA 4TSSA 1A70A 3FEHA 5BYSA 3SBGA 3K9OB 3U2SC 3LYYA 2LRWA 1KTKA 1FXTB 1P6SA 1OFFA 3FSSA 3MFGA 3I9V1 3OG5A 2W55A 2LVPA 2M4NA 2K25A 1Q5WB 1XD3B 3HM3A 1XT9B 5TR5A 3I5JC 1E7VA 2MW5A 1WRIA 3P4SB 3PV1A 3AE8B 3V6CB 1JW9D 2JYTA 1KC7A 3MC0B 4A8XC 2W82A 4DX8A 2BW2A 4ZYNA 4BBNF 3DPDA 4RH6A 2FJLA 4TQ1A 2Z0EB 3L16A 2OQBA 4K17A 2ELBA 3VAWA 3WAOA 4HDQA 1BUIC 1WG7A 2DKPA 4DX90 4OZBA 3NWFA 4DXAB 1TXDA 1WR1A 4FA6A 1QOBA 1XQQA 1OQQA 2C7MB 1EF1A 1DOIA 4ZHOA 2P8VA 5C16A 3IT4B 3M1IB 3ZGZA 3IHPC 2WDRB 1C4CA 3P4QB 5H8YE 2K9XA 5CLQB 3HQCA 4M01A 4DQOC 4MSQB 4PS7A 1SHCA 4GU2A 5JHAA 1NBFC 1UF0A 2CJOA 2RLOA 1BXTA 1DOXA 3FC4A 1S1QB 2YEPF 1FRRA 1YX5B 4W9GA 2QDFA 1E90A 1V8CA 1D4BA 4H8SA 1C1YB 1W1DA 4ZRJA 2DWQA 3A4SC 4CHMA 4RM9A 2KDEB 4JL9A 4JKDA 2J53A 5LLIA 3DXDA 5DPRA 4E71A 1Q1OA 2EMTA 1UEFA 2J0KA 3UI3A 3GB1A 1IBXB 1XD4A 2HTHB 4II2B 4MH0E 1YQ4B 2Z8LA 3ALBA 3ZXRA 4QJ5B 1F77A 1FNVA 3B9JA 4F7GA 5BMGA 1LB1A 3MDBC 1WGRA 2O6VD 1FGYA 2INPE 1BTNA 3I63C 2V4LA 3RULA 4GOUA 2DX5A 1HZ5A 1FGZA 1V5UA 2KX3A 1I2HA 3DVGX 3A9KB 1NI2A 4N9F4 4QJ3B 2X18A 3U7ZA 3OJ3A 3UINB 2N1WA 3ENBA 2DYMA 3GE8C 2Z0PA 2KO3A 2RGFA 4HVBA 2ICIA 3MC9A 3D32A 2GBNA 2BS2B 2N0SB 2D9XA 4GZUA 2PIAA 3ZKJC 4W9KA 5KHOA 3P42A 1QT9A 2KMCA 4DBGA 2WXKA 1U5GA 3QK0A 2ADZA 2M8SA 2J0MA 4KZCA 1UGJA 2RPVA 1SB3C 5KQ4A 4C4VA 1J7CA 2MA9B 4LTUA 5E6PA 1UBQA 3JSVB 1GOZA 2DLWA 4P7IA 4EOYA 1D5MC 4HK2A 1SE2A 3NOBA 1ZC4B 2L8JA 2KAJA 1AN8A 1V61A 1FXAA 2IFSA 3ML4A 1GJZA 1V89A 2WXGA 5KCVA 2TSSA 1YN4A 2WDTB 1IGCA 4A3OA 3QJZA 4P1BC 2W2WA 4A90A 3L4PA 2XNAC 2WX1A 4OHJA 3KRXA 2P0FA 4OW0A 2Q5WD 4FXCA 5IKCM 3WAMA 2DAFA 5T8IA 5I2SA 4B95A 4ZRPA 1P3QU 2K3UA 1YOVB 3V05A 1TKYA 4JGHB 2G4DB 2N9LA 4HB0B 2ELAA 2GI9A 1F9JA 4Z2MB 3A58A 2BWFA 2W3RA 1WXSA 1GB1A 2MWSB 3B08A 5BO4B 3RI7C 4IM2A 2L0FA 1C77A 4MY6A 2LULA 2FIDA 1WGKA 4LDTB 3W1YA 1KBLA 2M19A 1DDMA 2L83A 2MP2B 3L13A 4ILJA 1KM7A 1V1PA 5D6JB 1IUEA 3VDZA 1ZSQA 2DLBA 2IO0B 1JRPA 4WWNA 1C78A 1ZXHA 1JWBD 2MWNB 1T0QC 1ZE3D 2MBOA 2D2QA 2HJ1A 1KJTA 1RFAA 3S2AA 1TYGB 1YQBA 5IP4D 1L2NA 5GOWB 2CY4A 1J8CA 3WAPA 2DHZA 3BVGA 1GAQB 3Q8FA 2GUMA 2LOXA 3PTFC 1WE6A 4S17A 4EE2A 1XLNA 2O6VB 1AARA 3PRMB 3Q8AA 3B2FA 3HSAA 1M7RA 2CAYA 1WMHA 3TVVA 1TQZA 1EUVB 3QAQA 4F1SA 1R4MI 1VBHA 1E8XA 1XO3A 2L3ZA 4W9DA 2AQ1B 3SV1A 3VRAB 2UYZB 1FFUA 3AM9A 1B55A 3BIID 2NPTA 3EECA 2COCA 3CWIA 3KY9A 2RSUA 2IDYA 2XEWA 1BAKA 1Y5OA 3RZWC 1I7AA 3O96A 3N20C 3APFA 2BF8B 2QIEB 3AEDB 2QHOA 5J3YA 4KX6B 4W9JA 1WJUA 2J7QB 5D3YA 1Y56A 2NVUI 3R3MA 2AEHA 3BY4B 5FR3A 1WXAA 1ZUD2 4EZKA 2MKRA 3JYUA 2NBUA 4GDLB 1E9MA 3X23A 1L5PA 4AUQC 3VTWA 1FHXA 1U5FA 4LNIA 2GCLA 2CU1A 2KLCA 1WIAA 2V4IB 4KHBB 2EC1A 4MGIE 5J2RA 2IPKD 1NYQA 3GYOA 2RDHA 2JXTA 5C79A 4K7SA 2ZVNA 3LDZE 1V81A 5I4DA 1S3SG 2R2QA 3Q3OC 3MP9A 4WQMA 2IYBA 1MJDA 2GBKA 2ZPNA 2Y5CA 4C7YA 1V2YA 2MJ3A 3VR8B 1I4QA 1KOTA 2IO2B 2KWDA 3UF8A 1WGQA 1SE9A 5EE1A 2KQ7A 4YTNB 4YSYB 3W1SC 1D6EC 4XDDA 2CHZA 1AWEA 2K8EA 1TS3A 2M0XA 2OOBB 2W54A 1TS4A 2LOZA 1NVID 1JWSD 3TEYA 2MH7A 3U8ZA 1YN5A 4M8NA 3NS1A 2E2XA 4XWWA 1ZOYB 4J3OD 4NPNA 1L0VB 3U52E 2MRPA 2PVGC 5C6RA 2LMCA 4A20A 3GOEA 3EA6A 1FXIA 1XLPA 1P0RA 3HVZA 2FCSA 3N1ZC 1TS5A 4HPLB 4W9HA 4BKSA 1U5EA 4JWSC 2FDQA 2I1KA 3RMKC 1XR0B 2N23A 2Y8GA 2DNFA 4ANVA 3NS8A 3U7DA 2KC2A 2Z0QA 3N1YC 4JKEA 2QILA 3PZ7A 4DXFA 2JWUA 1FD6A 4HKQA 3AE7B 2LJIA 2KCJA 4A6KA 2R82A 3BZDB 1MHHE 1V5PA 1A5RA 2Y8FA 3A1QB 2AYOB 3VIAA 4J6IA 1J7BA 4CQNA 2D5GA 3PG7A 2IYDB 4GLSC 4MEMA 2FUHB 1CMXB 2DZJA 4OZAA 4IDIA 4AP4C 2D9WA 5CHVC 1KLVA 2LXCA 2RR9A 1KFYB 1LFDA 2GOWA 3TUOA 1IBXA 1FEHA 2KTRB 1U4AA 2LGIA 2KWVB 4HCNB 2GBRA 1VLBA 3UQAA 2Y7BA 4IUMB 1WFYA 1B9RA 4GN1A 3AU5A 2VZKB 5D3WA 4YSZB 1EAZA 4M0WB 3QBVB 1TBEA 3RFZB 3DBHI 4HJGE 2OHFA 3W2DA 3A9KA 3ZJVA 2IGGA 3ML9A 2R2OA 2Q13A 2KN4A 2BS3B 5DH9B 1WXQA 3IAS1 2PE6B 4PNKA 2KIGA 5LOPB 1MI0A 3A98B 5HI1A 1ZGUB 2QJLA 2GBMA 1UH6A 4IOIE 3WYFB 3G9WA 2K00A 2CKHB 3AEEB 4CYEA 3PRPB 1RAXA 5G55A 4FBJB 3AXCA 1HA5A 2I38A 2NBWB 5D7GA 5D3VA 3QARA 2W9NA 4K81A 1P7EA 4MM3B 3LJUX 1V86A 1UZXB 2GMIC 4Y94A 4YXDB 2EMSA 1HTOA 4G50A 3O13A 2AX5A 5DPWA 3CSFA 3NVZA 5CX3A 3RNCC 2LGDA 1HE8A 2OJRA 4KSKC 4W9EA 2PW9A 3NZ3A 4D6WA 5G5GA 4D2KA 1XEEA 2KWCA 2LYDA 2RRFA 1JRUA 4RF0A 2L2IA 3A9JA 1YN3A 4GOCA 4BKSD 3V5WA 2DKQA 5H92C 1TZ1A 3TCAA 2V3SA 3AV8A 4MELA 4IWPA 2FAZA 2LGSA 3KWLA 1YD8U 2MHJA 1FNUA 2REXA 2K2UA 5JP4A 4B9KA 2VRWB 1ZP0B 1XODA 1OQRA 4B0EA 3MHZA 4FJVB 2PZ1A 3F5RA 5KHQA 5LONB 3ZTDA 1Q67A 1X1FA 2QMTA 3ZW3A 4REZA 1X05A 2G9HD 1WGGA 1V88A 2O2VB 4XWTA 2YT0A 3FILB 1P7FA 1JCKB 1RLFA 5E6NA 2D3GA 1M7EA 1L6VA 4IWQA 4RGOS 2MP2A 4MT5A 1XX0A 3TEXA 2M1MA 2N1VA 1JQ4A 4MGYE 3PVWA 3VQIA 3AULA 1N62A 2DTCA 2KDBA 3D8FA 2C9WB 1J7AA 5TSSA 1TJEA 4JKGB 2W2XD 4FJZA 2IY0B 5GXGB 4DBBA 2XK5B 4YTPB 3V60A 2A5UA 3NWDA 4GNKB 3HW2B 2FCMA 4K3BA 3NG0A 3HRDD 2AQ2B 1N63A 3ZJUA 5DHFB 3ECIA 3WIMA 3AEFB 2IGDA 4ANUA 3KUZA 2LG1A 3N3KB 4X57B 4GDKA 2AQ3B 2KXJA 2WQYB 4I6NB 3RNBC 2Z59A 1I4PA 2WP9B 3KZ1A 2ZJDA 4MSMB 2JQRB 3V62A 2JZZA 2KQSA 2OEDA 2XQNM 1XCTL 4ITKA 1L4ZB 3PO0A 1WGYA 3UZTA 3EUB2 4IOYX 1MKEA 2Z0OA 2BYEA 5HHDG 1XLQA 3RNFC 2FJUB 4F7HA 3R7QA 1DDVA 1K5DB 4WQOB 4JK8A 2JPHA 1E5WA 4PS8A 3RN9C 1TY0A 2L00B 2ZEQA 4EEWA 3RNGC 4MGZE 4BKGA 3B2GA 4BBKA 4ILGB 3VH4B 4H2AA 1E8WA 4KDLB 4KHBA 2WXQA 4TQ0A 5AEKB 4ACFA 1WM2A 3MC8A 4A3PA 4FN2A 2L7RA 4CO7A 1NTIA 4BKTA 2MX2A 3TSSA 1QKZA 1DDWA 5J3QA 2DAJA 4ZHPA 2PTLA 1T0YA 3IXSA 1U2BA 4NAWB 1ZC3B 3ZRFA 4IKGA 3VUYA 2KGXB 3APCA 4XX5A 4GGQA 4JQWC 4WAAA 4USAA 3E9SA 3FM8C 4RGMA 1V5OA 1U5DA 1R4NI 2MCNB 1KRHA 4KIKB 1ZM0A 4KDIC 2JWZA 2KC1A 2COPA 4G0NB 1L6UA 1H4RA 1WGDA 4DIXA 1ET6A 3H7PB 1E10A 3QQ8B 2MJDA 4F7ZA 4E3CA 1WM3A 1P5TA 1FFVA 3ULBA 4JKAA 1NEKB 3QCAA 2BYFA 2IO1B 2X8XX 2G45B 1I4RA 1TGZB 3JW0X 2PEAA 3ONSA 3VTUA 1QILA 1AQCA 5E6JA 2GS0A 2N9PC 2JVCA 4KV2A 2KUPA 4TV3A 2KHWB 1NDDA 3DXEA 4BOZB 4ZDVA 2B76B 1ZVRA 1ZPSA 2PJHA 3ODXA 2L05A 3HIEA 1V5TA 3ZIMA 3A4RA
chains in the Genus database with same CATH topology
2VSZA 2VRRB 3MTNB 3KH0A 4DDGD 3UIOB 2VKIA 2NBVB 3A1QA 4NQKE 3PEGA 4KHAA 3PVUA 2M14A 4EZJA 4A5KA 1GNUA 5E6OA 2IZVB 3A33B 4IG7B 3U30A 2KFKB 3RCZA 2I5FA 2BYVE 3TIXA 3R7RA 4DK5A 2BWES 3PREA 4EUTA 5G2NA 4DHZE 3AI5A 3T9LA 3RUIB 1OMWA 3OAWA 4WJ7A 1Y19B 5JH5C 2KX0A 3PP2A 3DVNU 3PS6A 5EDSA 2L1CA 3ZNZB 2JY6A 1VD2A 4XZ4A 2MQJA 3SO6A 2K8CA 1EO6A 1GC6A 4JKBA 3M62B 4BFRA 2KOXA 2KWUB 4GMVA 4PYUA 3ZNID 2K8BA 3PVLA 1I35A 3P6AA 4GB9A 2HRJA 4IM3A 4IC7B 1D3ZA 4KAXB 1H8CA 3RCPA 3OANA 2KN5A 2G3QB 4MM3A 3IVFA 2B3AA 3SHQA 1UGMA 5JLJB 4RM8A 1YX6B 1LW3A 1C3TA 5C5BB 2D4QA 1PQSA 3NSUA 4XC2A 4KVGB 5JZEB 4GIVA 2YS1A 2LASA 2CODA 4A6FB 2KKCA 5D2MB 2X0SA 4G11A 3ZDMC 5J18A 5IAAC 3E9OA 4HCPB 4OVVA 5L83A 5HE2A 1UBIA 4AJYB 4NY0A 2RUKB 2IY1B 2LJ5A 1Q0WB 2LGYA 2EJ8A 2FCQA 4HAUB 2O2VA 1GGOA 2YT1A 2CY5A 3HHMA 4URKA 2COFA 1FHWA 2K1FA 3CXBB 3N32A 1WH3A 2JF5A 1K8RB 2ASQA 5GMVA 3VH3B 3L08A 1WF9A 5DCNA 2EKEC 4HXDA 3IFWB 4GXBA 3H6NA 4G3XB 3P7ZA 5FI0A 1WR6E 3BINA 2UZSA 4HB3B 1WJNA 2N7DA 2V1YA 4YONA 2YRYA 4ILHA 2YVCA 2ZCBA 1RJ2A 2J0JA 1VCBA 4IAPA 4JKFA 3C0RB 3KYDD 2P0HA 3PSEB 3IBEA 3W1SA 2LGXA 1W1HA 4K7WA 3B1LX 5D94A 4ZRIA 3SUZA 1UNRA 3HIZA 4GSWA 1X1GA 1OTRB 3PHXB 2DHJA 3D8EA 4K2PA 4B6WA 2G4SA 2DX5B 1BTKA 1UNPA 3ZUNA 3EFUA 1SIFA 4HB2B 2DENB 2AL3A 4NAWA 1J19A 2KVRA 3KVFB 3AJ4A 5IJMA 1WJ1A 2M38A 1DBHA 4GMXB 3DDCB 3H1UA 3O65B 4WWOA 2ZCCA 3DXCA 3T8MA 3SD5A 4HLEA 2HTHA 2DZMA 2KZRA 2MBEA 4FHJA 5AZGA 3ZDTA 4NSWA 4FADA 4GPTB 2KLGA 2FIFA 3KW5B 2KDIA 5IA7A 4C0AA 4XWXA 2C60A 2DZKA 1V6EA 2V76A 4WJNA 2P0DA 5J3TA 4TKNA 4RMAA 2CHWA 2JP2A 2L76A 3RD2A 3PZDA 5HKHA 3ML8A 3X0WA 2JT4B 5CHWA 3QC8B 2CQUA 3QWZB 3JSVA 1Z87A 4F8CB 1UPRA 3WA0A 5DPSA 3TFMA 4MK0A 5LXHA 1QQGA 3ZVRA 2MDXA 3MJWA 5DHAB 3JVZX 2CB8A 1P9DU 1KZGA 4IW0A 2KDFB 2LKOA 1LQBA 3QIJA 3A8PA 1GG3A 3L17A 1E8YA 1UELA 2Z0DB 3EHVA 1OQNA 1P1AA 2MFQA 4KZ0A 4E74A 1MIXA 4HAZB 2ZPYA 3CIKA 2GBJA 3KYCD 4IFSA 3GYPA 4TYZA 1WMHB 3QA8A 3M3JA 1V9JA 3HM6X 3SYXA 1V5MA 1X1MA 3GZNI 3OLMD 3UQBA 1OY2A 3MHSD 3ZO5B 4MJSB 4JK7A 2JRHA 3PRZA 4HAYB 3B0AA 4NNJB 1MPHA 1PLSA 2K6DB 2BGFA 2C7NB 2G35A 5HE3A 1LXDA 1NVLA 5DI9B 2YSZA 4KSLC 2LI5A 5HE0A 4A6FA 1P3RA 4ICVA 3LJ3A 4EFOA 1HB8A 4HHVA 4HJKA 2O6VA 2CHXA 2A4ZA 2KK8A 5L81A 4AJWA 3L0WB 4DWFA 4L6EA 3UIPB 3DVGY 4NJ7A 3M95A 1WI1A 3N30A 4W9LA 3DBLI 2BKRB 2WX0A 3NZSA 2K6QA 2LD9A 2IO3B 4JKCA 3Q3FA 3A8QA 4DHJD 3RT3B 2UWQA 2JZ3B 5CLLB 4F7UP 5J17A 4GDLA 1LM8B 3DQVA 3M63B 1J0WA 2RD0A 3KUCB 2LZ6A 2COAA 4FHKA 2ZNVB 5AZHA 4KHOA 2RNRB 2NMBA 2BPSA 2JUOA 3CSTA 2WH5A 2GCJA 1WXMA 1TTNA 1IPGA 3WANA 2KFJA 4PS3A 1N3HA 4IM0A 1PMSA 4A6HA 3DBRI 1ACAA 2BKFA 4MGKE 4LDTD 3D8DA 2BCJA 2WYQA 2LUEA 2KD0A 1OGWA 1WXVA 4HWIB 1IP9A 3P2BA 4DHZB 4JKHA 5KQ1A 4ANXA 5HE1A 3ODWA 2D9YA 2LXAA 5EFXA 1OEYJ 3PPAA 1FOEA 4K2OA 2KJHB 3TBLD 2DN6A 1UPQA 2MSED 2DHIA 2DYNA 5C1ZA 3EPYA 2HD5B 2N0YA 1G6JA 1Y8RC 5JHBA 5FI1A 3H9DA 1DYNA 2AWTA 4NJ6A 2CRFA 4IWOA 4MT7A 2I1JA 3R66C 4EMOA 4LCDE 3TL5A 4PQ0A 1EVHA 4YL8A 3ZRCA 2RGNB 1U29A 1WX9A 1QZEA 3CMMB 1WX8A 1WRDB 3H7SA 5D27A 3N7CA 2KTRA 2LRUA 2ZZPB 1YJ1A 3EC8A 4HAVB 1WJ6A 3KRWA 2Y5BB 4DHJB 2N9EB 3T06A 2K8HA 1FB8A 3A9JB 5CHFA 1BT0A 1HBKA 4JK9A 3IG3A 3TO1A 4WWPA 3DCGA 4PYZA 3MPXA 2LBBA 4ZRKA 3ENEA 4W9FA 4K7UA 4W9CA 4LJPB 2DYBA 1K5GB 1KI1B 1ISNA 4K1RB 2DYOA 3DBSA 5DPTA 3FLVA 4W9IA 4AWJA 4CHJA 1RRBA 3NZUA 4EZLA 2DHKA 2UVMA 3VFKA 4II3B 1MG8A 4M8MA 2D9ZA 1J0GA 2KJRA 3QX1A 4WSFA 1WX7A 1WJ4A 5LXIB 1V49A 3ZNGC 3VVWB 3F0WA 3RZFA 2L0TA 2ABDA 2ZVOA 1GUAB 1WYWB 2ROZB 2FCNA 2NS5A 2YS3A 4EKUA 4GDKB 5L95C 2D07B 4AOFA 4MJSA 2Z59B 2C7HA 3NHEB 2DIKA 3VHTC 2QKLA 3WALA 1OEYA 4OVUA 3APDA 2WWZA 3PLUA 3SU8X 4MDKE 2LVQA 4JKGA 4JLCA 3QWMA 3ZTCA 3RYTA 1GC7A 3L10B 2XK5A 1YIWA 1DIKA 2MBBB 2R0DA 1ST7A 2NR2A 2RQ1A 1NTYA 3ULCA 1L7YA 3KUDB 1FHOA 4CHKA 2PE9A 1V80A 3CF6E 2J59M 1XCGA 3AU4A 1EF5A 2D9VA 2CR5A 3DVNV 3VTVA 2ROVA 3Q3JA 1WGUA 3SBTA 4ICUA 1WVHA 2H7DA 2ZNVC 4I6PA 1IYFA 2QKMA 3OJ4B 2MBHA 4HATB 1BWNA 1X86A 4ASWC 3TJPA 5AZFA 1NU2A 3VXWA 1TJ6A 4JIOU 1HB6A 3I3TB 1X11A 4TUUA 1W1GA 3K9PB 1KZ7A 1RRPB 4HAXB 3ZLZA 2YF0A 2LVOA 2DX1A 3ODOA 3PT2B 4BVUC 3BJIA 1M94A 2OTXA 4KIKA 2IBIB 1WZ3A 4FULA 3E9PA 4FJYA 3E66A 1IRSA 3H7PA 3NY5A 2HJ8A 2GJYA 2N9XA 3TW1A 2RVBB 2YS5A 1SGHA 3SDLC 4EJNA 2JRIB 3PSCA 1NTVA 2W2XC 1DROA 2R09A 3VUWA 1UD7A 4HPMB 4Z2NA 2DZIA 1MK9B 1WY8A 1WE7A 2KNBA 2AL6A 3ZVVA 2YLMA 4WJQA 1I42A 3V61A 4HDOA 2UZRA 3FP5A 1EGXA 3E9LA 2JXXA 5FR6A 1PFJA 3VUXA 1P98A 4WJPA 1JDEA 2D10A 2DYQA 4LJOB 5JHGA 3UGBB 1U27A 3SNHA 2DA0A 5DIFB 2K39A 3L54A 3PGEA 2C5LC 2KFKA 1VBGA 3DOWA 2H7EA 1MAIA 1UNQA 5CTRC 4I6LB 2XBBC 2MBQA 1QC6A 2PPHA 1H10A 3KSYA 4D0NB 4WJOA 1WZ0A 1ZW7A 1FAOA 1E7UA 3PHWB 4BOSC 3V6EB 1XKEA 2KJ6A 2RPQA 2KMAA 2HE7A 5JVLA 3QHTA 4HB4B 4WVFB 4B6HA 2K2JA 3VOQA 1Z2MA 2N7EA 2NPTB 3TMPB 2N4FA 4NQLB 5C23A 1WI0A 2MLBA 2FJ9A 2LWPA 5C5BA 4BBNC 4FLHA 2RSGA 2NZ8B 2DFKA 5JHHA 1E8ZA 2KTFA 3ZNHB 5D3XA 2M17A 2NCNA 1WJMA 2I5CA 4DDID 1MK7B 1OQYA 1MIZB 4ANWA 1Z5SB 4HAWB 3PLVA 2D11A 2KANA 1WGHA 2FNJB 3HK0A 2CS4A 1ZKHA 3FEHA 3SBGA 3K9OB 2LRWA 1FXTB 1P6SA 3FSSA 2LVPA 2M4NA 2K25A 1Q5WB 1XD3B 3HM3A 1XT9B 5TR5A 1E7VA 2MW5A 3PV1A 3V6CB 1KC7A 4DX8A 4ZYNA 4BBNF 3DPDA 2FJLA 4TQ1A 2Z0EB 3L16A 2OQBA 4K17A 2ELBA 3VAWA 3WAOA 4HDQA 1WG7A 2DKPA 4DX90 4DXAB 1TXDA 1WR1A 4FA6A 1XQQA 2C7MB 1EF1A 2P8VA 5C16A 3M1IB 3IHPC 5CLQB 3HQCA 4MSQB 4PS7A 1SHCA 4GU2A 5JHAA 1NBFC 2RLOA 1S1QB 4W9GA 1YX5B 1E90A 4H8SA 1C1YB 1W1DA 4ZRJA 3A4SC 4CHMA 4RM9A 2KDEB 4JL9A 4JKDA 5LLIA 3DXDA 5DPRA 4E71A 1Q1OA 2EMTA 1UEFA 2J0KA 1XD4A 2HTHB 4II2B 4MH0E 3ALBA 4F7GA 1LB1A 3MDBC 1WGRA 2O6VD 1FGYA 1BTNA 2V4LA 3RULA 2DX5A 1FGZA 1V5UA 2KX3A 1I2HA 3DVGX 3A9KB 1NI2A 4N9F4 2X18A 3OJ3A 3UINB 2N1WA 3ENBA 2DYMA 2Z0PA 2KO3A 2RGFA 4HVBA 3D32A 2GBNA 2D9XA 4GZUA 3ZKJC 4W9KA 5KHOA 2KMCA 4DBGA 1U5GA 3QK0A 2ADZA 2M8SA 2J0MA 4KZCA 5KQ4A 2MA9B 5E6PA 1UBQA 3JSVB 2DLWA 4P7IA 4EOYA 4HK2A 3NOBA 1ZC4B 2L8JA 1V61A 2IFSA 3ML4A 1GJZA 1V89A 5KCVA 2WDTB 4A3OA 3QJZA 2W2WA 2WX1A 3KRXA 2P0FA 3WAMA 2DAFA 4B95A 1P3QU 4JGHB 2G4DB 4HB0B 2ELAA 1F9JA 4Z2MB 2BWFA 1WXSA 2MWSB 3B08A 5BO4B 4IM2A 2L0FA 4MY6A 2LULA 2FIDA 4LDTB 3W1YA 1KBLA 1DDMA 2MP2B 3L13A 4ILJA 1KM7A 5D6JB 3VDZA 1ZSQA 2IO0B 4WWNA 2MWNB 2MBOA 2D2QA 1KJTA 1RFAA 3S2AA 1YQBA 1L2NA 5GOWB 2CY4A 1J8CA 3WAPA 2DHZA 2LOXA 3PTFC 1WE6A 2O6VB 1AARA 3PRMB 1M7RA 2CAYA 1WMHA 3TVVA 1TQZA 1EUVB 3QAQA 4F1SA 1R4MI 1VBHA 1E8XA 2L3ZA 4W9DA 3SV1A 2UYZB 1B55A 3EECA 2NPTA 2COCA 3KY9A 2RSUA 2XEWA 1BAKA 1Y5OA 3RZWC 1I7AA 3O96A 3APFA 2BF8B 2QHOA 5J3YA 4W9JA 1WJUA 2J7QB 5D3YA 2NVUI 3R3MA 2AEHA 3BY4B 1WXAA 4EZKA 2MKRA 3JYUA 2NBUA 4GDLB 3X23A 4AUQC 3VTWA 1FHXA 1U5FA 2GCLA 2CU1A 2KLCA 1WIAA 4KHBB 2EC1A 4MGIE 5J2RA 3GYOA 4K7SA 5C79A 2ZVNA 3LDZE 1V81A 1S3SG 2R2QA 2IYBA 2GBKA 2ZPNA 1V2YA 1KOTA 2IO2B 3UF8A 1WGQA 1SE9A 2KQ7A 3W1SC 2CHZA 1AWEA 2M0XA 2OOBB 2LOZA 3U8ZA 4M8NA 2E2XA 4NPNA 2MRPA 5C6RA 4A20A 3GOEA 1P0RA 2FCSA 4HPLB 4W9HA 4BKSA 1U5EA 2FDQA 2I1KA 1XR0B 2N23A 2Y8GA 4ANVA 3NS8A 3U7DA 2KC2A 2Z0QA 4JKEA 2KCJA 4A6KA 2R82A 1V5PA 1A5RA 2Y8FA 3A1QB 2AYOB 3VIAA 4J6IA 3PG7A 2IYDB 4MEMA 2FUHB 1CMXB 2DZJA 4AP4C 2D9WA 5CHVC 1KLVA 2LXCA 2RR9A 1LFDA 2GOWA 2KTRB 1U4AA 2KWVB 4HCNB 2GBRA 3UQAA 2Y7BA 4IUMB 1WFYA 4GN1A 3AU5A 5D3WA 1EAZA 4M0WB 3QBVB 1TBEA 3DBHI 3A9KA 3ML9A 2R2OA 2Q13A 5DH9B 2PE6B 4PNKA 5LOPB 3A98B 1ZGUB 2GBMA 1UH6A 3WYFB 3G9WA 2K00A 2CKHB 4CYEA 3PRPB 1RAXA 5G55A 4FBJB 3AXCA 2NBWB 5D7GA 5D3VA 3QARA 2W9NA 4K81A 3LJUX 1V86A 1UZXB 2GMIC 4Y94A 2EMSA 4G50A 5DPWA 3CSFA 5CX3A 2LGDA 1HE8A 2OJRA 4KSKC 4W9EA 2KWCA 2LYDA 1JRUA 2L2IA 3A9JA 4GOCA 4BKSD 3V5WA 2DKQA 1TZ1A 3TCAA 2V3SA 4MELA 4IWPA 2FAZA 1YD8U 2REXA 2K2UA 5JP4A 4B9KA 2VRWB 1XODA 4FJVB 2PZ1A 3F5RA 5KHQA 5LONB 3ZTDA 1Q67A 1X1FA 3ZW3A 1X05A 1WGGA 1V88A 2O2VB 2YT0A 1RLFA 5E6NA 2D3GA 1M7EA 4IWQA 2MP2A 1XX0A 2M1MA 2N1VA 4MGYE 3PVWA 3VQIA 3AULA 2DTCA 2KDBA 3D8FA 2C9WB 4JKGB 2W2XD 4FJZA 2IY0B 4DBBA 2XK5B 3V60A 2A5UA 3HW2B 2FCMA 5DHFB 3ECIA 3WIMA 4ANUA 3KUZA 2LG1A 3N3KB 4X57B 4GDKA 2KXJA 4I6NB 3KZ1A 2ZJDA 4MSMB 3V62A 2JZZA 2KQSA 2XQNM 1WGYA 3UZTA 4IOYX 1MKEA 2Z0OA 2BYEA 4F7HA 3R7QA 1DDVA 1K5DB 4WQOB 4JK8A 2JPHA 1E5WA 4PS8A 2L00B 2ZEQA 4EEWA 4MGZE 4BKGA 4BBKA 4ILGB 3VH4B 1E8WA 4KDLB 4TQ0A 5AEKB 1WM2A 4A3PA 4FN2A 2L7RA 4CO7A 1NTIA 4BKTA 2MX2A 1DDWA 5J3QA 2DAJA 1T0YA 1U2BA 4NAWB 1ZC3B 3ZRFA 3VUYA 2KGXB 3APCA 4XX5A 4GGQA 4JQWC 4WAAA 3FM8C 1V5OA 1U5DA 1R4NI 2MCNB 4KIKB 1ZM0A 4KDIC 2JWZA 2KC1A 2COPA 4G0NB 1H4RA 1WGDA 3H7PB 3QQ8B 4F7ZA 4E3CA 1WM3A 1P5TA 3ULBA 4JKAA 3QCAA 2BYFA 2IO1B 2G45B 1TGZB 3JW0X 2PEAA 3ONSA 3VTUA 1AQCA 2GS0A 2N9PC 4TV3A 2JVCA 2KUPA 4KV2A 2KHWB 1NDDA 3DXEA 4BOZB 4ZDVA 1ZVRA 2PJHA 3ODXA 2L05A 1V5TA 3ZIMA 3A4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSZ A;  2VRR B;  3MTN B;  3KH0 A;  4DDG D;  3UIO B;  2VKI A;  2NBV B;  3A1Q A;  4NQK E;  3PEG A;  4KHA A;  3PVU A;  2M14 A;  4EZJ A;  4A5K A;  1GNU A;  5E6O A;  2IZV B;  3A33 B;  4IG7 B;  3U30 A;  2KFK B;  3RCZ A;  2I5F A;  2BYV E;  3TIX A;  3R7R A;  4DK5 A;  2BWE S;  3PRE A;  4EUT A;  5G2N A;  4DHZ E;  3AI5 A;  3T9L A;  3RUI B;  1OMW A;  3OAW A;  4WJ7 A;  1Y19 B;  5JH5 C;  2KX0 A;  3PP2 A;  3DVN U;  3PS6 A;  5EDS A;  2L1C A;  3ZNZ B;  2JY6 A;  1VD2 A;  4XZ4 A;  2MQJ A;  3SO6 A;  2K8C A;  1EO6 A;  1GC6 A;  3M62 B;  4BFR A;  2KOX A;  2KWU B;  4GMV A;  4PYU A;  3ZNI D;  2K8B A;  3PVL A;  1I35 A;  3P6A A;  4GB9 A;  2HRJ A;  4IM3 A;  4IC7 B;  1D3Z A;  4KAX B;  1H8C A;  3RCP A;  3OAN A;  2KN5 A;  2G3Q B;  4MM3 A;  3IVF A;  2B3A A;  3SHQ A;  1UGM A;  5JLJ B;  4RM8 A;  1YX6 B;  1LW3 A;  1C3T A;  5C5B B;  2D4Q A;  1PQS A;  3NSU A;  4XC2 A;  4KVG B;  5JZE B;  4GIV A;  2YS1 A;  2LAS A;  2COD A;  4A6F B;  2KKC A;  5D2M B;  4G11 A;  3ZDM C;  5J18 A;  5IAA C;  4HCP B;  4OVV A;  5L83 A;  5HE2 A;  1UBI A;  4AJY B;  4NY0 A;  2RUK B;  2IY1 B;  2LJ5 A;  1Q0W B;  2LGY A;  2EJ8 A;  2FCQ A;  4HAU B;  2O2V A;  2YT1 A;  2CY5 A;  3HHM A;  4URK A;  2COF A;  1FHW A;  2K1F A;  3CXB B;  3N32 A;  1WH3 A;  2JF5 A;  1K8R B;  2ASQ A;  5GMV A;  3VH3 B;  3L08 A;  1WF9 A;  5DCN A;  2EKE C;  4HXD A;  3IFW B;  4GXB A;  3H6N A;  4G3X B;  3P7Z A;  5FI0 A;  1WR6 E;  3BIN A;  2UZS A;  4HB3 B;  1WJN A;  2N7D A;  2V1Y A;  4YON A;  2YRY A;  2YVC A;  2ZCB A;  1RJ2 A;  2J0J A;  1VCB A;  4IAP A;  3C0R B;  3KYD D;  2P0H A;  3PSE B;  3IBE A;  3W1S A;  2LGX A;  1W1H A;  4K7W A;  3B1L X;  5D94 A;  4ZRI A;  3SUZ A;  1UNR A;  3HIZ A;  4GSW A;  1X1G A;  1OTR B;  3PHX B;  2DHJ A;  3D8E A;  4K2P A;  4B6W A;  2G4S A;  2DX5 B;  1BTK A;  1UNP A;  3ZUN A;  3EFU A;  1SIF A;  4HB2 B;  2DEN B;  2AL3 A;  4NAW A;  1J19 A;  2KVR A;  3KVF B;  3AJ4 A;  5IJM A;  1WJ1 A;  2M38 A;  1DBH A;  4GMX B;  3DDC B;  3H1U A;  3O65 B;  4WWO A;  2ZCC A;  3DXC A;  3T8M A;  3SD5 A;  4HLE A;  2HTH A;  2DZM A;  2KZR A;  2MBE A;  4FHJ A;  5AZG A;  3ZDT A;  4NSW A;  4FAD A;  4GPT B;  2KLG A;  2FIF A;  3KW5 B;  2KDI A;  5IA7 A;  4C0A A;  4XWX A;  2C60 A;  2DZK A;  1V6E A;  2V76 A;  4WJN A;  2P0D A;  5J3T A;  4TKN A;  4RMA A;  2CHW A;  2JP2 A;  2L76 A;  3RD2 A;  3PZD A;  5HKH A;  3ML8 A;  3X0W A;  2JT4 B;  5CHW A;  3QC8 B;  2CQU A;  3QWZ B;  3JSV A;  1Z87 A;  4F8C B;  1UPR A;  3WA0 A;  5DPS A;  3TFM A;  4MK0 A;  5LXH A;  1QQG A;  3ZVR A;  2MDX A;  3MJW A;  5DHA B;  3JVZ X;  2CB8 A;  1P9D U;  1KZG A;  4IW0 A;  2KDF B;  2LKO A;  1LQB A;  3QIJ A;  3A8P A;  1GG3 A;  3L17 A;  1E8Y A;  1UEL A;  2Z0D B;  3EHV A;  1OQN A;  1P1A A;  2MFQ A;  4KZ0 A;  4E74 A;  1MIX A;  4HAZ B;  2ZPY A;  3CIK A;  2GBJ A;  3KYC D;  4IFS A;  3GYP A;  4TYZ A;  1WMH B;  3QA8 A;  3M3J A;  1V9J A;  3HM6 X;  3SYX A;  1V5M A;  1X1M A;  3GZN I;  3OLM D;  3UQB A;  1OY2 A;  3MHS D;  3ZO5 B;  4MJS B;  2JRH A;  3PRZ A;  4HAY B;  3B0A A;  4NNJ B;  1MPH A;  1PLS A;  2K6D B;  2BGF A;  2C7N B;  2G35 A;  5HE3 A;  1LXD A;  1NVL A;  5DI9 B;  2YSZ A;  4KSL C;  2LI5 A;  5HE0 A;  4A6F A;  1P3R A;  4ICV A;  3LJ3 A;  4EFO A;  1HB8 A;  4HHV A;  4HJK A;  2O6V A;  2CHX A;  2A4Z A;  2KK8 A;  5L81 A;  4AJW A;  3L0W B;  4DWF A;  4L6E A;  3UIP B;  3DVG Y;  4NJ7 A;  3M95 A;  1WI1 A;  3N30 A;  4W9L A;  3DBL I;  2BKR B;  2WX0 A;  3NZS A;  2K6Q A;  2LD9 A;  2IO3 B;  3Q3F A;  3A8Q A;  4DHJ D;  3RT3 B;  2UWQ A;  2JZ3 B;  5CLL B;  4F7U P;  5J17 A;  4GDL A;  1LM8 B;  3DQV A;  3M63 B;  1J0W A;  2RD0 A;  3KUC B;  2LZ6 A;  2COA A;  4FHK A;  2ZNV B;  5AZH A;  4KHO A;  2RNR B;  2NMB A;  2BPS A;  2JUO A;  3CST A;  2WH5 A;  2GCJ A;  1WXM A;  1TTN A;  1IPG A;  3WAN A;  2KFJ A;  4PS3 A;  1N3H A;  4IM0 A;  1PMS A;  4A6H A;  3DBR I;  1ACA A;  2BKF A;  4MGK E;  4LDT D;  3D8D A;  2BCJ A;  2WYQ A;  2LUE A;  2KD0 A;  1OGW A;  1WXV A;  4HWI B;  1IP9 A;  3P2B A;  4DHZ B;  5KQ1 A;  4ANX A;  5HE1 A;  3ODW A;  2D9Y A;  2LXA A;  5EFX A;  1OEY J;  3PPA A;  1FOE A;  4K2O A;  2KJH B;  3TBL D;  2DN6 A;  1UPQ A;  2MSE D;  2DHI A;  2DYN A;  5C1Z A;  3EPY A;  2HD5 B;  2N0Y A;  1G6J A;  1Y8R C;  5JHB A;  5FI1 A;  3H9D A;  1DYN A;  2AWT A;  4NJ6 A;  2CRF A;  4IWO A;  4MT7 A;  2I1J A;  3R66 C;  4EMO A;  4LCD E;  3TL5 A;  4PQ0 A;  1EVH A;  4YL8 A;  3ZRC A;  2RGN B;  1U29 A;  1WX9 A;  1QZE A;  3CMM B;  1WX8 A;  1WRD B;  3H7S A;  5D27 A;  3N7C A;  2KTR A;  2LRU A;  2ZZP B;  1YJ1 A;  3EC8 A;  4HAV B;  1WJ6 A;  3KRW A;  2Y5B B;  4DHJ B;  2N9E B;  3T06 A;  2K8H A;  1FB8 A;  3A9J B;  5CHF A;  1BT0 A;  1HBK A;  3IG3 A;  3TO1 A;  4WWP A;  3DCG A;  4PYZ A;  3MPX A;  2LBB A;  4ZRK A;  3ENE A;  4W9F A;  4K7U A;  4W9C A;  4LJP B;  2DYB A;  1K5G B;  1KI1 B;  1ISN A;  4K1R B;  2DYO A;  3DBS A;  5DPT A;  3FLV A;  4W9I A;  4AWJ A;  4CHJ A;  1RRB A;  3NZU A;  4EZL A;  2DHK A;  2UVM A;  3VFK A;  4II3 B;  1MG8 A;  4M8M A;  2D9Z A;  1J0G A;  2KJR A;  3QX1 A;  4WSF A;  1WX7 A;  1WJ4 A;  5LXI B;  1V49 A;  3ZNG C;  3VVW B;  3F0W A;  3RZF A;  2L0T A;  2ABD A;  2ZVO A;  1GUA B;  1WYW B;  2ROZ B;  2FCN A;  2NS5 A;  2YS3 A;  4EKU A;  4GDK B;  5L95 C;  2D07 B;  4AOF A;  4MJS A;  2Z59 B;  2C7H A;  3NHE B;  3VHT C;  2QKL A;  3WAL A;  1OEY A;  4OVU A;  3APD A;  2WWZ A;  3PLU A;  3SU8 X;  4MDK E;  2LVQ A;  4JLC A;  3QWM A;  3ZTC A;  3RYT A;  1GC7 A;  3L10 B;  2XK5 A;  1YIW A;  2MBB B;  2R0D A;  1ST7 A;  2NR2 A;  2RQ1 A;  1NTY A;  3ULC A;  1L7Y A;  3KUD B;  1FHO A;  4CHK A;  2PE9 A;  1V80 A;  3CF6 E;  2J59 M;  1XCG A;  3AU4 A;  1EF5 A;  2D9V A;  2CR5 A;  3DVN V;  3VTV A;  2ROV A;  3Q3J A;  1WGU A;  4ICU A;  1WVH A;  2H7D A;  2ZNV C;  4I6P A;  1IYF A;  2QKM A;  3OJ4 B;  2MBH A;  4HAT B;  1BWN A;  1X86 A;  4ASW C;  3TJP A;  5AZF A;  3VXW A;  1NU2 A;  1TJ6 A;  4JIO U;  1HB6 A;  3I3T B;  1X11 A;  4TUU A;  1W1G A;  3K9P B;  1KZ7 A;  1RRP B;  4HAX B;  3ZLZ A;  2YF0 A;  2LVO A;  2DX1 A;  3ODO A;  3PT2 B;  4BVU C;  3BJI A;  1M94 A;  2OTX A;  4KIK A;  2IBI B;  1WZ3 A;  4FUL A;  4FJY A;  1IRS A;  3H7P A;  3NY5 A;  2HJ8 A;  2GJY A;  2N9X A;  3TW1 A;  2RVB B;  2YS5 A;  1SGH A;  3SDL C;  4EJN A;  2JRI B;  3PSC A;  1NTV A;  2W2X C;  1DRO A;  2R09 A;  3VUW A;  1UD7 A;  4HPM B;  4Z2N A;  2DZI A;  1MK9 B;  1WY8 A;  1WE7 A;  2KNB A;  2AL6 A;  3ZVV A;  2YLM A;  4WJQ A;  1I42 A;  3V61 A;  4HDO A;  2UZR A;  3FP5 A;  1EGX A;  2JXX A;  5FR6 A;  1PFJ A;  3VUX A;  1P98 A;  4WJP A;  2D10 A;  2DYQ A;  4LJO B;  5JHG A;  3UGB B;  1U27 A;  3SNH A;  2DA0 A;  5DIF B;  2K39 A;  3L54 A;  3PGE A;  2C5L C;  2KFK A;  3DOW A;  2H7E A;  1MAI A;  1UNQ A;  5CTR C;  4I6L B;  2XBB C;  2MBQ A;  1QC6 A;  2PPH A;  1H10 A;  3KSY A;  4D0N B;  4WJO A;  1WZ0 A;  1ZW7 A;  1FAO A;  1E7U A;  3PHW B;  4BOS C;  3V6E B;  1XKE A;  2KJ6 A;  2RPQ A;  2KMA A;  2HE7 A;  3QHT A;  4HB4 B;  4WVF B;  4B6H A;  2K2J A;  3VOQ A;  1Z2M A;  2N7E A;  2NPT B;  3TMP B;  2N4F A;  4NQL B;  5C23 A;  1WI0 A;  2MLB A;  2FJ9 A;  2LWP A;  5C5B A;  4BBN C;  4FLH A;  2RSG A;  2NZ8 B;  2DFK A;  5JHH A;  1E8Z A;  2KTF A;  3ZNH B;  5D3X A;  2M17 A;  2NCN A;  1WJM A;  2I5C A;  4DDI D;  1MK7 B;  1OQY A;  1MIZ B;  4ANW A;  1Z5S B;  4HAW B;  3PLV A;  2D11 A;  2KAN A;  1WGH A;  2FNJ B;  3HK0 A;  2CS4 A;  1ZKH A;  3FEH A;  3K9O B;  2LRW A;  1FXT B;  1P6S A;  3FSS A;  2LVP A;  2M4N A;  2K25 A;  1Q5W B;  1XD3 B;  3HM3 A;  1XT9 B;  5TR5 A;  1E7V A;  2MW5 A;  3PV1 A;  3V6C B;  4DX8 A;  4ZYN A;  4BBN F;  3DPD A;  2FJL A;  4TQ1 A;  2Z0E B;  3L16 A;  2OQB A;  4K17 A;  2ELB A;  3VAW A;  3WAO A;  4HDQ A;  1WG7 A;  2DKP A;  4DX9 0;  4DXA B;  1TXD A;  1WR1 A;  4FA6 A;  1XQQ A;  2C7M B;  1EF1 A;  2P8V A;  5C16 A;  3M1I B;  3IHP C;  5CLQ B;  3HQC A;  4MSQ B;  4PS7 A;  1SHC A;  4GU2 A;  5JHA A;  1NBF C;  2RLO A;  1S1Q B;  4W9G A;  1YX5 B;  1E90 A;  4H8S A;  1C1Y B;  1W1D A;  4ZRJ A;  3A4S C;  4CHM A;  4RM9 A;  2KDE B;  4JL9 A;  5LLI A;  3DXD A;  5DPR A;  4E71 A;  1Q1O A;  2EMT A;  1UEF A;  2J0K A;  1XD4 A;  2HTH B;  4II2 B;  4MH0 E;  3ALB A;  4F7G A;  1LB1 A;  3MDB C;  1WGR A;  2O6V D;  1FGY A;  1BTN A;  2V4L A;  3RUL A;  2DX5 A;  1FGZ A;  1V5U A;  2KX3 A;  1I2H A;  3DVG X;  3A9K B;  1NI2 A;  4N9F 4;  2X18 A;  3OJ3 A;  3UIN B;  2N1W A;  2DYM A;  2Z0P A;  2KO3 A;  2RGF A;  4HVB A;  3D32 A;  2GBN A;  2D9X A;  4GZU A;  3ZKJ C;  4W9K A;  5KHO A;  2KMC A;  4DBG A;  1U5G A;  3QK0 A;  2ADZ A;  2M8S A;  2J0M A;  4KZC A;  5KQ4 A;  2MA9 B;  5E6P A;  1UBQ A;  3JSV B;  2DLW A;  4P7I A;  4EOY A;  4HK2 A;  3NOB A;  1ZC4 B;  2L8J A;  1V61 A;  2IFS A;  3ML4 A;  1GJZ A;  1V89 A;  5KCV A;  2WDT B;  4A3O A;  3QJZ A;  2W2W A;  2WX1 A;  3KRX A;  2P0F A;  3WAM A;  2DAF A;  4B95 A;  1P3Q U;  4JGH B;  2G4D B;  4HB0 B;  2ELA A;  1F9J A;  4Z2M B;  2BWF A;  1WXS A;  2MWS B;  3B08 A;  5BO4 B;  4IM2 A;  2L0F A;  4MY6 A;  2LUL A;  2FID A;  4LDT B;  3W1Y A;  1DDM A;  2MP2 B;  3L13 A;  1KM7 A;  5D6J B;  3VDZ A;  1ZSQ A;  2IO0 B;  4WWN A;  2MWN B;  2MBO A;  2D2Q A;  1KJT A;  1RFA A;  3S2A A;  1YQB A;  1L2N A;  5GOW B;  2CY4 A;  1J8C A;  3WAP A;  2DHZ A;  2LOX A;  3PTF C;  1WE6 A;  2O6V B;  1AAR A;  3PRM B;  1M7R A;  2CAY A;  1WMH A;  3TVV A;  1TQZ A;  1EUV B;  3QAQ A;  4F1S A;  1R4M I;  1E8X A;  2L3Z A;  4W9D A;  3SV1 A;  2UYZ B;  1B55 A;  3EEC A;  2NPT A;  2COC A;  3KY9 A;  2RSU A;  2XEW A;  1BAK A;  1Y5O A;  3RZW C;  1I7A A;  3O96 A;  3APF A;  2BF8 B;  2QHO A;  5J3Y A;  4W9J A;  1WJU A;  2J7Q B;  5D3Y A;  2NVU I;  3R3M A;  2AEH A;  3BY4 B;  1WXA A;  4EZK A;  2MKR A;  3JYU A;  2NBU A;  4GDL B;  3X23 A;  4AUQ C;  3VTW A;  1FHX A;  1U5F A;  2GCL A;  2CU1 A;  2KLC A;  1WIA A;  4KHB B;  2EC1 A;  4MGI E;  5J2R A;  3GYO A;  4K7S A;  5C79 A;  2ZVN A;  3LDZ E;  1V81 A;  1S3S G;  2R2Q A;  2IYB A;  2GBK A;  2ZPN A;  1V2Y A;  1KOT A;  2IO2 B;  3UF8 A;  1WGQ A;  1SE9 A;  2KQ7 A;  3W1S C;  2CHZ A;  1AWE A;  2M0X A;  2OOB B;  2LOZ A;  3U8Z A;  4M8N A;  2E2X A;  4NPN A;  2MRP A;  5C6R A;  4A20 A;  3GOE A;  1P0R A;  2FCS A;  4HPL B;  4W9H A;  4BKS A;  1U5E A;  2FDQ A;  2I1K A;  1XR0 B;  2N23 A;  2Y8G A;  4ANV A;  3NS8 A;  3U7D A;  2KC2 A;  2Z0Q A;  2KCJ A;  4A6K A;  1V5P A;  1A5R A;  2Y8F A;  3A1Q B;  2AYO B;  3VIA A;  4J6I A;  3PG7 A;  2IYD B;  4MEM A;  2FUH B;  1CMX B;  2DZJ A;  4AP4 C;  2D9W A;  5CHV C;  1KLV A;  2LXC A;  2RR9 A;  1LFD A;  2GOW A;  2KTR B;  1U4A A;  2KWV B;  4HCN B;  2GBR A;  3UQA A;  2Y7B A;  4IUM B;  1WFY A;  4GN1 A;  3AU5 A;  5D3W A;  1EAZ A;  4M0W B;  3QBV B;  1TBE A;  3DBH I;  3A9K A;  3ML9 A;  2R2O A;  2Q13 A;  5DH9 B;  2PE6 B;  4PNK A;  5LOP B;  3A98 B;  1ZGU B;  2GBM A;  1UH6 A;  3WYF B;  3G9W A;  2K00 A;  2CKH B;  4CYE A;  3PRP B;  1RAX A;  5G55 A;  4FBJ B;  3AXC A;  2NBW B;  5D7G A;  5D3V A;  3QAR A;  2W9N A;  4K81 A;  3LJU X;  1V86 A;  1UZX B;  2GMI C;  4Y94 A;  2EMS A;  4G50 A;  5DPW A;  3CSF A;  5CX3 A;  2LGD A;  1HE8 A;  2OJR A;  4KSK C;  4W9E A;  2KWC A;  2LYD A;  1JRU A;  2L2I A;  3A9J A;  4GOC A;  4BKS D;  3V5W A;  2DKQ A;  1TZ1 A;  3TCA A;  2V3S A;  4MEL A;  4IWP A;  2FAZ A;  1YD8 U;  2REX A;  2K2U A;  5JP4 A;  4B9K A;  2VRW B;  1XOD A;  4FJV B;  2PZ1 A;  3F5R A;  5KHQ A;  5LON B;  3ZTD A;  1Q67 A;  1X1F A;  3ZW3 A;  1X05 A;  1WGG A;  1V88 A;  2O2V B;  2YT0 A;  1RLF A;  5E6N A;  2D3G A;  1M7E A;  4IWQ A;  2MP2 A;  1XX0 A;  2M1M A;  2N1V A;  4MGY E;  3PVW A;  3VQI A;  3AUL A;  2DTC A;  2KDB A;  3D8F A;  2C9W B;  2W2X D;  4FJZ A;  2IY0 B;  4DBB A;  2XK5 B;  3V60 A;  2A5U A;  3HW2 B;  2FCM A;  5DHF B;  3ECI A;  3WIM A;  4ANU A;  3KUZ A;  2LG1 A;  3N3K B;  4X57 B;  4GDK A;  2KXJ A;  4I6N B;  3KZ1 A;  2ZJD A;  4MSM B;  3V62 A;  2JZZ A;  2KQS A;  2XQN M;  1WGY A;  3UZT A;  4IOY X;  1MKE A;  2Z0O A;  2BYE A;  4F7H A;  3R7Q A;  1DDV A;  1K5D B;  4WQO B;  2JPH A;  1E5W A;  4PS8 A;  2L00 B;  2ZEQ A;  4EEW A;  4MGZ E;  4BKG A;  4BBK A;  3VH4 B;  1E8W A;  4KDL B;  4TQ0 A;  5AEK B;  1WM2 A;  4A3P A;  4FN2 A;  2L7R A;  4CO7 A;  1NTI A;  4BKT A;  2MX2 A;  1DDW A;  5J3Q A;  2DAJ A;  1T0Y A;  1U2B A;  4NAW B;  1ZC3 B;  3ZRF A;  3VUY A;  2KGX B;  3APC A;  4XX5 A;  4GGQ A;  4JQW C;  4WAA A;  3FM8 C;  1V5O A;  1U5D A;  1R4N I;  2MCN B;  4KIK B;  1ZM0 A;  4KDI C;  2JWZ A;  2KC1 A;  2COP A;  4G0N B;  1H4R A;  1WGD A;  3H7P B;  3QQ8 B;  4F7Z A;  4E3C A;  1WM3 A;  1P5T A;  3ULB A;  3QCA A;  2BYF A;  2IO1 B;  2G45 B;  1TGZ B;  3JW0 X;  2PEA A;  3ONS A;  3VTU A;  1AQC A;  2GS0 A;  2N9P C;  4TV3 A;  2JVC A;  2KUP A;  4KV2 A;  2KHW B;  1NDD A;  3DXE A;  4BOZ B;  4ZDV A;  1ZVR A;  2PJH A;  3ODX A;  2L05 A;  1V5T A;  3ZIM A;  3A4R A; 
#chains in the Genus database with same CATH topology
 2VSZ A;  2VRR B;  3MTN B;  4N59 A;  3KH0 A;  4DDG D;  3UIO B;  2VKI A;  2NBV B;  3A1Q A;  4NQK E;  3PEG A;  4KHA A;  3PVU A;  2M14 A;  4EZJ A;  4A5K A;  1GNU A;  2M56 B;  5E6O A;  2NTS A;  2IZV B;  1SJE D;  3A33 B;  1R4M B;  4IG7 B;  5AUK A;  3U30 A;  2KFK B;  1QOA A;  3RCZ A;  2I5F A;  2BYV E;  2WXH A;  3TIX A;  3R7R A;  4DK5 A;  1MFW A;  2WDV B;  2L1A A;  2BWE S;  3GE3 C;  3PRE A;  4EUT A;  5G2N A;  4DHZ E;  3AI5 A;  1RFK A;  1DGJ A;  2WXI A;  4NJC A;  3T9L A;  3RUI B;  1OMW A;  3OAW A;  4M0W A;  4WJ7 A;  1Y19 B;  4BZA A;  2KX0 A;  1R7S A;  5JH5 C;  3PP2 A;  3DVN U;  3AE3 B;  3PS6 A;  2L1C A;  4O1N A;  2WHI A;  3ZNZ B;  5EDS A;  4RNA A;  2WXJ A;  2JY6 A;  1VD2 A;  4XZ4 A;  2MQJ A;  3SO6 A;  2K8C A;  2JX5 A;  1EO6 A;  5IO9 A;  1GC6 A;  4JKB A;  3M62 B;  4BFR A;  1FMA D;  3SR6 A;  2KOX A;  2KWU B;  2INN E;  2WLB A;  4GMV A;  4RFB A;  4PYU A;  3ZNI D;  1FNW A;  1F2R I;  2K8B A;  2GLS A;  3PVL A;  1I35 A;  3P6A A;  4WWM A;  4GB9 A;  2HRJ A;  1CQV A;  4IM3 A;  1CZP A;  4IC7 B;  1D3Z A;  4KAX B;  4YWG G;  1H8C A;  3RCP A;  3OAN A;  2KN5 A;  2G3Q B;  1YNT E;  4MM3 A;  5EE0 A;  1QQR A;  3IVF A;  2WXN A;  5LNK 1;  4ZRQ A;  2GB1 A;  1UWM A;  2X38 A;  1VZ8 A;  2B3A A;  2WXM A;  3SHQ A;  1UGM A;  5BYQ A;  1N60 A;  5JLJ B;  5BMI A;  4RM8 A;  1YX6 B;  1IGD A;  4OSN A;  1LW3 A;  1C3T A;  4PT5 A;  5C5B B;  2D4Q A;  1PQS A;  3NSU A;  2V3N A;  4XC2 A;  4KVG B;  5JZE B;  4GIV A;  2YS1 A;  2LAS A;  5JXV A;  2COD A;  1JAL A;  1GPX A;  3NVY A;  4A6F B;  2KKC A;  1AW7 A;  4QXA B;  3RNA C;  5D2M B;  2X0S A;  4G11 A;  3ZDM C;  3C8Y A;  5J18 A;  5IAA C;  3E9O A;  2CU3 A;  4HCP B;  4OVV A;  5L83 A;  5HE2 A;  1UBI A;  3ABV B;  4AJY B;  4NY0 A;  5HG2 A;  2RUK B;  2ZW1 A;  2IY1 B;  1F1H A;  2LJ5 A;  4KGS A;  1CJE A;  1Q0W B;  2LGY A;  3J9C A;  2EJ8 A;  2FCQ A;  4HAU B;  2D3B A;  2O2V A;  1GGO A;  3FIL A;  4R3D A;  1KLU D;  4XYC A;  2YT1 A;  2CY5 A;  3KQ4 A;  3HHM A;  1D5X C;  4URK A;  2COF A;  1FHW A;  1RYJ A;  2K1F A;  3CXB B;  3N32 A;  3W5V B;  4B0M A;  1WH3 A;  2JF5 A;  2ZKM X;  1K8R B;  2ASQ A;  3BYT B;  5GMV A;  3VH3 B;  2KYW A;  3L08 A;  1WF9 A;  5DCN A;  1I4G A;  1PFD A;  2JU6 X;  5D3D A;  2EKE C;  4HXD A;  2GRI A;  3BK2 A;  3IFW B;  1YQ3 B;  4JPS A;  2SEB D;  4GXB A;  1UNS A;  3H6N A;  4G3X B;  2R2Y A;  3P7Z A;  5FI0 A;  1WR6 E;  3BIN A;  2UZS A;  4HB3 B;  3DBH B;  3FVC A;  1WJN A;  2N7D A;  2V1Y A;  4YON A;  2YRY A;  4ILH A;  1ACC A;  2YVC A;  2ZCB A;  1RJ2 A;  2J0J A;  4RCO A;  1VCB A;  4IAP A;  1WSP A;  2KMM A;  2PMV A;  4PK1 A;  1MHX A;  4JKF A;  1PGA A;  3CIR B;  3C0R B;  3KYD D;  2P0H A;  4A6Q A;  3PSE B;  3IBE A;  3W1S A;  1FCL A;  2LGX A;  1W1H A;  4K7W A;  3B1L X;  3R2I A;  5D94 A;  4LNO A;  2V9H A;  4KKJ A;  4ZRI A;  1ZDV A;  3SUZ A;  1UNR A;  4ZOH C;  3HIZ A;  4GSW A;  4WIP A;  1X1G A;  1OTR B;  2QEJ C;  3PHX B;  2DHJ A;  3P4P B;  1SSN A;  3D8E A;  4K2P A;  4B6W A;  2G4S A;  1E7P B;  2DX5 B;  1BTK A;  1UNP A;  3ZUN A;  3EFU A;  1MPE A;  1SIF A;  2K22 A;  2RDB C;  4HB2 B;  2N9K A;  2DEN B;  2AL3 A;  4C7Z A;  1FPY A;  3I57 A;  4NAW A;  1V97 A;  1J19 A;  3P63 A;  4LNK A;  2KVR A;  3KVF B;  3AJ4 A;  1VDV A;  5IJM A;  3PZ8 A;  1WJ1 A;  2M38 A;  1DBH A;  4GMX B;  3DDC B;  3H1U A;  3NWA A;  3O65 B;  4WWO A;  1ZYI A;  2WU5 B;  2ZCC A;  3DXC A;  1ROE A;  3T8M A;  2I2Y A;  2NTT A;  3SD5 A;  4HLE A;  2HTH A;  4C4V B;  1N61 A;  2DZM A;  3B77 A;  3FKY A;  2KZR A;  2SAK A;  2MBE A;  4FHJ A;  1T5X D;  5AZG A;  3ZDT A;  5C2T B;  4NSW A;  4MH8 A;  1HTQ A;  3AE1 B;  4GPT B;  2FBW B;  2KLG A;  4FAD A;  2FIF A;  1N6Z A;  3SFD B;  3KW5 B;  4HSI A;  3C19 A;  2KDI A;  1D5Z C;  5IA7 A;  4C0A A;  4AS1 A;  4ARI A;  4XWX A;  2C60 A;  4CSQ A;  2DZK A;  1V6E A;  2V76 A;  3BVZ A;  2P0D A;  5J3T A;  4WJN A;  5D3I B;  4YT0 B;  1DOY A;  4TKN A;  4RMA A;  1QF6 A;  2CHW A;  2JP2 A;  2L76 A;  3RD2 A;  3PZD A;  5HKH A;  3DHG C;  3ML8 A;  3Q3N C;  3X0W A;  1F0Z A;  4JE3 B;  2JT4 B;  3DHH C;  5CHW A;  3QC8 B;  2CQU A;  5EE9 A;  2KVZ A;  3QWZ B;  3JSV A;  1Z87 A;  1ZDX A;  4F8C B;  1UPR A;  3WA0 A;  1TZO A;  5DPS A;  3TFM A;  1XXG A;  4MK0 A;  2VH1 A;  5LXH A;  1QQG A;  3ZVR A;  2MDX A;  2WXL A;  2QCZ A;  4C80 A;  3MJW A;  5DHA B;  3JVZ X;  2CB8 A;  1P9D U;  1KZG A;  1V1P B;  4IW0 A;  2KDF B;  3EGR A;  2LKO A;  1LQB A;  3QIJ A;  2H88 B;  3R8B A;  3A8P A;  3BWU D;  1GG3 A;  3L17 A;  5MPO A;  1E8Y A;  5M4Y B;  1UEL A;  2Z0D B;  1PDX A;  3EHV A;  3N9Y C;  4WUR A;  3NVW A;  4L23 A;  2M0A A;  1OQN A;  1P1A A;  2MFQ A;  4KZ0 A;  4E74 A;  1MIX A;  4HAZ B;  2ZPY A;  3CIK A;  2GBJ A;  3KYC D;  4IFS A;  3GYP A;  4TYZ A;  1DYQ A;  4DXG A;  3VR9 B;  4YSX B;  1WMH B;  3QA8 A;  1EU3 A;  3M3J A;  1V9J A;  3HM6 X;  1HZ6 A;  3SYX A;  1V5M A;  1X1M A;  3GZN I;  3OLM D;  3UQB A;  4N58 A;  3AEG B;  1OY2 A;  3DCX A;  3MHS D;  3ZO5 B;  4MJS B;  4JK7 A;  2JRH A;  3AEB B;  4YTM B;  5I2M A;  3LB8 C;  3PRZ A;  4HAY B;  3W5U B;  3B0A A;  4NNJ B;  1MPH A;  1PLS A;  2K6D B;  2WGS A;  2BGF A;  1R4N B;  2C7N B;  1SE3 A;  2G35 A;  5HE3 A;  1LXD A;  1NVL A;  5DI9 B;  4A55 A;  2YSZ A;  4KSL C;  2ZW0 A;  2LI5 A;  5HE0 A;  4A6F A;  1P3R A;  4ICV A;  1YJI A;  3LJ3 A;  4EFO A;  3Q8C A;  1HB8 A;  4HHV A;  2J42 A;  1ZXI A;  2O6V A;  4HJK A;  2CHX A;  2A4Z A;  2KK8 A;  5L81 A;  2W3S A;  4AJW A;  3L0W B;  1M4V A;  4DWF A;  4L6E A;  2HTM E;  3UIP B;  3DVG Y;  4NJ7 A;  4HKZ E;  3ZXV A;  5IRS A;  4ZYS A;  3M95 A;  1WI1 A;  3N30 A;  1TT5 B;  2BT6 A;  4W9L A;  3DBL I;  2BKR B;  1LGR A;  2LHD A;  3NRZ A;  2WX0 A;  4L1R A;  3NZS A;  2K6Q A;  2LD9 A;  2IO3 B;  4JKC A;  4NZL B;  3HUI A;  3Q3F A;  3A8Q A;  4DHJ D;  2EKI A;  2Z14 A;  2IGH A;  3RT3 B;  2UWQ A;  2XN9 C;  2J4X A;  2JZ3 B;  2VH2 A;  5CLL B;  3AE5 B;  4F7U P;  3AE9 B;  5J17 A;  4GDL A;  4HPP A;  1LM8 B;  2LHE A;  2DBY A;  3DQV A;  3M63 B;  3ZYY X;  1HEZ E;  3RNE C;  1J0W A;  1TS2 A;  2V0G A;  3AE2 B;  2RD0 A;  1K52 A;  3KUC B;  2LZ6 A;  2RMM A;  2COA A;  4FHK A;  1E6E B;  2BBC A;  2ZNV B;  5AZH A;  4KHO A;  2RNR B;  2NMB A;  1VR9 A;  2BPS A;  1I4X A;  2JUO A;  3CST A;  2WH5 A;  1MI1 A;  2GCJ A;  2KQ4 X;  5EE3 A;  1WXM A;  5FKA C;  1TTN A;  3ZQ4 A;  1IPG A;  2JZP A;  3WAN A;  2KFJ A;  3TEZ A;  2QSD A;  4PS3 A;  1N3H A;  2Y3A A;  4IM0 A;  1UUP A;  1PMS A;  4A6H A;  3DBR I;  3R2T A;  1ACA A;  1FIQ A;  2IND C;  4OVZ A;  2BKF A;  4MGK E;  4LDT D;  3D8D A;  1AYF A;  2BCJ A;  2WYQ A;  1EU4 A;  2LUE A;  2KD0 A;  4P16 A;  3T3O A;  2BB6 A;  1OGW A;  1WXV A;  4HWI B;  1IP9 A;  3P2B A;  4DHZ B;  4JKH A;  5KQ1 A;  4ANX A;  5HE1 A;  3ODW A;  1SF0 A;  1F52 A;  2D9Y A;  4BAX A;  2LXA A;  5EFX A;  1FRD A;  4JX1 C;  1OEY J;  3PPA A;  3MJ5 A;  1JRO A;  1FOE A;  4K2O A;  2KJH B;  3TBL D;  2DN6 A;  2Z13 A;  1UPQ A;  2MSE D;  2DHI A;  2DYN A;  1L0Y B;  2L52 A;  2YT2 A;  5C1Z A;  3EPY A;  2ON8 A;  2HD5 B;  1ESF A;  2N0Y A;  1BML C;  1G6J A;  1Y8R C;  5JHB A;  1K50 A;  5FI1 A;  3N1X C;  3H9D A;  1K53 A;  1XF5 L;  1DYN A;  3KLS X;  2AWT A;  3NUH B;  2LFI A;  4NJ6 A;  2CRF A;  4IWO A;  4MT7 A;  2I1J A;  1C4A A;  3R66 C;  2V3P A;  4EMO A;  1LO5 D;  4L2Y A;  4XE0 A;  4LCD E;  3TL5 A;  4PQ0 A;  1EVH A;  4WH4 A;  4YL8 A;  3ZRC A;  2RGN B;  1XCQ L;  1U29 A;  3ZJT A;  1WX9 A;  1QZE A;  3CMM B;  1WX8 A;  1WRD B;  3H7S A;  5D27 A;  1N5W A;  1QOF A;  3N7C A;  2KTR A;  2LRU A;  2ZZP B;  3GS2 A;  1E0Z A;  4A9A A;  1UWX A;  4XDC A;  3AN1 A;  1YJ1 A;  3EC8 A;  4HAV B;  4LLG M;  1WJ6 A;  3KRW A;  3NJT A;  2Y5B B;  1NEN B;  4HRS A;  4DHJ B;  2N9E B;  2E3T A;  3T06 A;  5AUI A;  3EFC A;  2K8H A;  2WU2 B;  1JML A;  1FB8 A;  4LK0 M;  3A9J B;  5CHF A;  1BT0 A;  1WYG A;  1HBK A;  4JK9 A;  3IG3 A;  4K3C A;  3V3X A;  2BYT A;  3Q14 C;  3TO1 A;  3TEW A;  4WWP A;  1PGX A;  3DCG A;  4PYZ A;  3MPX A;  2QC8 A;  5C3J B;  2LBB A;  4ZRK A;  3ENE A;  1CK1 A;  4W9F A;  4K7U A;  2WDQ B;  4W9C A;  4LJP B;  1WWT A;  2DYB A;  1K5G B;  2JYE A;  3Q2A C;  1KI1 B;  1ISN A;  4K1R B;  4C56 C;  2DYO A;  3DBS A;  5DPT A;  3FLV A;  4W9I A;  4AWJ A;  4CHJ A;  1RRB A;  1KLG D;  2ONQ A;  2D3C A;  3IT6 B;  3NZU A;  4EZL A;  1QOG A;  2DHK A;  2UVM A;  1MVK A;  4XGA B;  3VFK A;  4RGT A;  4II3 B;  2KR0 A;  1MG8 A;  4M8M A;  2KDM A;  4US9 A;  2D9Z A;  3U12 A;  2WS3 B;  2J52 A;  4OT1 A;  1J0G A;  2KJR A;  3QX1 A;  4WSF A;  4MAC A;  2BB5 A;  2OJW A;  1ENF A;  1WX7 A;  1HQR D;  1WJ4 A;  5LXI B;  1V49 A;  4L1B A;  3AEC B;  3ZNG C;  4KGT A;  3VVW B;  3F0W A;  2BVC A;  3RZF A;  1NYR A;  2ABD A;  2L0T A;  2ZVO A;  1YJJ A;  1GUA B;  1WYW B;  3DWG C;  4QJ4 B;  4ARC A;  1QLB B;  2ROZ B;  2FCN A;  2NS5 A;  2YS3 A;  4EKU A;  3OWE B;  4GDK B;  5L95 C;  1I7H A;  1C9F A;  2D07 B;  4AOF A;  4MJS A;  1NI3 A;  2Z59 B;  1JWM D;  2C7H A;  3NHE B;  2DIK A;  2YEP B;  3AB5 A;  3VHT C;  1MG4 A;  2QKL A;  3WAL A;  1OEY A;  2VZK D;  2BQQ A;  4OVU A;  3APD A;  2WWZ A;  3PLU A;  3SU8 X;  4MDK E;  2LVQ A;  4JKG A;  4JLC A;  1FM0 D;  1VJK A;  3QWM A;  2WXP A;  3ZTC A;  3RYT A;  1GC7 A;  3L10 B;  1B1Z A;  2XK5 A;  4OZC A;  1YIW A;  1DIK A;  2MBB B;  3IAM 1;  2PKO A;  2R0D A;  1AWD A;  1ST7 A;  3DWM A;  3Q8B A;  4C00 A;  2MJE A;  3H8H A;  2NR2 A;  1XLO A;  2RQ1 A;  1NTY A;  3LXF A;  3ULC A;  4TMA B;  1L7Y A;  3KUD B;  1FHO A;  4CHK A;  1PUT A;  1C76 A;  2PE9 A;  1V80 A;  4NAM A;  3CF6 E;  4AQ7 A;  1T0R C;  4WAF A;  2J59 M;  2ACZ B;  1C4P A;  2G1E A;  1XCG A;  4LNF A;  3AU4 A;  1SXT A;  1EF5 A;  2D9V A;  1T0S C;  2KIE A;  2CR5 A;  3DVN V;  2Z4D A;  3VTV A;  2ROV A;  3Q3J A;  1WGU A;  3HVD A;  2D3A A;  3SBT A;  1WVH A;  4ICU A;  2H7D A;  2ZNV C;  4I6P A;  1IYF A;  2QKM A;  3OJ4 B;  2MBH A;  1VZ6 A;  4LNN A;  4HAT B;  2CJN A;  1BWN A;  1X86 A;  4ASW C;  4RF1 A;  3TJP A;  5BMH A;  2IJ0 A;  5AZF A;  1NU2 A;  3VXW A;  1TJ6 A;  4JIO U;  2RDG A;  3Q6B A;  2EEL A;  4M00 A;  1HB6 A;  1KF6 B;  3I3T B;  4P6V F;  1X11 A;  2JSV X;  4TUU A;  2FUG 1;  1W1G A;  3K9P B;  1KZ7 A;  3ETR A;  1RRP B;  4HAX B;  1ET9 A;  3RPF C;  3ZLZ A;  2YF0 A;  3Q8E A;  2LVO A;  2DX1 A;  3OHM B;  3ODO A;  3PT2 B;  4BVU C;  3BJI A;  1PGB A;  4UDU C;  1M94 A;  2OTX A;  1F2R C;  4KIK A;  3W9C B;  2FE8 A;  1EM7 A;  2IBI B;  4US8 A;  1WZ3 A;  1C79 A;  3P4R B;  3E9P A;  4FUL A;  4FJY A;  3E66 A;  5LG4 B;  1IRS A;  3H7P A;  1SBB B;  3NY5 A;  4M02 A;  2HJ8 A;  4QAY A;  1EWC A;  2WNM A;  2GJY A;  2N9X A;  1L0X B;  3Q69 A;  1JWA D;  3KWV A;  2L32 A;  3TW1 A;  1N5X A;  2RVB B;  3T3N A;  2WXF A;  2YS5 A;  1SGH A;  3SDL C;  4EJN A;  3Q3M C;  3GZN B;  2JRI B;  3PSC A;  1NTV A;  3AMZ A;  2W2X C;  1JWU D;  5HFY A;  1DRO A;  3AE4 B;  2R09 A;  2KAC A;  3VUW A;  1I4H A;  1UD7 A;  4HPM B;  4Z2N A;  2DZI A;  2WXO A;  1MK9 B;  1WY8 A;  1WE7 A;  2KNB A;  2AL6 A;  3ZVV A;  2YLM A;  4WJQ A;  1I42 A;  3V61 A;  4HDO A;  2UZR A;  3FP5 A;  1EGX A;  3E9L A;  1T3Q A;  2LEK A;  2JXX A;  2PLP A;  3AE6 B;  5FR6 A;  2KUQ A;  2INC C;  1PFJ A;  3VUX A;  1P98 A;  4WJP A;  1K51 A;  4JWU C;  2KT7 A;  1JDE A;  2D10 A;  1T77 A;  1SIJ A;  5FK9 C;  2DYQ A;  2NBV A;  3GP7 A;  3P1M A;  4LJO B;  1RM6 C;  5IOI A;  5JHG A;  3WCQ A;  1STE A;  1TY2 A;  3UGB B;  1FO4 A;  2WXR A;  1KH0 A;  1U27 A;  3SNH A;  3NW8 A;  2DA0 A;  5DIF B;  2K39 A;  3L54 A;  3AEA B;  3PGE A;  2C5L C;  2KFK A;  1VBG A;  3DOW A;  1VZ7 A;  3BVM A;  2H7E A;  3BYY B;  1MAI A;  1UNQ A;  5CTR C;  4I6L B;  2XBB C;  3DBL B;  2MBQ A;  1QC6 A;  2PPH A;  1H10 A;  3NVV A;  2N7J A;  3KSY A;  4D0N B;  2PVO D;  4WJO A;  1WZ0 A;  1ZW7 A;  1SEB D;  1TKE A;  1FAO A;  1VRA B;  1GB4 A;  1E7U A;  3E56 A;  1Q10 A;  3PHW B;  1RWS A;  4S0R A;  4BOS C;  3DHI C;  3V6E B;  1XKE A;  1YMH E;  4Q2J A;  2KJ6 A;  2RPQ A;  1PYW D;  2KMA A;  2HE7 A;  5JVL A;  3QHT A;  4HB4 B;  4WVF B;  1HXY D;  1FCC C;  5BYR A;  4B6H A;  1TIF A;  1SJH D;  2K2J A;  4RGN A;  2K49 A;  3URY A;  4KKI A;  3VOQ A;  1Z2M A;  2N7E A;  2NPT B;  3TMP B;  2H89 B;  4P1C C;  3U4E G;  2N4F A;  4NQL B;  5C23 A;  1WI0 A;  2MLB A;  3SEB A;  2BTE A;  2FJ9 A;  5IN7 A;  3DBR B;  2LWP A;  5C5B A;  4BBN C;  2Y5P A;  4FLH A;  2RSG A;  2NZ8 B;  1TKG A;  2DFK A;  3SFE B;  2MEK A;  5JHH A;  1E8Z A;  2KTF A;  3ZNH B;  5D3X A;  1L4D B;  1SE4 A;  2M17 A;  2NCN A;  1WJM A;  2I5C A;  4N6E B;  1V1O A;  4DDI D;  1MK7 B;  3VRB B;  1OQY A;  2NMQ A;  3FAH A;  1MIZ B;  4ANW A;  1EWY C;  4HRO A;  1Z5S B;  2UU7 A;  4HEA 1;  4HAW B;  3PLV A;  2BS4 B;  2E6X A;  2D11 A;  2KAN A;  1WGH A;  5G5H A;  2LUM A;  2FNJ B;  2K0P A;  3HK0 A;  2CS4 A;  2HDE A;  3BK1 A;  4KGR A;  2R61 A;  2K5P A;  3AH7 A;  1T6B X;  1ZKH A;  4TSS A;  1A70 A;  3FEH A;  5BYS A;  3SBG A;  3K9O B;  3U2S C;  3LYY A;  2LRW A;  1KTK A;  1FXT B;  1P6S A;  1OFF A;  3FSS A;  3MFG A;  3I9V 1;  3OG5 A;  2W55 A;  2LVP A;  2M4N A;  2K25 A;  1Q5W B;  1XD3 B;  3HM3 A;  1XT9 B;  5TR5 A;  3I5J C;  1E7V A;  2MW5 A;  1WRI A;  3P4S B;  3PV1 A;  3AE8 B;  3V6C B;  1JW9 D;  2JYT A;  1KC7 A;  3MC0 B;  4A8X C;  2W82 A;  4DX8 A;  2BW2 A;  4ZYN A;  4BBN F;  3DPD A;  4RH6 A;  2FJL A;  4TQ1 A;  2Z0E B;  3L16 A;  2OQB A;  4K17 A;  2ELB A;  3VAW A;  3WAO A;  4HDQ A;  1BUI C;  1WG7 A;  2DKP A;  4DX9 0;  4OZB A;  3NWF A;  4DXA B;  1TXD A;  1WR1 A;  4FA6 A;  1QOB A;  1XQQ A;  1OQQ A;  2C7M B;  1EF1 A;  1DOI A;  4ZHO A;  2P8V A;  5C16 A;  3IT4 B;  3M1I B;  3ZGZ A;  3IHP C;  2WDR B;  1C4C A;  3P4Q B;  5H8Y E;  2K9X A;  5CLQ B;  3HQC A;  4M01 A;  4DQO C;  4MSQ B;  4PS7 A;  1SHC A;  4GU2 A;  5JHA A;  1NBF C;  1UF0 A;  2CJO A;  2RLO A;  1BXT A;  1DOX A;  3FC4 A;  1S1Q B;  2YEP F;  1FRR A;  1YX5 B;  4W9G A;  2QDF A;  1E90 A;  1V8C A;  1D4B A;  4H8S A;  1C1Y B;  1W1D A;  4ZRJ A;  2DWQ A;  3A4S C;  4CHM A;  4RM9 A;  2KDE B;  4JL9 A;  4JKD A;  2J53 A;  5LLI A;  3DXD A;  5DPR A;  4E71 A;  1Q1O A;  2EMT A;  1UEF A;  2J0K A;  3UI3 A;  3GB1 A;  1IBX B;  1XD4 A;  2HTH B;  4II2 B;  4MH0 E;  1YQ4 B;  2Z8L A;  3ALB A;  3ZXR A;  4QJ5 B;  1F77 A;  1FNV A;  3B9J A;  4F7G A;  5BMG A;  1LB1 A;  3MDB C;  1WGR A;  2O6V D;  1FGY A;  2INP E;  1BTN A;  3I63 C;  2V4L A;  3RUL A;  4GOU A;  2DX5 A;  1HZ5 A;  1FGZ A;  1V5U A;  2KX3 A;  1I2H A;  3DVG X;  3A9K B;  1NI2 A;  4N9F 4;  4QJ3 B;  2X18 A;  3U7Z A;  3OJ3 A;  3UIN B;  2N1W A;  3ENB A;  2DYM A;  3GE8 C;  2Z0P A;  2KO3 A;  2RGF A;  4HVB A;  2ICI A;  3MC9 A;  3D32 A;  2GBN A;  2BS2 B;  2N0S B;  2D9X A;  4GZU A;  2PIA A;  3ZKJ C;  4W9K A;  5KHO A;  3P42 A;  1QT9 A;  2KMC A;  4DBG A;  2WXK A;  1U5G A;  3QK0 A;  2ADZ A;  2M8S A;  2J0M A;  4KZC A;  1UGJ A;  2RPV A;  1SB3 C;  5KQ4 A;  4C4V A;  1J7C A;  2MA9 B;  4LTU A;  5E6P A;  1UBQ A;  3JSV B;  1GOZ A;  2DLW A;  4P7I A;  4EOY A;  1D5M C;  4HK2 A;  1SE2 A;  3NOB A;  1ZC4 B;  2L8J A;  2KAJ A;  1AN8 A;  1V61 A;  1FXA A;  2IFS A;  3ML4 A;  1GJZ A;  1V89 A;  2WXG A;  5KCV A;  2TSS A;  1YN4 A;  2WDT B;  1IGC A;  4A3O A;  3QJZ A;  4P1B C;  2W2W A;  4A90 A;  3L4P A;  2XNA C;  2WX1 A;  4OHJ A;  3KRX A;  2P0F A;  4OW0 A;  2Q5W D;  4FXC A;  5IKC M;  3WAM A;  2DAF A;  5T8I A;  5I2S A;  4B95 A;  4ZRP A;  1P3Q U;  2K3U A;  1YOV B;  3V05 A;  1TKY A;  4JGH B;  2G4D B;  2N9L A;  4HB0 B;  2ELA A;  2GI9 A;  1F9J A;  4Z2M B;  3A58 A;  2BWF A;  2W3R A;  1WXS A;  1GB1 A;  2MWS B;  3B08 A;  5BO4 B;  3RI7 C;  4IM2 A;  2L0F A;  1C77 A;  4MY6 A;  2LUL A;  2FID A;  1WGK A;  4LDT B;  3W1Y A;  1KBL A;  2M19 A;  1DDM A;  2L83 A;  2MP2 B;  3L13 A;  4ILJ A;  1KM7 A;  1V1P A;  5D6J B;  1IUE A;  3VDZ A;  1ZSQ A;  2DLB A;  2IO0 B;  1JRP A;  4WWN A;  1C78 A;  1ZXH A;  1JWB D;  2MWN B;  1T0Q C;  1ZE3 D;  2MBO A;  2D2Q A;  2HJ1 A;  1KJT A;  1RFA A;  3S2A A;  1TYG B;  1YQB A;  5IP4 D;  1L2N A;  5GOW B;  2CY4 A;  1J8C A;  3WAP A;  2DHZ A;  3BVG A;  1GAQ B;  3Q8F A;  2GUM A;  2LOX A;  3PTF C;  1WE6 A;  4S17 A;  4EE2 A;  1XLN A;  2O6V B;  1AAR A;  3PRM B;  3Q8A A;  3B2F A;  3HSA A;  1M7R A;  2CAY A;  1WMH A;  3TVV A;  1TQZ A;  1EUV B;  3QAQ A;  4F1S A;  1R4M I;  1VBH A;  1E8X A;  1XO3 A;  2L3Z A;  4W9D A;  2AQ1 B;  3SV1 A;  3VRA B;  2UYZ B;  1FFU A;  3AM9 A;  1B55 A;  3BII D;  2NPT A;  3EEC A;  2COC A;  3CWI A;  3KY9 A;  2RSU A;  2IDY A;  2XEW A;  1BAK A;  1Y5O A;  3RZW C;  1I7A A;  3O96 A;  3N20 C;  3APF A;  2BF8 B;  2QIE B;  3AED B;  2QHO A;  5J3Y A;  4KX6 B;  4W9J A;  1WJU A;  2J7Q B;  5D3Y A;  1Y56 A;  2NVU I;  3R3M A;  2AEH A;  3BY4 B;  5FR3 A;  1WXA A;  1ZUD 2;  4EZK A;  2MKR A;  3JYU A;  2NBU A;  4GDL B;  1E9M A;  3X23 A;  1L5P A;  4AUQ C;  3VTW A;  1FHX A;  1U5F A;  4LNI A;  2GCL A;  2CU1 A;  2KLC A;  1WIA A;  2V4I B;  4KHB B;  2EC1 A;  4MGI E;  5J2R A;  2IPK D;  1NYQ A;  3GYO A;  2RDH A;  2JXT A;  5C79 A;  4K7S A;  2ZVN A;  3LDZ E;  1V81 A;  5I4D A;  1S3S G;  2R2Q A;  3Q3O C;  3MP9 A;  4WQM A;  2IYB A;  1MJD A;  2GBK A;  2ZPN A;  2Y5C A;  4C7Y A;  1V2Y A;  2MJ3 A;  3VR8 B;  1I4Q A;  1KOT A;  2IO2 B;  2KWD A;  3UF8 A;  1WGQ A;  1SE9 A;  5EE1 A;  2KQ7 A;  4YTN B;  4YSY B;  3W1S C;  1D6E C;  4XDD A;  2CHZ A;  1AWE A;  2K8E A;  1TS3 A;  2M0X A;  2OOB B;  2W54 A;  1TS4 A;  2LOZ A;  1NVI D;  1JWS D;  3TEY A;  2MH7 A;  3U8Z A;  1YN5 A;  4M8N A;  3NS1 A;  2E2X A;  4XWW A;  1ZOY B;  4J3O D;  4NPN A;  1L0V B;  3U52 E;  2MRP A;  2PVG C;  5C6R A;  2LMC A;  4A20 A;  3GOE A;  3EA6 A;  1FXI A;  1XLP A;  1P0R A;  3HVZ A;  2FCS A;  3N1Z C;  1TS5 A;  4HPL B;  4W9H A;  4BKS A;  1U5E A;  4JWS C;  2FDQ A;  2I1K A;  3RMK C;  1XR0 B;  2N23 A;  2Y8G A;  2DNF A;  4ANV A;  3NS8 A;  3U7D A;  2KC2 A;  2Z0Q A;  3N1Y C;  4JKE A;  2QIL A;  3PZ7 A;  4DXF A;  2JWU A;  1FD6 A;  4HKQ A;  3AE7 B;  2LJI A;  2KCJ A;  4A6K A;  2R82 A;  3BZD B;  1MHH E;  1V5P A;  1A5R A;  2Y8F A;  3A1Q B;  2AYO B;  3VIA A;  4J6I A;  1J7B A;  4CQN A;  2D5G A;  3PG7 A;  2IYD B;  4GLS C;  4MEM A;  2FUH B;  1CMX B;  2DZJ A;  4OZA A;  4IDI A;  4AP4 C;  2D9W A;  5CHV C;  1KLV A;  2LXC A;  2RR9 A;  1KFY B;  1LFD A;  2GOW A;  3TUO A;  1IBX A;  1FEH A;  2KTR B;  1U4A A;  2LGI A;  2KWV B;  4HCN B;  2GBR A;  1VLB A;  3UQA A;  2Y7B A;  4IUM B;  1WFY A;  1B9R A;  4GN1 A;  3AU5 A;  2VZK B;  5D3W A;  4YSZ B;  1EAZ A;  4M0W B;  3QBV B;  1TBE A;  3RFZ B;  3DBH I;  4HJG E;  2OHF A;  3W2D A;  3A9K A;  3ZJV A;  2IGG A;  3ML9 A;  2R2O A;  2Q13 A;  2KN4 A;  2BS3 B;  5DH9 B;  1WXQ A;  3IAS 1;  2PE6 B;  4PNK A;  2KIG A;  5LOP B;  1MI0 A;  3A98 B;  5HI1 A;  1ZGU B;  2QJL A;  2GBM A;  1UH6 A;  4IOI E;  3WYF B;  3G9W A;  2K00 A;  2CKH B;  3AEE B;  4CYE A;  3PRP B;  1RAX A;  5G55 A;  4FBJ B;  3AXC A;  1HA5 A;  2I38 A;  2NBW B;  5D7G A;  5D3V A;  3QAR A;  2W9N A;  4K81 A;  1P7E A;  4MM3 B;  3LJU X;  1V86 A;  1UZX B;  2GMI C;  4Y94 A;  4YXD B;  2EMS A;  1HTO A;  4G50 A;  3O13 A;  2AX5 A;  5DPW A;  3CSF A;  3NVZ A;  5CX3 A;  3RNC C;  2LGD A;  1HE8 A;  2OJR A;  4KSK C;  4W9E A;  2PW9 A;  3NZ3 A;  4D6W A;  5G5G A;  4D2K A;  1XEE A;  2KWC A;  2LYD A;  2RRF A;  1JRU A;  4RF0 A;  2L2I A;  3A9J A;  1YN3 A;  4GOC A;  4BKS D;  3V5W A;  2DKQ A;  5H92 C;  1TZ1 A;  3TCA A;  2V3S A;  3AV8 A;  4MEL A;  4IWP A;  2FAZ A;  2LGS A;  3KWL A;  1YD8 U;  2MHJ A;  1FNU A;  2REX A;  2K2U A;  5JP4 A;  4B9K A;  2VRW B;  1ZP0 B;  1XOD A;  1OQR A;  4B0E A;  3MHZ A;  4FJV B;  2PZ1 A;  3F5R A;  5KHQ A;  5LON B;  3ZTD A;  1Q67 A;  1X1F A;  2QMT A;  3ZW3 A;  4REZ A;  1X05 A;  2G9H D;  1WGG A;  1V88 A;  2O2V B;  4XWT A;  2YT0 A;  3FIL B;  1P7F A;  1JCK B;  1RLF A;  5E6N A;  2D3G A;  1M7E A;  1L6V A;  4IWQ A;  4RGO S;  2MP2 A;  4MT5 A;  1XX0 A;  3TEX A;  2M1M A;  2N1V A;  1JQ4 A;  4MGY E;  3PVW A;  3VQI A;  3AUL A;  1N62 A;  2DTC A;  2KDB A;  3D8F A;  2C9W B;  1J7A A;  5TSS A;  1TJE A;  4JKG B;  2W2X D;  4FJZ A;  2IY0 B;  5GXG B;  4DBB A;  2XK5 B;  4YTP B;  3V60 A;  2A5U A;  3NWD A;  4GNK B;  3HW2 B;  2FCM A;  4K3B A;  3NG0 A;  3HRD D;  2AQ2 B;  1N63 A;  3ZJU A;  5DHF B;  3ECI A;  3WIM A;  3AEF B;  2IGD A;  4ANU A;  3KUZ A;  2LG1 A;  3N3K B;  4X57 B;  4GDK A;  2AQ3 B;  2KXJ A;  2WQY B;  4I6N B;  3RNB C;  2Z59 A;  1I4P A;  2WP9 B;  3KZ1 A;  2ZJD A;  4MSM B;  2JQR B;  3V62 A;  2JZZ A;  2KQS A;  2OED A;  2XQN M;  1XCT L;  4ITK A;  1L4Z B;  3PO0 A;  1WGY A;  3UZT A;  3EUB 2;  4IOY X;  1MKE A;  2Z0O A;  2BYE A;  5HHD G;  1XLQ A;  3RNF C;  2FJU B;  4F7H A;  3R7Q A;  1DDV A;  1K5D B;  4WQO B;  4JK8 A;  2JPH A;  1E5W A;  4PS8 A;  3RN9 C;  1TY0 A;  2L00 B;  2ZEQ A;  4EEW A;  3RNG C;  4MGZ E;  4BKG A;  3B2G A;  4BBK A;  4ILG B;  3VH4 B;  4H2A A;  1E8W A;  4KDL B;  4KHB A;  2WXQ A;  4TQ0 A;  5AEK B;  4ACF A;  1WM2 A;  3MC8 A;  4A3P A;  4FN2 A;  2L7R A;  4CO7 A;  1NTI A;  4BKT A;  2MX2 A;  3TSS A;  1QKZ A;  1DDW A;  5J3Q A;  2DAJ A;  4ZHP A;  2PTL A;  1T0Y A;  3IXS A;  1U2B A;  4NAW B;  1ZC3 B;  3ZRF A;  4IKG A;  3VUY A;  2KGX B;  3APC A;  4XX5 A;  4GGQ A;  4JQW C;  4WAA A;  4USA A;  3E9S A;  3FM8 C;  4RGM A;  1V5O A;  1U5D A;  1R4N I;  2MCN B;  1KRH A;  4KIK B;  1ZM0 A;  4KDI C;  2JWZ A;  2KC1 A;  2COP A;  4G0N B;  1L6U A;  1H4R A;  1WGD A;  4DIX A;  1ET6 A;  3H7P B;  1E10 A;  3QQ8 B;  2MJD A;  4F7Z A;  4E3C A;  1WM3 A;  1P5T A;  1FFV A;  3ULB A;  4JKA A;  1NEK B;  3QCA A;  2BYF A;  2IO1 B;  2X8X X;  2G45 B;  1I4R A;  1TGZ B;  3JW0 X;  2PEA A;  3ONS A;  3VTU A;  1QIL A;  1AQC A;  5E6J A;  2GS0 A;  2N9P C;  2JVC A;  4KV2 A;  2KUP A;  4TV3 A;  2KHW B;  1NDD A;  3DXE A;  4BOZ B;  4ZDV A;  2B76 B;  1ZVR A;  1ZPS A;  2PJH A;  3ODX A;  2L05 A;  3HIE A;  1V5T A;  3ZIM A;  3A4R A; 
#chains in the Genus database with same CATH homology
 2VSZ A;  2VRR B;  3MTN B;  3KH0 A;  4DDG D;  3UIO B;  2VKI A;  2NBV B;  3A1Q A;  4NQK E;  3PEG A;  4KHA A;  3PVU A;  2M14 A;  4EZJ A;  4A5K A;  1GNU A;  5E6O A;  2IZV B;  3A33 B;  4IG7 B;  3U30 A;  2KFK B;  3RCZ A;  2I5F A;  2BYV E;  3TIX A;  3R7R A;  4DK5 A;  2BWE S;  3PRE A;  4EUT A;  5G2N A;  4DHZ E;  3AI5 A;  3T9L A;  3RUI B;  1OMW A;  3OAW A;  4WJ7 A;  1Y19 B;  5JH5 C;  2KX0 A;  3PP2 A;  3DVN U;  3PS6 A;  5EDS A;  2L1C A;  3ZNZ B;  2JY6 A;  1VD2 A;  4XZ4 A;  2MQJ A;  3SO6 A;  2K8C A;  1EO6 A;  1GC6 A;  4JKB A;  3M62 B;  4BFR A;  2KOX A;  2KWU B;  4GMV A;  4PYU A;  3ZNI D;  2K8B A;  3PVL A;  1I35 A;  3P6A A;  4GB9 A;  2HRJ A;  4IM3 A;  4IC7 B;  1D3Z A;  4KAX B;  1H8C A;  3RCP A;  3OAN A;  2KN5 A;  2G3Q B;  4MM3 A;  3IVF A;  2B3A A;  3SHQ A;  1UGM A;  5JLJ B;  4RM8 A;  1YX6 B;  1LW3 A;  1C3T A;  5C5B B;  2D4Q A;  1PQS A;  3NSU A;  4XC2 A;  4KVG B;  5JZE B;  4GIV A;  2YS1 A;  2LAS A;  2COD A;  4A6F B;  2KKC A;  5D2M B;  2X0S A;  4G11 A;  3ZDM C;  5J18 A;  5IAA C;  3E9O A;  4HCP B;  4OVV A;  5L83 A;  5HE2 A;  1UBI A;  4AJY B;  4NY0 A;  2RUK B;  2IY1 B;  2LJ5 A;  1Q0W B;  2LGY A;  2EJ8 A;  2FCQ A;  4HAU B;  2O2V A;  1GGO A;  2YT1 A;  2CY5 A;  3HHM A;  4URK A;  2COF A;  1FHW A;  2K1F A;  3CXB B;  3N32 A;  1WH3 A;  2JF5 A;  1K8R B;  2ASQ A;  5GMV A;  3VH3 B;  3L08 A;  1WF9 A;  5DCN A;  2EKE C;  4HXD A;  3IFW B;  4GXB A;  3H6N A;  4G3X B;  3P7Z A;  5FI0 A;  1WR6 E;  3BIN A;  2UZS A;  4HB3 B;  1WJN A;  2N7D A;  2V1Y A;  4YON A;  2YRY A;  4ILH A;  2YVC A;  2ZCB A;  1RJ2 A;  2J0J A;  1VCB A;  4IAP A;  4JKF A;  3C0R B;  3KYD D;  2P0H A;  3PSE B;  3IBE A;  3W1S A;  2LGX A;  1W1H A;  4K7W A;  3B1L X;  5D94 A;  4ZRI A;  3SUZ A;  1UNR A;  3HIZ A;  4GSW A;  1X1G A;  1OTR B;  3PHX B;  2DHJ A;  3D8E A;  4K2P A;  4B6W A;  2G4S A;  2DX5 B;  1BTK A;  1UNP A;  3ZUN A;  3EFU A;  1SIF A;  4HB2 B;  2DEN B;  2AL3 A;  4NAW A;  1J19 A;  2KVR A;  3KVF B;  3AJ4 A;  5IJM A;  1WJ1 A;  2M38 A;  1DBH A;  4GMX B;  3DDC B;  3H1U A;  3O65 B;  4WWO A;  2ZCC A;  3DXC A;  3T8M A;  3SD5 A;  4HLE A;  2HTH A;  2DZM A;  2KZR A;  2MBE A;  4FHJ A;  5AZG A;  3ZDT A;  4NSW A;  4FAD A;  4GPT B;  2KLG A;  2FIF A;  3KW5 B;  2KDI A;  5IA7 A;  4C0A A;  4XWX A;  2C60 A;  2DZK A;  1V6E A;  2V76 A;  4WJN A;  2P0D A;  5J3T A;  4TKN A;  4RMA A;  2CHW A;  2JP2 A;  2L76 A;  3RD2 A;  3PZD A;  5HKH A;  3ML8 A;  3X0W A;  2JT4 B;  5CHW A;  3QC8 B;  2CQU A;  3QWZ B;  3JSV A;  1Z87 A;  4F8C B;  1UPR A;  3WA0 A;  5DPS A;  3TFM A;  4MK0 A;  5LXH A;  1QQG A;  3ZVR A;  2MDX A;  3MJW A;  5DHA B;  3JVZ X;  2CB8 A;  1P9D U;  1KZG A;  4IW0 A;  2KDF B;  2LKO A;  1LQB A;  3QIJ A;  3A8P A;  1GG3 A;  3L17 A;  1E8Y A;  1UEL A;  2Z0D B;  3EHV A;  1OQN A;  1P1A A;  2MFQ A;  4KZ0 A;  4E74 A;  1MIX A;  4HAZ B;  2ZPY A;  3CIK A;  2GBJ A;  3KYC D;  4IFS A;  3GYP A;  4TYZ A;  1WMH B;  3QA8 A;  3M3J A;  1V9J A;  3HM6 X;  3SYX A;  1V5M A;  1X1M A;  3GZN I;  3OLM D;  3UQB A;  1OY2 A;  3MHS D;  3ZO5 B;  4MJS B;  4JK7 A;  2JRH A;  3PRZ A;  4HAY B;  3B0A A;  4NNJ B;  1MPH A;  1PLS A;  2K6D B;  2BGF A;  2C7N B;  2G35 A;  5HE3 A;  1LXD A;  1NVL A;  5DI9 B;  2YSZ A;  4KSL C;  2LI5 A;  5HE0 A;  4A6F A;  1P3R A;  4ICV A;  3LJ3 A;  4EFO A;  1HB8 A;  4HHV A;  4HJK A;  2O6V A;  2CHX A;  2A4Z A;  2KK8 A;  5L81 A;  4AJW A;  3L0W B;  4DWF A;  4L6E A;  3UIP B;  3DVG Y;  4NJ7 A;  3M95 A;  1WI1 A;  3N30 A;  4W9L A;  3DBL I;  2BKR B;  2WX0 A;  3NZS A;  2K6Q A;  2LD9 A;  2IO3 B;  4JKC A;  3Q3F A;  3A8Q A;  4DHJ D;  3RT3 B;  2UWQ A;  2JZ3 B;  5CLL B;  4F7U P;  5J17 A;  4GDL A;  1LM8 B;  3DQV A;  3M63 B;  1J0W A;  2RD0 A;  3KUC B;  2LZ6 A;  2COA A;  4FHK A;  2ZNV B;  5AZH A;  4KHO A;  2RNR B;  2NMB A;  2BPS A;  2JUO A;  3CST A;  2WH5 A;  2GCJ A;  1WXM A;  1TTN A;  1IPG A;  3WAN A;  2KFJ A;  4PS3 A;  1N3H A;  4IM0 A;  1PMS A;  4A6H A;  3DBR I;  1ACA A;  2BKF A;  4MGK E;  4LDT D;  3D8D A;  2BCJ A;  2WYQ A;  2LUE A;  2KD0 A;  1OGW A;  1WXV A;  4HWI B;  1IP9 A;  3P2B A;  4DHZ B;  4JKH A;  5KQ1 A;  4ANX A;  5HE1 A;  3ODW A;  2D9Y A;  2LXA A;  5EFX A;  1OEY J;  3PPA A;  1FOE A;  4K2O A;  2KJH B;  3TBL D;  2DN6 A;  1UPQ A;  2MSE D;  2DHI A;  2DYN A;  5C1Z A;  3EPY A;  2HD5 B;  2N0Y A;  1G6J A;  1Y8R C;  5JHB A;  5FI1 A;  3H9D A;  1DYN A;  2AWT A;  4NJ6 A;  2CRF A;  4IWO A;  4MT7 A;  2I1J A;  3R66 C;  4EMO A;  4LCD E;  3TL5 A;  4PQ0 A;  1EVH A;  4YL8 A;  3ZRC A;  2RGN B;  1U29 A;  1WX9 A;  1QZE A;  3CMM B;  1WX8 A;  1WRD B;  3H7S A;  5D27 A;  3N7C A;  2KTR A;  2LRU A;  2ZZP B;  1YJ1 A;  3EC8 A;  4HAV B;  1WJ6 A;  3KRW A;  2Y5B B;  4DHJ B;  2N9E B;  3T06 A;  2K8H A;  1FB8 A;  3A9J B;  5CHF A;  1BT0 A;  1HBK A;  4JK9 A;  3IG3 A;  3TO1 A;  4WWP A;  3DCG A;  4PYZ A;  3MPX A;  2LBB A;  4ZRK A;  3ENE A;  4W9F A;  4K7U A;  4W9C A;  4LJP B;  2DYB A;  1K5G B;  1KI1 B;  1ISN A;  4K1R B;  2DYO A;  3DBS A;  5DPT A;  3FLV A;  4W9I A;  4AWJ A;  4CHJ A;  1RRB A;  3NZU A;  4EZL A;  2DHK A;  2UVM A;  3VFK A;  4II3 B;  1MG8 A;  4M8M A;  2D9Z A;  1J0G A;  2KJR A;  3QX1 A;  4WSF A;  1WX7 A;  1WJ4 A;  5LXI B;  1V49 A;  3ZNG C;  3VVW B;  3F0W A;  3RZF A;  2L0T A;  2ABD A;  2ZVO A;  1GUA B;  1WYW B;  2ROZ B;  2FCN A;  2NS5 A;  2YS3 A;  4EKU A;  4GDK B;  5L95 C;  2D07 B;  4AOF A;  4MJS A;  2Z59 B;  2C7H A;  3NHE B;  2DIK A;  3VHT C;  2QKL A;  3WAL A;  1OEY A;  4OVU A;  3APD A;  2WWZ A;  3PLU A;  3SU8 X;  4MDK E;  2LVQ A;  4JKG A;  4JLC A;  3QWM A;  3ZTC A;  3RYT A;  1GC7 A;  3L10 B;  2XK5 A;  1YIW A;  1DIK A;  2MBB B;  2R0D A;  1ST7 A;  2NR2 A;  2RQ1 A;  1NTY A;  3ULC A;  1L7Y A;  3KUD B;  1FHO A;  4CHK A;  2PE9 A;  1V80 A;  3CF6 E;  2J59 M;  1XCG A;  3AU4 A;  1EF5 A;  2D9V A;  2CR5 A;  3DVN V;  3VTV A;  2ROV A;  3Q3J A;  1WGU A;  3SBT A;  4ICU A;  1WVH A;  2H7D A;  2ZNV C;  4I6P A;  1IYF A;  2QKM A;  3OJ4 B;  2MBH A;  4HAT B;  1BWN A;  1X86 A;  4ASW C;  3TJP A;  5AZF A;  1NU2 A;  3VXW A;  1TJ6 A;  4JIO U;  1HB6 A;  3I3T B;  1X11 A;  4TUU A;  1W1G A;  3K9P B;  1KZ7 A;  1RRP B;  4HAX B;  3ZLZ A;  2YF0 A;  2LVO A;  2DX1 A;  3ODO A;  3PT2 B;  4BVU C;  3BJI A;  1M94 A;  2OTX A;  4KIK A;  2IBI B;  1WZ3 A;  4FUL A;  3E9P A;  4FJY A;  3E66 A;  1IRS A;  3H7P A;  3NY5 A;  2HJ8 A;  2GJY A;  2N9X A;  3TW1 A;  2RVB B;  2YS5 A;  1SGH A;  3SDL C;  4EJN A;  2JRI B;  3PSC A;  1NTV A;  2W2X C;  1DRO A;  2R09 A;  3VUW A;  1UD7 A;  4HPM B;  4Z2N A;  2DZI A;  1MK9 B;  1WY8 A;  1WE7 A;  2KNB A;  2AL6 A;  3ZVV A;  2YLM A;  4WJQ A;  1I42 A;  3V61 A;  4HDO A;  2UZR A;  3FP5 A;  1EGX A;  3E9L A;  2JXX A;  5FR6 A;  1PFJ A;  3VUX A;  1P98 A;  4WJP A;  1JDE A;  2D10 A;  2DYQ A;  4LJO B;  5JHG A;  3UGB B;  1U27 A;  3SNH A;  2DA0 A;  5DIF B;  2K39 A;  3L54 A;  3PGE A;  2C5L C;  2KFK A;  1VBG A;  3DOW A;  2H7E A;  1MAI A;  1UNQ A;  5CTR C;  4I6L B;  2XBB C;  2MBQ A;  1QC6 A;  2PPH A;  1H10 A;  3KSY A;  4D0N B;  4WJO A;  1WZ0 A;  1ZW7 A;  1FAO A;  1E7U A;  3PHW B;  4BOS C;  3V6E B;  1XKE A;  2KJ6 A;  2RPQ A;  2KMA A;  2HE7 A;  5JVL A;  3QHT A;  4HB4 B;  4WVF B;  4B6H A;  2K2J A;  3VOQ A;  1Z2M A;  2N7E A;  2NPT B;  3TMP B;  2N4F A;  4NQL B;  5C23 A;  1WI0 A;  2MLB A;  2FJ9 A;  2LWP A;  5C5B A;  4BBN C;  4FLH A;  2RSG A;  2NZ8 B;  2DFK A;  5JHH A;  1E8Z A;  2KTF A;  3ZNH B;  5D3X A;  2M17 A;  2NCN A;  1WJM A;  2I5C A;  4DDI D;  1MK7 B;  1OQY A;  1MIZ B;  4ANW A;  1Z5S B;  4HAW B;  3PLV A;  2D11 A;  2KAN A;  1WGH A;  2FNJ B;  3HK0 A;  2CS4 A;  1ZKH A;  3FEH A;  3SBG A;  3K9O B;  2LRW A;  1FXT B;  1P6S A;  3FSS A;  2LVP A;  2M4N A;  2K25 A;  1Q5W B;  1XD3 B;  3HM3 A;  1XT9 B;  5TR5 A;  1E7V A;  2MW5 A;  3PV1 A;  3V6C B;  1KC7 A;  4DX8 A;  4ZYN A;  4BBN F;  3DPD A;  2FJL A;  4TQ1 A;  2Z0E B;  3L16 A;  2OQB A;  4K17 A;  2ELB A;  3VAW A;  3WAO A;  4HDQ A;  1WG7 A;  2DKP A;  4DX9 0;  4DXA B;  1TXD A;  1WR1 A;  4FA6 A;  1XQQ A;  2C7M B;  1EF1 A;  2P8V A;  5C16 A;  3M1I B;  3IHP C;  5CLQ B;  3HQC A;  4MSQ B;  4PS7 A;  1SHC A;  4GU2 A;  5JHA A;  1NBF C;  2RLO A;  1S1Q B;  4W9G A;  1YX5 B;  1E90 A;  4H8S A;  1C1Y B;  1W1D A;  4ZRJ A;  3A4S C;  4CHM A;  4RM9 A;  2KDE B;  4JL9 A;  4JKD A;  5LLI A;  3DXD A;  5DPR A;  4E71 A;  1Q1O A;  2EMT A;  1UEF A;  2J0K A;  1XD4 A;  2HTH B;  4II2 B;  4MH0 E;  3ALB A;  4F7G A;  1LB1 A;  3MDB C;  1WGR A;  2O6V D;  1FGY A;  1BTN A;  2V4L A;  3RUL A;  2DX5 A;  1FGZ A;  1V5U A;  2KX3 A;  1I2H A;  3DVG X;  3A9K B;  1NI2 A;  4N9F 4;  2X18 A;  3OJ3 A;  3UIN B;  2N1W A;  3ENB A;  2DYM A;  2Z0P A;  2KO3 A;  2RGF A;  4HVB A;  3D32 A;  2GBN A;  2D9X A;  4GZU A;  3ZKJ C;  4W9K A;  5KHO A;  2KMC A;  4DBG A;  1U5G A;  3QK0 A;  2ADZ A;  2M8S A;  2J0M A;  4KZC A;  5KQ4 A;  2MA9 B;  5E6P A;  1UBQ A;  3JSV B;  2DLW A;  4P7I A;  4EOY A;  4HK2 A;  3NOB A;  1ZC4 B;  2L8J A;  1V61 A;  2IFS A;  3ML4 A;  1GJZ A;  1V89 A;  5KCV A;  2WDT B;  4A3O A;  3QJZ A;  2W2W A;  2WX1 A;  3KRX A;  2P0F A;  3WAM A;  2DAF A;  4B95 A;  1P3Q U;  4JGH B;  2G4D B;  4HB0 B;  2ELA A;  1F9J A;  4Z2M B;  2BWF A;  1WXS A;  2MWS B;  3B08 A;  5BO4 B;  4IM2 A;  2L0F A;  4MY6 A;  2LUL A;  2FID A;  4LDT B;  3W1Y A;  1KBL A;  1DDM A;  2MP2 B;  3L13 A;  4ILJ A;  1KM7 A;  5D6J B;  3VDZ A;  1ZSQ A;  2IO0 B;  4WWN A;  2MWN B;  2MBO A;  2D2Q A;  1KJT A;  1RFA A;  3S2A A;  1YQB A;  1L2N A;  5GOW B;  2CY4 A;  1J8C A;  3WAP A;  2DHZ A;  2LOX A;  3PTF C;  1WE6 A;  2O6V B;  1AAR A;  3PRM B;  1M7R A;  2CAY A;  1WMH A;  3TVV A;  1TQZ A;  1EUV B;  3QAQ A;  4F1S A;  1R4M I;  1VBH A;  1E8X A;  2L3Z A;  4W9D A;  3SV1 A;  2UYZ B;  1B55 A;  3EEC A;  2NPT A;  2COC A;  3KY9 A;  2RSU A;  2XEW A;  1BAK A;  1Y5O A;  3RZW C;  1I7A A;  3O96 A;  3APF A;  2BF8 B;  2QHO A;  5J3Y A;  4W9J A;  1WJU A;  2J7Q B;  5D3Y A;  2NVU I;  3R3M A;  2AEH A;  3BY4 B;  1WXA A;  4EZK A;  2MKR A;  3JYU A;  2NBU A;  4GDL B;  3X23 A;  4AUQ C;  3VTW A;  1FHX A;  1U5F A;  2GCL A;  2CU1 A;  2KLC A;  1WIA A;  4KHB B;  2EC1 A;  4MGI E;  5J2R A;  3GYO A;  4K7S A;  5C79 A;  2ZVN A;  3LDZ E;  1V81 A;  1S3S G;  2R2Q A;  2IYB A;  2GBK A;  2ZPN A;  1V2Y A;  1KOT A;  2IO2 B;  3UF8 A;  1WGQ A;  1SE9 A;  2KQ7 A;  3W1S C;  2CHZ A;  1AWE A;  2M0X A;  2OOB B;  2LOZ A;  3U8Z A;  4M8N A;  2E2X A;  4NPN A;  2MRP A;  5C6R A;  4A20 A;  3GOE A;  1P0R A;  2FCS A;  4HPL B;  4W9H A;  4BKS A;  1U5E A;  2FDQ A;  2I1K A;  1XR0 B;  2N23 A;  2Y8G A;  4ANV A;  3NS8 A;  3U7D A;  2KC2 A;  2Z0Q A;  4JKE A;  2KCJ A;  4A6K A;  2R82 A;  1V5P A;  1A5R A;  2Y8F A;  3A1Q B;  2AYO B;  3VIA A;  4J6I A;  3PG7 A;  2IYD B;  4MEM A;  2FUH B;  1CMX B;  2DZJ A;  4AP4 C;  2D9W A;  5CHV C;  1KLV A;  2LXC A;  2RR9 A;  1LFD A;  2GOW A;  2KTR B;  1U4A A;  2KWV B;  4HCN B;  2GBR A;  3UQA A;  2Y7B A;  4IUM B;  1WFY A;  4GN1 A;  3AU5 A;  5D3W A;  1EAZ A;  4M0W B;  3QBV B;  1TBE A;  3DBH I;  3A9K A;  3ML9 A;  2R2O A;  2Q13 A;  5DH9 B;  2PE6 B;  4PNK A;  5LOP B;  3A98 B;  1ZGU B;  2GBM A;  1UH6 A;  3WYF B;  3G9W A;  2K00 A;  2CKH B;  4CYE A;  3PRP B;  1RAX A;  5G55 A;  4FBJ B;  3AXC A;  2NBW B;  5D7G A;  5D3V A;  3QAR A;  2W9N A;  4K81 A;  3LJU X;  1V86 A;  1UZX B;  2GMI C;  4Y94 A;  2EMS A;  4G50 A;  5DPW A;  3CSF A;  5CX3 A;  2LGD A;  1HE8 A;  2OJR A;  4KSK C;  4W9E A;  2KWC A;  2LYD A;  1JRU A;  2L2I A;  3A9J A;  4GOC A;  4BKS D;  3V5W A;  2DKQ A;  1TZ1 A;  3TCA A;  2V3S A;  4MEL A;  4IWP A;  2FAZ A;  1YD8 U;  2REX A;  2K2U A;  5JP4 A;  4B9K A;  2VRW B;  1XOD A;  4FJV B;  2PZ1 A;  3F5R A;  5KHQ A;  5LON B;  3ZTD A;  1Q67 A;  1X1F A;  3ZW3 A;  1X05 A;  1WGG A;  1V88 A;  2O2V B;  2YT0 A;  1RLF A;  5E6N A;  2D3G A;  1M7E A;  4IWQ A;  2MP2 A;  1XX0 A;  2M1M A;  2N1V A;  4MGY E;  3PVW A;  3VQI A;  3AUL A;  2DTC A;  2KDB A;  3D8F A;  2C9W B;  4JKG B;  2W2X D;  4FJZ A;  2IY0 B;  4DBB A;  2XK5 B;  3V60 A;  2A5U A;  3HW2 B;  2FCM A;  5DHF B;  3ECI A;  3WIM A;  4ANU A;  3KUZ A;  2LG1 A;  3N3K B;  4X57 B;  4GDK A;  2KXJ A;  4I6N B;  3KZ1 A;  2ZJD A;  4MSM B;  3V62 A;  2JZZ A;  2KQS A;  2XQN M;  1WGY A;  3UZT A;  4IOY X;  1MKE A;  2Z0O A;  2BYE A;  4F7H A;  3R7Q A;  1DDV A;  1K5D B;  4WQO B;  4JK8 A;  2JPH A;  1E5W A;  4PS8 A;  2L00 B;  2ZEQ A;  4EEW A;  4MGZ E;  4BKG A;  4BBK A;  4ILG B;  3VH4 B;  1E8W A;  4KDL B;  4TQ0 A;  5AEK B;  1WM2 A;  4A3P A;  4FN2 A;  2L7R A;  4CO7 A;  1NTI A;  4BKT A;  2MX2 A;  1DDW A;  5J3Q A;  2DAJ A;  1T0Y A;  1U2B A;  4NAW B;  1ZC3 B;  3ZRF A;  3VUY A;  2KGX B;  3APC A;  4XX5 A;  4GGQ A;  4JQW C;  4WAA A;  3FM8 C;  1V5O A;  1U5D A;  1R4N I;  2MCN B;  4KIK B;  1ZM0 A;  4KDI C;  2JWZ A;  2KC1 A;  2COP A;  4G0N B;  1H4R A;  1WGD A;  3H7P B;  3QQ8 B;  4F7Z A;  4E3C A;  1WM3 A;  1P5T A;  3ULB A;  4JKA A;  3QCA A;  2BYF A;  2IO1 B;  2G45 B;  1TGZ B;  3JW0 X;  2PEA A;  3ONS A;  3VTU A;  1AQC A;  2GS0 A;  2N9P C;  4TV3 A;  2JVC A;  2KUP A;  4KV2 A;  2KHW B;  1NDD A;  3DXE A;  4BOZ B;  4ZDV A;  1ZVR A;  2PJH A;  3ODX A;  2L05 A;  1V5T A;  3ZIM A;  3A4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...