3ZDTA

Crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
368
structure length
326
Chain Sequence
ERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYKKSNYEVLEKDVGLRRFFPKSLLDSVAAATLAALIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPDYAEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 89
structure length 326
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3zdtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3zdtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zdtA01
5DI9B 1MPHA 2XK5B 4YONA 1WFYA 4KV2A 4AUQC 3PREA 4AJWA 1UBIA 4KDIC 1J0GA 4PS7A 1UZXB 3ZIMA 2DX5B 3B1LX 1WYWB 2BCJA 2COCA 2KQSA 4EMOA 2PEAA 2FIFA 1P3RA 2RR9A 2WX0A 2VRWB 2VKIA 3FEHA 1ZGUB 2GBNA 3T9LA 1UBQA 4FBJB 1EO6A 3EECA 2KKCA 2EMSA 5DPRA 2KZRA 2DN6A 4KVGB 3VIAA 3JYUA 3M1IB 1E8WA 4EKUA 3A8QA 3ODWA 1WR1A 2YVCA 1Q0WB 4FJZA 3NS8A 1ZKHA 2GCJA 4IOYX 1TQZA 3FM8C 4DHZE 3L10B 1I42A 1GC6A 2DZJA 1NBFC 2Z0PA 4F7HA 2WWZA 4LDTD 1Y8RC 2UYZB 1Y19B 1DYNA 1WI1A 3PEGA 4BOSC 2R2OA 1I7AA 2Y8GA 2CR5A 2K6QA 4HK2A 2MBEA 5CX3A 5KCVA 1E8XA 4KZCA 4HAWB 4BVUC 1FAOA 3CIKA 2D11A 2KMCA 2PJHA 4DXAB 1UNPA 1IPGA 1K8RB 4ZYNA 3TFMA 4K81A 2HD5B 3L08A 2KX0A 5DPSA 3SDLC 2KUPA 2M14A 2QKMA 4TV3A 4PYUA 1PQSA 2EC1A 2ZEQA 5HE1A 1EGXA 5D7GA 5HE2A 3CMMB 1XR0B 3KW5B 5JH5C 2KC1A 4II3B 4F8CB 3A9JB 2HTHB 1WGDA 3PPAA 2MLBA 3PLVA 2Z59B 3UQAA 4A6KA 3DVNU 3A98B 3ZNID 1P0RA 3DQVA 1ZVRA 1P5TA 1FHXA 1U5DA 2EKEC 2LXAA 3N30A 2HJ8A 2NCNA 2FJLA 3EFUA 1OQNA 2PE9A 4WVFB 3PRMB 2DENB 4HAZB 1WXAA 3ECIA 2Y7BA 3TJPA 2XEWA 1KZ7A 3BINA 3VVWB 4IM0A 2Y8FA 1W1DA 1K5DB 4W9LA 4RM8A 4DDID 2DYBA 1S1QB 2YLMA 4HPMB 4K7SA 2KD0A 4M0WB 2DZIA 2DLWA 4WAAA 1W1HA 3PHWB 3C0RB 4FLHA 1I35A 1OEYJ 5G2NA 1EVHA 2RQ1A 2XK5A 1BTNA 1KZGA 2KGXB 1GJZA 2RD0A 3HQCA 3Q3JA 3N7CA 3I3TB 5CHVC 5JHGA 4ANVA 1D3ZA 1BAKA 3QQ8B 2AL3A 3NZSA 4MEMA 2ABDA 5C5BB 1U5GA 4HDQA 2A4ZA 2KXJA 1UEFA 3B0AA 3KY9A 3RULA 4BBNC 1M7EA 5E6NA 3SHQA 4MK0A 1WGYA 2KJ6A 2ZNVC 3IG3A 3L54A 4GDLA 4P7IA 1WH3A 4JL9A 2GS0A 2GJYA 3ZTDA 4AOFA 2EJ8A 4ICUA 2G4SA 4LJOB 4G50A 4KSKC 4WJNA 5AEKB 1FHWA 3LJUX 2CHZA 4WWPA 2J59M 1ZC3B 2DHKA 1LQBA 1NTVA 2DHJA 2KJRA 2BKRB 2OOBB 5TR5A 1Z5SB 5D3WA 3TCAA 2V1YA 1GG3A 4GDLB 5C6RA 3ZO5B 1TTNA 4WSFA 3PRZA 3TW1A 1WE7A 3NZUA 4HCNB 4KIKB 1LFDA 3ZVRA 1Y5OA 1OGWA 2ROZB 1WZ3A 4MH0E 2Z0EB 4X57B 2G4DB 2IY1B 1NTYA 2L0FA 2GBKA 2JZ3B 2KWCA 3H7PB 3KRXA 5GOWB 2LZ6A 2D10A 3PTFC 2B3AA 2N1VA 1OMWA 2MW5A 3A33B 2AYOB 3L17A 5KHOA 5HKHA 2MWNB 2M4NA 2MP2B 3DVGX 4G3XB 2KDEB 2KMAA 2KWUB 4Z2NA 4WQOB 4C0AA 3WANA 2ZNVB 3SUZA 2CB8A 3PP2A 3MHSD 2ELAA 1WM2A 2I5FA 1WX9A 1WXVA 2DKPA 2KNBA 3QARA 4BBNF 2YT1A 1PMSA 4HAUB 2C9WB 2W2XD 1OTRB 5CHFA 5JLJB 3LJ3A 3PG7A 1QC6A 2PZ1A 3D8EA 4W9JA 3TBLD 2RSGA 3VXWA 3ENEA 1GNUA 2O2VA 3JW0X 2BKFA 3FP5A 4PNKA 1WXMA 2D9WA 2DKQA 3SD5A 1V61A 4XWXA 5KHQA 1ZSQA 3PSCA 4LJPB 3QHTA 1MKEA 2MSED 2KOXA 3H1UA 2DTCA 3RZWC 3KRWA 4KHAA 1XCGA 1XD3B 2DYMA 3ML4A 2KX3A 2MBOA 4NQKE 3IVFA 2LRWA 3L16A 1MIXA 1WX8A 3DBSA 3HK0A 1WF9A 1A5RA 2JRHA 5DPWA 2GMIC 1L7YA 4LCDE 2K8BA 2L8JA 4F7UP 2FCSA 2K39A 1V88A 1BTKA 2JUOA 2L00B 1VD2A 2D2QA 2L7RA 2ZVNA 3K9OB 3W1SC 3K9PB 2COPA 1IYFA 2NR2A 1YX6B 4RMAA 4ZRKA 3DOWA 2CQUA 1H4RA 3ML8A 2Z0QA 3JSVB 1E7UA 1YJ1A 5D27A 2LD9A 3QJZA 4IC7B 3P6AA 1SIFA 4N9F4 2I1JA 3F5RA 1S3SG 5CLLB 5JHBA 1KLVA 2KCJA 2M1MA 2LGXA 4NQLB 4XX5A 4XZ4A 3R7RA 3WAOA 4GSWA 3APCA 3V6CB 4F7ZA 2COAA 2FAZA 2IFSA 2BWES 2CHXA 4W9CA 3ZW3A 2XBBC 3W1YA 1ST7A 4MT7A 2OJRA 4FHKA 5CTRC 2YRYA 2FUHB 3MTNB 3OLMD 3RZFA 1NU2A 3U8ZA 1E7VA 2DZMA 2AWTA 3WALA 4GB9A 4GMXB 3DXEA 2NPTA 2MRPA 5D3VA 3A9KA 4NAWA 5JP4A 5D94A 4HATB 4DX90 1FOEA 3FSSA 1V6EA 2DFKA 5J3YA 1WGGA 1UELA 2J0KA 5DHFB 5DH9B 3AJ4A 4I6PA 1I2HA 2A5UA 2IO3B 3H7PA 3NHEB 5D2MB 4A3OA 4ZDVA 2M38A 4G0NB 2MP2A 4MGKE 4D0NB 1UD7A 1ZM0A 3ULCA 2FJ9A 4WJ7A 2LKOA 2IY0B 1UH6A 1XQQA 2NPTB 2V4LA 3A9KB 2JWZA 3PRPB 4B6WA 3NSUA 2JP2A 3QBVB 4DX8A 2K25A 2KDFB 3O65B 4MSQB 1WRDB 4M8MA 4OVUA 3RD2A 4HLEA 3DXCA 2D9YA 4ICVA 1ACAA 4Z2MB 1F9JA 3SNHA 2LXCA 3GOEA 5DCNA 1CMXB 4DHJD 2N23A 2ZJDA 2C5LC 4KDLB 4EEWA 3TIXA 4PQ0A 3AU5A 3VH3B 3DBRI 4W9KA 5HE0A 4BKTA 5BO4B 4BFRA 5LXIB 1H10A 5G55A 2W2XC 1Z87A 4JGHB 1EF5A 1NDDA 4IWQA 1J19A 5L83A 3QWMA 1WMHA 3KYDD 3UIPB 3SU8X 4FN2A 4BKSA 1JRUA 4FJVB 2IBIB 2GCLA 2ZCCA 4W9DA 1Z2MA 3DVGY 4W9FA 3VAWA 3KYCD 4B95A 1C1YB 3CSFA 3D8DA 2DX1A 3ZNZB 5KQ1A 2J0MA 1LM8B 2NS5A 3OANA 2R0DA 3HM6X 2LUEA 2DHIA 3L0WB 4PS8A 4PYZA 3V60A 2AL6A 4NJ6A 3OJ3A 1WVHA 2BWFA 3U7DA 3RT3B 3O96A 1WGUA 4WJOA 1RRBA 3VTUA 4GN1A 2IO2B 1WXSA 3H9DA 4JLCA 2FCQA 4M8NA 2K2UA 3QAQA 2VSZA 2GBRA 2WDTB 2WYQA 2IO1B 4IM2A 2M8SA 4DBGA 2FIDA 2FCNA 4E74A 3EPYA 2VRRB 4TQ0A 3VFKA 1C3TA 2JY6A 2KTRA 2J7QB 2RGFA 1E8ZA 4HDOA 4XC2A 4IAPA 2KO3A 3QIJA 4TYZA 2JPHA 1WY8A 1WJ6A 3EHVA 4AJYB 4HHVA 4DHJB 2LASA 4K1RB 2CY5A 5C1ZA 2V76A 3U30A 1WX7A 4MJSA 1DBHA 1ZC4B 2O6VB 3Q3FA 2MBBB 4DWFA 1G6JA 4IFSA 5C16A 5GMVA 1N3HA 2K8CA 3ML9A 4CHKA 2E2XA 3H7SA 3KUDB 3A8PA 2KDBA 5AZFA 1V2YA 5DPTA 3GZNI 4G11A 2MA9B 4FULA 1E5WA 1M7RA 4A6HA 1FHOA 2GOWA 4HCPB 2P8VA 2OQBA 4MDKE 2IO0B 4AP4C 2KQ7A 1J8CA 1M94A 4KIKA 3VUXA 2R09A 5IJMA 2C7NB 4MGIE 1VCBA 2JZZA 4IG7B 4EFOA 1EF1A 1WJMA 2FCMA 4FA6A 1SGHA 1UNRA 4K2OA 4K17A 2R2QA 2KWVB 3BY4B 2LG1A 5FR6A 4KAXB 2LRUA 5LLIA 1HB8A 2D3GA 2MBHA 2MQJA 4AWJA 3ODOA 4IUMB 1Q67A 1UPRA 1W1GA 3F0WA 1FGZA 4IM3A 2LULA 3DBHI 3D32A 2IZVB 4IWPA 2DZKA 3UINB 1WGQA 2J0JA 2RPQA 1RAXA 2ZZPB 4HB4B 3HHMA 2DX5A 1HB6A 2QKLA 2RGNB 5J3QA 2N9XA 2RUKB 3R7QA 2LOZA 1DDWA 4TKNA 2P0DA 1P1AA 2N7EA 2KHWB 2C60A 3TO1A 4ZRIA 2KFKA 2LVPA 4I6LB 1PFJA 2BF8B 3ALBA 1Q1OA 2CKHB 4II2B 2CS4A 2W9NA 5J18A 5IA7A 3A1QA 4BBKA 3ZKJC 2DAJA 4EJNA 1MK9B 3PVUA 1WJNA 1AWEA 3PVWA 1U27A 1FB8A 4WWNA 3AI5A 4GZUA 2K2JA 1WGRA 2MX2A 2MKRA 2O6VD 2V3SA 2KDIA 1KJTA 1YIWA 2LJ5A 1XD4A 2YS3A 4H8SA 4HB3B 5D3XA 3DCGA 3M95A 1IRSA 2LI5A 1RRPB 1YD8U 3TVVA 2BGFA 2IYDB 1E8YA 2REXA 4GIVA 4GDKB 1U2BA 3ZRFA 2G3QB 4GMVA 5LONB 4PS3A 2GBMA 2L3ZA 3UQBA 3PLUA 1ZW7A 2NBVB 5JHHA 3KUZA 2KTRB 1X86A 1WJUA 2KFJA 2PPHA 3ONSA 2YSZA 3H6NA 3AU4A 5DIFB 2RNRB 2C7MB 4WJPA 4ASWC 2KC2A 2RLOA 4CHMA 3NY5A 4IWOA 1LXDA 3N3KB 2D9VA 3IBEA 3SV1A 5AZGA 3VTVA 2KN5A 1V49A 3A9JA 4EOYA 3QC8B 4HPLB 2UZRA 4NJ7A 1DROA 3DVNV 4ZRJA 1H8CA 1X11A 4DBBA 4GXBA 2ZPYA 2CODA 1WI0A 1V81A 2O6VA 2KJHB 3AULA 3UGBB 1TGZB 4L6EA 4F7GA 2DYQA 2L1CA 1OY2A 1AARA 1P3QU 2LGDA 2MWSB 2GBJA 3L13A 4FHJA 4MELA 4EZKA 4HB0B 1EUVB 4FJYA 4IW0A 5C23A 5J17A 1HE8A 1TJ6A 2LVOA 3T8MA 4KSLC 1P6SA 1WM3A 2Q13A 2KTFA 3M63B 3APDA 3PV1A 4HXDA 2CAYA 5E6OA 1V80A 4NAWB 4K2PA 3A4SC 2CHWA 3VOQA 2NMBA 3VUYA 1V5OA 4GGQA 1X1GA 4MGZE 3VUWA 4B9KA 1XT9B 2L2IA 4B6HA 2M0XA 4RM9A 4EZJA 3WA0A 4MGYE 2N9PC 2KK8A 4K7UA 1LW3A 2KLCA 3AXCA 4WJQA 5JHAA 3ZDTA 1J0WA 3KSYA 4KHBB 2HTHA 2LBBA 1V5PA 2RSUA 3DDCB 3N32A 3QCAA 2I1KA 2G45B 3BJIA 2H7DA 2MFQA 1OQYA 1Q5WB 1WG7A 2DYOA 3KUCB 3P2BA 4MM3A 1U5EA 2MCNB 1U5FA 2YF0A 3V62A 3ZNGC 1XODA 5FI0A 1RLFA 2P0HA 5HE3A 5LOPB 4NSWA 5JZEB 3D8FA 1B55A 2JF5A 1NTIA 2K8HA 3PVLA 3ULBA 2LYDA 4LDTB 4JQWC 2D9ZA 4BKGA 2RVBB 2LWPA 3A1QB 2COFA 2P0FA 4I6NB 4WWOA 4ANUA 2JT4B 3PGEA 3DPDA 1UGMA 1WJ4A 1QZEA 2CY4A 2CU1A 2DYNA 1WR6E 1DDMA 4NPNA 4TUUA 4E71A 4W9EA 1L2NA 2LGYA 4HB2B 2MBQA 4ANXA 2UZSA 5EFXA 3KZ1A 3QK0A 3RYTA 5J2RA 2NVUI 4HAYB 1K5GB 3P7ZA 3RUIB 2YS1A 2KANA 1V86A 1P9DU 3OAWA 1AQCA 2IYBA 5D6JB 3WAMA 2OTXA 3IHPC 4W9GA 2BYEA 3ZDMC 3ZNHB 3R66C 2K1FA 3R3MA 5J3TA 4A20A 3TL5A 1RFAA 3CF6E 1V5MA 5C5BA 2ADZA 1LB1A 4A3PA 3CXBB 3ODXA 3SO6A 2N1WA 3QX1A 3W1SA 3EC8A 1UNQA 3ZTCA 4F1SA 4W9IA 4CYEA 2I5CA 3DXDA 1FGYA 1X1MA 1WE6A 1T0YA 2K6DB 2KLGA 3PSEB 3WAPA 2JXXA 5L95C 4YL8A 4CHJA 1BT0A 2HE7A 1P98A 3APFA 2L76A 2N0YA 1MG8A 3UZTA 4Y94A 4MSMB 2L0TA 2L05A 4JIOU 1TBEA 3VHTC 4A5KA 3FLVA 2N7DA 3KH0A 3GYPA 1TZ1A 2CRFA 3UF8A 4BOZB 2FNJB 2C7HA 2YT0A 5EDSA 1TXDA 4URKA 3CSTA 3KVFB 4EUTA 2BYFA 1V5UA 3HM3A 1X05A 5AZHA 1GUAB 2M17A 3IFWB 1DDVA 4HVBA 3ZRCA 3VQIA 3OJ4B 2DHZA 3DBLI 2LOXA 3GYOA 4NY0A 3HIZA 2Y5BB 3V5WA 2DAFA 2KVRA 4GOCA 4OVVA 1XX0A 2Z0OA 2ZPNA 4GU2A 3VTWA 4MY6A 5D3YA 1MAIA 4GPTB 4A6FB 1FXTB 1WJ1A 4BKSD 4CO7A 3QWZB 2O2VB 4HAXB 4DHZB 4KZ0A 1IP9A 1E90A 1ISNA 4EZLA 4W9HA 1YX5B 1R4MI 4ANWA 4FADA 1HBKA 1MIZB 2BYVE 1KI1B 2MDXA 1QQGA 5CLQB 2QHOA 3V6EB 1GC7A 1KM7A 1MK7B 5KQ4A 2PE6B 3M62B 2ROVA 1WMHB 1YQBA 2JRIB 1WGHA 1WZ0A 4J6IA 3VDZA 1U29A 2ASQA 3MPXA 2NBUA 4K7WA 3G9WA 3WIMA 3MJWA 1V89A 3HW2B 3SYXA 1WIAA 2X18A 3ZLZA 2JVCA 1NI2A 1X1FA 3JVZX 4MJSB 3RCZA 2ELBA 4HAVB 2K00A 3A4RA 3ZVVA 1U4AA 2HRJA 3X0WA 4HWIB 2KFKB 3PZDA 1EAZA 4NNJB 4DK5A 3S2AA 2ZVOA 3B08A 5C79A 4HJKA 2Z0DB 2BPSA 3RCPA 1RJ2A 1V9JA 2LVQA 3PT2B 4DDGD 4E3CA 3X23A 4KHOA 5L81A 3WYFB 4A6FA 3V61A 2NZ8B 2N4FA 3M3JA 5IAAC 2ZCBA 1R4NI 5E6PA 2AEHA 2W2WA 1KOTA 2G35A 3QA8A 2UWQA 3PHXB 3MDBC 2N9EB 3JSVA 2FDQA 3LDZE 3NOBA 2D07B 5CHWA 2YS5A 1OEYA 2NBWB 1BWNA 1PLSA 1UPQA 3UIOB 1V5TA 2WX1A 3ZUNA 4GDKA 2DA0A 2D9XA 2H7EA 1SHCA 2D4QA 3PS6A 2WH5A 2XQNM 3T06A 5LXHA 1SE9A 5DHAB 1NVLA 5FI1A 4TQ1A 3TMPB 3VH4B 1XKEA 2EMTA 2UVMA
chains in the Genus database with same CATH superfamily
2XK5B 1MPHA 4YONA 4AUQC 3PREA 1J0GA 2V3NA 3ZIMA 1WYWB 3AE9B 2WX0A 1P3RA 2Z14A 3GP7A 1ZGUB 3T9LA 1XLQA 3E9OA 5DPRA 1D5XC 2GUMA 2D3AA 2XNAC 2YVCA 3BYTB 3V05A 4IOYX 3NS1A 1GC6A 4LDTD 4F7HA 3NW8A 1Y19B 1DYNA 2DNFA 2V3PA 3RPFC 2CR5A 3BVGA 2KYWA 2MBEA 5KCVA 4D2KA 1YQ3B 2PJHA 2D11A 2KMCA 4DXAB 1UNPA 1K8RB 1ZPSA 4M01A 5BYSA 4K81A 2HD5B 4JWSC 3SDLC 2QKMA 4TV3A 3W9CB 3CMMB 1XR0B 2KC1A 4II3B 1WGDA 1UNSA 2MLBA 3RMKC 4ITKA 3VR9B 1R4NB 4KGRA 2X38A 2W82A 1P5TA 1CK1A 3ZJVA 1F52A 3N30A 2HJ8A 1ZE3D 1OQNA 2PE9A 2DENB 2M0AA 3TJPA 2N0SB 2Y7BA 3DWGC 2XEWA 3BINA 3VRAB 1K5DB 2DYBA 2PLPA 2KD0A 1E6EB 2DZIA 2PKOA 2RMMA 3AECB 1BTNA 1KZGA 1GJZA 3KWVA 3HQCA 5IN7A 5JHGA 4ANVA 2AL3A 1U5GA 4HDQA 1UEFA 2GB1A 2KJ6A 3L54A 2GJYA 4N59A 4G50A 5AEKB 3LJUX 1WGKA 2BKRB 3NWFA 5D3WA 2Y5CA 2HJ1A 1WE7A 3NZUA 4KIKB 1WZ3A 2Z0EB 3H7PB 1NTYA 2JZ3B 4N58A 4I6LB 3KRXA 2B3AA 1ZDVA 2MW5A 2N1VA 3HUIA 2AYOB 2MWNB 4G3XB 1CZPA 2KMAA 4B0MA 2KWUB 3BVMA 4C0AA 3SUZA 5EE1A 2CB8A 3PP2A 3MHSD 2ELAA 1WXVA 1WX9A 3RI7C 2D3CA 1PMSA 2C9WB 1OTRB 2PZ1A 2V9HA 2RSGA 3VXWA 2O2VA 3JW0X 1JCKB 2BKFA 4PNKA 1PFDA 2ZW0A 1MKEA 3H1UA 2DTCA 1STEA 3I57A 3KRWA 3RZWC 4NQKE 3L16A 1MIXA 2IGDA 5M4YB 2GMIC 4LCDE 2ZVNA 2JUOA 2L00B 2LFIA 3K9PB 2COPA 4NZLB 1YX6B 2CQUA 2KCJA 2R2YA 2BQQA 1VLBA 4XX5A 4XZ4A 3WAOA 2COAA 2IFSA 2XBBC 1J7CA 2OJRA 5CTRC 3NUHB 1FXIA 1T77A 3U8ZA 4GMXB 2NPTA 2MRPA 5JP4A 2CJOA 1FOEA 2DFKA 1WGGA 4I6PA 5DH9B 3AJ4A 5D2MB 2IO3B 1N62A 3H7PA 3NHEB 4A3OA 2L32A 2IY0B 2NPTB 3PRPB 4JX1C 1TZOA 3E9PA 2WXGA 1WRDB 4M8MA 4MM3B 3RD2A 1IBXA 3GOEA 3TSSA 4PQ0A 3VH3B 3DBRI 5BO4B 1H10A 3N20C 5G55A 1MI1A 2KR0A 1JQ4A 1WMHA 3SU8X 3MHZA 4FN2A 1A70A 1D5ZC 4IDIA 1L0XB 4NAMA 1YNTE 4PYZA 5BMHA 2AL6A 4NJ6A 3U7DA 3VTUA 1WGUA 1RFKA 4JLCA 3H9DA 2RDHA 3QAQA 3TEWA 1ESFA 2NBVA 3AH7A 2GBRA 2M8SA 4YTMB 2PTLA 2WXKA 4E74A 3VFKA 3NZ3A 3GE3C 3AE3B 2J7QB 4LNFA 1HTOA 1WJ6A 1XLNA 4K1RB 2V76A 1ACCA 1DBHA 2O6VB 3Q3FA 4DWFA 4IFSA 1TS3A 1QF6A 2K8CA 2KDBA 1VJKA 4RFBA 2WXIA 3AB5A 4FULA 4AP4C 2IO0B 2FE8A 1J8CA 4KIKA 1V1PA 2JZZA 4EFOA 1EF1A 2FCMA 5IP4D 3BY4B 4HRSA 5FR6A 1SJHD 2D3GA 2MBHA 4IKGA 1ZDXA 1UPRA 2LULA 4A6QA 2N7JA 4IWPA 2XN9C 2ZZPB 5IRSA 2N9XA 1DDWA 1NYRA 4RCOA 1PFJA 2BF8B 2CKHB 5G5GA 1L4DB 3PVUA 5G5HA 1FB8A 1C78A 3AI5A 2MX2A 2K22A 3U2SC 2LJ5A 1KJTA 1YIWA 1XD4A 4HB3B 2KACA 4HPPA 2GRIA 2BGFA 1E8YA 4GDKB 2ZKMX 2G3QB 4PS3A 4C4VB 3ZYYX 3PLUA 2NBVB 3ONSA 3KUZA 2PPHA 1JWMD 2YSZA 4WJPA 4KGSA 5BYQA 4CHMA 4IWOA 3IBEA 4P1CC 2FBWB 2KN5A 1P7FA 4HPLB 1DROA 1H8CA 1X11A 2ZPYA 2Z4DA 3AULA 1V81A 1MVKA 1TGZB 4F7GA 2L1CA 2MWSB 2GBJA 4FHJA 5J17A 4MELA 1JWUD 2J53A 3T8MA 3Q8AA 2KTFA 2Q13A 4HROA 3APDA 1T0QC 3AE2B 2Z8LA 1KLUD 5JXVA 4OSNA 3VOQA 2KIGA 1X1GA 2QMTA 2WDVB 4B6HA 3DBHB 1CJEA 2KQ4X 1J0WA 3DDCB 3N32A 2MFQA 1WG7A 3KUCB 3V62A 1U5FA 2YF0A 5AUIA 4ACFA 1XODA 5HE3A 4OZCA 4NSWA 2JF5A 4LDTB 4BKGA 2RVBB 2LWPA 2COFA 2P0FA 3B2FA 4I6NB 3FVCA 2E3TA 2CU1A 1DDMA 2IJ0A 4ANXA 4ILJA 1SE2A 2LHEA 1K5GB 2N9KA 3NRZA 3B77A 3RUIB 1FD6A 1DGJA 1P9DU 2IYBA 1TIFA 2K1FA 2RPVA 4A20A 3TL5A 2WXPA 3CF6E 5C5BA 3ABVB 3SO6A 2H89B 3DXDA 1WE6A 2K6DB 2JWUA 2LUMA 4CHJA 1P98A 2HE7A 2W54A 3R2TA 3UZTA 4MSMB 3FLVA 2N7DA 3EA6A 2W3RA 3CSTA 3P4SB 1X05A 4D6WA 4KKIA 4R3DA 4HVBA 4QJ5B 2DHZA 3GYOA 2INNE 2Y5BB 2DAFA 2ZPNA 3VTWA 5D3YA 1MAIA 4A6FB 1ZOYB 1WJ1A 1LGRA 2WDRB 3Q8CA 2O2VB 1NEKB 4KZ0A 1R4MI 3Q8FA 1PGAA 2ZW1A 2QHOA 1HA5A 3V6EB 1GC7A 2WP9B 1WMHB 3MJWA 1WIAA 2X18A 1TY2A 3DWMA 2ELBA 3OG5A 2K00A 3A4RA 1NYQA 4HWIB 4NNJB 3TEYA 2ZVOA 1ZP0B 2Z0DB 1V9JA 1K52A 1UF0A 4KX6B 1I4QA 4RH6A 5IAAC 2H88B 2Q5WD 4JKHA 3NOBA 2D07B 2NBWB 1V5TA 4YT0B 1V1PB 2W3SA 3PS6A 2WH5A 2VZKD 3T06A 1SE9A 5DHAB 1IP9A 1QQRA 1WFYA 4KV2A 1FIQA 1UBIA 3E56A 3Q8EA 4RGTA 2OHFA 2BCJA 2COCA 1KTKA 3ZKJC 4P16A 2KMMA 2VRWB 1GOZA 3EECA 1XF5L 2INPE 1K50A 3JYUA 4XWWA 3M1IB 3MJ5A 1E8WA 4EKUA 3AE8B 1Q0WB 1FCLA 4FJZA 3NS8A 3AE6B 1VZ8A 1TQZA 1MI0A 4DHZE 1I42A 1OQQA 2Z0PA 4BOSC 2WU5B 1F77A 3B9JA 2K6QA 4HK2A 4KZCA 3L08A 2KUPA 5HE1A 1EGXA 2AQ3B 1YN4A 3KLSX 1JWSD 3ZJUA 2HTHB 4CSQA 3PPAA 3DVNU 1XCQL 4C80A 2LEKA 5I2SA 3EFUA 1MG4A 4WVFB 3PRMB 1WXAA 2IDYA 1KZ7A 1YOVB 1W1DA 1S1QB 2YLMA 4HPMB 4M0WB 3PHWB 4FLHA 5G2NA 2XK5A 2KGXB 1NI3A 3GE8C 3Q3JA 4GLSC 1D3ZA 1BAKA 1C4AA 4BBNC 4MK0A 1WGYA 3IG3A 2N9LA 3ETRA 4GDLA 4P7IA 4JL9A 3ZTDA 4KKJA 4AOFA 1F0ZA 3PZ8A 1AW7A 1FHWA 3IT4B 2CHZA 4WWPA 2J59M 1NTVA 5C6RA 1HTQA 3PRZA 3TW1A 1RWSA 2WXQA 2ROZB 4X57B 2G4DB 4JKAA 2KWCA 4BBNF 4ARIA 5KHOA 4XDDA 2ZNVB 5EE9A 4P1BC 1I4RA 5LG4B 2KNBA 3BIID 4L1BA 2W2XD 3E66A 5CHFA 3PG7A 3D8EA 1GNUA 1EWCA 3FP5A 1JWBD 3SD5A 4XWXA 3PSCA 4LJPB 3I9V1 1NVID 1UUPA 1XD3B 1SB3C 4EZKA 2K5PA 3IVFA 3HK0A 1A5RA 2JRHA 5DPWA 1RYJA 2LHDA 2L8JA 1WXQA 1BTKA 1VD2A 1IYFA 1FNVA 4RMAA 4ZRKA 1VBGA 4JKCA 1I4XA 1H4RA 1E7UA 2LD9A 5D27A 3QJZA 4IC7B 1SIFA 2I1JA 1MPEA 2M1MA 1C9FA 3V6CB 2FAZA 1J7AA 3W1YA 3OWEB 3OLMD 4TSSA 3UI3A 3HVDA 5D3VA 1L6VA 1MHHE 1UELA 5DHFB 1ZXHA 1QKZA 2LJIA 2MP2A 4MGKE 3Q14C 4WIPA 1ZM0A 3ULCA 2FJ9A 4WJ7A 2LKOA 2V4LA 3SBGA 1XQQA 2K25A 2JP2A 4ICVA 1ACAA 4Z2MB 3AEGB 2N23A 2J52A 3T3OA 4EEWA 1GB4A 3AU5A 4NJCA 1F1HA 5HE0A 2W2XC 1Z87A 4RNAA 2D3BA 1XXGA 1J19A 3AEAB 3KYDD 3DVGY 4W9FA 3ZNZB 5KQ1A 2NS5A 1VZ6A 1F2RI 2DHIA 3NVYA 4PS8A 3OJ3A 1WVHA 2BWFA 1D6EC 2VZKB 2V4IB 2VSZA 3RNCC 2DWQA 4DBGA 2FIDA 3TEZA 4ZRPA 1C3TA 1DYQA 4XC2A 4TYZA 3EHVA 4AJYB 1PGBA 2NMQA 2WQYB 1N6ZA 5C1ZA 3U30A 1ZC4B 1VDVA 2NTTA 5C16A 1YN5A 1MFWA 1N3HA 1OFFA 4CHKA 1I4GA 3H7SA 5AZFA 1AN8A 4CQNA 1V2YA 3GZNI 3Q3OC 4A9AA 4G11A 1E5WA 2PIAA 2P8VA 2OQBA 4MDKE 5H92C 2KQ7A 2WU2B 3P4RB 4XDCA 4IG7B 1E7PB 1UNRA 2WHIA 5C2TB 1HB8A 4AWJA 3IAS1 1Q67A 1W1GA 4IM3A 4QAYA 2RPQA 3HHMA 2ONQA 4HB4B 2QIEB 2DX5A 1HB6A 2QKLA 2AQ1B 4ZRIA 2LVPA 5J18A 1Q1OA 2CS4A 1E10A 3A1QA 4BBKA 4YSYB 2BB5A 1MK9B 1L0VB 3NG0A 3PVWA 2HTME 2HDEA 1QOFA 1WGRA 4P6VF 3I5JC 2O6VD 2V3SA 2KDIA 3DCGA 2YS3A 3M95A 2DIKA 1IRSA 2MJEA 1RRPB 3AEEB 1U2BA 5LONB 4B0EA 4L1RA 3UQBA 2KFJA 1HZ5A 3H6NA 4ASWC 1T0SC 2KVZA 2KC2A 3NVWA 5FKAC 2D9VA 3P63A 4OHJA 5AZGA 2BS4B 3QC8B 4NJ7A 2Z13A 3DVNV 1BMLC 3UGBB 2MH7A 2LGDA 1OY2A 1P3QU 4YTPB 4FJYA 3U7ZA 5I2MA 1QOAA 3PV1A 3P42A 3A4SC 2CHWA 3VR8B 4MGZE 4B9KA 1NENB 4M02A 4RM9A 4EZJA 3WA0A 2BW2A 2N9PC 2KK8A 4WJQA 1LW3A 2KLCA 5JHAA 3KSYA 2HTHA 1K51A 3AEDB 1Q5WB 2DYOA 1KFYB 4MM3A 3ZRCA 5FI0A 1RLFA 2P0HA 4USAA 5LOPB 1GAQB 3FC4A 3GZNB 1JDEA 4WWOA 2JT4B 1QZEA 4JKDA 2CY4A 2IGGA 1WR6E 4TUUA 4NPNA 1XLPA 4E71A 2LGYA 1F2RC 5EFXA 3IAM1 5J2RA 3RYTA 1C4CA 4C56C 1AQCA 2WNMA 3ZNHB 4L2YA 1RFAA 3ODXA 1R7SA 2N1WA 1N63A 3EC8A 4F1SA 4W9IA 4CYEA 2I5CA 1B1ZA 1X1MA 3RNBC 5LXIB 1T0YA 1OQRA 5L95C 2L76A 2N0YA 2JYEA 4Y94A 4JIOU 1TBEA 4A5KA 4LLGM 1GGOA 2LMCA 2PVOD 1TXDA 3KVFB 3IFWB 3U4EG 1DDVA 3OJ4B 4JK7A 3DBLI 2LOXA 4NY0A 3HIZA 1IBXB 4OVVA 2Z0OA 4MY6A 4GPTB 2PVGC 4CO7A 3QWZB 4DHZB 1ISNA 5HI1A 1R4MB 1WRIA 1HBKA 3PZ7A 4XE0A 5GXGB 3VDZA 1YQBA 2JRIB 4J6IA 1WZ0A 1U29A 4M00A 4K7WA 4LK0M 3WIMA 3HW2B 3NWDA 1X1FA 3RCZA 4A8XC 2JYTA 3SEBA 2D5GA 3PZDA 1SE4A 1KLGD 4HJKA 2BPSA 1XO3A 3RCPA 3X23A 3WYFB 4A6FA 1LO5D 3V61A 5EE3A 2N4FA 3M3JA 2ZCBA 1R4NI 5E6PA 2W2WA 3LDZE 2CJNA 1XEEA 5CHWA 3UIOB 1PLSA 1UPQA 4J3OD 1J7BA 3ZUNA 2D9XA 2XQNM 5LXHA 1QOBA 3HSAA 3PO0A 2EMTA 2QJLA 4AJWA 4KDIC 3P1MA 3B1LX 2K0PA 1EU4A 2RR9A 4EMOA 4FBJB 2VKIA 3FEHA 1EO6A 2RDGA 2EMSA 4MH8A 2IPKD 2KZRA 4KVGB 3R8BA 3RNEC 4AS1A 3VIAA 1WR1A 3A8QA 1PGXA 3ODWA 2GCJA 1NBFC 2WWZA 1Y8RC 2UYZB 1WI1A 1TS2A 2R2OA 2Y8GA 4JKFA 4A55A 1E8XA 1FAOA 3CIKA 1IPGA 3I63C 1TS4A 3AE7B 4WQMA 5DPSA 2M14A 5C3JB 4PYUA 2ZEQA 3MC9A 5HE2A 5HHDG 3RNAC 4WAFA 3A9JB 1N5XA 2Z59B 4US9A 4A6KA 3A98B 3E9LA 2LGSA 3ZNID 1P0RA 3DQVA 1VZ7A 1U5DA 2EKEC 4RGOS 2LXAA 5I4DA 2NCNA 2FJLA 4YWGG 2WXFA 2B76B 2FJUB 1FRRA 4W9LA 4DDID 1PDXA 4K7SA 1T5XD 2DLWA 1HQRD 5EE0A 1FMAD 3FILB 3SFDB 3QQ8B 3NZSA 2ABDA 2A4ZA 2KXJA 1M7EA 5E6NA 4GNKB 1WH3A 4ICUA 4LJOB 4KSKC 2JSVX 2JX5A 2DHKA 2INCC 2OOBB 2V1YA 3TCAA 1TTNA 4HCNB 1YJIA 1Y5OA 2G9HD 3BVZA 2IY1B 3PTFC 1WYGA 5GOWB 2LZ6A 3FILA 3L17A 3DBLB 3DVGX 2KDEB 4WQOB 1Y56A 3WANA 1IGDA 2ICIA 2GLSA 2I5FA 4S0RA 3QARA 2WXHA 2YT1A 4HAUB 4WURA 1HXYD 5JLJB 1QC6A 1FXAA 2SEBD 3ENEA 1PUTA 1WXMA 2Z59A 2DKQA 1DOYA 1V61A 5KHQA 1ZSQA 2Y5PA 2Y3AA 1VR9A 1I4PA 2MSED 2KOXA 4KHAA 5HG2A 1WX8A 3DBSA 1WF9A 4N6EB 1I4HA 1L7YA 2JZPA 2K8BA 2FCSA 2AX5A 3DCXA 2D2QA 1FRDA 1IUEA 1KC7A 2NR2A 3DOWA 2Z0QA 3JSVB 1YJ1A 4N9F4 3BWUD 3P6AA 1KLVA 5JHBA 3Q69A 2LGXA 3DBRB 1AWDA 4GSWA 3MC0B 3APCA 2CHXA 1ET9A 4W9CA 1FM0D 3ZW3A 1ST7A 4MT7A 4YTNB 2X8XX 1FO4A 1NU2A 1E7VA 1QT9A 4GB9A 3A9KA 2AQ2B 1TKYA 2BBCA 3EUB2 5J3YA 4ZDVA 2M38A 4G0NB 1UD7A 4OT1A 3A9KB 2OJWA 1UH6A 5D3DA 4B6WA 2JWZA 3EFCA 2DBYA 3NSUA 4K3BA 3AV8A 4OVUA 1FEHA 2D9YA 1KH0A 1F9JA 1QLBB 3SNHA 2LXCA 1CMXB 2ZJDA 2WGSA 3NWAA 3TIXA 3N1YC 3B2GA 2BYTA 4W9KA 3H8HA 1RM6C 1EU3A 1GB1A 4JGHB 1EF5A 3AEFB 3RNGC 4EE2A 1JRUA 4FJVB 2IBIB 2GCLA 1YJJA 2ZCCA 4W9DA 1Z2MA 3KYCD 4XYCA 5LNK1 5AUKA 2PW9A 2DX1A 2J0MA 1LM8B 3OANA 3HM6X 1YQ4B 2YT2A 2MHJA 3KQ4A 3RT3B 3O96A 3W5VB 4GN1A 1IGCA 2IO2B 4M8NA 2K2UA 2K3UA 2IO1B 4IM2A 1ENFA 1L5PA 4TQ0A 2JY6A 2RGFA 1E8ZA 4HDOA 4IAPA 2MJ3A 3QIJA 2JPHA 2CY5A 4DIXA 1TT5B 1XCTL 4MJSA 2MBBB 1G6JA 2V0GA 5IOIA 1N5WA 4DXGA 2E2XA 1L0YB 5DPTA 1PYWD 1L4ZB 1M7RA 2GOWA 1FHOA 4HCPB 3IT6B 1M94A 1SSNA 3AE5B 2R09A 2C7NB 4HJGE 1VCBA 2L52A 4K2OA 2R2QA 2KWVB 2LG1A 3CWIA 4KAXB 5BYRA 3ODOA 4IUMB 3DBHI 3HIEA 3D32A 3UINB 2DZKA 1WGQA 2J0JA 4LNOA 1RAXA 2RGNB 5J3QA 3R7QA 2LOZA 1P1AA 2N7EA 2KHWB 2C60A 3TO1A 2KFKA 4MGIE 3ALBA 4II2B 1YN3A 2WLBA 2DAJA 1AWEA 2X0SA 1U27A 1JMLA 2WDQB 4WWNA 4GZUA 2K2JA 1N61A 3ZXRA 4H8SA 5D3XA 2JXTA 1YD8U 3TVVA 1EWYC 2REXA 3ZRFA 1M4VA 4K3CA 2GBMA 1ZW7A 4C7ZA 2KTRB 1WJUA 3BK1A 3AU4A 5DIFB 3Q6BA 1SEBD 3NY5A 1LXDA 3N3KB 3SV1A 4ZHPA 1V49A 4EOYA 2TSSA 2UZRA 3DHHC 4DBBA 2CODA 4YSZB 4HB0B 4IW0A 5C23A 1HE8A 2LVOA 4KSLC 4C7YA 1P6SA 1KBLA 1L6UA 1WM3A 4HXDA 4C00A 2CAYA 4BAXA 5E6OA 4K2PA 2NMBA 4OZAA 3VUYA 1V5OA 3VUWA 2L2IA 2M0XA 2QSDA 4MGYE 4K7UA 3W5UB 2RSUA 2LBBA 3QCAA 2I1KA 2G45B 1BUIC 2H7DA 1C76A 3HVZA 3P2BA 2MCNB 1U5EA 1D4BA 2DLBA 2MEKA 5JZEB 2EELA 3D8FA 4A90A 2KIEA 3PGEA 1UGMA 1WJ4A 2KN4A 3N9YC 2QDFA 4W9EA 3SFEB 2MBQA 2UZSA 1FFUA 4JPSA 4QXAB 4ZOHC 3P7ZA 2YS1A 2KANA 2M19A 2OTXA 4W9GA 3ZDMC 2BYEA 3R66C 3R3MA 5J3TA 1V5MA 1AYFA 2ADZA 4A3PA 3W1SA 1UNQA 3WAPA 2KLGA 2JXXA 4YL8A 1YMHE 4OZBA 1MG8A 3E9SA 2L0TA 2L05A 3U12A 3LXFA 3KH0A 2C7HA 2INDC 4URKA 4AQ7A 1V97A 2BYFA 3HM3A 5AZHA 3SR6A 1GUAB 2M17A 1WWTA 3VQIA 3EGRA 3V5WA 4GOCA 1XX0A 4GU2A 4BKSD 4JKBA 4HAXB 4BZAA 4ANWA 1MIZB 3N1ZC 4RGMA 2J4XA 2MDXA 4LTUA 4DQOC 3V3XA 2ASQA 2NBUA 3WCQA 1JWAD 3G9WA 2R61A 1V89A 3SYXA 3ZLZA 1NI2A 1QOGA 1FPYA 3CIRB 3ZVVA 3ZXVA 5D3IB 2HRJA 2KFKB 4DK5A 3S2AA 1FNUA 3PT2B 4JE3B 4DDGD 4L23A 1K53A 4MT5A 4KHOA 1CQVA 1I7HA 2KUQA 2BS3B 1KOTA 2E6XA 1T0RC 2L1AA 3MDBC 2N9EB 1BWNA 1JRPA 2WX1A 2DA0A 2H7EA 5IO9A 2D4QA 1C4PA 4GOUA 2L83A 4Q2JA 5TSSA 4WWMA 1NVLA 3VH4B 2UVMA 5DI9B 2YEPB 4PS7A 1UZXB 2CU3A 2DX5B 2KQSA 2PEAA 2FIFA 2GBNA 1UBQA 1ET6A 2KKCA 2KAJA 2DN6A 2I2YA 1FFVA 1ZKHA 3FM8C 3ENBA 3L10B 2LGIA 2DZJA 3ZGZA 3PEGA 3N1XC 1I7AA 5CX3A 4HAWB 2BS2B 1FNWA 4BVUC 3ZJTA 4ZYNA 3TFMA 2KX0A 4UDUC 1DOIA 1PQSA 2EC1A 5D7GA 2BB6A 3KW5B 4S17A 5JH5C 4F8CB 1JW9D 4KHBA 1VRAB 3PLVA 1UWXA 3UQAA 1ZVRA 4TMAB 1FHXA 1D5MC 4HAZB 3ECIA 3VVWB 1Q10A 4IM0A 2Y8FA 3TEXA 4XWTA 3NVZA 4RF1A 2ACZB 4WAAA 1W1HA 2WXLA 3C0RB 1I35A 1OEYJ 1EVHA 2RQ1A 2RD0A 4LNNA 3N7CA 3I3TB 5CHVC 4MEMA 5C5BB 3B0AA 3RULA 3KY9A 3SHQA 2ZNVC 4LNKA 2GS0A 4HKZE 2EJ8A 2G4SA 2QEJC 4WJNA 4OVZA 1ZC3B 1LQBA 1UGJA 5H8YE 2DHJA 2KJRA 5TR5A 1Z5SB 3ZO5B 1GG3A 4GDLB 4WSFA 5IKCM 1LFDA 1SBBB 1SXTA 3ZVRA 1OGWA 4MH0E 2YEPF 2L0FA 2GBKA 5LLIA 4FXCA 2D10A 1V1OA 1OMWA 3A33B 5HKHA 4IOIE 2M4NA 2MP2B 2QC8A 4Z2NA 4PK1A 1XLOA 1WM2A 2DKPA 3MC8A 2K9XA 3LJ3A 4JKEA 4W9JA 3TBLD 1ZYIA 5MPOA 5BMGA 2W55A 2D9WA 3URYA 1WSPA 4ARCA 3QHTA 2DYMA 2KX3A 1XCGA 1E9MA 3ML4A 2MBOA 2LRWA 1C79A 4F7UP 2K39A 1JALA 1V88A 2L7RA 3K9OB 3W1SC 2QCZA 3ML8A 1EM7A 3F5RA 1S3SG 5CLLB 3ZQ4A 4NQLB 3R7RA 4QJ4B 4ZRQA 4F7ZA 1E0ZA 2BWES 1N60A 4FHKA 4YXDB 2YRYA 2FUHB 3MTNB 3RZFA 2DZMA 2JQRB 2AWTA 5BMIA 3WALA 1TYGB 2EKIA 1MJDA 3DXEA 2R82A 4NAWA 4HKQA 5D94A 4HATB 4DX90 3C19A 4ILGB 2K49A 3FSSA 1V6EA 4JWUC 5EDSA 2J0KA 1I2HA 2A5UA 4D0NB 5HFYA 4MJSB 4KGTA 1HEZE 4DX8A 3SBTA 3QBVB 2KDFB 3O65B 4LNIA 4MSQB 5T8IA 5FR3A 2VH2A 4HLEA 3DXCA 4DHJD 5DCNA 2OEDA 1SE3A 1ZUD2 1JROA 2C5LC 4KDLB 3DHGC 4BFRA 4BKTA 3R2IA 1NDDA 4IWQA 4ILHA 3HRDD 5L83A 3QWMA 2KWDA 3UIPB 4BKSA 4MACA 3VAWA 2IGHA 2PMVA 3TUOA 4B95A 1C1YB 3CSFA 3D8DA 1SIJA 4OW0A 2NTSA 2R0DA 2LUEA 3V60A 3L0WB 3AMZA 2I38A 4JKGB 3AEBB 4WJOA 1RRBA 1WXSA 2FCQA 2GI9A 2WDTB 2WYQA 2FCNA 1TKEA 3EPYA 2VRRB 2KTRA 2KO3A 2K8EA 4DHJB 1WY8A 5E6JA 4HHVA 4REZA 2LASA 1WX7A 3BZDB 5GMVA 1KRHA 2FUG1 3ML9A 3KUDB 3A8PA 1BXTA 2MA9B 4A6HA 2VH1A 2WXMA 3VUXA 3Q3NC 5IJMA 3Q2AC 3J9CA 1WJMA 4FA6A 1SGHA 4K17A 2LRUA 2MQJA 3F0WA 4HSIA 1FGZA 4US8A 2IZVB 2J42A 2ON8A 2RUKB 1KF6B 4TKNA 2P0DA 4JKGA 2W9NA 5IA7A 1C77A 4EJNA 1WJNA 3GB1A 2MKRA 2RRFA 3NVVA 3AM9A 1V8CA 2LI5A 4GIVA 2IYDB 3MFGA 1DOXA 4GMVA 2L3ZA 1ROEA 3FKYA 5JHHA 1X86A 3L4PA 2RNRB 2C7MB 2RLOA 2RDBC 3VTVA 3A9JA 4RGNA 4ZRJA 4GXBA 1WI0A 2O6VA 2KJHB 4L6EA 2DYQA 1AARA 4RM8A 3L13A 3LYYA 5JVLA 1EUVB 3IXSA 2SAKA 1TJ6A 1TY0A 3M63B 1FCCC 1GPXA 2WXNA 3P4QB 1V80A 2WXRA 4NAWB 4WH4A 4O1NA 1VBHA 4GGQA 2BT6A 1SF0A 1XT9B 4YSXB 3AXCA 4ZYSA 3ZDTA 4KHBB 3ZNGC 1V5PA 3NJTA 3BJIA 2KDMA 1OQYA 1QILA 3GS2A 1B55A 2K8HA 3RFZB 1NTIA 3PVLA 4QJ3B 2LYDA 3ULBA 4JQWC 2D9ZA 2BVCA 3A1QB 3T3NA 4ANUA 3DPDA 4JK9A 2DYNA 1L2NA 2WXJA 4HB2B 1B9RA 3KZ1A 3QK0A 2NVUI 4HAYB 1V86A 3OAWA 5D6JB 4PT5A 3WAMA 4H2AA 3IHPC 3U52E 3FAHA 1LB1A 3DHIC 3CXBB 3QX1A 3AE4B 3ZTCA 3W2DA 3RN9C 1FGYA 3PSEB 1SJED 2WXOA 3OHMB 1BT0A 3KWLA 1T6BX 3APFA 3BK2A 1ZXIA 3VHTC 1UWMA 1HZ6A 3GYPA 1TZ1A 2CRFA 3UF8A 4BOZB 2FNJB 2YT0A 2KT7A 2UU7A 4EUTA 1V5UA 3MP9A 4XGAB 2MJDA 1TJEA 2KVRA 3RNFC 1FXTB 1DIKA 3O13A 1E90A 4HEA1 4EZLA 4W9HA 1YX5B 3AE1B 4FADA 2BYVE 1KI1B 1T3QA 1QQGA 5CLQB 3LB8C 1KM7A 1MK7B 5KQ4A 2PE6B 3M62B 2ROVA 3A58A 1WGHA 4DXFA 3AN1A 3MPXA 3VRBB 1P7EA 3Q8BA 2JVCA 3JVZX 4HAVB 2G1EA 2M56B 1U4AA 3X0WA 1EAZA 4ZHOA 2BTEA 3B08A 5C79A 4E3CA 1RJ2A 2LVQA 5L81A 2NZ8B 1TKGA 2AEHA 2QILA 2G35A 4RF0A 1TS5A 2WS3B 2UWQA 3C8YA 3PHXB 3QA8A 4JK8A 3JSVA 1MHXA 2FDQA 2YS5A 1OEYA 4C4VA 3P4PB 4GDKA 1SHCA 4M0WA 3Q3MC 2JU6X 5FI1A 3TMPB 4TQ1A 5FK9C 1XKEA 3BYYB
chains in the Genus database with same CATH topology
2XK5B 1MPHA 4YONA 4AUQC 3PREA 1J0GA 3ZIMA 1WYWB 2WX0A 1P3RA 3T9LA 1ZGUB 3E9OA 5DPRA 2YVCA 4IOYX 1GC6A 4LDTD 4F7HA 1Y19B 1DYNA 2CR5A 2MBEA 5KCVA 2PJHA 2D11A 2KMCA 4DXAB 1UNPA 1K8RB 4K81A 2HD5B 3SDLC 2QKMA 4TV3A 3CMMB 1XR0B 2KC1A 4II3B 1WGDA 2MLBA 1P5TA 3N30A 2HJ8A 1OQNA 2PE9A 2DENB 3TJPA 2Y7BA 2XEWA 3BINA 1K5DB 2DYBA 2KD0A 2DZIA 1BTNA 1KZGA 1GJZA 3HQCA 5JHGA 4ANVA 2AL3A 1U5GA 4HDQA 1UEFA 2KJ6A 3L54A 2GJYA 4G50A 5AEKB 3LJUX 2BKRB 5D3WA 1WE7A 3NZUA 4KIKB 1WZ3A 2Z0EB 3H7PB 1NTYA 2JZ3B 4I6LB 3KRXA 2B3AA 2N1VA 2MW5A 2AYOB 2MWNB 4G3XB 2KMAA 2KWUB 4C0AA 3SUZA 2CB8A 3PP2A 3MHSD 2ELAA 1WXVA 1WX9A 1PMSA 2C9WB 1OTRB 2PZ1A 2RSGA 3VXWA 2O2VA 3JW0X 2BKFA 4PNKA 1MKEA 3H1UA 2DTCA 3RZWC 3KRWA 4NQKE 3L16A 1MIXA 2GMIC 4LCDE 2ZVNA 2JUOA 2L00B 3K9PB 2COPA 1YX6B 2CQUA 2KCJA 4XX5A 4XZ4A 3WAOA 2COAA 2IFSA 2XBBC 2OJRA 5CTRC 3U8ZA 4GMXB 2NPTA 2MRPA 5JP4A 1FOEA 2DFKA 1WGGA 4I6PA 5DH9B 3AJ4A 5D2MB 2IO3B 3H7PA 3NHEB 4A3OA 2IY0B 2NPTB 3PRPB 3E9PA 1WRDB 4M8MA 3RD2A 3GOEA 4PQ0A 3VH3B 3DBRI 5BO4B 1H10A 5G55A 1WMHA 3SU8X 4FN2A 4PYZA 2AL6A 4NJ6A 3U7DA 3VTUA 1WGUA 4JLCA 3H9DA 3QAQA 2GBRA 2M8SA 4E74A 3VFKA 2J7QB 1WJ6A 4K1RB 2V76A 1DBHA 2O6VB 3Q3FA 4DWFA 4IFSA 2K8CA 2KDBA 4FULA 4AP4C 2IO0B 1J8CA 4KIKA 2JZZA 4EFOA 1EF1A 2FCMA 3BY4B 5FR6A 2D3GA 2MBHA 1UPRA 2LULA 4IWPA 2ZZPB 2N9XA 1DDWA 1PFJA 2BF8B 2CKHB 3PVUA 1FB8A 3AI5A 2MX2A 2LJ5A 1KJTA 1YIWA 1XD4A 4HB3B 2BGFA 1E8YA 4GDKB 2G3QB 4PS3A 3PLUA 2NBVB 3ONSA 3KUZA 2PPHA 2YSZA 4WJPA 4CHMA 4IWOA 3IBEA 2KN5A 4HPLB 1DROA 1H8CA 1X11A 2ZPYA 3AULA 1V81A 1TGZB 4F7GA 2L1CA 2MWSB 2GBJA 4FHJA 5J17A 4MELA 3T8MA 2KTFA 2Q13A 3APDA 3VOQA 1X1GA 4B6HA 1J0WA 3DDCB 3N32A 2MFQA 1WG7A 3KUCB 3V62A 1U5FA 2YF0A 1XODA 5HE3A 4NSWA 2JF5A 4LDTB 4BKGA 2RVBB 2LWPA 2COFA 2P0FA 4I6NB 2CU1A 1DDMA 4ANXA 4ILJA 1K5GB 3RUIB 1P9DU 2IYBA 2K1FA 4A20A 3TL5A 3CF6E 5C5BA 3SO6A 3DXDA 1WE6A 2K6DB 4CHJA 1P98A 2HE7A 3UZTA 4MSMB 3FLVA 2N7DA 3CSTA 1X05A 4HVBA 2DHZA 3GYOA 2Y5BB 2DAFA 2ZPNA 3VTWA 5D3YA 1MAIA 4A6FB 1WJ1A 2O2VB 4KZ0A 1R4MI 2QHOA 3V6EB 1GC7A 1WMHB 3MJWA 1WIAA 2X18A 2ELBA 2K00A 3A4RA 4HWIB 4NNJB 2ZVOA 2Z0DB 1V9JA 5IAAC 4JKHA 3NOBA 2D07B 2NBWB 1V5TA 3PS6A 2WH5A 3T06A 1SE9A 5DHAB 1IP9A 1WFYA 4KV2A 1UBIA 2BCJA 2COCA 3ZKJC 2VRWB 3EECA 3JYUA 3M1IB 1E8WA 4EKUA 1Q0WB 4FJZA 3NS8A 1TQZA 4DHZE 1I42A 2Z0PA 4BOSC 2K6QA 4HK2A 4KZCA 3L08A 2KUPA 5HE1A 1EGXA 2HTHB 3PPAA 3DVNU 3EFUA 4WVFB 3PRMB 1WXAA 1KZ7A 1W1DA 1S1QB 2YLMA 4HPMB 4M0WB 3PHWB 4FLHA 5G2NA 2XK5A 2KGXB 3Q3JA 1D3ZA 1BAKA 4BBNC 4MK0A 1WGYA 3IG3A 4GDLA 4P7IA 4JL9A 3ZTDA 4AOFA 1FHWA 4WWPA 2CHZA 2J59M 1NTVA 5C6RA 3PRZA 3TW1A 2ROZB 4X57B 2G4DB 4JKAA 2KWCA 4BBNF 5KHOA 2ZNVB 2KNBA 2W2XD 3E66A 5CHFA 3PG7A 3D8EA 1GNUA 3FP5A 3SD5A 4XWXA 3PSCA 4LJPB 4EZKA 1XD3B 3IVFA 3HK0A 1A5RA 2JRHA 5DPWA 2L8JA 1BTKA 1VD2A 1IYFA 4RMAA 4ZRKA 1VBGA 4JKCA 1H4RA 1E7UA 2LD9A 5D27A 3QJZA 4IC7B 1SIFA 2I1JA 2M1MA 3V6CB 2FAZA 3W1YA 3OLMD 5D3VA 1UELA 5DHFB 2MP2A 4MGKE 1ZM0A 3ULCA 2FJ9A 4WJ7A 2LKOA 2V4LA 3SBGA 1XQQA 2K25A 2JP2A 4ICVA 1ACAA 4Z2MB 2N23A 4EEWA 3AU5A 5HE0A 2W2XC 1Z87A 1J19A 3KYDD 3DVGY 4W9FA 3ZNZB 5KQ1A 2NS5A 2DHIA 4PS8A 3OJ3A 1WVHA 2BWFA 2VSZA 4DBGA 2FIDA 1C3TA 4XC2A 4TYZA 3EHVA 4AJYB 5C1ZA 3U30A 1ZC4B 5C16A 1N3HA 4CHKA 3H7SA 5AZFA 1V2YA 3GZNI 4G11A 1E5WA 2P8VA 2OQBA 4MDKE 2KQ7A 4IG7B 1UNRA 1HB8A 4AWJA 1Q67A 1W1GA 4IM3A 2RPQA 3HHMA 4HB4B 2DX5A 1HB6A 2QKLA 4ZRIA 2LVPA 5J18A 1Q1OA 2CS4A 3A1QA 4BBKA 1MK9B 3PVWA 1WGRA 2O6VD 2V3SA 2KDIA 3DCGA 2YS3A 3M95A 2DIKA 1IRSA 1RRPB 1U2BA 5LONB 3UQBA 2KFJA 3H6NA 4ASWC 2KC2A 2D9VA 5AZGA 3QC8B 4NJ7A 3DVNV 3UGBB 2LGDA 1OY2A 1P3QU 4FJYA 3PV1A 3A4SC 2CHWA 4MGZE 4B9KA 4RM9A 4EZJA 3WA0A 2N9PC 2KK8A 4WJQA 1LW3A 2KLCA 5JHAA 3KSYA 2HTHA 1Q5WB 2DYOA 3ZRCA 4MM3A 5FI0A 1RLFA 2P0HA 5LOPB 1JDEA 4WWOA 2JT4B 1QZEA 4JKDA 2CY4A 1WR6E 4TUUA 4NPNA 4E71A 2LGYA 5EFXA 5J2RA 3RYTA 1AQCA 3ZNHB 1RFAA 3ODXA 2N1WA 3EC8A 4F1SA 4W9IA 4CYEA 2I5CA 5LXIB 1X1MA 1T0YA 5L95C 2L76A 2N0YA 4Y94A 4JIOU 1TBEA 4A5KA 1GGOA 1TXDA 3KVFB 3IFWB 1DDVA 3OJ4B 4JK7A 3DBLI 2LOXA 4NY0A 3HIZA 4OVVA 2Z0OA 4MY6A 4GPTB 4CO7A 3QWZB 4DHZB 1ISNA 1HBKA 3VDZA 1YQBA 2JRIB 4J6IA 1WZ0A 1U29A 4K7WA 3WIMA 3HW2B 1X1FA 3RCZA 3PZDA 4HJKA 2BPSA 3RCPA 3X23A 3WYFB 4A6FA 3V61A 2N4FA 3M3JA 2ZCBA 1R4NI 5E6PA 2W2WA 3LDZE 5CHWA 3UIOB 1PLSA 1UPQA 3ZUNA 2D9XA 2XQNM 5LXHA 2EMTA 4AJWA 4KDIC 3B1LX 2RR9A 4EMOA 4FBJB 2VKIA 3FEHA 1EO6A 2EMSA 2KZRA 4KVGB 3VIAA 1WR1A 3A8QA 3ODWA 2GCJA 1NBFC 2WWZA 1Y8RC 2UYZB 1WI1A 2R2OA 2Y8GA 4JKFA 1E8XA 1FAOA 3CIKA 1IPGA 5DPSA 2M14A 4PYUA 2ZEQA 5HE2A 3A9JB 2Z59B 4A6KA 3A98B 3E9LA 3ZNID 1P0RA 3DQVA 1U5DA 2EKEC 2LXAA 2NCNA 2FJLA 4W9LA 4DDID 4K7SA 2DLWA 3QQ8B 3NZSA 2ABDA 2A4ZA 2KXJA 1M7EA 5E6NA 1WH3A 4ICUA 4LJOB 4KSKC 2DHKA 2OOBB 2V1YA 3TCAA 1TTNA 4HCNB 1Y5OA 2IY1B 3PTFC 5GOWB 2LZ6A 3L17A 3DVGX 2KDEB 4WQOB 3WANA 2I5FA 3QARA 2YT1A 4HAUB 5JLJB 1QC6A 3ENEA 1WXMA 2DKQA 1V61A 5KHQA 1ZSQA 2MSED 2KOXA 4KHAA 1WX8A 3DBSA 1WF9A 1L7YA 2K8BA 2FCSA 2D2QA 1KC7A 2NR2A 3DOWA 2Z0QA 3JSVB 1YJ1A 4N9F4 1KLVA 3P6AA 5JHBA 2LGXA 4GSWA 3APCA 2CHXA 4W9CA 3ZW3A 1ST7A 4MT7A 1NU2A 1E7VA 4GB9A 3A9KA 5J3YA 4ZDVA 2M38A 4G0NB 1UD7A 3A9KB 1UH6A 4B6WA 2JWZA 3NSUA 4OVUA 2D9YA 1F9JA 2LXCA 3SNHA 1CMXB 2ZJDA 3TIXA 4W9KA 4JGHB 1EF5A 1JRUA 4FJVB 2IBIB 2GCLA 2ZCCA 4W9DA 1Z2MA 3KYCD 2DX1A 2J0MA 1LM8B 3OANA 3HM6X 3RT3B 3O96A 4GN1A 2IO2B 4M8NA 2K2UA 2IO1B 4IM2A 4TQ0A 2JY6A 2RGFA 1E8ZA 4HDOA 4IAPA 3QIJA 2JPHA 2CY5A 4MJSA 2MBBB 1G6JA 2E2XA 5DPTA 1M7RA 2GOWA 1FHOA 4HCPB 1M94A 2R09A 2C7NB 1VCBA 4K2OA 2R2QA 2KWVB 2LG1A 4KAXB 3ODOA 4IUMB 3DBHI 3D32A 3UINB 2DZKA 1WGQA 2J0JA 1RAXA 2RGNB 5J3QA 3R7QA 2LOZA 1P1AA 2N7EA 2KHWB 2C60A 4MGIE 3TO1A 2KFKA 3ALBA 4II2B 2DAJA 1AWEA 2X0SA 1U27A 4WWNA 4GZUA 2K2JA 4H8SA 5D3XA 1YD8U 3TVVA 2REXA 3ZRFA 2GBMA 1ZW7A 2KTRB 1WJUA 3AU4A 5DIFB 3NY5A 1LXDA 3N3KB 3SV1A 1V49A 4EOYA 2UZRA 4DBBA 2CODA 4HB0B 4IW0A 5C23A 1HE8A 2LVOA 4KSLC 1P6SA 1KBLA 1WM3A 4HXDA 2CAYA 5E6OA 4K2PA 2NMBA 3VUYA 1V5OA 3VUWA 2L2IA 2M0XA 4MGYE 4K7UA 2RSUA 2LBBA 3QCAA 2I1KA 2G45B 2H7DA 3P2BA 2MCNB 1U5EA 5JZEB 3D8FA 3PGEA 1UGMA 1WJ4A 4W9EA 2MBQA 2UZSA 3P7ZA 2YS1A 2KANA 2OTXA 4W9GA 3ZDMC 2BYEA 3R66C 3R3MA 5J3TA 1V5MA 2ADZA 4A3PA 3W1SA 1UNQA 3WAPA 2KLGA 2JXXA 4YL8A 1MG8A 2L0TA 2L05A 3KH0A 2C7HA 4URKA 2BYFA 3HM3A 5AZHA 1GUAB 2M17A 3VQIA 3V5WA 4GOCA 1XX0A 4GU2A 4BKSD 4JKBA 4HAXB 4ANWA 1MIZB 2MDXA 2ASQA 2NBUA 3G9WA 1V89A 3SYXA 3ZLZA 1NI2A 3ZVVA 2HRJA 2KFKB 4DK5A 3S2AA 3PT2B 4DDGD 4KHOA 1KOTA 3MDBC 2N9EB 1BWNA 2WX1A 2DA0A 2H7EA 2D4QA 1NVLA 3VH4B 2UVMA 5DI9B 4PS7A 1UZXB 2DX5B 2KQSA 2PEAA 2FIFA 2GBNA 1UBQA 2KKCA 2DN6A 1ZKHA 3FM8C 3ENBA 3L10B 2DZJA 3PEGA 1I7AA 5CX3A 4HAWB 4BVUC 4ZYNA 3TFMA 2KX0A 1PQSA 2EC1A 5D7GA 3KW5B 5JH5C 4F8CB 3PLVA 3UQAA 1ZVRA 1FHXA 4HAZB 3ECIA 3VVWB 4IM0A 2Y8FA 4WAAA 1W1HA 3C0RB 1I35A 1OEYJ 1EVHA 2RQ1A 2RD0A 3N7CA 3I3TB 5CHVC 4MEMA 5C5BB 3B0AA 3RULA 3KY9A 3SHQA 2ZNVC 2GS0A 2EJ8A 2G4SA 4WJNA 1ZC3B 1LQBA 2DHJA 2KJRA 5TR5A 1Z5SB 3ZO5B 1GG3A 4GDLB 4WSFA 1LFDA 3ZVRA 1OGWA 4MH0E 2L0FA 2GBKA 5LLIA 2D10A 1OMWA 3A33B 5HKHA 2M4NA 2MP2B 4Z2NA 1WM2A 2DKPA 3LJ3A 4JKEA 4W9JA 3TBLD 2D9WA 3QHTA 2DYMA 2KX3A 1XCGA 3ML4A 2MBOA 2LRWA 4F7UP 2K39A 1V88A 2L7RA 3K9OB 3W1SC 3ML8A 3F5RA 1S3SG 5CLLB 4NQLB 3R7RA 4F7ZA 2BWES 4FHKA 2YRYA 2FUHB 3MTNB 3RZFA 2DZMA 2AWTA 3WALA 3DXEA 2R82A 4NAWA 5D94A 4HATB 4DX90 4ILGB 3FSSA 1V6EA 5EDSA 2J0KA 1I2HA 2A5UA 4D0NB 4MJSB 4DX8A 3SBTA 3QBVB 2KDFB 3O65B 4MSQB 4HLEA 3DXCA 4DHJD 5DCNA 2C5LC 4KDLB 4BFRA 4BKTA 1NDDA 4IWQA 4ILHA 5L83A 3QWMA 3UIPB 4BKSA 3VAWA 4B95A 1C1YB 3CSFA 3D8DA 2R0DA 2LUEA 3V60A 3L0WB 4JKGB 4WJOA 1RRBA 1WXSA 2FCQA 2WDTB 2WYQA 2FCNA 3EPYA 2VRRB 2KTRA 2KO3A 4DHJB 1WY8A 4HHVA 2LASA 1WX7A 5GMVA 3ML9A 3KUDB 3A8PA 2MA9B 4A6HA 3VUXA 5IJMA 1WJMA 4FA6A 1SGHA 4K17A 2LRUA 2MQJA 3F0WA 1FGZA 2IZVB 2RUKB 4TKNA 2P0DA 4JKGA 2W9NA 5IA7A 4EJNA 1WJNA 2MKRA 2LI5A 4GIVA 2IYDB 4GMVA 2L3ZA 5JHHA 1X86A 2RNRB 2C7MB 2RLOA 3VTVA 3A9JA 4ZRJA 4GXBA 1WI0A 2O6VA 2KJHB 4L6EA 4RM8A 2DYQA 1AARA 3L13A 5JVLA 1EUVB 1TJ6A 3M63B 1V80A 4NAWB 1VBHA 4GGQA 1XT9B 3AXCA 3ZDTA 4KHBB 3ZNGC 1V5PA 3BJIA 1OQYA 1B55A 2K8HA 1NTIA 3PVLA 3ULBA 2LYDA 4JQWC 2D9ZA 3A1QB 4ANUA 3DPDA 4JK9A 2DYNA 1L2NA 4HB2B 3KZ1A 3QK0A 2NVUI 4HAYB 1V86A 3OAWA 5D6JB 3WAMA 3IHPC 1LB1A 3CXBB 3QX1A 3ZTCA 1FGYA 3PSEB 1BT0A 3APFA 3VHTC 3GYPA 1TZ1A 2CRFA 3UF8A 4BOZB 2FNJB 2YT0A 4EUTA 1V5UA 2KVRA 1FXTB 1DIKA 1E90A 4EZLA 4W9HA 1YX5B 4FADA 2BYVE 1KI1B 1QQGA 5CLQB 1KM7A 1MK7B 5KQ4A 2PE6B 3M62B 2ROVA 1WGHA 3MPXA 2JVCA 3JVZX 4HAVB 1U4AA 3X0WA 1EAZA 3B08A 5C79A 4E3CA 1RJ2A 2LVQA 5L81A 2NZ8B 2AEHA 2G35A 3QA8A 2UWQA 3PHXB 4JK8A 3JSVA 2FDQA 2YS5A 1OEYA 4GDKA 1SHCA 5FI1A 3TMPB 4TQ1A 1XKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DI9 B;  1MPH A;  2XK5 B;  4YON A;  1WFY A;  4KV2 A;  4AUQ C;  3PRE A;  4AJW A;  1UBI A;  4KDI C;  1J0G A;  4PS7 A;  1UZX B;  3ZIM A;  2DX5 B;  3B1L X;  1WYW B;  2BCJ A;  2COC A;  2KQS A;  4EMO A;  2PEA A;  2FIF A;  1P3R A;  2RR9 A;  2WX0 A;  2VRW B;  2VKI A;  3FEH A;  1ZGU B;  2GBN A;  3T9L A;  1UBQ A;  4FBJ B;  1EO6 A;  3EEC A;  2KKC A;  2EMS A;  5DPR A;  2KZR A;  2DN6 A;  4KVG B;  3VIA A;  3JYU A;  3M1I B;  1E8W A;  4EKU A;  3A8Q A;  3ODW A;  1WR1 A;  2YVC A;  1Q0W B;  4FJZ A;  3NS8 A;  1ZKH A;  2GCJ A;  4IOY X;  1TQZ A;  3FM8 C;  4DHZ E;  3L10 B;  1I42 A;  1GC6 A;  2DZJ A;  1NBF C;  2Z0P A;  4F7H A;  2WWZ A;  4LDT D;  1Y8R C;  2UYZ B;  1Y19 B;  1DYN A;  1WI1 A;  3PEG A;  4BOS C;  2R2O A;  1I7A A;  2Y8G A;  2CR5 A;  2K6Q A;  4HK2 A;  2MBE A;  5CX3 A;  5KCV A;  1E8X A;  4KZC A;  4HAW B;  4BVU C;  1FAO A;  3CIK A;  2D11 A;  2KMC A;  2PJH A;  4DXA B;  1UNP A;  1IPG A;  1K8R B;  4ZYN A;  3TFM A;  4K81 A;  2HD5 B;  3L08 A;  2KX0 A;  5DPS A;  3SDL C;  2KUP A;  2M14 A;  2QKM A;  4TV3 A;  4PYU A;  1PQS A;  2EC1 A;  2ZEQ A;  5HE1 A;  1EGX A;  5D7G A;  5HE2 A;  3CMM B;  1XR0 B;  3KW5 B;  5JH5 C;  2KC1 A;  4II3 B;  4F8C B;  3A9J B;  2HTH B;  1WGD A;  3PPA A;  2MLB A;  3PLV A;  2Z59 B;  3UQA A;  4A6K A;  3DVN U;  3A98 B;  3ZNI D;  1P0R A;  3DQV A;  1ZVR A;  1P5T A;  1FHX A;  1U5D A;  2EKE C;  2LXA A;  3N30 A;  2HJ8 A;  2NCN A;  2FJL A;  3EFU A;  1OQN A;  2PE9 A;  4WVF B;  3PRM B;  2DEN B;  4HAZ B;  1WXA A;  3ECI A;  2Y7B A;  3TJP A;  2XEW A;  1KZ7 A;  3BIN A;  3VVW B;  4IM0 A;  2Y8F A;  1W1D A;  1K5D B;  4W9L A;  4RM8 A;  4DDI D;  2DYB A;  1S1Q B;  2YLM A;  4HPM B;  4K7S A;  2KD0 A;  4M0W B;  2DZI A;  2DLW A;  4WAA A;  1W1H A;  3PHW B;  3C0R B;  4FLH A;  1I35 A;  1OEY J;  5G2N A;  1EVH A;  2RQ1 A;  2XK5 A;  1BTN A;  1KZG A;  2KGX B;  1GJZ A;  2RD0 A;  3HQC A;  3Q3J A;  3N7C A;  3I3T B;  5CHV C;  5JHG A;  4ANV A;  1D3Z A;  1BAK A;  3QQ8 B;  2AL3 A;  3NZS A;  4MEM A;  2ABD A;  5C5B B;  1U5G A;  4HDQ A;  2A4Z A;  2KXJ A;  1UEF A;  3B0A A;  3KY9 A;  3RUL A;  4BBN C;  1M7E A;  5E6N A;  3SHQ A;  4MK0 A;  1WGY A;  2KJ6 A;  2ZNV C;  3IG3 A;  3L54 A;  4GDL A;  4P7I A;  1WH3 A;  4JL9 A;  2GS0 A;  2GJY A;  3ZTD A;  4AOF A;  2EJ8 A;  4ICU A;  2G4S A;  4LJO B;  4G50 A;  4KSK C;  4WJN A;  5AEK B;  1FHW A;  3LJU X;  2CHZ A;  4WWP A;  2J59 M;  1ZC3 B;  2DHK A;  1LQB A;  1NTV A;  2DHJ A;  2KJR A;  2BKR B;  2OOB B;  5TR5 A;  1Z5S B;  5D3W A;  3TCA A;  2V1Y A;  1GG3 A;  4GDL B;  5C6R A;  3ZO5 B;  1TTN A;  4WSF A;  3PRZ A;  3TW1 A;  1WE7 A;  3NZU A;  4HCN B;  4KIK B;  1LFD A;  3ZVR A;  1Y5O A;  1OGW A;  2ROZ B;  1WZ3 A;  4MH0 E;  2Z0E B;  4X57 B;  2G4D B;  2IY1 B;  1NTY A;  2L0F A;  2GBK A;  2JZ3 B;  2KWC A;  3H7P B;  3KRX A;  5GOW B;  2LZ6 A;  2D10 A;  3PTF C;  2B3A A;  2N1V A;  1OMW A;  2MW5 A;  3A33 B;  2AYO B;  3L17 A;  5KHO A;  5HKH A;  2MWN B;  2M4N A;  2MP2 B;  3DVG X;  4G3X B;  2KDE B;  2KMA A;  2KWU B;  4Z2N A;  4WQO B;  4C0A A;  3WAN A;  2ZNV B;  3SUZ A;  2CB8 A;  3PP2 A;  3MHS D;  2ELA A;  1WM2 A;  2I5F A;  1WX9 A;  1WXV A;  2DKP A;  2KNB A;  3QAR A;  4BBN F;  2YT1 A;  1PMS A;  4HAU B;  2C9W B;  2W2X D;  1OTR B;  5CHF A;  5JLJ B;  3LJ3 A;  3PG7 A;  1QC6 A;  2PZ1 A;  3D8E A;  4W9J A;  3TBL D;  2RSG A;  3VXW A;  3ENE A;  1GNU A;  2O2V A;  3JW0 X;  2BKF A;  3FP5 A;  4PNK A;  1WXM A;  2D9W A;  2DKQ A;  3SD5 A;  1V61 A;  4XWX A;  5KHQ A;  1ZSQ A;  3PSC A;  4LJP B;  3QHT A;  1MKE A;  2MSE D;  2KOX A;  3H1U A;  2DTC A;  3RZW C;  3KRW A;  4KHA A;  1XCG A;  1XD3 B;  2DYM A;  3ML4 A;  2KX3 A;  2MBO A;  4NQK E;  3IVF A;  2LRW A;  3L16 A;  1MIX A;  1WX8 A;  3DBS A;  3HK0 A;  1WF9 A;  1A5R A;  2JRH A;  5DPW A;  2GMI C;  1L7Y A;  4LCD E;  2K8B A;  2L8J A;  4F7U P;  2FCS A;  2K39 A;  1V88 A;  1BTK A;  2JUO A;  2L00 B;  1VD2 A;  2D2Q A;  2L7R A;  2ZVN A;  3K9O B;  3W1S C;  3K9P B;  2COP A;  1IYF A;  2NR2 A;  1YX6 B;  4RMA A;  4ZRK A;  3DOW A;  2CQU A;  1H4R A;  3ML8 A;  2Z0Q A;  3JSV B;  1E7U A;  1YJ1 A;  5D27 A;  2LD9 A;  3QJZ A;  4IC7 B;  3P6A A;  1SIF A;  4N9F 4;  2I1J A;  3F5R A;  1S3S G;  5CLL B;  5JHB A;  1KLV A;  2KCJ A;  2M1M A;  2LGX A;  4NQL B;  4XX5 A;  4XZ4 A;  3R7R A;  3WAO A;  4GSW A;  3APC A;  3V6C B;  4F7Z A;  2COA A;  2FAZ A;  2IFS A;  2BWE S;  2CHX A;  4W9C A;  3ZW3 A;  2XBB C;  3W1Y A;  1ST7 A;  4MT7 A;  2OJR A;  4FHK A;  5CTR C;  2YRY A;  2FUH B;  3MTN B;  3OLM D;  3RZF A;  1NU2 A;  3U8Z A;  1E7V A;  2DZM A;  2AWT A;  3WAL A;  4GB9 A;  4GMX B;  3DXE A;  2NPT A;  2MRP A;  5D3V A;  3A9K A;  4NAW A;  5JP4 A;  5D94 A;  4HAT B;  4DX9 0;  1FOE A;  3FSS A;  1V6E A;  2DFK A;  5J3Y A;  1WGG A;  1UEL A;  2J0K A;  5DHF B;  5DH9 B;  3AJ4 A;  4I6P A;  1I2H A;  2A5U A;  2IO3 B;  3H7P A;  3NHE B;  5D2M B;  4A3O A;  4ZDV A;  2M38 A;  4G0N B;  2MP2 A;  4MGK E;  4D0N B;  1UD7 A;  1ZM0 A;  3ULC A;  2FJ9 A;  4WJ7 A;  2LKO A;  2IY0 B;  1UH6 A;  1XQQ A;  2NPT B;  2V4L A;  3A9K B;  2JWZ A;  3PRP B;  4B6W A;  3NSU A;  2JP2 A;  3QBV B;  4DX8 A;  2K25 A;  2KDF B;  3O65 B;  4MSQ B;  1WRD B;  4M8M A;  4OVU A;  3RD2 A;  4HLE A;  3DXC A;  2D9Y A;  4ICV A;  1ACA A;  4Z2M B;  1F9J A;  3SNH A;  2LXC A;  3GOE A;  5DCN A;  1CMX B;  4DHJ D;  2N23 A;  2ZJD A;  2C5L C;  4KDL B;  4EEW A;  3TIX A;  4PQ0 A;  3AU5 A;  3VH3 B;  3DBR I;  4W9K A;  5HE0 A;  4BKT A;  5BO4 B;  4BFR A;  5LXI B;  1H10 A;  5G55 A;  2W2X C;  1Z87 A;  4JGH B;  1EF5 A;  1NDD A;  4IWQ A;  1J19 A;  5L83 A;  3QWM A;  1WMH A;  3KYD D;  3UIP B;  3SU8 X;  4FN2 A;  4BKS A;  1JRU A;  4FJV B;  2IBI B;  2GCL A;  2ZCC A;  4W9D A;  1Z2M A;  3DVG Y;  4W9F A;  3VAW A;  3KYC D;  4B95 A;  1C1Y B;  3CSF A;  3D8D A;  2DX1 A;  3ZNZ B;  5KQ1 A;  2J0M A;  1LM8 B;  2NS5 A;  3OAN A;  2R0D A;  3HM6 X;  2LUE A;  2DHI A;  3L0W B;  4PS8 A;  4PYZ A;  3V60 A;  2AL6 A;  4NJ6 A;  3OJ3 A;  1WVH A;  2BWF A;  3U7D A;  3RT3 B;  3O96 A;  1WGU A;  4WJO A;  1RRB A;  3VTU A;  4GN1 A;  2IO2 B;  1WXS A;  3H9D A;  4JLC A;  2FCQ A;  4M8N A;  2K2U A;  3QAQ A;  2VSZ A;  2GBR A;  2WDT B;  2WYQ A;  2IO1 B;  4IM2 A;  2M8S A;  4DBG A;  2FID A;  2FCN A;  4E74 A;  3EPY A;  2VRR B;  4TQ0 A;  3VFK A;  1C3T A;  2JY6 A;  2KTR A;  2J7Q B;  2RGF A;  1E8Z A;  4HDO A;  4XC2 A;  4IAP A;  2KO3 A;  3QIJ A;  4TYZ A;  2JPH A;  1WY8 A;  1WJ6 A;  3EHV A;  4AJY B;  4HHV A;  4DHJ B;  2LAS A;  4K1R B;  2CY5 A;  5C1Z A;  2V76 A;  3U30 A;  1WX7 A;  4MJS A;  1DBH A;  1ZC4 B;  2O6V B;  3Q3F A;  2MBB B;  4DWF A;  1G6J A;  4IFS A;  5C16 A;  5GMV A;  1N3H A;  2K8C A;  3ML9 A;  4CHK A;  2E2X A;  3H7S A;  3KUD B;  3A8P A;  2KDB A;  5AZF A;  1V2Y A;  5DPT A;  3GZN I;  4G11 A;  2MA9 B;  4FUL A;  1E5W A;  1M7R A;  4A6H A;  1FHO A;  2GOW A;  4HCP B;  2P8V A;  2OQB A;  4MDK E;  2IO0 B;  4AP4 C;  2KQ7 A;  1J8C A;  1M94 A;  4KIK A;  3VUX A;  2R09 A;  5IJM A;  2C7N B;  4MGI E;  1VCB A;  2JZZ A;  4IG7 B;  4EFO A;  1EF1 A;  1WJM A;  2FCM A;  4FA6 A;  1SGH A;  1UNR A;  4K2O A;  4K17 A;  2R2Q A;  2KWV B;  3BY4 B;  2LG1 A;  5FR6 A;  4KAX B;  2LRU A;  5LLI A;  1HB8 A;  2D3G A;  2MBH A;  2MQJ A;  4AWJ A;  3ODO A;  4IUM B;  1Q67 A;  1UPR A;  1W1G A;  3F0W A;  1FGZ A;  4IM3 A;  2LUL A;  3DBH I;  3D32 A;  2IZV B;  4IWP A;  2DZK A;  3UIN B;  1WGQ A;  2J0J A;  2RPQ A;  1RAX A;  2ZZP B;  4HB4 B;  3HHM A;  2DX5 A;  1HB6 A;  2QKL A;  2RGN B;  5J3Q A;  2N9X A;  2RUK B;  3R7Q A;  2LOZ A;  1DDW A;  4TKN A;  2P0D A;  1P1A A;  2N7E A;  2KHW B;  2C60 A;  3TO1 A;  4ZRI A;  2KFK A;  2LVP A;  4I6L B;  1PFJ A;  2BF8 B;  3ALB A;  1Q1O A;  2CKH B;  4II2 B;  2CS4 A;  2W9N A;  5J18 A;  5IA7 A;  3A1Q A;  4BBK A;  3ZKJ C;  2DAJ A;  4EJN A;  1MK9 B;  3PVU A;  1WJN A;  1AWE A;  3PVW A;  1U27 A;  1FB8 A;  4WWN A;  3AI5 A;  4GZU A;  2K2J A;  1WGR A;  2MX2 A;  2MKR A;  2O6V D;  2V3S A;  2KDI A;  1KJT A;  1YIW A;  2LJ5 A;  1XD4 A;  2YS3 A;  4H8S A;  4HB3 B;  5D3X A;  3DCG A;  3M95 A;  1IRS A;  2LI5 A;  1RRP B;  1YD8 U;  3TVV A;  2BGF A;  2IYD B;  1E8Y A;  2REX A;  4GIV A;  4GDK B;  1U2B A;  3ZRF A;  2G3Q B;  4GMV A;  5LON B;  4PS3 A;  2GBM A;  2L3Z A;  3UQB A;  3PLU A;  1ZW7 A;  2NBV B;  5JHH A;  3KUZ A;  2KTR B;  1X86 A;  1WJU A;  2KFJ A;  2PPH A;  3ONS A;  2YSZ A;  3H6N A;  3AU4 A;  5DIF B;  2RNR B;  2C7M B;  4WJP A;  4ASW C;  2KC2 A;  2RLO A;  4CHM A;  3NY5 A;  4IWO A;  1LXD A;  3N3K B;  2D9V A;  3IBE A;  3SV1 A;  5AZG A;  3VTV A;  2KN5 A;  1V49 A;  3A9J A;  4EOY A;  3QC8 B;  4HPL B;  2UZR A;  4NJ7 A;  1DRO A;  3DVN V;  4ZRJ A;  1H8C A;  1X11 A;  4DBB A;  4GXB A;  2ZPY A;  2COD A;  1WI0 A;  1V81 A;  2O6V A;  2KJH B;  3AUL A;  3UGB B;  1TGZ B;  4L6E A;  4F7G A;  2DYQ A;  2L1C A;  1OY2 A;  1AAR A;  1P3Q U;  2LGD A;  2MWS B;  2GBJ A;  3L13 A;  4FHJ A;  4MEL A;  4EZK A;  4HB0 B;  1EUV B;  4FJY A;  4IW0 A;  5C23 A;  5J17 A;  1HE8 A;  1TJ6 A;  2LVO A;  3T8M A;  4KSL C;  1P6S A;  1WM3 A;  2Q13 A;  2KTF A;  3M63 B;  3APD A;  3PV1 A;  4HXD A;  2CAY A;  5E6O A;  1V80 A;  4NAW B;  4K2P A;  3A4S C;  2CHW A;  3VOQ A;  2NMB A;  3VUY A;  1V5O A;  4GGQ A;  1X1G A;  4MGZ E;  3VUW A;  4B9K A;  1XT9 B;  2L2I A;  4B6H A;  2M0X A;  4RM9 A;  4EZJ A;  3WA0 A;  4MGY E;  2N9P C;  2KK8 A;  4K7U A;  1LW3 A;  2KLC A;  3AXC A;  4WJQ A;  5JHA A;  3ZDT A;  1J0W A;  3KSY A;  4KHB B;  2HTH A;  2LBB A;  1V5P A;  2RSU A;  3DDC B;  3N32 A;  3QCA A;  2I1K A;  2G45 B;  3BJI A;  2H7D A;  2MFQ A;  1OQY A;  1Q5W B;  1WG7 A;  2DYO A;  3KUC B;  3P2B A;  4MM3 A;  1U5E A;  2MCN B;  1U5F A;  2YF0 A;  3V62 A;  3ZNG C;  1XOD A;  5FI0 A;  1RLF A;  2P0H A;  5HE3 A;  5LOP B;  4NSW A;  5JZE B;  3D8F A;  1B55 A;  2JF5 A;  1NTI A;  2K8H A;  3PVL A;  3ULB A;  2LYD A;  4LDT B;  4JQW C;  2D9Z A;  4BKG A;  2RVB B;  2LWP A;  3A1Q B;  2COF A;  2P0F A;  4I6N B;  4WWO A;  4ANU A;  2JT4 B;  3PGE A;  3DPD A;  1UGM A;  1WJ4 A;  1QZE A;  2CY4 A;  2CU1 A;  2DYN A;  1WR6 E;  1DDM A;  4NPN A;  4TUU A;  4E71 A;  4W9E A;  1L2N A;  2LGY A;  4HB2 B;  2MBQ A;  4ANX A;  2UZS A;  5EFX A;  3KZ1 A;  3QK0 A;  3RYT A;  5J2R A;  2NVU I;  4HAY B;  1K5G B;  3P7Z A;  3RUI B;  2YS1 A;  2KAN A;  1V86 A;  1P9D U;  3OAW A;  1AQC A;  2IYB A;  5D6J B;  3WAM A;  2OTX A;  3IHP C;  4W9G A;  2BYE A;  3ZDM C;  3ZNH B;  3R66 C;  2K1F A;  3R3M A;  5J3T A;  4A20 A;  3TL5 A;  1RFA A;  3CF6 E;  1V5M A;  5C5B A;  2ADZ A;  1LB1 A;  4A3P A;  3CXB B;  3ODX A;  3SO6 A;  2N1W A;  3QX1 A;  3W1S A;  3EC8 A;  1UNQ A;  3ZTC A;  4F1S A;  4W9I A;  4CYE A;  2I5C A;  3DXD A;  1FGY A;  1X1M A;  1WE6 A;  1T0Y A;  2K6D B;  2KLG A;  3PSE B;  3WAP A;  2JXX A;  5L95 C;  4YL8 A;  4CHJ A;  1BT0 A;  2HE7 A;  1P98 A;  3APF A;  2L76 A;  2N0Y A;  1MG8 A;  3UZT A;  4Y94 A;  4MSM B;  2L0T A;  2L05 A;  4JIO U;  1TBE A;  3VHT C;  4A5K A;  3FLV A;  2N7D A;  3KH0 A;  3GYP A;  1TZ1 A;  2CRF A;  3UF8 A;  4BOZ B;  2FNJ B;  2C7H A;  2YT0 A;  5EDS A;  1TXD A;  4URK A;  3CST A;  3KVF B;  4EUT A;  2BYF A;  1V5U A;  3HM3 A;  1X05 A;  5AZH A;  1GUA B;  2M17 A;  3IFW B;  1DDV A;  4HVB A;  3ZRC A;  3VQI A;  3OJ4 B;  2DHZ A;  3DBL I;  2LOX A;  3GYO A;  4NY0 A;  3HIZ A;  2Y5B B;  3V5W A;  2DAF A;  2KVR A;  4GOC A;  4OVV A;  1XX0 A;  2Z0O A;  2ZPN A;  4GU2 A;  3VTW A;  4MY6 A;  5D3Y A;  1MAI A;  4GPT B;  4A6F B;  1FXT B;  1WJ1 A;  4BKS D;  4CO7 A;  3QWZ B;  2O2V B;  4HAX B;  4DHZ B;  4KZ0 A;  1IP9 A;  1E90 A;  1ISN A;  4EZL A;  4W9H A;  1YX5 B;  1R4M I;  4ANW A;  4FAD A;  1HBK A;  1MIZ B;  2BYV E;  1KI1 B;  2MDX A;  1QQG A;  5CLQ B;  2QHO A;  3V6E B;  1GC7 A;  1KM7 A;  1MK7 B;  5KQ4 A;  2PE6 B;  3M62 B;  2ROV A;  1WMH B;  1YQB A;  2JRI B;  1WGH A;  1WZ0 A;  4J6I A;  3VDZ A;  1U29 A;  2ASQ A;  3MPX A;  2NBU A;  4K7W A;  3G9W A;  3WIM A;  3MJW A;  1V89 A;  3HW2 B;  3SYX A;  1WIA A;  2X18 A;  3ZLZ A;  2JVC A;  1NI2 A;  1X1F A;  3JVZ X;  4MJS B;  3RCZ A;  2ELB A;  4HAV B;  2K00 A;  3A4R A;  3ZVV A;  1U4A A;  2HRJ A;  3X0W A;  4HWI B;  2KFK B;  3PZD A;  1EAZ A;  4NNJ B;  4DK5 A;  3S2A A;  2ZVO A;  3B08 A;  5C79 A;  4HJK A;  2Z0D B;  2BPS A;  3RCP A;  1RJ2 A;  1V9J A;  2LVQ A;  3PT2 B;  4DDG D;  4E3C A;  3X23 A;  4KHO A;  5L81 A;  3WYF B;  4A6F A;  3V61 A;  2NZ8 B;  2N4F A;  3M3J A;  5IAA C;  2ZCB A;  1R4N I;  5E6P A;  2AEH A;  2W2W A;  1KOT A;  2G35 A;  3QA8 A;  2UWQ A;  3PHX B;  3MDB C;  2N9E B;  3JSV A;  2FDQ A;  3LDZ E;  3NOB A;  2D07 B;  5CHW A;  2YS5 A;  1OEY A;  2NBW B;  1BWN A;  1PLS A;  1UPQ A;  3UIO B;  1V5T A;  2WX1 A;  3ZUN A;  4GDK A;  2DA0 A;  2D9X A;  2H7E A;  1SHC A;  2D4Q A;  3PS6 A;  2WH5 A;  2XQN M;  3T06 A;  5LXH A;  1SE9 A;  5DHA B;  1NVL A;  5FI1 A;  4TQ1 A;  3TMP B;  3VH4 B;  1XKE A;  2EMT A;  2UVM A; 
#chains in the Genus database with same CATH topology
 2XK5 B;  1MPH A;  4YON A;  4AUQ C;  3PRE A;  1J0G A;  2V3N A;  3ZIM A;  1WYW B;  3AE9 B;  2WX0 A;  1P3R A;  2Z14 A;  3GP7 A;  1ZGU B;  3T9L A;  1XLQ A;  3E9O A;  5DPR A;  1D5X C;  2GUM A;  2D3A A;  2XNA C;  2YVC A;  3BYT B;  3V05 A;  4IOY X;  3NS1 A;  1GC6 A;  4LDT D;  4F7H A;  3NW8 A;  1Y19 B;  1DYN A;  2DNF A;  2V3P A;  3RPF C;  2CR5 A;  3BVG A;  2KYW A;  2MBE A;  5KCV A;  4D2K A;  1YQ3 B;  2PJH A;  2D11 A;  2KMC A;  4DXA B;  1UNP A;  1K8R B;  1ZPS A;  4M01 A;  5BYS A;  4K81 A;  2HD5 B;  4JWS C;  3SDL C;  2QKM A;  4TV3 A;  3W9C B;  3CMM B;  1XR0 B;  2KC1 A;  4II3 B;  1WGD A;  1UNS A;  2MLB A;  3RMK C;  4ITK A;  3VR9 B;  1R4N B;  4KGR A;  2X38 A;  2W82 A;  1P5T A;  1CK1 A;  3ZJV A;  1F52 A;  3N30 A;  2HJ8 A;  1ZE3 D;  1OQN A;  2PE9 A;  2DEN B;  2M0A A;  3TJP A;  2N0S B;  2Y7B A;  3DWG C;  2XEW A;  3BIN A;  3VRA B;  1K5D B;  2DYB A;  2PLP A;  2KD0 A;  1E6E B;  2DZI A;  2PKO A;  2RMM A;  3AEC B;  1BTN A;  1KZG A;  1GJZ A;  3KWV A;  3HQC A;  5IN7 A;  5JHG A;  4ANV A;  2AL3 A;  1U5G A;  4HDQ A;  1UEF A;  2GB1 A;  2KJ6 A;  3L54 A;  2GJY A;  4N59 A;  4G50 A;  5AEK B;  3LJU X;  1WGK A;  2BKR B;  3NWF A;  5D3W A;  2Y5C A;  2HJ1 A;  1WE7 A;  3NZU A;  4KIK B;  1WZ3 A;  2Z0E B;  3H7P B;  1NTY A;  2JZ3 B;  4N58 A;  4I6L B;  3KRX A;  2B3A A;  1ZDV A;  2MW5 A;  2N1V A;  3HUI A;  2AYO B;  2MWN B;  4G3X B;  1CZP A;  2KMA A;  4B0M A;  2KWU B;  3BVM A;  4C0A A;  3SUZ A;  5EE1 A;  2CB8 A;  3PP2 A;  3MHS D;  2ELA A;  1WXV A;  1WX9 A;  3RI7 C;  2D3C A;  1PMS A;  2C9W B;  1OTR B;  2PZ1 A;  2V9H A;  2RSG A;  3VXW A;  2O2V A;  3JW0 X;  1JCK B;  2BKF A;  4PNK A;  1PFD A;  2ZW0 A;  1MKE A;  3H1U A;  2DTC A;  1STE A;  3I57 A;  3KRW A;  3RZW C;  4NQK E;  3L16 A;  1MIX A;  2IGD A;  5M4Y B;  2GMI C;  4LCD E;  2ZVN A;  2JUO A;  2L00 B;  2LFI A;  3K9P B;  2COP A;  4NZL B;  1YX6 B;  2CQU A;  2KCJ A;  2R2Y A;  2BQQ A;  1VLB A;  4XX5 A;  4XZ4 A;  3WAO A;  2COA A;  2IFS A;  2XBB C;  1J7C A;  2OJR A;  5CTR C;  3NUH B;  1FXI A;  1T77 A;  3U8Z A;  4GMX B;  2NPT A;  2MRP A;  5JP4 A;  2CJO A;  1FOE A;  2DFK A;  1WGG A;  4I6P A;  5DH9 B;  3AJ4 A;  5D2M B;  2IO3 B;  1N62 A;  3H7P A;  3NHE B;  4A3O A;  2L32 A;  2IY0 B;  2NPT B;  3PRP B;  4JX1 C;  1TZO A;  3E9P A;  2WXG A;  1WRD B;  4M8M A;  4MM3 B;  3RD2 A;  1IBX A;  3GOE A;  3TSS A;  4PQ0 A;  3VH3 B;  3DBR I;  5BO4 B;  1H10 A;  3N20 C;  5G55 A;  1MI1 A;  2KR0 A;  1JQ4 A;  1WMH A;  3SU8 X;  3MHZ A;  4FN2 A;  1A70 A;  1D5Z C;  4IDI A;  1L0X B;  4NAM A;  1YNT E;  4PYZ A;  5BMH A;  2AL6 A;  4NJ6 A;  3U7D A;  3VTU A;  1WGU A;  1RFK A;  4JLC A;  3H9D A;  2RDH A;  3QAQ A;  3TEW A;  1ESF A;  2NBV A;  3AH7 A;  2GBR A;  2M8S A;  4YTM B;  2PTL A;  2WXK A;  4E74 A;  3VFK A;  3NZ3 A;  3GE3 C;  3AE3 B;  2J7Q B;  4LNF A;  1HTO A;  1WJ6 A;  1XLN A;  4K1R B;  2V76 A;  1ACC A;  1DBH A;  2O6V B;  3Q3F A;  4DWF A;  4IFS A;  1TS3 A;  1QF6 A;  2K8C A;  2KDB A;  1VJK A;  4RFB A;  2WXI A;  3AB5 A;  4FUL A;  4AP4 C;  2IO0 B;  2FE8 A;  1J8C A;  4KIK A;  1V1P A;  2JZZ A;  4EFO A;  1EF1 A;  2FCM A;  5IP4 D;  3BY4 B;  4HRS A;  5FR6 A;  1SJH D;  2D3G A;  2MBH A;  4IKG A;  1ZDX A;  1UPR A;  2LUL A;  4A6Q A;  2N7J A;  4IWP A;  2XN9 C;  2ZZP B;  5IRS A;  2N9X A;  1DDW A;  1NYR A;  4RCO A;  1PFJ A;  2BF8 B;  2CKH B;  5G5G A;  1L4D B;  3PVU A;  5G5H A;  1FB8 A;  1C78 A;  3AI5 A;  2MX2 A;  2K22 A;  3U2S C;  2LJ5 A;  1KJT A;  1YIW A;  1XD4 A;  4HB3 B;  2KAC A;  4HPP A;  2GRI A;  2BGF A;  1E8Y A;  4GDK B;  2ZKM X;  2G3Q B;  4PS3 A;  4C4V B;  3ZYY X;  3PLU A;  2NBV B;  3ONS A;  3KUZ A;  2PPH A;  1JWM D;  2YSZ A;  4WJP A;  4KGS A;  5BYQ A;  4CHM A;  4IWO A;  3IBE A;  4P1C C;  2FBW B;  2KN5 A;  1P7F A;  4HPL B;  1DRO A;  1H8C A;  1X11 A;  2ZPY A;  2Z4D A;  3AUL A;  1V81 A;  1MVK A;  1TGZ B;  4F7G A;  2L1C A;  2MWS B;  2GBJ A;  4FHJ A;  5J17 A;  4MEL A;  1JWU D;  2J53 A;  3T8M A;  3Q8A A;  2KTF A;  2Q13 A;  4HRO A;  3APD A;  1T0Q C;  3AE2 B;  2Z8L A;  1KLU D;  5JXV A;  4OSN A;  3VOQ A;  2KIG A;  1X1G A;  2QMT A;  2WDV B;  4B6H A;  3DBH B;  1CJE A;  2KQ4 X;  1J0W A;  3DDC B;  3N32 A;  2MFQ A;  1WG7 A;  3KUC B;  3V62 A;  1U5F A;  2YF0 A;  5AUI A;  4ACF A;  1XOD A;  5HE3 A;  4OZC A;  4NSW A;  2JF5 A;  4LDT B;  4BKG A;  2RVB B;  2LWP A;  2COF A;  2P0F A;  3B2F A;  4I6N B;  3FVC A;  2E3T A;  2CU1 A;  1DDM A;  2IJ0 A;  4ANX A;  4ILJ A;  1SE2 A;  2LHE A;  1K5G B;  2N9K A;  3NRZ A;  3B77 A;  3RUI B;  1FD6 A;  1DGJ A;  1P9D U;  2IYB A;  1TIF A;  2K1F A;  2RPV A;  4A20 A;  3TL5 A;  2WXP A;  3CF6 E;  5C5B A;  3ABV B;  3SO6 A;  2H89 B;  3DXD A;  1WE6 A;  2K6D B;  2JWU A;  2LUM A;  4CHJ A;  1P98 A;  2HE7 A;  2W54 A;  3R2T A;  3UZT A;  4MSM B;  3FLV A;  2N7D A;  3EA6 A;  2W3R A;  3CST A;  3P4S B;  1X05 A;  4D6W A;  4KKI A;  4R3D A;  4HVB A;  4QJ5 B;  2DHZ A;  3GYO A;  2INN E;  2Y5B B;  2DAF A;  2ZPN A;  3VTW A;  5D3Y A;  1MAI A;  4A6F B;  1ZOY B;  1WJ1 A;  1LGR A;  2WDR B;  3Q8C A;  2O2V B;  1NEK B;  4KZ0 A;  1R4M I;  3Q8F A;  1PGA A;  2ZW1 A;  2QHO A;  1HA5 A;  3V6E B;  1GC7 A;  2WP9 B;  1WMH B;  3MJW A;  1WIA A;  2X18 A;  1TY2 A;  3DWM A;  2ELB A;  3OG5 A;  2K00 A;  3A4R A;  1NYQ A;  4HWI B;  4NNJ B;  3TEY A;  2ZVO A;  1ZP0 B;  2Z0D B;  1V9J A;  1K52 A;  1UF0 A;  4KX6 B;  1I4Q A;  4RH6 A;  5IAA C;  2H88 B;  2Q5W D;  4JKH A;  3NOB A;  2D07 B;  2NBW B;  1V5T A;  4YT0 B;  1V1P B;  2W3S A;  3PS6 A;  2WH5 A;  2VZK D;  3T06 A;  1SE9 A;  5DHA B;  1IP9 A;  1QQR A;  1WFY A;  4KV2 A;  1FIQ A;  1UBI A;  3E56 A;  3Q8E A;  4RGT A;  2OHF A;  2BCJ A;  2COC A;  1KTK A;  3ZKJ C;  4P16 A;  2KMM A;  2VRW B;  1GOZ A;  3EEC A;  1XF5 L;  2INP E;  1K50 A;  3JYU A;  4XWW A;  3M1I B;  3MJ5 A;  1E8W A;  4EKU A;  3AE8 B;  1Q0W B;  1FCL A;  4FJZ A;  3NS8 A;  3AE6 B;  1VZ8 A;  1TQZ A;  1MI0 A;  4DHZ E;  1I42 A;  1OQQ A;  2Z0P A;  4BOS C;  2WU5 B;  1F77 A;  3B9J A;  2K6Q A;  4HK2 A;  4KZC A;  3L08 A;  2KUP A;  5HE1 A;  1EGX A;  2AQ3 B;  1YN4 A;  3KLS X;  1JWS D;  3ZJU A;  2HTH B;  4CSQ A;  3PPA A;  3DVN U;  1XCQ L;  4C80 A;  2LEK A;  5I2S A;  3EFU A;  1MG4 A;  4WVF B;  3PRM B;  1WXA A;  2IDY A;  1KZ7 A;  1YOV B;  1W1D A;  1S1Q B;  2YLM A;  4HPM B;  4M0W B;  3PHW B;  4FLH A;  5G2N A;  2XK5 A;  2KGX B;  1NI3 A;  3GE8 C;  3Q3J A;  4GLS C;  1D3Z A;  1BAK A;  1C4A A;  4BBN C;  4MK0 A;  1WGY A;  3IG3 A;  2N9L A;  3ETR A;  4GDL A;  4P7I A;  4JL9 A;  3ZTD A;  4KKJ A;  4AOF A;  1F0Z A;  3PZ8 A;  1AW7 A;  1FHW A;  3IT4 B;  2CHZ A;  4WWP A;  2J59 M;  1NTV A;  5C6R A;  1HTQ A;  3PRZ A;  3TW1 A;  1RWS A;  2WXQ A;  2ROZ B;  4X57 B;  2G4D B;  4JKA A;  2KWC A;  4BBN F;  4ARI A;  5KHO A;  4XDD A;  2ZNV B;  5EE9 A;  4P1B C;  1I4R A;  5LG4 B;  2KNB A;  3BII D;  4L1B A;  2W2X D;  3E66 A;  5CHF A;  3PG7 A;  3D8E A;  1GNU A;  1EWC A;  3FP5 A;  1JWB D;  3SD5 A;  4XWX A;  3PSC A;  4LJP B;  3I9V 1;  1NVI D;  1UUP A;  1XD3 B;  1SB3 C;  4EZK A;  2K5P A;  3IVF A;  3HK0 A;  1A5R A;  2JRH A;  5DPW A;  1RYJ A;  2LHD A;  2L8J A;  1WXQ A;  1BTK A;  1VD2 A;  1IYF A;  1FNV A;  4RMA A;  4ZRK A;  1VBG A;  4JKC A;  1I4X A;  1H4R A;  1E7U A;  2LD9 A;  5D27 A;  3QJZ A;  4IC7 B;  1SIF A;  2I1J A;  1MPE A;  2M1M A;  1C9F A;  3V6C B;  2FAZ A;  1J7A A;  3W1Y A;  3OWE B;  3OLM D;  4TSS A;  3UI3 A;  3HVD A;  5D3V A;  1L6V A;  1MHH E;  1UEL A;  5DHF B;  1ZXH A;  1QKZ A;  2LJI A;  2MP2 A;  4MGK E;  3Q14 C;  4WIP A;  1ZM0 A;  3ULC A;  2FJ9 A;  4WJ7 A;  2LKO A;  2V4L A;  3SBG A;  1XQQ A;  2K25 A;  2JP2 A;  4ICV A;  1ACA A;  4Z2M B;  3AEG B;  2N23 A;  2J52 A;  3T3O A;  4EEW A;  1GB4 A;  3AU5 A;  4NJC A;  1F1H A;  5HE0 A;  2W2X C;  1Z87 A;  4RNA A;  2D3B A;  1XXG A;  1J19 A;  3AEA B;  3KYD D;  3DVG Y;  4W9F A;  3ZNZ B;  5KQ1 A;  2NS5 A;  1VZ6 A;  1F2R I;  2DHI A;  3NVY A;  4PS8 A;  3OJ3 A;  1WVH A;  2BWF A;  1D6E C;  2VZK B;  2V4I B;  2VSZ A;  3RNC C;  2DWQ A;  4DBG A;  2FID A;  3TEZ A;  4ZRP A;  1C3T A;  1DYQ A;  4XC2 A;  4TYZ A;  3EHV A;  4AJY B;  1PGB A;  2NMQ A;  2WQY B;  1N6Z A;  5C1Z A;  3U30 A;  1ZC4 B;  1VDV A;  2NTT A;  5C16 A;  1YN5 A;  1MFW A;  1N3H A;  1OFF A;  4CHK A;  1I4G A;  3H7S A;  5AZF A;  1AN8 A;  4CQN A;  1V2Y A;  3GZN I;  3Q3O C;  4A9A A;  4G11 A;  1E5W A;  2PIA A;  2P8V A;  2OQB A;  4MDK E;  5H92 C;  2KQ7 A;  2WU2 B;  3P4R B;  4XDC A;  4IG7 B;  1E7P B;  1UNR A;  2WHI A;  5C2T B;  1HB8 A;  4AWJ A;  3IAS 1;  1Q67 A;  1W1G A;  4IM3 A;  4QAY A;  2RPQ A;  3HHM A;  2ONQ A;  4HB4 B;  2QIE B;  2DX5 A;  1HB6 A;  2QKL A;  2AQ1 B;  4ZRI A;  2LVP A;  5J18 A;  1Q1O A;  2CS4 A;  1E10 A;  3A1Q A;  4BBK A;  4YSY B;  2BB5 A;  1MK9 B;  1L0V B;  3NG0 A;  3PVW A;  2HTM E;  2HDE A;  1QOF A;  1WGR A;  4P6V F;  3I5J C;  2O6V D;  2V3S A;  2KDI A;  3DCG A;  2YS3 A;  3M95 A;  2DIK A;  1IRS A;  2MJE A;  1RRP B;  3AEE B;  1U2B A;  5LON B;  4B0E A;  4L1R A;  3UQB A;  2KFJ A;  1HZ5 A;  3H6N A;  4ASW C;  1T0S C;  2KVZ A;  2KC2 A;  3NVW A;  5FKA C;  2D9V A;  3P63 A;  4OHJ A;  5AZG A;  2BS4 B;  3QC8 B;  4NJ7 A;  2Z13 A;  3DVN V;  1BML C;  3UGB B;  2MH7 A;  2LGD A;  1OY2 A;  1P3Q U;  4YTP B;  4FJY A;  3U7Z A;  5I2M A;  1QOA A;  3PV1 A;  3P42 A;  3A4S C;  2CHW A;  3VR8 B;  4MGZ E;  4B9K A;  1NEN B;  4M02 A;  4RM9 A;  4EZJ A;  3WA0 A;  2BW2 A;  2N9P C;  2KK8 A;  4WJQ A;  1LW3 A;  2KLC A;  5JHA A;  3KSY A;  2HTH A;  1K51 A;  3AED B;  1Q5W B;  2DYO A;  1KFY B;  4MM3 A;  3ZRC A;  5FI0 A;  1RLF A;  2P0H A;  4USA A;  5LOP B;  1GAQ B;  3FC4 A;  3GZN B;  1JDE A;  4WWO A;  2JT4 B;  1QZE A;  4JKD A;  2CY4 A;  2IGG A;  1WR6 E;  4TUU A;  4NPN A;  1XLP A;  4E71 A;  2LGY A;  1F2R C;  5EFX A;  3IAM 1;  5J2R A;  3RYT A;  1C4C A;  4C56 C;  1AQC A;  2WNM A;  3ZNH B;  4L2Y A;  1RFA A;  3ODX A;  1R7S A;  2N1W A;  1N63 A;  3EC8 A;  4F1S A;  4W9I A;  4CYE A;  2I5C A;  1B1Z A;  1X1M A;  3RNB C;  5LXI B;  1T0Y A;  1OQR A;  5L95 C;  2L76 A;  2N0Y A;  2JYE A;  4Y94 A;  4JIO U;  1TBE A;  4A5K A;  4LLG M;  1GGO A;  2LMC A;  2PVO D;  1TXD A;  3KVF B;  3IFW B;  3U4E G;  1DDV A;  3OJ4 B;  4JK7 A;  3DBL I;  2LOX A;  4NY0 A;  3HIZ A;  1IBX B;  4OVV A;  2Z0O A;  4MY6 A;  4GPT B;  2PVG C;  4CO7 A;  3QWZ B;  4DHZ B;  1ISN A;  5HI1 A;  1R4M B;  1WRI A;  1HBK A;  3PZ7 A;  4XE0 A;  5GXG B;  3VDZ A;  1YQB A;  2JRI B;  4J6I A;  1WZ0 A;  1U29 A;  4M00 A;  4K7W A;  4LK0 M;  3WIM A;  3HW2 B;  3NWD A;  1X1F A;  3RCZ A;  4A8X C;  2JYT A;  3SEB A;  2D5G A;  3PZD A;  1SE4 A;  1KLG D;  4HJK A;  2BPS A;  1XO3 A;  3RCP A;  3X23 A;  3WYF B;  4A6F A;  1LO5 D;  3V61 A;  5EE3 A;  2N4F A;  3M3J A;  2ZCB A;  1R4N I;  5E6P A;  2W2W A;  3LDZ E;  2CJN A;  1XEE A;  5CHW A;  3UIO B;  1PLS A;  1UPQ A;  4J3O D;  1J7B A;  3ZUN A;  2D9X A;  2XQN M;  5LXH A;  1QOB A;  3HSA A;  3PO0 A;  2EMT A;  2QJL A;  4AJW A;  4KDI C;  3P1M A;  3B1L X;  2K0P A;  1EU4 A;  2RR9 A;  4EMO A;  4FBJ B;  2VKI A;  3FEH A;  1EO6 A;  2RDG A;  2EMS A;  4MH8 A;  2IPK D;  2KZR A;  4KVG B;  3R8B A;  3RNE C;  4AS1 A;  3VIA A;  1WR1 A;  3A8Q A;  1PGX A;  3ODW A;  2GCJ A;  1NBF C;  2WWZ A;  1Y8R C;  2UYZ B;  1WI1 A;  1TS2 A;  2R2O A;  2Y8G A;  4JKF A;  4A55 A;  1E8X A;  1FAO A;  3CIK A;  1IPG A;  3I63 C;  1TS4 A;  3AE7 B;  4WQM A;  5DPS A;  2M14 A;  5C3J B;  4PYU A;  2ZEQ A;  3MC9 A;  5HE2 A;  5HHD G;  3RNA C;  4WAF A;  3A9J B;  1N5X A;  2Z59 B;  4US9 A;  4A6K A;  3A98 B;  3E9L A;  2LGS A;  3ZNI D;  1P0R A;  3DQV A;  1VZ7 A;  1U5D A;  2EKE C;  4RGO S;  2LXA A;  5I4D A;  2NCN A;  2FJL A;  4YWG G;  2WXF A;  2B76 B;  2FJU B;  1FRR A;  4W9L A;  4DDI D;  1PDX A;  4K7S A;  1T5X D;  2DLW A;  1HQR D;  5EE0 A;  1FMA D;  3FIL B;  3SFD B;  3QQ8 B;  3NZS A;  2ABD A;  2A4Z A;  2KXJ A;  1M7E A;  5E6N A;  4GNK B;  1WH3 A;  4ICU A;  4LJO B;  4KSK C;  2JSV X;  2JX5 A;  2DHK A;  2INC C;  2OOB B;  2V1Y A;  3TCA A;  1TTN A;  4HCN B;  1YJI A;  1Y5O A;  2G9H D;  3BVZ A;  2IY1 B;  3PTF C;  1WYG A;  5GOW B;  2LZ6 A;  3FIL A;  3L17 A;  3DBL B;  3DVG X;  2KDE B;  4WQO B;  1Y56 A;  3WAN A;  1IGD A;  2ICI A;  2GLS A;  2I5F A;  4S0R A;  3QAR A;  2WXH A;  2YT1 A;  4HAU B;  4WUR A;  1HXY D;  5JLJ B;  1QC6 A;  1FXA A;  2SEB D;  3ENE A;  1PUT A;  1WXM A;  2Z59 A;  2DKQ A;  1DOY A;  1V61 A;  5KHQ A;  1ZSQ A;  2Y5P A;  2Y3A A;  1VR9 A;  1I4P A;  2MSE D;  2KOX A;  4KHA A;  5HG2 A;  1WX8 A;  3DBS A;  1WF9 A;  4N6E B;  1I4H A;  1L7Y A;  2JZP A;  2K8B A;  2FCS A;  2AX5 A;  3DCX A;  2D2Q A;  1FRD A;  1IUE A;  1KC7 A;  2NR2 A;  3DOW A;  2Z0Q A;  3JSV B;  1YJ1 A;  4N9F 4;  3BWU D;  3P6A A;  1KLV A;  5JHB A;  3Q69 A;  2LGX A;  3DBR B;  1AWD A;  4GSW A;  3MC0 B;  3APC A;  2CHX A;  1ET9 A;  4W9C A;  1FM0 D;  3ZW3 A;  1ST7 A;  4MT7 A;  4YTN B;  2X8X X;  1FO4 A;  1NU2 A;  1E7V A;  1QT9 A;  4GB9 A;  3A9K A;  2AQ2 B;  1TKY A;  2BBC A;  3EUB 2;  5J3Y A;  4ZDV A;  2M38 A;  4G0N B;  1UD7 A;  4OT1 A;  3A9K B;  2OJW A;  1UH6 A;  5D3D A;  4B6W A;  2JWZ A;  3EFC A;  2DBY A;  3NSU A;  4K3B A;  3AV8 A;  4OVU A;  1FEH A;  2D9Y A;  1KH0 A;  1F9J A;  1QLB B;  3SNH A;  2LXC A;  1CMX B;  2ZJD A;  2WGS A;  3NWA A;  3TIX A;  3N1Y C;  3B2G A;  2BYT A;  4W9K A;  3H8H A;  1RM6 C;  1EU3 A;  1GB1 A;  4JGH B;  1EF5 A;  3AEF B;  3RNG C;  4EE2 A;  1JRU A;  4FJV B;  2IBI B;  2GCL A;  1YJJ A;  2ZCC A;  4W9D A;  1Z2M A;  3KYC D;  4XYC A;  5LNK 1;  5AUK A;  2PW9 A;  2DX1 A;  2J0M A;  1LM8 B;  3OAN A;  3HM6 X;  1YQ4 B;  2YT2 A;  2MHJ A;  3KQ4 A;  3RT3 B;  3O96 A;  3W5V B;  4GN1 A;  1IGC A;  2IO2 B;  4M8N A;  2K2U A;  2K3U A;  2IO1 B;  4IM2 A;  1ENF A;  1L5P A;  4TQ0 A;  2JY6 A;  2RGF A;  1E8Z A;  4HDO A;  4IAP A;  2MJ3 A;  3QIJ A;  2JPH A;  2CY5 A;  4DIX A;  1TT5 B;  1XCT L;  4MJS A;  2MBB B;  1G6J A;  2V0G A;  5IOI A;  1N5W A;  4DXG A;  2E2X A;  1L0Y B;  5DPT A;  1PYW D;  1L4Z B;  1M7R A;  2GOW A;  1FHO A;  4HCP B;  3IT6 B;  1M94 A;  1SSN A;  3AE5 B;  2R09 A;  2C7N B;  4HJG E;  1VCB A;  2L52 A;  4K2O A;  2R2Q A;  2KWV B;  2LG1 A;  3CWI A;  4KAX B;  5BYR A;  3ODO A;  4IUM B;  3DBH I;  3HIE A;  3D32 A;  3UIN B;  2DZK A;  1WGQ A;  2J0J A;  4LNO A;  1RAX A;  2RGN B;  5J3Q A;  3R7Q A;  2LOZ A;  1P1A A;  2N7E A;  2KHW B;  2C60 A;  3TO1 A;  2KFK A;  4MGI E;  3ALB A;  4II2 B;  1YN3 A;  2WLB A;  2DAJ A;  1AWE A;  2X0S A;  1U27 A;  1JML A;  2WDQ B;  4WWN A;  4GZU A;  2K2J A;  1N61 A;  3ZXR A;  4H8S A;  5D3X A;  2JXT A;  1YD8 U;  3TVV A;  1EWY C;  2REX A;  3ZRF A;  1M4V A;  4K3C A;  2GBM A;  1ZW7 A;  4C7Z A;  2KTR B;  1WJU A;  3BK1 A;  3AU4 A;  5DIF B;  3Q6B A;  1SEB D;  3NY5 A;  1LXD A;  3N3K B;  3SV1 A;  4ZHP A;  1V49 A;  4EOY A;  2TSS A;  2UZR A;  3DHH C;  4DBB A;  2COD A;  4YSZ B;  4HB0 B;  4IW0 A;  5C23 A;  1HE8 A;  2LVO A;  4KSL C;  4C7Y A;  1P6S A;  1KBL A;  1L6U A;  1WM3 A;  4HXD A;  4C00 A;  2CAY A;  4BAX A;  5E6O A;  4K2P A;  2NMB A;  4OZA A;  3VUY A;  1V5O A;  3VUW A;  2L2I A;  2M0X A;  2QSD A;  4MGY E;  4K7U A;  3W5U B;  2RSU A;  2LBB A;  3QCA A;  2I1K A;  2G45 B;  1BUI C;  2H7D A;  1C76 A;  3HVZ A;  3P2B A;  2MCN B;  1U5E A;  1D4B A;  2DLB A;  2MEK A;  5JZE B;  2EEL A;  3D8F A;  4A90 A;  2KIE A;  3PGE A;  1UGM A;  1WJ4 A;  2KN4 A;  3N9Y C;  2QDF A;  4W9E A;  3SFE B;  2MBQ A;  2UZS A;  1FFU A;  4JPS A;  4QXA B;  4ZOH C;  3P7Z A;  2YS1 A;  2KAN A;  2M19 A;  2OTX A;  4W9G A;  3ZDM C;  2BYE A;  3R66 C;  3R3M A;  5J3T A;  1V5M A;  1AYF A;  2ADZ A;  4A3P A;  3W1S A;  1UNQ A;  3WAP A;  2KLG A;  2JXX A;  4YL8 A;  1YMH E;  4OZB A;  1MG8 A;  3E9S A;  2L0T A;  2L05 A;  3U12 A;  3LXF A;  3KH0 A;  2C7H A;  2IND C;  4URK A;  4AQ7 A;  1V97 A;  2BYF A;  3HM3 A;  5AZH A;  3SR6 A;  1GUA B;  2M17 A;  1WWT A;  3VQI A;  3EGR A;  3V5W A;  4GOC A;  1XX0 A;  4GU2 A;  4BKS D;  4JKB A;  4HAX B;  4BZA A;  4ANW A;  1MIZ B;  3N1Z C;  4RGM A;  2J4X A;  2MDX A;  4LTU A;  4DQO C;  3V3X A;  2ASQ A;  2NBU A;  3WCQ A;  1JWA D;  3G9W A;  2R61 A;  1V89 A;  3SYX A;  3ZLZ A;  1NI2 A;  1QOG A;  1FPY A;  3CIR B;  3ZVV A;  3ZXV A;  5D3I B;  2HRJ A;  2KFK B;  4DK5 A;  3S2A A;  1FNU A;  3PT2 B;  4JE3 B;  4DDG D;  4L23 A;  1K53 A;  4MT5 A;  4KHO A;  1CQV A;  1I7H A;  2KUQ A;  2BS3 B;  1KOT A;  2E6X A;  1T0R C;  2L1A A;  3MDB C;  2N9E B;  1BWN A;  1JRP A;  2WX1 A;  2DA0 A;  2H7E A;  5IO9 A;  2D4Q A;  1C4P A;  4GOU A;  2L83 A;  4Q2J A;  5TSS A;  4WWM A;  1NVL A;  3VH4 B;  2UVM A;  5DI9 B;  2YEP B;  4PS7 A;  1UZX B;  2CU3 A;  2DX5 B;  2KQS A;  2PEA A;  2FIF A;  2GBN A;  1UBQ A;  1ET6 A;  2KKC A;  2KAJ A;  2DN6 A;  2I2Y A;  1FFV A;  1ZKH A;  3FM8 C;  3ENB A;  3L10 B;  2LGI A;  2DZJ A;  3ZGZ A;  3PEG A;  3N1X C;  1I7A A;  5CX3 A;  4HAW B;  2BS2 B;  1FNW A;  4BVU C;  3ZJT A;  4ZYN A;  3TFM A;  2KX0 A;  4UDU C;  1DOI A;  1PQS A;  2EC1 A;  5D7G A;  2BB6 A;  3KW5 B;  4S17 A;  5JH5 C;  4F8C B;  1JW9 D;  4KHB A;  1VRA B;  3PLV A;  1UWX A;  3UQA A;  1ZVR A;  4TMA B;  1FHX A;  1D5M C;  4HAZ B;  3ECI A;  3VVW B;  1Q10 A;  4IM0 A;  2Y8F A;  3TEX A;  4XWT A;  3NVZ A;  4RF1 A;  2ACZ B;  4WAA A;  1W1H A;  2WXL A;  3C0R B;  1I35 A;  1OEY J;  1EVH A;  2RQ1 A;  2RD0 A;  4LNN A;  3N7C A;  3I3T B;  5CHV C;  4MEM A;  5C5B B;  3B0A A;  3RUL A;  3KY9 A;  3SHQ A;  2ZNV C;  4LNK A;  2GS0 A;  4HKZ E;  2EJ8 A;  2G4S A;  2QEJ C;  4WJN A;  4OVZ A;  1ZC3 B;  1LQB A;  1UGJ A;  5H8Y E;  2DHJ A;  2KJR A;  5TR5 A;  1Z5S B;  3ZO5 B;  1GG3 A;  4GDL B;  4WSF A;  5IKC M;  1LFD A;  1SBB B;  1SXT A;  3ZVR A;  1OGW A;  4MH0 E;  2YEP F;  2L0F A;  2GBK A;  5LLI A;  4FXC A;  2D10 A;  1V1O A;  1OMW A;  3A33 B;  5HKH A;  4IOI E;  2M4N A;  2MP2 B;  2QC8 A;  4Z2N A;  4PK1 A;  1XLO A;  1WM2 A;  2DKP A;  3MC8 A;  2K9X A;  3LJ3 A;  4JKE A;  4W9J A;  3TBL D;  1ZYI A;  5MPO A;  5BMG A;  2W55 A;  2D9W A;  3URY A;  1WSP A;  4ARC A;  3QHT A;  2DYM A;  2KX3 A;  1XCG A;  1E9M A;  3ML4 A;  2MBO A;  2LRW A;  1C79 A;  4F7U P;  2K39 A;  1JAL A;  1V88 A;  2L7R A;  3K9O B;  3W1S C;  2QCZ A;  3ML8 A;  1EM7 A;  3F5R A;  1S3S G;  5CLL B;  3ZQ4 A;  4NQL B;  3R7R A;  4QJ4 B;  4ZRQ A;  4F7Z A;  1E0Z A;  2BWE S;  1N60 A;  4FHK A;  4YXD B;  2YRY A;  2FUH B;  3MTN B;  3RZF A;  2DZM A;  2JQR B;  2AWT A;  5BMI A;  3WAL A;  1TYG B;  2EKI A;  1MJD A;  3DXE A;  2R82 A;  4NAW A;  4HKQ A;  5D94 A;  4HAT B;  4DX9 0;  3C19 A;  4ILG B;  2K49 A;  3FSS A;  1V6E A;  4JWU C;  5EDS A;  2J0K A;  1I2H A;  2A5U A;  4D0N B;  5HFY A;  4MJS B;  4KGT A;  1HEZ E;  4DX8 A;  3SBT A;  3QBV B;  2KDF B;  3O65 B;  4LNI A;  4MSQ B;  5T8I A;  5FR3 A;  2VH2 A;  4HLE A;  3DXC A;  4DHJ D;  5DCN A;  2OED A;  1SE3 A;  1ZUD 2;  1JRO A;  2C5L C;  4KDL B;  3DHG C;  4BFR A;  4BKT A;  3R2I A;  1NDD A;  4IWQ A;  4ILH A;  3HRD D;  5L83 A;  3QWM A;  2KWD A;  3UIP B;  4BKS A;  4MAC A;  3VAW A;  2IGH A;  2PMV A;  3TUO A;  4B95 A;  1C1Y B;  3CSF A;  3D8D A;  1SIJ A;  4OW0 A;  2NTS A;  2R0D A;  2LUE A;  3V60 A;  3L0W B;  3AMZ A;  2I38 A;  4JKG B;  3AEB B;  4WJO A;  1RRB A;  1WXS A;  2FCQ A;  2GI9 A;  2WDT B;  2WYQ A;  2FCN A;  1TKE A;  3EPY A;  2VRR B;  2KTR A;  2KO3 A;  2K8E A;  4DHJ B;  1WY8 A;  5E6J A;  4HHV A;  4REZ A;  2LAS A;  1WX7 A;  3BZD B;  5GMV A;  1KRH A;  2FUG 1;  3ML9 A;  3KUD B;  3A8P A;  1BXT A;  2MA9 B;  4A6H A;  2VH1 A;  2WXM A;  3VUX A;  3Q3N C;  5IJM A;  3Q2A C;  3J9C A;  1WJM A;  4FA6 A;  1SGH A;  4K17 A;  2LRU A;  2MQJ A;  3F0W A;  4HSI A;  1FGZ A;  4US8 A;  2IZV B;  2J42 A;  2ON8 A;  2RUK B;  1KF6 B;  4TKN A;  2P0D A;  4JKG A;  2W9N A;  5IA7 A;  1C77 A;  4EJN A;  1WJN A;  3GB1 A;  2MKR A;  2RRF A;  3NVV A;  3AM9 A;  1V8C A;  2LI5 A;  4GIV A;  2IYD B;  3MFG A;  1DOX A;  4GMV A;  2L3Z A;  1ROE A;  3FKY A;  5JHH A;  1X86 A;  3L4P A;  2RNR B;  2C7M B;  2RLO A;  2RDB C;  3VTV A;  3A9J A;  4RGN A;  4ZRJ A;  4GXB A;  1WI0 A;  2O6V A;  2KJH B;  4L6E A;  2DYQ A;  1AAR A;  4RM8 A;  3L13 A;  3LYY A;  5JVL A;  1EUV B;  3IXS A;  2SAK A;  1TJ6 A;  1TY0 A;  3M63 B;  1FCC C;  1GPX A;  2WXN A;  3P4Q B;  1V80 A;  2WXR A;  4NAW B;  4WH4 A;  4O1N A;  1VBH A;  4GGQ A;  2BT6 A;  1SF0 A;  1XT9 B;  4YSX B;  3AXC A;  4ZYS A;  3ZDT A;  4KHB B;  3ZNG C;  1V5P A;  3NJT A;  3BJI A;  2KDM A;  1OQY A;  1QIL A;  3GS2 A;  1B55 A;  2K8H A;  3RFZ B;  1NTI A;  3PVL A;  4QJ3 B;  2LYD A;  3ULB A;  4JQW C;  2D9Z A;  2BVC A;  3A1Q B;  3T3N A;  4ANU A;  3DPD A;  4JK9 A;  2DYN A;  1L2N A;  2WXJ A;  4HB2 B;  1B9R A;  3KZ1 A;  3QK0 A;  2NVU I;  4HAY B;  1V86 A;  3OAW A;  5D6J B;  4PT5 A;  3WAM A;  4H2A A;  3IHP C;  3U52 E;  3FAH A;  1LB1 A;  3DHI C;  3CXB B;  3QX1 A;  3AE4 B;  3ZTC A;  3W2D A;  3RN9 C;  1FGY A;  3PSE B;  1SJE D;  2WXO A;  3OHM B;  1BT0 A;  3KWL A;  1T6B X;  3APF A;  3BK2 A;  1ZXI A;  3VHT C;  1UWM A;  1HZ6 A;  3GYP A;  1TZ1 A;  2CRF A;  3UF8 A;  4BOZ B;  2FNJ B;  2YT0 A;  2KT7 A;  2UU7 A;  4EUT A;  1V5U A;  3MP9 A;  4XGA B;  2MJD A;  1TJE A;  2KVR A;  3RNF C;  1FXT B;  1DIK A;  3O13 A;  1E90 A;  4HEA 1;  4EZL A;  4W9H A;  1YX5 B;  3AE1 B;  4FAD A;  2BYV E;  1KI1 B;  1T3Q A;  1QQG A;  5CLQ B;  3LB8 C;  1KM7 A;  1MK7 B;  5KQ4 A;  2PE6 B;  3M62 B;  2ROV A;  3A58 A;  1WGH A;  4DXF A;  3AN1 A;  3MPX A;  3VRB B;  1P7E A;  3Q8B A;  2JVC A;  3JVZ X;  4HAV B;  2G1E A;  2M56 B;  1U4A A;  3X0W A;  1EAZ A;  4ZHO A;  2BTE A;  3B08 A;  5C79 A;  4E3C A;  1RJ2 A;  2LVQ A;  5L81 A;  2NZ8 B;  1TKG A;  2AEH A;  2QIL A;  2G35 A;  4RF0 A;  1TS5 A;  2WS3 B;  2UWQ A;  3C8Y A;  3PHX B;  3QA8 A;  4JK8 A;  3JSV A;  1MHX A;  2FDQ A;  2YS5 A;  1OEY A;  4C4V A;  3P4P B;  4GDK A;  1SHC A;  4M0W A;  3Q3M C;  2JU6 X;  5FI1 A;  3TMP B;  4TQ1 A;  5FK9 C;  1XKE A;  3BYY B; 
#chains in the Genus database with same CATH homology
 2XK5 B;  1MPH A;  4YON A;  4AUQ C;  3PRE A;  1J0G A;  3ZIM A;  1WYW B;  2WX0 A;  1P3R A;  3T9L A;  1ZGU B;  3E9O A;  5DPR A;  2YVC A;  4IOY X;  1GC6 A;  4LDT D;  4F7H A;  1Y19 B;  1DYN A;  2CR5 A;  2MBE A;  5KCV A;  2PJH A;  2D11 A;  2KMC A;  4DXA B;  1UNP A;  1K8R B;  4K81 A;  2HD5 B;  3SDL C;  2QKM A;  4TV3 A;  3CMM B;  1XR0 B;  2KC1 A;  4II3 B;  1WGD A;  2MLB A;  1P5T A;  3N30 A;  2HJ8 A;  1OQN A;  2PE9 A;  2DEN B;  3TJP A;  2Y7B A;  2XEW A;  3BIN A;  1K5D B;  2DYB A;  2KD0 A;  2DZI A;  1BTN A;  1KZG A;  1GJZ A;  3HQC A;  5JHG A;  4ANV A;  2AL3 A;  1U5G A;  4HDQ A;  1UEF A;  2KJ6 A;  3L54 A;  2GJY A;  4G50 A;  5AEK B;  3LJU X;  2BKR B;  5D3W A;  1WE7 A;  3NZU A;  4KIK B;  1WZ3 A;  2Z0E B;  3H7P B;  1NTY A;  2JZ3 B;  4I6L B;  3KRX A;  2B3A A;  2N1V A;  2MW5 A;  2AYO B;  2MWN B;  4G3X B;  2KMA A;  2KWU B;  4C0A A;  3SUZ A;  2CB8 A;  3PP2 A;  3MHS D;  2ELA A;  1WXV A;  1WX9 A;  1PMS A;  2C9W B;  1OTR B;  2PZ1 A;  2RSG A;  3VXW A;  2O2V A;  3JW0 X;  2BKF A;  4PNK A;  1MKE A;  3H1U A;  2DTC A;  3RZW C;  3KRW A;  4NQK E;  3L16 A;  1MIX A;  2GMI C;  4LCD E;  2ZVN A;  2JUO A;  2L00 B;  3K9P B;  2COP A;  1YX6 B;  2CQU A;  2KCJ A;  4XX5 A;  4XZ4 A;  3WAO A;  2COA A;  2IFS A;  2XBB C;  2OJR A;  5CTR C;  3U8Z A;  4GMX B;  2NPT A;  2MRP A;  5JP4 A;  1FOE A;  2DFK A;  1WGG A;  4I6P A;  5DH9 B;  3AJ4 A;  5D2M B;  2IO3 B;  3H7P A;  3NHE B;  4A3O A;  2IY0 B;  2NPT B;  3PRP B;  3E9P A;  1WRD B;  4M8M A;  3RD2 A;  3GOE A;  4PQ0 A;  3VH3 B;  3DBR I;  5BO4 B;  1H10 A;  5G55 A;  1WMH A;  3SU8 X;  4FN2 A;  4PYZ A;  2AL6 A;  4NJ6 A;  3U7D A;  3VTU A;  1WGU A;  4JLC A;  3H9D A;  3QAQ A;  2GBR A;  2M8S A;  4E74 A;  3VFK A;  2J7Q B;  1WJ6 A;  4K1R B;  2V76 A;  1DBH A;  2O6V B;  3Q3F A;  4DWF A;  4IFS A;  2K8C A;  2KDB A;  4FUL A;  4AP4 C;  2IO0 B;  1J8C A;  4KIK A;  2JZZ A;  4EFO A;  1EF1 A;  2FCM A;  3BY4 B;  5FR6 A;  2D3G A;  2MBH A;  1UPR A;  2LUL A;  4IWP A;  2ZZP B;  2N9X A;  1DDW A;  1PFJ A;  2BF8 B;  2CKH B;  3PVU A;  1FB8 A;  3AI5 A;  2MX2 A;  2LJ5 A;  1KJT A;  1YIW A;  1XD4 A;  4HB3 B;  2BGF A;  1E8Y A;  4GDK B;  2G3Q B;  4PS3 A;  3PLU A;  2NBV B;  3ONS A;  3KUZ A;  2PPH A;  2YSZ A;  4WJP A;  4CHM A;  4IWO A;  3IBE A;  2KN5 A;  4HPL B;  1DRO A;  1H8C A;  1X11 A;  2ZPY A;  3AUL A;  1V81 A;  1TGZ B;  4F7G A;  2L1C A;  2MWS B;  2GBJ A;  4FHJ A;  5J17 A;  4MEL A;  3T8M A;  2KTF A;  2Q13 A;  3APD A;  3VOQ A;  1X1G A;  4B6H A;  1J0W A;  3DDC B;  3N32 A;  2MFQ A;  1WG7 A;  3KUC B;  3V62 A;  1U5F A;  2YF0 A;  1XOD A;  5HE3 A;  4NSW A;  2JF5 A;  4LDT B;  4BKG A;  2RVB B;  2LWP A;  2COF A;  2P0F A;  4I6N B;  2CU1 A;  1DDM A;  4ANX A;  4ILJ A;  1K5G B;  3RUI B;  1P9D U;  2IYB A;  2K1F A;  4A20 A;  3TL5 A;  3CF6 E;  5C5B A;  3SO6 A;  3DXD A;  1WE6 A;  2K6D B;  4CHJ A;  1P98 A;  2HE7 A;  3UZT A;  4MSM B;  3FLV A;  2N7D A;  3CST A;  1X05 A;  4HVB A;  2DHZ A;  3GYO A;  2Y5B B;  2DAF A;  2ZPN A;  3VTW A;  5D3Y A;  1MAI A;  4A6F B;  1WJ1 A;  2O2V B;  4KZ0 A;  1R4M I;  2QHO A;  3V6E B;  1GC7 A;  1WMH B;  3MJW A;  1WIA A;  2X18 A;  2ELB A;  2K00 A;  3A4R A;  4HWI B;  4NNJ B;  2ZVO A;  2Z0D B;  1V9J A;  5IAA C;  4JKH A;  3NOB A;  2D07 B;  2NBW B;  1V5T A;  3PS6 A;  2WH5 A;  3T06 A;  1SE9 A;  5DHA B;  1IP9 A;  1WFY A;  4KV2 A;  1UBI A;  2BCJ A;  2COC A;  3ZKJ C;  2VRW B;  3EEC A;  3JYU A;  3M1I B;  1E8W A;  4EKU A;  1Q0W B;  4FJZ A;  3NS8 A;  1TQZ A;  4DHZ E;  1I42 A;  2Z0P A;  4BOS C;  2K6Q A;  4HK2 A;  4KZC A;  3L08 A;  2KUP A;  5HE1 A;  1EGX A;  2HTH B;  3PPA A;  3DVN U;  3EFU A;  4WVF B;  3PRM B;  1WXA A;  1KZ7 A;  1W1D A;  1S1Q B;  2YLM A;  4HPM B;  4M0W B;  3PHW B;  4FLH A;  5G2N A;  2XK5 A;  2KGX B;  3Q3J A;  1D3Z A;  1BAK A;  4BBN C;  4MK0 A;  1WGY A;  3IG3 A;  4GDL A;  4P7I A;  4JL9 A;  3ZTD A;  4AOF A;  1FHW A;  4WWP A;  2CHZ A;  2J59 M;  1NTV A;  5C6R A;  3PRZ A;  3TW1 A;  2ROZ B;  4X57 B;  2G4D B;  4JKA A;  2KWC A;  4BBN F;  5KHO A;  2ZNV B;  2KNB A;  2W2X D;  3E66 A;  5CHF A;  3PG7 A;  3D8E A;  1GNU A;  3FP5 A;  3SD5 A;  4XWX A;  3PSC A;  4LJP B;  4EZK A;  1XD3 B;  3IVF A;  3HK0 A;  1A5R A;  2JRH A;  5DPW A;  2L8J A;  1BTK A;  1VD2 A;  1IYF A;  4RMA A;  4ZRK A;  1VBG A;  4JKC A;  1H4R A;  1E7U A;  2LD9 A;  5D27 A;  3QJZ A;  4IC7 B;  1SIF A;  2I1J A;  2M1M A;  3V6C B;  2FAZ A;  3W1Y A;  3OLM D;  5D3V A;  1UEL A;  5DHF B;  2MP2 A;  4MGK E;  1ZM0 A;  3ULC A;  2FJ9 A;  4WJ7 A;  2LKO A;  2V4L A;  3SBG A;  1XQQ A;  2K25 A;  2JP2 A;  4ICV A;  1ACA A;  4Z2M B;  2N23 A;  4EEW A;  3AU5 A;  5HE0 A;  2W2X C;  1Z87 A;  1J19 A;  3KYD D;  3DVG Y;  4W9F A;  3ZNZ B;  5KQ1 A;  2NS5 A;  2DHI A;  4PS8 A;  3OJ3 A;  1WVH A;  2BWF A;  2VSZ A;  4DBG A;  2FID A;  1C3T A;  4XC2 A;  4TYZ A;  3EHV A;  4AJY B;  5C1Z A;  3U30 A;  1ZC4 B;  5C16 A;  1N3H A;  4CHK A;  3H7S A;  5AZF A;  1V2Y A;  3GZN I;  4G11 A;  1E5W A;  2P8V A;  2OQB A;  4MDK E;  2KQ7 A;  4IG7 B;  1UNR A;  1HB8 A;  4AWJ A;  1Q67 A;  1W1G A;  4IM3 A;  2RPQ A;  3HHM A;  4HB4 B;  2DX5 A;  1HB6 A;  2QKL A;  4ZRI A;  2LVP A;  5J18 A;  1Q1O A;  2CS4 A;  3A1Q A;  4BBK A;  1MK9 B;  3PVW A;  1WGR A;  2O6V D;  2V3S A;  2KDI A;  3DCG A;  2YS3 A;  3M95 A;  2DIK A;  1IRS A;  1RRP B;  1U2B A;  5LON B;  3UQB A;  2KFJ A;  3H6N A;  4ASW C;  2KC2 A;  2D9V A;  5AZG A;  3QC8 B;  4NJ7 A;  3DVN V;  3UGB B;  2LGD A;  1OY2 A;  1P3Q U;  4FJY A;  3PV1 A;  3A4S C;  2CHW A;  4MGZ E;  4B9K A;  4RM9 A;  4EZJ A;  3WA0 A;  2N9P C;  2KK8 A;  4WJQ A;  1LW3 A;  2KLC A;  5JHA A;  3KSY A;  2HTH A;  1Q5W B;  2DYO A;  3ZRC A;  4MM3 A;  5FI0 A;  1RLF A;  2P0H A;  5LOP B;  1JDE A;  4WWO A;  2JT4 B;  1QZE A;  4JKD A;  2CY4 A;  1WR6 E;  4TUU A;  4NPN A;  4E71 A;  2LGY A;  5EFX A;  5J2R A;  3RYT A;  1AQC A;  3ZNH B;  1RFA A;  3ODX A;  2N1W A;  3EC8 A;  4F1S A;  4W9I A;  4CYE A;  2I5C A;  5LXI B;  1X1M A;  1T0Y A;  5L95 C;  2L76 A;  2N0Y A;  4Y94 A;  4JIO U;  1TBE A;  4A5K A;  1GGO A;  1TXD A;  3KVF B;  3IFW B;  1DDV A;  3OJ4 B;  4JK7 A;  3DBL I;  2LOX A;  4NY0 A;  3HIZ A;  4OVV A;  2Z0O A;  4MY6 A;  4GPT B;  4CO7 A;  3QWZ B;  4DHZ B;  1ISN A;  1HBK A;  3VDZ A;  1YQB A;  2JRI B;  4J6I A;  1WZ0 A;  1U29 A;  4K7W A;  3WIM A;  3HW2 B;  1X1F A;  3RCZ A;  3PZD A;  4HJK A;  2BPS A;  3RCP A;  3X23 A;  3WYF B;  4A6F A;  3V61 A;  2N4F A;  3M3J A;  2ZCB A;  1R4N I;  5E6P A;  2W2W A;  3LDZ E;  5CHW A;  3UIO B;  1PLS A;  1UPQ A;  3ZUN A;  2D9X A;  2XQN M;  5LXH A;  2EMT A;  4AJW A;  4KDI C;  3B1L X;  2RR9 A;  4EMO A;  4FBJ B;  2VKI A;  3FEH A;  1EO6 A;  2EMS A;  2KZR A;  4KVG B;  3VIA A;  1WR1 A;  3A8Q A;  3ODW A;  2GCJ A;  1NBF C;  2WWZ A;  1Y8R C;  2UYZ B;  1WI1 A;  2R2O A;  2Y8G A;  4JKF A;  1E8X A;  1FAO A;  3CIK A;  1IPG A;  5DPS A;  2M14 A;  4PYU A;  2ZEQ A;  5HE2 A;  3A9J B;  2Z59 B;  4A6K A;  3A98 B;  3E9L A;  3ZNI D;  1P0R A;  3DQV A;  1U5D A;  2EKE C;  2LXA A;  2NCN A;  2FJL A;  4W9L A;  4DDI D;  4K7S A;  2DLW A;  3QQ8 B;  3NZS A;  2ABD A;  2A4Z A;  2KXJ A;  1M7E A;  5E6N A;  1WH3 A;  4ICU A;  4LJO B;  4KSK C;  2DHK A;  2OOB B;  2V1Y A;  3TCA A;  1TTN A;  4HCN B;  1Y5O A;  2IY1 B;  3PTF C;  5GOW B;  2LZ6 A;  3L17 A;  3DVG X;  2KDE B;  4WQO B;  3WAN A;  2I5F A;  3QAR A;  2YT1 A;  4HAU B;  5JLJ B;  1QC6 A;  3ENE A;  1WXM A;  2DKQ A;  1V61 A;  5KHQ A;  1ZSQ A;  2MSE D;  2KOX A;  4KHA A;  1WX8 A;  3DBS A;  1WF9 A;  1L7Y A;  2K8B A;  2FCS A;  2D2Q A;  1KC7 A;  2NR2 A;  3DOW A;  2Z0Q A;  3JSV B;  1YJ1 A;  4N9F 4;  1KLV A;  3P6A A;  5JHB A;  2LGX A;  4GSW A;  3APC A;  2CHX A;  4W9C A;  3ZW3 A;  1ST7 A;  4MT7 A;  1NU2 A;  1E7V A;  4GB9 A;  3A9K A;  5J3Y A;  4ZDV A;  2M38 A;  4G0N B;  1UD7 A;  3A9K B;  1UH6 A;  4B6W A;  2JWZ A;  3NSU A;  4OVU A;  2D9Y A;  1F9J A;  2LXC A;  3SNH A;  1CMX B;  2ZJD A;  3TIX A;  4W9K A;  4JGH B;  1EF5 A;  1JRU A;  4FJV B;  2IBI B;  2GCL A;  2ZCC A;  4W9D A;  1Z2M A;  3KYC D;  2DX1 A;  2J0M A;  1LM8 B;  3OAN A;  3HM6 X;  3RT3 B;  3O96 A;  4GN1 A;  2IO2 B;  4M8N A;  2K2U A;  2IO1 B;  4IM2 A;  4TQ0 A;  2JY6 A;  2RGF A;  1E8Z A;  4HDO A;  4IAP A;  3QIJ A;  2JPH A;  2CY5 A;  4MJS A;  2MBB B;  1G6J A;  2E2X A;  5DPT A;  1M7R A;  2GOW A;  1FHO A;  4HCP B;  1M94 A;  2R09 A;  2C7N B;  1VCB A;  4K2O A;  2R2Q A;  2KWV B;  2LG1 A;  4KAX B;  3ODO A;  4IUM B;  3DBH I;  3D32 A;  3UIN B;  2DZK A;  1WGQ A;  2J0J A;  1RAX A;  2RGN B;  5J3Q A;  3R7Q A;  2LOZ A;  1P1A A;  2N7E A;  2KHW B;  2C60 A;  4MGI E;  3TO1 A;  2KFK A;  3ALB A;  4II2 B;  2DAJ A;  1AWE A;  2X0S A;  1U27 A;  4WWN A;  4GZU A;  2K2J A;  4H8S A;  5D3X A;  1YD8 U;  3TVV A;  2REX A;  3ZRF A;  2GBM A;  1ZW7 A;  2KTR B;  1WJU A;  3AU4 A;  5DIF B;  3NY5 A;  1LXD A;  3N3K B;  3SV1 A;  1V49 A;  4EOY A;  2UZR A;  4DBB A;  2COD A;  4HB0 B;  4IW0 A;  5C23 A;  1HE8 A;  2LVO A;  4KSL C;  1P6S A;  1KBL A;  1WM3 A;  4HXD A;  2CAY A;  5E6O A;  4K2P A;  2NMB A;  3VUY A;  1V5O A;  3VUW A;  2L2I A;  2M0X A;  4MGY E;  4K7U A;  2RSU A;  2LBB A;  3QCA A;  2I1K A;  2G45 B;  2H7D A;  3P2B A;  2MCN B;  1U5E A;  5JZE B;  3D8F A;  3PGE A;  1UGM A;  1WJ4 A;  4W9E A;  2MBQ A;  2UZS A;  3P7Z A;  2YS1 A;  2KAN A;  2OTX A;  4W9G A;  3ZDM C;  2BYE A;  3R66 C;  3R3M A;  5J3T A;  1V5M A;  2ADZ A;  4A3P A;  3W1S A;  1UNQ A;  3WAP A;  2KLG A;  2JXX A;  4YL8 A;  1MG8 A;  2L0T A;  2L05 A;  3KH0 A;  2C7H A;  4URK A;  2BYF A;  3HM3 A;  5AZH A;  1GUA B;  2M17 A;  3VQI A;  3V5W A;  4GOC A;  1XX0 A;  4GU2 A;  4BKS D;  4JKB A;  4HAX B;  4ANW A;  1MIZ B;  2MDX A;  2ASQ A;  2NBU A;  3G9W A;  1V89 A;  3SYX A;  3ZLZ A;  1NI2 A;  3ZVV A;  2HRJ A;  2KFK B;  4DK5 A;  3S2A A;  3PT2 B;  4DDG D;  4KHO A;  1KOT A;  3MDB C;  2N9E B;  1BWN A;  2WX1 A;  2DA0 A;  2H7E A;  2D4Q A;  1NVL A;  3VH4 B;  2UVM A;  5DI9 B;  4PS7 A;  1UZX B;  2DX5 B;  2KQS A;  2PEA A;  2FIF A;  2GBN A;  1UBQ A;  2KKC A;  2DN6 A;  1ZKH A;  3FM8 C;  3ENB A;  3L10 B;  2DZJ A;  3PEG A;  1I7A A;  5CX3 A;  4HAW B;  4BVU C;  4ZYN A;  3TFM A;  2KX0 A;  1PQS A;  2EC1 A;  5D7G A;  3KW5 B;  5JH5 C;  4F8C B;  3PLV A;  3UQA A;  1ZVR A;  1FHX A;  4HAZ B;  3ECI A;  3VVW B;  4IM0 A;  2Y8F A;  4WAA A;  1W1H A;  3C0R B;  1I35 A;  1OEY J;  1EVH A;  2RQ1 A;  2RD0 A;  3N7C A;  3I3T B;  5CHV C;  4MEM A;  5C5B B;  3B0A A;  3RUL A;  3KY9 A;  3SHQ A;  2ZNV C;  2GS0 A;  2EJ8 A;  2G4S A;  4WJN A;  1ZC3 B;  1LQB A;  2DHJ A;  2KJR A;  5TR5 A;  1Z5S B;  3ZO5 B;  1GG3 A;  4GDL B;  4WSF A;  1LFD A;  3ZVR A;  1OGW A;  4MH0 E;  2L0F A;  2GBK A;  5LLI A;  2D10 A;  1OMW A;  3A33 B;  5HKH A;  2M4N A;  2MP2 B;  4Z2N A;  1WM2 A;  2DKP A;  3LJ3 A;  4JKE A;  4W9J A;  3TBL D;  2D9W A;  3QHT A;  2DYM A;  2KX3 A;  1XCG A;  3ML4 A;  2MBO A;  2LRW A;  4F7U P;  2K39 A;  1V88 A;  2L7R A;  3K9O B;  3W1S C;  3ML8 A;  3F5R A;  1S3S G;  5CLL B;  4NQL B;  3R7R A;  4F7Z A;  2BWE S;  4FHK A;  2YRY A;  2FUH B;  3MTN B;  3RZF A;  2DZM A;  2AWT A;  3WAL A;  3DXE A;  2R82 A;  4NAW A;  5D94 A;  4HAT B;  4DX9 0;  4ILG B;  3FSS A;  1V6E A;  5EDS A;  2J0K A;  1I2H A;  2A5U A;  4D0N B;  4MJS B;  4DX8 A;  3SBT A;  3QBV B;  2KDF B;  3O65 B;  4MSQ B;  4HLE A;  3DXC A;  4DHJ D;  5DCN A;  2C5L C;  4KDL B;  4BFR A;  4BKT A;  1NDD A;  4IWQ A;  4ILH A;  5L83 A;  3QWM A;  3UIP B;  4BKS A;  3VAW A;  4B95 A;  1C1Y B;  3CSF A;  3D8D A;  2R0D A;  2LUE A;  3V60 A;  3L0W B;  4JKG B;  4WJO A;  1RRB A;  1WXS A;  2FCQ A;  2WDT B;  2WYQ A;  2FCN A;  3EPY A;  2VRR B;  2KTR A;  2KO3 A;  4DHJ B;  1WY8 A;  4HHV A;  2LAS A;  1WX7 A;  5GMV A;  3ML9 A;  3KUD B;  3A8P A;  2MA9 B;  4A6H A;  3VUX A;  5IJM A;  1WJM A;  4FA6 A;  1SGH A;  4K17 A;  2LRU A;  2MQJ A;  3F0W A;  1FGZ A;  2IZV B;  2RUK B;  4TKN A;  2P0D A;  4JKG A;  2W9N A;  5IA7 A;  4EJN A;  1WJN A;  2MKR A;  2LI5 A;  4GIV A;  2IYD B;  4GMV A;  2L3Z A;  5JHH A;  1X86 A;  2RNR B;  2C7M B;  2RLO A;  3VTV A;  3A9J A;  4ZRJ A;  4GXB A;  1WI0 A;  2O6V A;  2KJH B;  4L6E A;  4RM8 A;  2DYQ A;  1AAR A;  3L13 A;  5JVL A;  1EUV B;  1TJ6 A;  3M63 B;  1V80 A;  4NAW B;  1VBH A;  4GGQ A;  1XT9 B;  3AXC A;  3ZDT A;  4KHB B;  3ZNG C;  1V5P A;  3BJI A;  1OQY A;  1B55 A;  2K8H A;  1NTI A;  3PVL A;  3ULB A;  2LYD A;  4JQW C;  2D9Z A;  3A1Q B;  4ANU A;  3DPD A;  4JK9 A;  2DYN A;  1L2N A;  4HB2 B;  3KZ1 A;  3QK0 A;  2NVU I;  4HAY B;  1V86 A;  3OAW A;  5D6J B;  3WAM A;  3IHP C;  1LB1 A;  3CXB B;  3QX1 A;  3ZTC A;  1FGY A;  3PSE B;  1BT0 A;  3APF A;  3VHT C;  3GYP A;  1TZ1 A;  2CRF A;  3UF8 A;  4BOZ B;  2FNJ B;  2YT0 A;  4EUT A;  1V5U A;  2KVR A;  1FXT B;  1DIK A;  1E90 A;  4EZL A;  4W9H A;  1YX5 B;  4FAD A;  2BYV E;  1KI1 B;  1QQG A;  5CLQ B;  1KM7 A;  1MK7 B;  5KQ4 A;  2PE6 B;  3M62 B;  2ROV A;  1WGH A;  3MPX A;  2JVC A;  3JVZ X;  4HAV B;  1U4A A;  3X0W A;  1EAZ A;  3B08 A;  5C79 A;  4E3C A;  1RJ2 A;  2LVQ A;  5L81 A;  2NZ8 B;  2AEH A;  2G35 A;  3QA8 A;  2UWQ A;  3PHX B;  4JK8 A;  3JSV A;  2FDQ A;  2YS5 A;  1OEY A;  4GDK A;  1SHC A;  5FI1 A;  3TMP B;  4TQ1 A;  1XKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...