3ZDWA

Substrate and dioxygen binding to the endospore coat laccase cota from bacillus subtilis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COTA LACCASE
publication title Substrate and Dioxygen Binding to the Endospore Coat Laccase from Bacillus Subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 144
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA02
2IWKA 3WIAA 2UXGA 4DP9X 3TU6A 3X2QB 1QHQA 2Y69B 1OV8A 2VN3A 1XMEB 4BDVA 3X1GA 2XVBA 2EIKB 3ZIYA 1OE3A 2JXMA 1A4CA 4DP6X 1PZBA 4PCYA 1V54B 4YSTA 4E9TA 4A2GA 1JXFA 2XV2A 2FQEA 3UABA 1ET8A 4KOCA 2B3IA 4DP8X 2HX9A 3ZDWA 1MG2C 3PPSA 2HXAA 4E9SA 4YSAA 3S3DB 4F7KA 4KO5A 1ZDQA 3IBOA 2WO2B 4M4RB 1IKOP 4HCGA 1NIDA 1PLCA 2YAMA 1M56B 2FNWA 1PLAA 2OJ1A 3S8GB 2YQBA 2W8CA 2VW4A 1ZV2A 2XV0A 2OCCB 1AG6A 5B1BB 2YXWA 1JVOA 3C75A 1FFTB 1CC3A 4GY4A 1J9RA 5AZUA 1ASOA 1J5DA 3QJQB 2CCWA 3QPKA 2BZ7A 5B1AB 1JVLA 2PP8A 4G70B 1SDDA 4NAJA 1AZUA 3CG8A 4FA7B 2GIMA 1JZGA 1JZFA 2ZONA 1RZQA 2YAQA 1AS7A 2VW6A 1N68A 1XB8A 1PY0A 4HHGA 4Q89A 3V9EA 4HZ1A 3QJRB 1BYPA 3UAEA 4BXSV 2NRDA 6PCYA 1WA0X 4BXVA 1ILSA 2BP0A 4K9JA 4YSDA 4A66A 1J9TA 1OOWA 2DWSA 3X1FA 4AKOA 1AQ8A 4G7SB 1M57B 2R7EA 2FQFA 1KGYE 4YSRA 1QNIA 3NSDA 3QQXA 5TK4A 1IUZA 3PXLA 2H5UA 5I26A 1KBWA 2VMJA 3NYKA 4G7RB 4KNUA 1AG0A 3FQ1A 2PP9A 3NJFA 1ET7A 1EZLA 4RH4A 4PAZA 1QLEB 3CDZB 3TASA 1BQRA 4CSPA 5F7AA 2QDWA 3SBRA 1A3ZA 1AANA 2BP8A 3HEIB 5B1JC 3L45A 3TBCA 2ZXWB 4YSEA 2CAKA 1X9RA 2GI0A 3NJIA 4X4KA 3UADA 3WI9A 1JZEA 4M3HA 2EIJB 1V55B 1FWXA 5D4JA 3ZX1A 1E67A 1DZ0A 1OE1A 3MX0B 3NP4A 3KW7A 2XV3A 3DTUB 2PPCA 3QJSB 3CVBA 1TEFA 4BWTA 1T5KA 1SHXA 5B1KA 3FU8A 1WA2X 4AKQA 4L0PB 2W88A 4N8UA 4A2FA 3IEAA 1CURA 3EF4A 1AZCA 4BK5C 1L9SA 3U25A 1CYWA 3OMIB 4UAHA 2AFNA 1PCSA 1SHWA 1MG3C 1BEXA 4ZK8A 2P80D 2PPDA 1AS8A 5A7EA 3ZBMA 3NJGA 1CUOA 1UATA 4E9RA 2BHFA 4KO6A 1M9WA 3CZUB 1JZIA 5I5MA 1SJMA 2IAAC 2Q5BA 3H56A 2PP7A 3OQRA 2GBAA 2VW7A 3DKHA 4QLWA 2UXTA 3AZUA 4BDVB 2OV0A 3FYIB 1BXVA 2QPDB 1OF0A 1BYOA 3H4FA 3QJVB 3H4HA 4A68A 1V10A 2BO0A 2BW4A 3WKPA 5AKRA 2IWFA 3AG3B 4FAAB 5I6NA 1OE2A 5I6LA 3NP3A 3FSZA 2YAFA 3NSFA 1OCCB 2IDQA 3NJJA 3EH3B 1MDAA 2BWDA 2DYSB 3ABKB 2I7SA 2QT6A 4HCFA 1AR1B 1IBYA 1URIA 4HHWA 3FSAA 2GHZA 2I85A 2J56A 1IC0A 5LDUA 3NJKA 4BWUA 1MZZA 1N70A 4F2EA 3FQ2A 2XUWA 3CVCA 2PCYA 9PCYA 2EIMB 3OM3B 3FYEB 3EH5B 4G72B 1JZHA 1SDDB 2WO3B 4JHUA 3V9CA 1WA1X 3FU7A 1ASPA 1SNRA 2LLNA 3QJUB 3UAAA 1JXGA 4AKPA 1SF3A 4KO9A 1RZPA 5B3SB 1AZNA 3SQRA 1KCWA 3GXUB 2PPFA 1E65A 2BP0B 2FJSA 1HAUA 3RYMA 1W6WA 1PNDA 2H3XC 3EHBB 1AS6A 2HLEB 1I53A 4E9XA 3PLYA 2PPEA 5B7EA 1W8EA 3GYRA 2R7EB 3AW5A 2YARA 3D12B 3N2JA 4DP7X 3T9WA 1TU2A 1NPNA 2BWIA 2GC7C 2FQDA 3ABMB 5AFAA 1PMYA 5D4HA 5I6KA 1JERA 3NJNA 1NWPA 3UGEA 2BP8B 2MTAA 2GC4C 3FSWA 3GDCA 2VM4A 4YVUA 1WS7A 1BQ5A 2Y1AA 2FQGA 3JT2A 2IWEA 1NTDA 5I6MA 3EH4B 4AX3A 2I7OA 5EHFA 2XWZA 1FA4A 1RCYA 4AI7A 3AG2B 1NINA 2BW5A 1A4BA 1J5CA 5ANHA 1PAZA 1E5YA 3KW8A 1PZAA 1NPJA 1ETJA 2P80A 1GR7A 1JOIA 4DP5X 2FT6A 1NICA 4P5RA 1EHKB 2TSBA 4YSQA 2H47C 1BXAA 4A2EA 2TSAA 3ABLB 4KNTA 4KOBA 1IBZA 1J9SA 1GSKA 4G7QB 2IDFA 3NJLA 1A65A 5I6PA 4QKTA 3T6WA 3X1NA 1OCZB 2YXVA 1PZCA 2DY2A 1ZPUA 3AY2A 2PCFA 2DV6A 1SFHA 2FWLB 4DPCX 3S3BB 3OMAB 1AOZA 1MZYA 2IH9A 2YAHA 1HFUA 3BVDB 1AZBA 2FTAA 2VSMB 2B08A 3IE9A 4G71B 4DP2X 3JTBA 3WG7B 3PAZA 3BQVA 3PAUA 4NERA 4DP4X 1A8ZA 2HRHA 2ZWNA 1SF5A 4P5SA 4YVNA 4YSOA 4HALA 1GYCA 3WKQA 1WS8A 7PCYA 3UACA 1PNCA 2CALA 1KBVA 3N55A 4GP5B 1ET5A 4KNSA 1GS6X 2IH8A 1CYXA 2AANA 3IN0A 1AACA 4DP1X 3OD3A 1F56A 4JKNA 4UANA 3TBBA 3ABGA 1J9QA 4JHVA 5I6OA 1GY1A 4F2FA 1L9OA 3CVDA 1GS8A 4DPAX 2E86A 2HZHA 5F7BA 4TXVB 4GYBA 1E5ZA 1WAEA 1GY2A 1VLXA 2JFCA 2PPAA 5FC9A 1HAWA 1NDTA 2MRYA 8PAZA 4MFHA 3QJTB 1ZIAA 5B7MA 3FS9A 4WKXA 1NIAA 1ID2A 2UXFA 2YAPA 1OCRB 4DPBX 1TKWA 5PAZA 1KYAA 2FT7A 3WNIA 3FPYA 1KCBA 1NZRA 2AZUA 4GXFA 3FU7B 5I28A 1BQKA 1X9UA 1OCOB 1XB3A 3FU9A 3NSCA 3PCYA 5D4IA 1TEGA 5IY5B 3ASOB 3T6ZA 1KV7A 4GP4B 3NT0A 4E9QA 2X87A 2RACA 1E30A 4DP0X 2XXGA 4YSPA 3PAVA 3ERXA 4GP8B 3X1EA 4W1TA 3SBQA 1L9RA 3DIVA 1R1CA 1ZIBA 1AAJA 2XYBA 2J57A 3T71A 4E9YA 4W9ZA 2J5WA 2Q9OA 1SFDA 3NJHA 4KO7A 4A2HA 1PLBA 2EINB 3NSYA 4YL4A 3ASNB 4ENZA 4HAKA 2AZAA 4YSUA 1YLBB 1DYZA 1XB6A 4HIPA 3SBPA 3S8FB 3G5WA 2PLTA 2ZOOA 1RKRA 2HX8A 4UF7C 3TA4D 2DWTA 1AIZA 2IDSA 2QPEB 2XXFA 1GS7A 4AZUA 2VSKB 1KDIA 1NIBA 2HX7A 3AG1B 5B7FA 5I5IA 1GW0A 3X1BA 3MBWB 3S3CB 1BAWA 2YAEA 3CDZA 2XU9A 4WTQA 4E9WA 1BXUA 7PAZA 4E9VA 4HCIA 5E9NA 2A3TA 2WSDA 2QDVA 2XX1A 1L9TA 3HB3B 5TK2A 4BWWA 5PCYA 4YSSA 3OMNB 2CBPA 1ZDSA 1B3IA 2XX0A 2BZCA 1PF3A 1A4AA 4YSCA 3FPXA 2UX7A 3NJMA 1ADWA 1JXDA 1NIEA 2CJ3A 1KDJA 1ILUA 3IN2A 3AG4B 4Q8BA 2X88A 2GB2A 2XLLA 3FSVA 1W6LA 4A2DA 2EILB 4CSZA 2IDTA 1L9PA 2UX6A 2IDUA 2VM3A 5I5JA 2JKWA 3FQYA 1JZJA 2DYRB 3T6XA 4N4YB 2N0MA 2AVFA 4EF3A 2YAOA 6PAZA 3T6VA 2J55A 2HRGA 5B1JA 4A67A 3WNJA 2GSMB 1AZRA 2CUAA 1NWOA 2UXVA 2FT8A 3FT0A 1NIFA 4NB7A 1L9QA 1ASQA
chains in the Genus database with same CATH superfamily
2EDBA 2BHUA 3QCVH 5I2IA 1MUJA 2WINB 1HK6A 3SOBL 3BGFB 2ODHA 1MCPL 5KWYC 1MJUH 3P30H 3D9AH 3QR0A 2QZQA 3UAJD 1LE5A 3VWKC 2YD6A 1MNUH 4G1MB 4KKPA 1V54B 3E3QC 2R56H 4X5XB 1QRKA 4PLKC 1NL0L 3KBHE 1DANT 1I31A 3QQNA 3NZHH 3ZDWA 2X9ZA 4ZS7H 5GJTH 4EDWH 4K9EL 1ORQA 5TE6H 4MB5A 4YR6A 2Q7YB 2X05A 4EQ2A 1I7TB 4EIZC 5IB5B 5F7MC 1FRGL 1UZ6F 4DGIL 2PR4H 5HHMD 4AYBA 4F57L 3S8GB 3ZVVA 1PFOA 3OZ9L 4LFHD 3OR7B 4OGQC 5IG7B 3UFIA 2VR9A 1CG9A 3BKMH 2GCYB 4ZMVA 2BCKA 5KAQF 4R3SB 1AC6A 4FFTA 3D4CA 1SDDA 2H2PD 5E9DA 5EC1A 3FTVA 4B5EA 5AW7B 1ETB1 4NFDA 1YEEL 3K91A 2OTWB 3V4VB 1OGTB 4XVTL 3MJ9L 1S5IL 3RWJA 1KNOB 3L7EA 4HHGA 5EZJA 1IGIL 2QR0B 5DQJA 2VDOL 5JDJA 4X6EA 2H6PB 5BQDA 4MMZB 4RGMB 5C86A 2CHZA 3D30A 3FQRA 4H13C 2XI9A 4YFDB 1A1OA 1OOWA 4LDOB 5CIPB 3NBNA 4WI0B 4K94H 4H4NA 4GSDL 1M2OA 3SDAA 4X8JB 4YIQB 2FQFA 1QNIA 3NSDA 2CUMA 1UM4H 2NY5H 5D7IF 2RTTA 3ZRSA 1HZKA 2GTZA 3UBXI 5GS2D 2AK1H 1NFDA 4RH4A 4UIKH 1PY4A 4Z7QF 5EO0B 2HFGL 5GS3A 3HOGA 3VGAC 4EDXB 4DK3A 4CNIB 3HEIB 1NGWB 4JK0D 4NO0A 1VSCA 3GGWB 2XN9A 3WSQL 4M3HA 5JIIA 1GGCH 4RRPG 2QEJA 3FO1A 3HZKB 3FQUA 4IK7A 1NDGA 3CMOL 3FFCB 1RULH 2I5YL 4QHNB 4HYTB 2PPCA 3V5KA 5BOPA 2YKLH 4W9FC 4X8XA 1DSFL 5D5MF 3QUZB 4TF4A 2VLLB 3DX6B 1MCEA 2J1ZA 3LN4B 4KXZH 3CBRA 1IGYB 4IRSD 4BSVB 4K2UL 3RKPA 1WC7A 1DQLL 2FHCA 2IV8A 1XH3B 4OIFA 4WWPA 2F53D 3VI4F 2AFNA 2JIXB 1EHXA 2I07A 4O5LL 4R26H 4AT6B 1BEXA 1MQKH 5IEHA 1EVTC 2F19H 1KXHA 2NY4B 1ACCA 4RMSA 3GSOA 4K7FA 5AZEH 1H9DA 3MDJA 3EGSB 5J3HC 5EEWA 1BZEA 2QSVA 4RBPH 5L4MA 3PFUA 3CZUB 3CFUA 1S7SA 1ZHNB 2YGPA 4J3OG 4BELD 4UTAH 1UWFA 2IAAC 1FZJA 4NZUL 3P1VA 3VXTB 2WTRB 2F53E 1WTGT 3DKHA 3P4NA 3UBGA 3MCKB 2V2TA 4XBGA 3UJJL 3IU3A 5SWSA 3DYOA 3WEOA 3CSBA 4WTZG 3TVMC 2NY6C 1G4RA 4U6VL 4G7YL 1MH5A 1JGEA 5CWSB 5I75C 5D72H 5IJVA 3H4HA 4FQHB 4A68A 2IWFA 3MRPB 3NH7H 4JL2A 4BGLA 1OE2A 2ZYRA 3QNZB 4TVPH 2OSWA 2ZUVA 4JBSA 4MXQD 4OZGE 3MLXH 5BRZD 3R1GH 2IDQA 4N2DA 4L4TD 1WZKA 4U3SA 5JR1L 3SDAC 2VDQL 2YXMA 2QT6A 2WAQA 1WV7T 2DMHA 3N40F 1U8JA 1I9JH 4W9JC 1UZGA 1FL6A 3P3TA 2QQNH 3HE6A 2NW3A 3VXNA 1H8OA 2AJZB 1ZLWK 3MLRL 3IFNH 3T4YA 3TJEH 3CFEB 1MW1A 3OSKA 4N3UA 1DSYA 1UACH 2FGWH 3C6LD 1K2DB 4F93B 5BRZE 5HDQL 1LNUB 2WNGA 4JO3L 4L4TE 3JTSA 4H8QA 1ZT7A 3QXAA 4RFEA 1O6TA 3ZRCC 3ZTNL 3CH1A 1KN4H 1UD3A 3OKKB 4UB0L 3V6OE 2OR8A 1A6VH 2XQYK 4KO9A 3BWZA 4PJHB 1RZPA 2Q76A 3GHBH 4XPGH 1WBYA 4OQTA 4KHXH 3ULVH 1SVBA 3VACA 1Q0YH 2NY3C 1G7HA 2KPWA 3C6SA 1ZXKA 2AHIA 2FEEI 1TSRA 2V5MA 4EKXA 5HGGS 3CE1A 1CDUA 4LPUA 4YDIH 4FABH 4NQEB 1RUAL 3D3VA 5CZXD 5D1ZA 4YNYA 4Q6KA 4X9YA 2H9GB 5IVOA 3N2JA 1VERA 3SGEH 2CLRB 4KTDL 1CQKA 3ARYA 2K3HA 2VAAA 3K2KA 3QEGL 4W4NA 1U91A 2UZYB 4Y4FD 4IGBD 5CZKA 5AFAA 4L5FL 4E0RA 3VG0L 1YECL 3OGCA 3RVVD 5FOBB 1S3KL 2WLLA 2CDEA 4A55A 2JCWA 5ERWA 1D6VL 3KJ4B 2ICWI 3FCBA 1Q0XH 5JIMA 2Z4TA 3IMTA 1HEJC 3LS4L 2FQGA 1O7DC 2HVJB 4ZD3H 3AS3A 1GH7A 3D0VA 4LBEB 1HIML 4HS6A 4IBWA 2JSFA 2LFGA 1PG7X 5FO8B 5ID1B 3O6ML 3S37X 5DJZB 5FCUH 3LEXA 4XP1H 1BJ1H 2EEXA 1AQKH 4HBCH 4ZUTA 4OLEA 1TG8A 3HAEH 5KEZA 1QTYT 3V0AC 3KPPB 3EG9B 4O2FA 4BGDA 4HETA 5L88H 3ZRFC 5ISZB 4FP8L 4AW7A 1J8HE 3I50H 4YZWA 2WLHA 1TZ8A 4WZ9A 1A7OH 4PJFF 5F0LB 1LILA 4TLUA 4LMQI 3C5JB 2CCLA 4NUJA 4WFED 1J8RA 2IDFA 4PJXA 5I6PA 3H9SD 3F65A 4JFQA 4PJ8C 5HVWA 3O2VL 2O6DA 3QEHA 4WSJA 1U8QA 5I1DB 4ODUA 2DQTH 2BVPA 2IBGA 3CLEL 2FYYA 2PCFA 3HE6C 1N59A 3G3LA 1TTAA 1B2YA 2DV6A 4OCSH 3DOIA 1NANH 2FWLB 4DN3L 1WD9A 3NCJL 1P4BL 1HFUA 12E8L 3BVDB 2B08A 3B9VA 4MDJA 3RZWA 1JBJA 2J6EH 2NY2C 2XV6B 1XTLA 3QDJA 5LAPA 1GGYA 2AV7B 4WFEE 1O9ZA 5ADPH 4NYLB 2Q86B 3CZFA 5I30L 4QWWD 2HJLA 5JO5A 2HLFC 2QLYA 5KBDA 5IFJA 1DDTA 1V7ML 1E4JA 3MGTB 4RVBA 1F2QA 4JRLA 1DBKH 3TBBA 4PJDF 1IM3D 1MW0A 3X14B 1J9QA 2APSA 5KS9F 2R83A 4BK8A 5KVEE 3X3GL 1CK0L 3AFLA 3AS1A 4KJYB 4DPAX 2KKQA 4FFYH 2BOBB 4IIQB 1GOFA 5D1ZC 5M94B 5LGHL 5EBWA 4PRHE 1N26A 3S36H 4JFZH 3SGJA 3WXVH 2L4OA 1F6AA 3QDMA 2ICWB 5K1JA 2ZXQA 1MCSA 4KRPD 2OMXA 3D2UB 4UMGA 3WCYA 3ZL2A 4Z8FL 4UBDC 4UU9A 1ZIAA 1KCVH 2KLSA 1GHFL 2C9QA 3CXHK 2OR7A 1KYAA 1Y7VA 2YPVL 3MZGB 1U93A 1A6UL 4Z7UA 5L7XH 1J0HA 4ELKA 3FU9A 3B9KB 2GHWB 4P2QB 2IH1B 5IY5B 1NUFA 4HAGA 2J25A 5AW9B 1ACYL 3RJDA 3T0DA 3MTXA 1UA3A 5I19L 3H9HA 5EF1A 5DJAA 2JKLA 2HG0A 1E43A 2BWQA 2X87A 2RACA 3GSNH 4C56B 4OB5L 1T66D 5L2JB 2XVKA 4NNXA 4EUPB 3K4ZA 3LPPA 3IFOA 2R0KH 4OU3A 1I8KA 2ZOUA 3F62A 3MRFA 5HHOD 1LYQA 1H3VA 3P9WB 1S7WA 4G6KH 3FUJA 1RHHA 3KYOB 2AZAA 4FDWA 1J1XL 1KSRA 3VXUB 1EK3A 4IM8A 1X7TA 2FVNA 2AI0H 3IDJA 5FKPA 2G2PA 2XOTA 4H0LC 2GSIA 4UF7C 3REVB 5H2BB 1SXAA 3BO8B 1MIMH 1EPFA 1GS7A 4KV5F 3WYRA 3EO0B 4BZYA 3HCVB 2KDGA 2QVTA 2I26N 3L3KB 3MHZA 4XMZA 4CJ0A 3MBWB 3S3CB 3U7YL 4H8HA 2YAEA 2BIPA 3DI3B 4Y0GA 4XCYB 3V4PB 3TONA 5CCKL 4B3VA 2XXCB 3W57A 1R33A 4XZUB 1AFVH 5GSRB 3O4LE 2AF2A 3I02B 3PNRB 5AUMA 3FQXA 3DSNA 2HN7A 3JWNC 7CGTA 4CC0A 4RFOH 1B0GA 4HZAA 1BMGA 5DTFB 1W2KT 5C9JB 4GBXB 1FIEA 3OL2A 2A83A 4FCAA 3RTQA 4YSCA 4QRPB 3UC0L 4XR8C 4FFWC 1UA6H 4YXHL 4OF0A 3I6SA 5CHNB 1I9RH 4QOKB 5JW4N 3UGXA 4Q8BA 2V33A 3Q8BA 4Q9QL 4CSZA 2DQFA 1EERB 3SGJC 3M45A 1IX2A 3QHTC 3VFWA 4AQOA 2WUCL 4N68A 3STZB 1TXKA 3C5ZD 1HI6B 2XPGA 3TBYB 1JZJA 4H1LH 5CU9A 1AXTL 4NQDB 1IAIL 3INUH 1YAIA 5B1JA 2APFA 2ZOLB 3VGEA 4XO4A 3QO1B 4UV4H 1XGTA 5DEGB 2VC2H 1NGPL 1G9NL 5IR1A 2OBGA 1GC1C 5EO1B 2DQHH 2WD0A 5MEQA 3P4OA 3NIFE 1QATA 3D85A 3G6AB 1UD2A 3N3EA 2PW2B 4JCLA 5K39B 1ECYA 4TOYL 2PYFB 2V17H 4WEBL 3IDGA 3QWRD 3BN9D 4PVNA 5I1GL 3HZ3A 4WUUE 3BD3A 2H0PA 5CGTA 3CQPA 3VXMD 3I3EA 3ES6B 5LXVA 1XF4A 1FJ1A 4OCXL 4DVRL 2DLGA 3HZMB 2OW6A 4JQXC 2ZYHA 4JFDB 1UM5H 3D69B 5DQDL 1OCWH 4A2GA 3DX8B 1TQCC 3VD9A 4XOAA 4RAVB 4PJEA 4DP8X 2HWZH 2PR9A 2XA3A 2HXAA 2AKRA 4G3YH 2M2DA 1DQVA 2GJJA 1YDPA 1FCCA 1J1PH 3VXME 4WU7A 2MTPA 4ZAKC 1A6ZA 5SWZB 4HKJB 4GT7A 2OX5B 4GFTB 1PLAA 4NQCB 4UQ2A 4Y5VA 2J88L 5HYJA 5DJ0A 5F96L 1TYJA 4RRPA 2HUHA 1D5BA 3VMOA 2X1QA 2XWBB 1TMQA 3BVWA 5I6XC 4HLEA 2YXWA 4IRZH 1CC3A 3MRRA 2GJZA 1K8IB 2HT3C 3B8SA 4LLWB 4F8LA 1NCCL 1K5WA 3FTYA 1HOCA 4XP6H 3TNNB 1DQDH 3EW3B 1QR1A 3P4MB 1OAQL 2UWEB 1U8IA 1HHGA 2BSDA 4HEMA 4LBAA 2Z4QA 1IAII 3BPLB 1OB1B 4RSVA 5D4QA 5D1XA 1EGJL 4XPAH 5ICYB 2Z7YA 4CBZA 3ZUCA 4N87A 3RTQC 4C55A 2FHBA 4XCFH 3VX0A 1TZHA 1DE4A 3APFA 4Y89A 1VFAB 2HTLC 4LCIH 1FVCA 5CSZA 2FX8H 5K5YA 1MRCL 2A99A 4R7NA 4BINA 2YC1B 1OTSD 3L3JB 3NA9H 3QJHA 5DRZB 3LDBB 2VMEA 2P45B 5IGXL 3QHZL 2JKIS 2EUXA 4LCWA 1RZ8B 1YEHL 3ZSSA 3BHBA 4C83A 5B1JC 3IDYC 1A7PL 1N5AA 3MRQA 5J11C 2CAKA 4OIAA 3D06A 4WTZA 1ADQH 2CIKA 1K6QL 2WIIA 3T04D 1U8PA 4L8SA 4X8GA 3EO1A 1E67A 1JD7A 1OE1A 2HRPL 1Z66A 4L2YA 1FZOA 2F61A 3MA7A 3QIBB 5I8EB 3WHE1 3SJVD 3UOAB 3HUJA 1EUUA 4G5ZH 1TEFA 1S9XB 5AB2A 3GRWH 3QARA 4IDJL 4QHMB 4CA4A 1WA2X 1PG7H 1VADA 1DUYA 4PJ7F 4N8UA 1Q38A 4FXKB 5FM8A 3NDZE 2Q0ZX 5H4ZA 3NSXA 3F12B 1XGRB 4KDTC 4KKBC 1QG3A 5E1AA 3ESVF 3ZT6A 4DSYA 4IOFC 4I77H 5MP6H 1E8ZA 3CVHL 4FMFA 4I2XA 4QCIB 1KXQE 3AAZB 2YPLA 2N1KA 4IKJA 1ZGLA 4PJAA 4UT9A 2VWEE 3UTSE 1UT9A 2Z34A 4PV1C 3F7VA 2QQLL 1ES0A 3GMOB 5EZOH 3SJVE 2P80D 1YNTB 4H8VA 4F9LA 5FCSH 4KTGA 4GAJH 3A4FA 3CFJB 4JPKH 2VABB 4X98A 1K8DB 4FZEL 3TEZA 3BH4A 2ZICA 3QHFH 1CICD 1SJMA 2WQXA 3F5WB 3FF7A 2C3GA 5CEXA 5HDRA 3OXRA 4X50A 1IAOA 1H9VA 1JPGA 5H8DA 2VW7A 2V7HB 2PTUA 3KPRE 5C2BH 2YD4A 4POUB 4QTFA 1A1MB 3V0WH 4XMKH 5E51A 4YHLH 2HMIC 3SPVB 4LASH 1XH1A 1RIHL 3UG4A 1TJXA 2OW7A 3ILQC 1S3RA 1AGDA 5GRJL 2Z7UA 1P7KB 1L7TL 3QIWA 1OHQA 4GRLB 4AMWA 2D03H 2VN6A 2ZOKB 2YAFA 4IQHA 3FH7A 3FO9B 3LKNB 1LO3L 4QJ5B 3NJJA 1DVFB 2YBRA 1SBBA 1HNGA 1IGJA 3I6LD 4CKVX 3HNSL 5TFSH 2Y07L 3MFFB 1QVOB 1S9WA 5CILL 3WL9B 5FUCC 4OM0L 3HAEG 4LOVA 2QVMA 2QLVB 4JQIH 3A6BL 1RZGB 4UCFA 2WQRA 4GLRH 1N70A 3UX9B 1FVDB 1X5IA 4AENB 1WFTA 2E8ZA 5GGQH 4APXA 4Y19E 3H85A 1WHOA 3FUKA 4XH2A 3OJDA 3ZYZA 4PJIA 1P6AB 4IKLA 3FU7A 2JB6B 4WK0B 4L8SC 4XHQA 2XICA 3I2CH 4M1GL 4MB1A 3DX9A 4OT1L 2W92A 1GCFA 5E5RB 5I1AB 5C0EB 2C34A 3DHJA 2LR4A 4NUGL 4NO3B 3U6RB 4XNUL 3AWGA 1YPZA 3EYUL 1TVBB 4YDNA 3DRTA 4HIJA 1CDHA 3E38A 2ARWA 2VYRE 1UJ3A 1W8EA 2R7EB 3T8XB 2NYZA 1E2VA 3AW5A 3GDBA 5CSBA 4PY7B 3BSHA 3D12B 1E5BA 3T5WA 1U92B 4LLYB 4NZFA 1TVDA 1OP9A 1CIUA 4HH9B 4LL9A 1TLMA 3ZE2E 1T20B 3HLAA 4HX1B 4Q14A 5K9KB 3WLWC 3BGMB 1RJZA 1QYGH 1P5UB 1M6UA 2GK0A 1QPPA 1HVXA 2ATKB 4F9LC 4FXTA 3KPMB 4LPCA 3VMPA 1AD0A 3EYOB 1A02N 2VLJB 1TTFA 4ERSH 3O3EB 1KTKE 2I7OA 4HJ0C 1B9KA 5DC0A 1UKSA 4XP4H 1IARB 3CTTA 2BW5A 4FI6A 2CUHA 4OLWH 1AIFA 3IAGC 1SXCA 4BD4A 3KW8A 3QXUA 2DDQL 5DC2A 1IAKB 4E41B 1UFGA 3W9DB 4DP5X 5K9JL 2EIDA 4OBSA 4UDTB 1T83A 2AJ3B 4LQ1A 3QIWC 1QBML 2TSBA 1MAML 3QZWB 4MB4A 1RJYA 3G08A 1EDHA 4M8UA 4FTDA 1KN2L 1KG0B 1SLUA 2FL5A 4FERA 2X38A 4IBTA 4W6YB 3SDXE 4LCYB 4C54A 3WEXB 3FOLB 1J9SA 5B3NA 4G7QB 4XNYL 2ESVA 4LAQL 1RZIA 1HWGB 4WI5A 2Q8BH 4FA6A 4JANA 4KPHL 5CJQH 3CFKA 2YA0A 3KXFD 1NFIB 3RFZC 1J18A 3AM8A 1ZSHA 3EFFA 4JPSA 4RSYA 4FG2A 4AZ8B 2EO1A 3GXIA 1TETL 5FYJH 4KAQL 4F91B 3WMSA 1SOXA 3HN5A 2R69A 4JY6A 2ZWLT 3LRSB 3IDMB 3M1CA 1CGSH 4N3TA 2OYMA 1EHNA 1X5MA 1Z5LA 2DZEA 2C9SA 4ONHA 1BX2A 3FBKA 4OZFB 4E9LA 4OCWL 4P5SA 5LLIC 3VQMA 4PR5B 3VYNA 1O0VA 4NRXA 4R2GD 4WW2C 1C5BL 1XHHA 4WW2F 3MV9D 1JK8B 1Q9OB 1FNEA 2KT6A 3OD3A 1F56A 5I1EH 5FHAL 4AUYA 5EF2A 4LEOA 5E1IA 1BLNA 3WY2A 1CL7L 5KSUB 3T09A 1GY1A 3SN6N 1N5YH 2FH8A 1UB6B 1IAMA 5K59F 3L1GA 1BF5A 3SZ6A 1SEQL 3QXVA 2LE9A 4U1JA 5EWIL 1E5ZA 2WKOF 1GY2A 2AERT 4R90H 2PPAA 2O5NA 4U6XB 3SDDD 3O3UN 4G8FB 4PW9A 3NEXA 4DGUA 3RHWK 4ZW3A 4MQ7A 4GKZA 4Q7DA 4LHUB 3SO3B 2XWTB 1UVQB 4K5MA 1X5HA 1TCRA 2D7NA 3QAZB 4M8RA 4OF7A 2OPCA 4PG9A 5C09D 3ZE0E 1BFOB 4GO8A 1VIWA 1MLCB 3FN3A 3QDAA 4NHUB 3NAAL 3WUWA 4HUVA 1N67A 2Y7MA 5DEFA 2FT7A 5I17B 3V4UL 1QFPA 4K3JL 1BQKA 4AV0A 4NN7C 3FCGA 1E3FA 1KENH 1KIPA 3VVVA 3IDIA 4Q4IA 2WP3T 4YZFE 4YGVB 3K6SA 2W65B 3R0MA 2BP3A 4HPOH 2IFFH 4H1LG 1E42A 4M7KL 2XXGA 5DC9B 1NC2A 2QKSA 2M26A 1JGUL 5GZNA 1ONQB 5F0JB 1L9RA 4DKAA 3ZDYB 1OGAD 1ZIBA 5E2UL 3B2UC 1T04B 3LD8B 3OF6D 1DQIA 3RILA 1UQSA 3TOPA 1UXMA 1FVEA 3S4SB 4MJ4A 2OXHA 1OAUL 1RURL 3LXBA 1G84A 4ENZA 3QWOB 4AQEA 5F88B 1UM6L 4P2AA 3GHEL 4PJBF 4Q74A 2YA1A 1DFXA 5AYQA 1BCIA 2P3YA 1UFUA 4GSQA 5HDLA 3SY0B 1T6BX 3HG0A 3QK0A 5I5IA 4FG6D 3BAKA 1CL7I 1BZ9B 3CDZA 4P3WA 4X9BA 1JI2A 4KNQA 4OJFL 3MLUH 4L9LA 2JI1A 4WY7L 3AMKA 3QNYA 3H2QA 4HV8B 4K5NA 4M1DL 3V0DA 1H3WM 2Y7LA 4E9VA 4HCIA 3PQYE 3IFLL 1TJHH 1BOGA 3M88A 3EJRA 3IMUA 3P3UA 4WRLA 2XVLA 1X9LA 1OTTD 2NXZB 2VDLH 3QIUA 4LLDA 4HGKC 3SDCB 2QPFA 4HJIA 3NCXA 1F4XH 3C60C 4M00A 4G42B 4UIMB 4QNPE 2QFPA 3OKNB 3HC3L 4KK6D 2X5PA 1E0OB 4NNPL 5F7YC 3SKOA 3I9PA 3LKOB 1HCZA 4ZUUA 4YHNA 3D39B 4MMYB 5CLXA 2VDMB 5C07E 4P46A 1I1AB 3V0HA 3P9MB 5EEZA 5DO8A 5F1SA 3CFDA 4QY8A 3B3IB 2YIHA 4YXLH 4G9FB 2NNRA 3O6FB 4JRYD 3D6GA 4UOJA 2N0MA 1HDMB 1IEHA 1BFTA 4Z7QB 4ORGA 2A5UA 2IWGA 3F6IA 1R3LB 4ANVA 3H6AA 1FFOA 4P5MA 2Z31B 2FZ3A 2LV4A 1CF8L 1G7MB 4Y4KA 1MHEB 2NY7L 3M8OH 3BZDA 1H5BC 3X3FH 4JGNA 2GUOA 2FT8A 5JNYB 5CZVL 2ITDA 3F2LA 1F18A 3ARED 4EN3B 4NOFA 3KNBA 3FZUD 3HNTL 1QTPA 2CO1A 2G2NA 1S5HA 4NP4H 3QI9A 2GY5A 1P5VB 1W0VB 1UT2A 4PUBH 5EZLA 5D5MB 4P4KA 4UTAA 3EYSL 3B2PA 1IC7H 2XKNB 1OE3A 2PCPA 4P5TA 1A5FH 4ZSOE 5MI0B 5GZNC 1SXBA 4PCYA 2VZVA 4NI3A 1N7MH 3QPXL 4OF6A 4AQ1B 2CPUA 4AJ0A 3CDYA 5GHWH 2C9UA 5HGHB 2EDXA 2B39A 1H15B 2F15A 2YQ3A 5TE4L 4HHAA 4W93A 2E9GA 5C0ND 2R4SL 3L4XA 1E27A 2BVQB 4PMEA 3MLWH 4KDVA 4ELMF 1D2PA 1RD6A 3LIZH 5IB3A 3BISA 4M4RB 5AVZB 3R06A 1IKOP 1NIDA 2HKHL 1LO4L 3QP3A 1TZAA 1FDLH 4YEEA 1S78D 4DKFH 2XACC 1WITA 3L08A 4BIKA 1ZV2A 5GQBA 4GRWF 4R4BB 3VXRB 2BSTB 1QNZH 1VGKB 2NY5C 4L9LC 5ICZA 3GMLA 1FYTA 3APDA 4OQTL 5MERA 3ULUF 5C0AB 5EOCL 4ZFGH 1CXKA 1OPOA 2HB0A 2K6ZA 3MBEB 3NIDF 4G2AA 4HUUA 1NUGA 4KY2A 5IEKB 1JZFA 2WUBH 3FUFA 3C9NA 1BVLB 5CGBA 3L5IA 1RAMA 4N0UB 2BIQA 1TUPA 4MA3B 3QIUC 3DNKA 4X0KB 3ZO9A 4FKKA 1HL8A 3PGDB 3EGXB 5D2LF 4AGLA 2G3MA 4NN5C 1MI5A 2VO5A 3ESOA 4XRCB 3RWFA 4PSPA 4F2MB 3GIZH 1UD5A 1YEGH 3VSTA 1HL4A 1NLDH 3VGDA 3REWA 3P3SA 1E8YA 3INOA 2DQEH 3T2NH 1KEGL 3WHXB 4P46C 2X4PA 1DVSA 3PXLA 5TDPB 4KNUA 3WFZA 1L7IH 2K45A 1CFTA 5EO9A 5KSBF 5DXWA 3W81A 3GSUA 3WN5A 4JPWH 2ZX5A 2DTSA 1QLEB 1M05B 2K9UA 4XAWH 3E8VA 5A2BA 3U4AA 5IHHA 1A3ZA 2AJUL 3MODL 4R4ND 3X12A 4XNZC 4KTYA 4YSEA 3CMGA 3NJIA 4Y4KC 5DYOB 4IBLT 3L3GA 4QT5A 4JZJB 4RZCA 1Y07A 4X5WA 1J5IA 2M1KA 5KJ4A 5C7XL 2G75A 1IBBA 2SODB 4OFYA 2YHGA 1XR8A 1GL4B 3KW7A 4JFFA 4NWTL 5F7EH 3WIHH 1O7VA 3QI9C 3O3BA 4MVBD 3TGXA 5CINL 1BFSA 1VPOL 4J3UA 5JOPD 2BOLA 2C3VA 3Q13A 4P5TC 5BNXD 1CLZL 4XN9A 3IEAA 4FQIH 1B4JH 4N2CA 1HWHB 5CCJA 5DMGC 1I7ZA 1V3LA 2VQUA 3HAEA 4ZMYA 4AG4L 4NENB 2YD8A 2R15A 4WI4A 2J44A 4YXKL 1AMYA 5FDWA 2WKLA 3LZOA 3QA3B 1SHWA 1T5WA 5D1ZI 1XF5B 4ZK8A 3V7AE 1EZVY 2PPDA 1A9BB 1AR1C 2ZF9A 3VJ6B 3ZBMA 2EIEA 1L5GB 3SY6A 3CZSA 1GJUA 3PIQB 1OT4A 3GFUA 4PBVC 1GZPA 2ODIA 2HJKB 4NI6A 3FFCD 5EPMA 4YHIB 4IJ3C 1U95A 1ZHLA 5CBAA 1J0JA 3V6FB 2KZKA 1D5ZB 2J8OA 3QUZD 4KKCD 5C0BA 2BZDA 5K1NA 5IQ7H 2UXTA 3HHSA 3TPUB 5KBPA 3CC5A 3S88L 5IMLB 1FGVL 1RUPL 3D0LA 3H4FA 2W80C 3U46B 1KIUA 4HP5A 3L95A 4DJMA 4JZOA 3FB5B 4BHUI 4JREB 2OMWB 1BVNT 2CG9X 2JIXD 4N2MA 3VFNB 3FFCE 3SPJA 5I6LA 3S5ZA 3CSYB 4LNVA 4A6YB 5IBUG 4JJHA 4Z7WA 2FJGA 4PJFB 4X80L 4Q9RH 3G6DH 5GGTH 2YGQA 1IFHL 1QEXA 3QUYC 4HIXL 3S5LG 4DWHA 3DROB 5CKGA 4XN4A 3ULVC 2CLVB 5BS0B 3DIFB 4HJJL 4U1NA 4EKJA 2H0EA 1GC1L 5E6ZA 2WGNB 3M6DA 1F02I 4FMKA 4FFYA 2JCCF 5DD1H 2I9LA 3KGSA 4U7MA 5I73B 3V0JA 1A4KA 1N8OE 4QHUB 2XUWA 2UZIL 4KY1H 2PCYA 3W3BA 3DXAA 1FN4B 4P0DA 1EEYA 2DJUA 3K3QA 1AR2A 4ZXBD 1L0PA 4MD4B 2FO4B 4RWHA 3J07A 5F9JB 3ZKNC 3GK8H 5D7SL 3ORJA 5B22A 3TO4A 1S9YB 1EO7A 3GMQB 3CBKB 3ECBB 2ZQKA 1E65A 2IPTH 4AIXA 4H8PA 3BKJL 4B7LA 1JDCA 4NZJA 2VDNH 3SOTA 3SD5A 3CD4A 3KJ6H 2NZIA 3PGCB 4YLCA 3EYVB 2IO5A 5C3TA 4Q9CA 3GBEA 4R8WL 4A2LA 1RERA 1NLBL 1TFPA 2VXQH 3GSNA 4XVUD 4ZJ9A 4LGPB 1AXSA 2FIKA 4X0NA 1YA5A 1QFWM 15C8H 4YC2C 3IXAA 4ACPA 3OTTA 4W6XB 3SCMD 2PNDA 1J05A 1IFRA 3B34A 1OD7A 1VACB 2NSXA 3STLB 3UIYA 5KW9L 4K7PY 3L3HB 3LKPA 3AGVA 1WS7A 2HLAA 4ODVL 2W60B 2OZ4H 2Y1AA 2OQJA 1ZA6B 4ODXB 3UTZA 3BFOA 4U6YB 1E9OB 5K1VA 4Y4HB 1HH9B 2AXHA 1I3RB 1TITA 1U8MA 1XSKA 2BSSB 2R0WL 3JXAA 3OBAA 4AMKH 1JYVA 2NY0B 5IMKA 4AI7A 4GKNA 4XWOC 1T1XB 1SGKA 1JHTA 5F3FA 4U0RC 1I9IL 4CILA 4LEXL 5JIDA 2VQ1B 1E5YA 3RDTA 3NACL 4X4ZA 1FIGL 2WTOA 4M7JL 4NQED 4PGEB 4DEPB 1UENA 5L9DL 1XAKA 3U0PA 2DWEA 1KF9B 3MBXH 1SJEB 3S48A 5AB0A 1JGDA 2DM7A 4P5RA 4ZO9A 2XFXA 4KZEH 2IF7A 4Y9FA 5KUMA 1QQDA 4PJHE 3L4VA 1NEUA 2DRUA 4GQ9H 4OZHA 1BSIA 1P4LB 1K3ZA 3FQNA 3PABA 2VZ3A 4IRJA 1U3YA 4ZQKB 3ZMRA 4I0PB 5DD3L 3KLAB 2Z1KA 3NJLA 4X6DF 1OZTG 1AH1A 3LXUX 1A22B 3JWOC 3QDGB 4NQEE 1OVZA 2MH4A 1ZPUA 2EDRA 5AWNL 1UKTA 2PWHA 4YQXH 3RAJH 1SFHA 3MRIA 2CK0H 4PRNB 1KPVA 3S3BB 3W38A 4Z0BH 1I3VA 1NKOA 1RU9L 3OPZL 1TYRA 3P3RA 3RKDD 2BIMA 4G80B 3WG7B 1A3LL 4H1LA 2NUPB 2ZCLL 1OAXH 4APQC 1Z6JT 3TT1L 4N90E 1RZKH 3M46A 3GKWH 2CALA 2NNCA 4HKXA 3FTGA 1NUNB 2XN1A 3TO4C 3SYAA 2WANA 1HSAA 2CDFA 5E5MA 2AANA 2F6AA 4KK5D 1W72B 2IPKA 4ODHH 4ZFOL 1WBXA 3F7LA 5LBSA 4M93B 3QC5X 3ULSA 1UB5A 3UPAA 3D2TA 4JHVA 2OI9B 3KLHC 1BBJB 2GSGA 4JVWA 1LEKA 4XN2A 4A38A 4MJ2A 1KB5B 3DOSA 3RX9A 4B53A 1A7NH 4QEGA 4NRZA 1YYCA 4QO1B 1QMUA 4JPVL 2HAZA 1KIRB 1S9VA 1SBSL 4YK4C 4TN9A 4TQHA 1AD9B 4RDBA 3HPJB 1YNKL 4JGUA 1YNLH 3S9DB 1N64L 1KLUA 5B7MA 3LRKA 5LNEA 1FO0B 4D0CA 1DZBA 4JN2A 5KYWA 1A7QL 1G6RB 4X8CA 1YVLA 5SX5K 4RMQA 5AW6B 4CADA 3VI3A 4ODTH 1P1ZB 1YEJL 1HE7A 1S7XA 1GKOA 4PG2A 1X9UA 3HMWH 4OLUH 4FYTA 4HXAH 5EIIG 3L6FB 4YN3A 1EFXD 5HD8D 4TQPA 5ABAA 1AZVA 2BRQA 3MOQA 1YUHA 3D4YA 3RDTC 2YOAA 4IRZA 1JHKH 1IEBA 4PSRA 5F7DA 4AGMA 2MWCA 4PJGA 2DJSA 2D3VA 3P0YH 4H5SA 3L3DB 3L1OL 3PXJA 4L8BB 4QUOA 4UM9D 4WVRA 1AAJA 4WWKA 3ZHFA 3I6GB 3DO3A 3OR6B 3O4OC 2J5WA 1YEDB 2N4IA 3D2UD 2IVFC 4HIHA 3ZU8A 3NTCL 4OFKA 3LN5B 1HTYA 3BVUA 4HAKA 4BKSC 4ETQB 1YLBB 2BFGA 3RGVB 3RVXC 4PB9H 1H8NA 5F1OB 5LCVA 4HKZA 1RKRA 3TA4D 2OJEB 3JWDC 3FQWB 2YRZA 4TLTA 3QISA 1NAMH 2KI6A 3DVGB 4XWGH 2BK8A 5IM7B 3KCPA 4YHOL 4B9IA 1JNLL 4HDIA 4DPRA 2JTDA 1CFSB 2I24N 1OF2A 3W2DH 3E1ZA 2VL5A 3BP6B 2JVUA 5C70A 2QDVA 4LU5H 3L5HA 2C1PA 5DRWA 3WO4B 3H7BB 1AMXA 4YDMA 3WS3A 2X44D 3QH3A 2GUYA 5IHUL 3KYMB 1MF2L 3HHMA 3B6SA 3GXDA 4BE5A 4Y8AA 3VD7A 4YSSA 3W5NA 3IAQA 3CU7A 4OZGA 1ADQA 2J8UF 4P2QE 3G5VB 4YDVA 1DP0A 4I1RA 1KPRB 4M6MH 3HE7B 1PF3A 2C9AA 2P26A 5D70H 3R8BB 4OF8A 2E9WA 3MUUA 2EH8L 2QPUA 4C56E 3EDEA 3IDUA 2X88A 5ITFB 4GW5A 2UZXB 1RP8A 3LY6A 3TL5A 1D5XA 4LSSH 3O2WL 4YHKL 1T7WA 3UTQB 5EU4A 3LHAA 4M7LT 4MXWH 2XZZA 2J12B 4Y16A 5G5DA 3T8MA 5AG9A 1GJIA 3FUNA 4W9CC 4LRNL 3KCWA 2FDBP 1R3KA 3VXUE 1CI5A 2DQIH 3FN0L 4A67A 4DESA 4V1DB 3LRLA 3MRGB 5DDHB 4WI3A 2K78A 4WFFD 4LF3B 2DWDA 4CGUB 1JWMB 2I27N 4F33B 4Z7OB 5ES4B 5K69A 2ZXCA 3MRDB 4PG2C 4IBVA 4KGJA 2A6KB 4M3KB 3WIFA 1A6WL 3U9UB 1NCJA 1ZE3H 1I8LC 1K4CB 4QRPD 4CKQA 1CD1B 1IKNC 3CU1A 1ZY9A 4DUXA 2QPSA 5E7FA 5JORA 1OV8A 5GS1B 1AKPA 5JW4R 1WT5A 3L4UA 3QCUH 2AITA 3BKCL 4JHWH 2YKKA 5I8CA 3VXQA 4QXVA 3TBWA 3W9EA 4JDEA 1G43A 1ETZB 6FABH 3LEYH 1QLRB 5GZOA 4NC1C 1AGBA 2P7TA 1JXFA 5I1CH 1ET8A 5B39B 2OAAA 4OFPA 1Z3RA 3RWHB 3TA3A 3G6JF 2R8SL 4QRPE 2DQDH 4CUCA 4PJ9B 5C0RH 2YPKA 1X6NA 1USQA 1E3XA 1N6QL 3SYPA 3ILPA 4XPFH 2A1WH 4LSRL 3RVUD 4LESA 5IMOA 3VXPB 4TNEA 1RPKA 2GAZB 4HU2A 4MX7B 2MOVA 4BH7A 2YQBA 4KJPD 2VW4A 4KKNA 2BY1A 3HFML 1XGYH 2PTVA 4QRTB 5EBLA 5DO2C 4DH2A 1OHZA 4JQIA 5LGYA 4NQDE 1ZS8A 1JVLA 1DBMH 4AW4A 4TTGA 1KTLB 5E8DL 1A3QA 5LXGL 4CU6A 1DCEA 4FA7B 2GIMA 4JFDD 1E4XL 3LEVL 4HUMB 4JKWA 1F90L 1OAJA 1FFNA 2XZQL 1PPIA 1ZCRA 2VW6A 5IP4A 1P2CB 3V9EA 5A6MA 1J8HA 3QJRB 1CD8A 3OAYK 2VR5A 4KZDL 1UXSB 1ZA3A 3Q5TA 5F1NB 2XTJB 2OL3H 1ZLWH 2DWSA 4OJCA 1AQ8A 4HUWA 4J6RH 2Z92A 1U8HB 4UOQA 4MCYB 2N01B 5EUKA 4NQCD 5DCCA 4B6ZA 4HUXA 2C8NA 2EH7H 2EAEA 1QFWI 4JM2D 4NLAA 1REIA 4JFDE 1MEXH 1G7QB 4W81A 1W91A 3GSXB 3EYQD 5DJ6B 4Y16C 1Q9LA 4RMBA 1EZLA 4RQQB 3MACH 5C9KA 4MXQC 1OM3H 3DX7A 3PWLB 1F11A 5FM5M 3BYTA 2VZSA 4HIEA 4PFEA 1M7XA 3QORB 4PRBB 3TBCA 4Y7OC 4Y88A 4DO6A 2A74B 1C1EL 4XCEA 5F89B 1J12A 5SWZE 2NDFA 3JV4B 4N0YH 4NQCE 3V6OC 1BIHA 4UUJA 1FWXA 3NVQA 3ZDXF 3BAYA 3QJSB 3WEBA 3F7YA 4XTRC 2J1XA 4K55A 4MWFB 3LQMA 3B7TA 1T5KA 1GGIH 1WT5C 5A16A 3C6LC 4AY0A 3B9DA 2UWEE 2PWGA 1NBYA 4DEUA 4PRHA 1MLBB 4TUOB 3VFMB 4XMLH 4U2ZA 4ZFFA 5GZOC 4M8VA 1AZCA 1YEWA 4YPGA 1W80A 3QFGA 3EDKA 3H9YA 3TA3C 2DD8H 1E4XI 2R69L 1IQDB 2A77L 2ZXGA 5AALA 1F8TH 1S46A 1LK3H 2R9HD 2NT0A 3BH9B 3LMJH 2CA4A 3QSKB 1FG2B 5HHPB 2IG2H 3PDDA 4FX5A 4P4RA 4PV9A 1MREL 4Q52A 3FQTB 2X4QB 2OMUB 2D9QB 3F83A 4D8PB 1M9WA 4U3CA 1LD9A 4E36A 2GITA 3EOYG 3QIBD 5J1SC 3KBEA 4H44C 5AW2B 1G7PA 1ZVHA 4UOW1 3HA0A 4IGBC 4WJ5B 5IVZB 4EXPX 1RSYA 2X4RB 3RVVC 3QCVL 4D7BA 4JN1L 1WF5A 1VEMA 2OTUA 2QPDB 2Y36L 4JRWA 1F3DH 1MJUL 2PXYA 3D9AL 2VLKD 2YRPA 3P30L 1T03H 2VL4A 3E2HC 3SOBH 5HVGB 5JOFB 4PGCB 3P0VL 1MCPH 3U82B 3MCLL 5FYJD 1HEZA 1P53A 4LLAA 2AQSA 4GAGL 5IB4A 3MV8B 2BVOB 3FTXA 3NZHL 3FMGL 4XE5B 3TIEB 4EOWL 2DYPB 4EDWL 2IAMA 4O4YL 3IRPX 1PX3A 4JHAL 3V6ZA 1NL0H 3QQ3B 1PKQB 2NLJA 3MUGB 4XC1L 4WKZB 3DUUA 3I74A 4K9EH 3AC0A 2VLKE 3DLQR 2NXYC 5F72S 4AYDC 2LGNA 4BWUA 1AHWA 3RJOA 4F2EA 4Y2DB 5DS1A 2Z93A 4WHTA 4GG6F 5T1LB 5F71A 4DGIH 5CFAA 4FI8A 5CUSL 4F57H 1H0DA 2YFOA 3HG2A 3O4LA 1NMAL 3OZ9H 5AB9A 3CLWA 3NJVA 1XGUB 3V9CA 1BAFH 3BIKB 3TIDA 1AHMA 3BXNB 3UAAA 2LLNA 2WOBA 5I1IH 2GG1A 5ACZA 3E1F1 3GEFA 4PREA 3ZGHA 2PPFA 2YD3A 4HK3J 4CW1A 5HYQA 1X5AA 2BC4A 2QJDA 3GXFA 5FW7A 5KBKA 3V5DB 1HQRA 4MAYB 1IGIH 1L9NA 5AVQB 5T1MB 4ENED 3FB8A 1OD9A 2BSRB 4B9KC 1GSMA 1C5CL 4K94L 4PRDB 2V5RA 4QWWC 3OKYA 3TWYA 3LH2L 4KKAD 4P99A 2FQDA 3AADB 2NY5L 4OFVA 4GSDH 1JERA 4ODWA 1JZ4A 1E5AA 4ZW6A 1MCBA 3SKUD 2PMZA 1F5WA 4UIKL 5HGAA 3UGEA 3W1ZA 4I1PA 3OKMA 1T0NA 3FSWA 3VSVA 4PB0L 3BRGC 2AEIT 3VFVB 2EC9U 4X5PA 2NY1D 1S7UA 2X6VA 3WN6A 1N6UA 1XSJA 2WQUA 4AX3A 2HFGH 2XIDA 3FH8A 2Z8VC 3TLRA 1GGCL 1T21A 4WUUA 5BJTB 4DHLA 4MD0B 4RMWA 1NBZB 4F7CB 4QTHB 4L1LA 4HVBA 5I0VA 5JA8B 4JFUA 1SJXA 5C3LD 3CMOH 2PXYC 4HUNB 4PRPA 2AK4D 4NDMA 5IF0A 1GMIA 2GJ6D 2OMTB 3U4EA 4XI5C 4W4OA 5DRXA 1FHNA 1DSFH 1A4JA 5E2VL 5A2JH 1KBGH 3MRJA 4JY4A 4ZUWB 1YY8B 1ZV9A 1HXMA 3PWNA 3FCSA 3N42B 2TSAA 1SN0A 2AXGA 1AGEA 3BVTA 5TDNA 2K7QA 4PJBB 3FB6A 2HH0L 2IAMC 4K2UH 2ORBL 4Z9KB 4R26L 5EOCJ 1DQLH 1DSWA 1MQKL 1T66C 2VLJD 4N2BA 2DKSA 1WCBB 2DOCA 3CHXA 1R5WA 1JPEA 4LIQH 4G6MH 2OTPA 4O5LH 4LAJH 2TAAA 2GABA 5EUOA 4OUUA 4P9HH 1QSFB 3FSOA 1AHWC 1PJ9A 5EIIA 3B5HA 1BXXA 1MZYA 4Y9EA 3B2DC 4I3GA 2YAHA 3P40A 2YN3A 2J1KA 2QGDA 4U1MB 3KWUA 4UTAL 1AI1L 1L0QA 2P24B 5FGRA 4U1LA 4E41D 1QBBA 3U36B 4GXUN 4AV5A 3ME0A 4PEEA 1MCCA 4B7IA 5B38A 1OSZB 1J8KA 2R2EA 4NZUH 2VITB 5C08B 3FU3A 4FFZH 2VLJE 1R9FA 3ESNA 1MCRA 4WDIB 1OM9A 2AAAA 4Z7VF 1SLWA 4UQ3B 2P5WA 2DIBA 3NH7L 3NUKA 2CM5A 4U6VH 1XZ0A 3RY6A 4GB9A 4F2FA 4TVPL 3WU1A 3CVDA 2WYTA 4FJZA 4M1CD 1N0XH 2WQVA 4A39A 4E41E 3SE8L 4M43L 4G6AC 4O02B 3JUYA 4QDGA 1RMFH 2A4EA 2FSDA 3CHQA 1F3JB 5JR1H 2VDQH 2FR4A 4YPJA 8PAZA 5D7JB 2QQNL 3HS0A 3AUVA 3PHOB 2A9NH 1TJMA 3TJEL 4KI5E 1MCQA 1SLXA 3T0ED 3DVFA 4FXGA 1M71B 1UGNA 1UACL 3LIZA 3MLRH 3TNMA 2EC9T 2IOIA 2DQCL 3GZQA 5D1QD 4BM7A 4JR9L 4FHKA 1BIIB 3C5ZC 1DLHB 1KN4L 1KV7A 4M8QA 4NIYE 3GHBL 1VKXB 4XPGL 3ZTNH 2X6UA 2WXFA 1B4RA 3ULVL 4UB0H 3RUGE 4OF5A 1U4EA 3B5TA 4JNXA 5D96B 1JV2A 1BD2B 2WMPB 3CIQA 4W4OC 3T71A 4LVHB 4FABL 1JZ5A 2ADIB 2EZ0C 4LHUD 1NCBL 1YMHA 4IBQA 4R7DA 5E5UB 3UZQA 3MGAA 4KK8C 3UTSA 4F5CE 4FS0A 5DYFA 3UG3A 1M6OA 5I74B 5T1KB 1HXKA 2YOCA 4PRIA 1QA9A 1MFAL 5I9QB 4F9PC 1CWVA 2HX8A 4LSUL 1HESA 1B6UA 1AGCA 3KPLB 2VUKA 3LOWA 3DV6B 4AZUA 2EYTA 4B95C 1ZTXE 2X70B 5EZPA 1ZT1A 3K6OA 2A7BA 1HC1A 5FA4A 5IKCB 1VGEL 4L5FH 3SKNA 3V0IA 3VG0H 1IC1A 1QSEB 1SM3H 1YECH 3GZOA 3THML 2V5TA 1CYGA 1G7LB 1S3KH 3UBHA 1D6VH 3KPRA 2EYRB 3TZVA 1FORL 4XXCA 1UA7A 4RGNC 4ZD3L 2EO7A 1WSST 1YQVL 4NAMA 4U1GB 4B9JA 3NIDB 3LS4H 3GD1C 2CA3A 3HB3B 5F9DC 3MRLB 4A7GA 2X4UA 1FH2A 5D9SA 4NPYB 2CM6A 4EI5B 1AQKL 2X4OA 1HIMH 1XCTA 4LL1A 1RZJC 2CO6A 2EUWA 3O6MH 4DVBB 4L18A 5I76B 4L8DB 5D2LB 1F1AA 4TSAL 4HS3B 2QGBA 5CR8A 2VLRB 3BI9X 4BFIB 3ECVA 5L88L 3RY6C 2D0FA 1ADWA 5LNGA 2VT0A 1I3GH 1QRNA 3LX9A 3WIHA 4WSGA 2GPZA 1P4IL 4GS7C 3VMNA 3UP1A 2X2HA 2XLLA 4ICXA 4FP8H 3PGFL 2XG4B 2F7RA 3ZDYE 3G04B 5DMIH 3IS1X 1PSKL 1FNGB 1T89A 1XR9B 1LQSR 5KSBB 4YFEA 2ADFH 2WWKO 4Y19A 4TUUA 3IJ8A 4OCSL 3Q9PA 3ARDD 1QRND 3ILDA 4R4FL 4GKLA 2HT4C 4TQEL 1TDQA 3CLEH 2B77A 4FXGC 1F1DA 5FO9A 1UZ6E 3PDOA 1PZDA 4DN3H 4X4XA 3HI1A 2DH2A 1NIFA 4M02A 2WYZA 1OP5K 4H20L 3PHAA 1OTSC 4XO9A 3SE6A 3BOVA 1M7DA 4OD1H 5ADPL 5FYLD 3SE9H 3X2QB 2W38A 5KVGL 2ZZUT 2XQYG 5L0QB 1N8ZA 1CFNA 1COBA 1XCQB 4LCCB 3MNDA 1DCLA 3FQ4A 3GI8H 4QYOA 3JWOL 4LNRA 2VXUH 1KB3A 4XXWC 1INQB 2D3JA 4FN0A 5J6HA 1IQWL 3MJ8B 4FFYL 2FNBA 4G9FD 3N44F 5BXFB 3O6FD 1Z3GH 1QSZA 3X3GH 5I66A 1CK0H 2VWEC 5FGBC 4K7PX 3MFGB 3FRUB 2H32A 3U4KA 1CFBA 2Z31D 3KPSB 4E9SA 5FYLE 4F7KA 3VWJD 5LGHH 2H1LM 2R29L 4GJTB 1NCUA 4TPRH 3ZT5A 1HHHB 3D39E 3L9BA 3O8XB 3RPIA 1KGCE 2WOYA 3K2MC 1EDQA 4ONOA 2WXPA 2QQKL 2FO8A 4Z8FH 3VXOB 1UWXH 4DGVL 1KCUL 2AEWA 4NAQA 3TZVC 4G9FE 4GY4A 2VGLM 4OZIF 1GHFH 4Z7QE 5E4OA 2FEDC 5IHBA 5IBTH 2YPVH 5TPWL 2H2SD 1A6UH 3QFJA 4E68A 1T2QL 1PYWA 4BA8A 1DQKA 3MLPA 4UNVA 1D9KD 3WTSA 4L4VB 4TUKH 3TJHC 4G82A 3ZKSD 3VGBA 2P43B 2XWJA 1PEZA 3SDXA 5J0BA 1EANA 4I7ZC 1WA0X 3A0OA 2PTTB 3C5XA 2WLNA 4S1RH 4YSDA 3ZHLA 5JHMA 4KKQA 3QR1A 4OB5H 3K5RA 5D5ME 2NYYD 4R0LC 4RAUA 3UPCA 1A7BA 4MZ3A 2JJVA 1JV5B 1Z5YD 4P2OB 3PJSA 4U31A 5HDOA 2GFBA 2CQVA 5DURB 1YCSA 1D7FA 2AI0L 2J4WL 5JHDB 4A37A 1AG0A 1G0DA 1MIML 1T89C 2H0FA 4NWUL 4P8QA 7FABH 1TZIA 3N43B 1J1XH 1PTZA 5EU6B 5C0AD 4XBPB 2Y6SC 3ASWA 2VXQA 4PJ5D 4HOWA 1TQTA 1QEWA 4I0KA 4NXKA 1RK0B 4WV1A 3UBXG 5BUGA 4RFNB 3BVNA 3GSQA 1N9PA 1A6AA 2HUEA 4BJLA 1GOHA 1XIWD 2DBLH 5D4JA 5CCKH 3NP4A 4LLMB 1AFVL 3VXRE 5CLYA 5F1IA 3VRJA 2OZ4A 2BXZA 3KEHA 1IM9B 2VLME 3IJ7A 3OMZA 4RFOL 5C0AE 5J89A 1KTRL 4L0PB 5GS0D 1T22B 1JPST 3JWDL 4XVOA 5IIEB 4MA1C 1T3FA 1FZKB 3BUQA 4ZX6A 4N0UE 2Y1YA 2JQZA 5ICXA 1I9RL 4CRPA 4JLRB 3SD2A 2EACA 4OCRH 1DQJA 3R7RA 5EU5A 3CVHB 2GVYA 8FABA 4HC1H 4YXHH 1NCOA 2NTFB 3EFOB 4G8IB 3RWDB 3T0VA 1A2YB 5KYYB 1JRHL 1OTUD 4F2ME 1N12A 4OGAD 2NNAA 2Y5QA 5DJDA 5A7EA 4Q9QH 4UT6H 4JEGB 3MR9B 2VJXA 3US0A 5JDSA 2WUCH 4IIZA 5E6IA 3LKQA 3ARBA 1OARL 1AXTH 2VC2L 1FL5A 3FRPG 1IAIH 3VD4A 2DQHL 3MCG1 4ZDHB 5C0JA 2G2RB 5KANI 5LBSL 1D7BA 4Z6AT 1R24A 3C08H 1NGPH 1G9NH 4GW4B 4MNQD 2V17L 4NQXB 2IQAB 2VO8A 1RJCA 1JF5A 3HR5A 3PP3K 4NQSA 5IB1A 4X2UA 4TOYH 3T4AC 3MZTA 2ENYA 4WEBH 5I1GH 1S7TB 4JPQA 3F64A 1KWKA 1T5XA 3OKLB 3GPEA 1OCWL 3HI6H 4OCXH 4ZG1A 5TGBA 2HWZL 3OQ3B 1XGZA 1S7QA 2H7WA 5CEZE 2Q10A 4X6DB 5DQDH 1EMTH 2G5UA 4NUQA 5DFAA 4G3YL 4Z76A 5G4MA 4JZNA 5A3IC 2DM3A 1J1PL 1A1NA 4HHWA 4P04A 2OULB 5DGRA 4Z5RA 3BRFA 1NSNL 1HHKB 1TFHA 5FWQA 1T0MA 2LVEA 1JWUB 2IJ0C 4ZX3A 1JPTH 2APVA 4J3VA 3PQYA 5FLUA 3WS6A 1IEAB 4WV1C 3V79C 3PL6B 3NN8B 1UOKA 2R2BB 2J88H 3O3AB 4IRZL 4PVMA 4P23D 3W37A 3NEOA 3BJ91 4XP6L 3VD2A 3AQZA 1JRHI 3QJFB 1JK9B 2C5DC 2WLJA 4TV3A 5T3ZD 4DK6A 2N7SA 1RZFL 5LJYH 2HVKB 1OQOA 5DD6A 1OAQH 3CSTA 1HAUA 4K5LA 1CLVA 2R2HA 4LOUD 1MHCB 1DN0B 2YZ8A 5JIHA 1G0YR 5LCVL 5BS0D 3PWPB 3E6FB 5GJSL 5C07A 1ANUA 3N04A 5BOZG 3IDXL 3FXIC 1XGPB 2ZJSH 5AVUB 3W0WB 5KVFE 2FWUA 3BP5A 3SIKA 1ED3A 1ROWA 2QBWA 4MNGB 1OAYH 4QRRB 2PO6D 3RY5A 1EAPB 4X9GA 3IS0X 4JQVA 2F74B 3NA9L 4PJFE 4P2RB 4J27A 4AC4A 1OAKH 5DU7A 3LNDA 1MRCH 3UTPD 1K5NB 4FQQA 5BS0E 3WOVA 2MPVA 2DICA 3BJLA 4DAGH 1YN7A 3QT2A 3ARBC 4MJIB 4WO4D 4MSWA 4JHBA 1CFQA 1AC0A 3SDDC 1ADQL 2YGNA 3VRIB 1NAMA 2F54D 5FYKE 3V0GA 4ANWA 1UCBL 5IQ9B 1A7PH 1EQWA 3AG2B 2O61B 1A4BA 1RUML 1ITCA 3FT2A 4OKVA 5K93A 2EADA 1OSYA 1K6QH 3CDGA 4YUEH 2CNZA 2IIJA 2Y7QB 1BFVL 4ZSOA 4JFOA 3BH8A 3KLDA 2HRPH 2P42B 3TYFA 4PWEA 4M29A 3LH9A 3UTPE 3ZTDC 1IJNA 4I18A 1PG7L 4OZ4B 4C4BA 4HOMA 3S37L 5C6PB 4MJ6B 3VB8A 2VAJA 3LZLA 1D7DA 3KYKL 2VH5H 2E47A 4BKLA 4IDJH 3BZEA 5ALBH 3KL5A 1QUNB 5EOTA 3MGOB 3RL2A 2OSLA 1WLHA 3ELQA 5DUBA 4MA8L 5ILTL 1DVQA 4FQXA 1THCA 2GBTA 1OCZB 5MENB 2BY2A 2BNRA 2R1WA 4JUSA 1UD6A 3NPZB 1PFCA 2NOYA 2QV4A 4OIBA 4JPKL 4HK0B 5DZOA 3U7WH 1WIOA 2OXGA 2QQLH 5DHXB 5I2IB 3DBXB 2KPNA 5IZ7A 1X5XA 3QHFL 3WS6C 5CN2A 1S7RA 2EE9A 5E6SB 4F7PA 4PS4L 3F04A 2ZNWA 4PGDA 3PAZA 3P73A 4BFGA 1KELH 1Y6KR 1U8LA 3QNXA 4R97B 3ZYOA 1S7VB 3AY4A 3WKQA 5GRXG 5DZAA 3DI2B 4KFZC 5BMFL 4YHLL 4LASL 5HHMB 5C0FA 2AABL 2QV2A 1JZ3A 2WINA 3BP7B 1U9KA 2J8UB 4QNPF 1TPXB 4POYA 2F58L 2EDNA 1RIHH 4HJUA 4I0PD 4N0CD 4X5LA 4ZTEA 4YR6B 5DD5H 2YSTA 3C8DA 3EFDL 4NO5B 3UBFA 4ATTA 4G1MA 4OUOA 3QDGD 1L7TH 2ITFA 4QRQA 5I1JL 3NOIA 4TXVB 2OMZB 2FBJL 3RL1B 5DJXB 2B16A 5GGRY 1F4HA 1VLXA 1SY6A 1OTTC 1XD1A 3AQXA 1ZGLP 2ATPA 4RNRA 4HSAC 4DFIA 4QGTA 1VZHA 4RMUA 1SVCP 3D33A 4MLIA 1LO3H 2HFFB 1WISA 1CG9B 4TNWF 2Q7YA 2KERA 3HNSH 2Y07H 4JQIL 5FYKU 2QADB 3QGVA 4KK6C 2B15A 3FS9A 1V7NL 4MGXA 1QLFB 5CILH 1ID2A 4FJYA 1ZKAA 5GGQL 2JJSA 2WVSA 3A6BH 3QDGE 2NUTB 2R51A 2H1PL 1NZRA 1FGNH 3CFIC 3OR7A 1SJVA 2QVIA 4Q6IA 4KUZH 3RWJB 4F7EA 2NR6A 5IG7A 5EZJB 2AV1B 2H41A 5D4IA 5DQJB 2WZ5A 5A40E 3EDFA 3FQRB 2GCYA 1PQZA 2ZX7A 4U3HA 5TDOB 4E9QA 3MRMB 4HF5L 2OTWA 1OGTA 4M1GH 2A6JB 4OT1H 5JW5A 1KNOA 4M61A 3G5YB 5DHYB 2Y3NA 3MCYA 2QR0A 2X3AA 5T3ZE 4XBEH 4NUGH 4KROC 4XNUH 2GTWB 3Q44A 5CIPA 4YL4A 3DX2A 3G6JB 4L05A 1K4DB 3HVDA 4GPVA 4HIPA 1G4MA 1QI4A 3RGHA 3SBPA 5CBEB 3GT6A 4YIQA 4HG4J 2VKWA 2OL3A 3EBIA 4FQXC 2UUDK 4NO0B 3L5WA 2XN9B 4LDCA 5I24A 1P7QA 4PHXA 2O6CA 1OK8A 4PWGA 4RRPM 4WUKH 3QE5A 1FLRL 1U3ZA 3FO1B 1U41A 4IRSB 1ROCA 3FQUB 4K71B 2YEQA 4CC4A 4NO2B 2J5LC 4NSKA 5F7HA 3V5KB 1Y18A 1WQVT 4EDXA 4ERSL 2ZIDA 5KVEL 4CNIA 5C0NC 1MXGA 1NGWA 5HJBA 3RZCA 2CLZB 4KGLA 1XX9C 1HYSD 2XQYA 3GGWA 4XP4L 1KGJA 3GEWB 3AY4C 3HZKA 5HI3D 1BBDL 1WC7B 3K4AA 3OMNB 1HCVA 3VA6A 3WNKA 3ZMEA 3CZGA 1YYMH 4LPWA 3LHPL 4G43B 5BZDA 2I07B 1BMZA 3FPXA 2VLLA 3DX6A 1IB5A 5K9JH 1XH2A 4HMEA 3OXSB 1FLTX 3LN4A 1QBMH 4RIRB 1MAMH 3GSOB 4K7FB 1IGYA 1I1YA 2DKUA 4BSVA 2JQAA 4MCZA 1KN2H 3IB4A 3O9WA 2Q8BL 5IQOA 1JMZA 1S7SB 4QIRA 3DX1A 1TMCB 5GGUA 1PZ5B 3RLSA 5I5JA 1OANA 3T6XA 2OMBA 4XHJD 4GKOA 4XNYH 4LAQH 1BM7A 1KYDA 4AT6A 3DO7B 1TCMA 5GRVL 4M9OA 3P4NB 4KPHH 5F2FA 3D51A 5HVHB 2VR4A 2V2TB 4XBGB 3RGBA 3IU3B 5SWSB 3BYYA 3EGSA 4GAYB 2JJSC 1YMMD 3RIFF 1TETH 2WLYA 4KAQH 1NCWL 1FFPA 2NR6C 1ZWIA 1Z9SB 4D2NA 4N1CA 3ZDXB 2CUIA 3HE7D 4YJZL 2D2OA 5I0DA 2P9RA 2UXGA 4YGAB 5AVVB 4V2BA 4OCWH 4H0HB 3KYNB 2ZCZA 2JKJA 2EIKB 3HBPA 1K3IA 3ARZA 3U79A 5FIEA 5CWSA 1A4CA 3GRBA 1D6EA 3BUBA 1U8JB 3QW9A 1GTNA 3GMNB 3MRPA 3KHOA 3Q1EA 3BZ4B 4BK5A 4MMZC 4RGMC 2FQEA 3OPUA 1CL7H 4I1NB 2Y4SA 1ZGLM 1URLA 4F92B 3T4YB 3PPSA 5E1HB 4MVBC 1DL7H 5TTRA 3RBSA 4HEPG 2E6QA 4X5RA 4XP9L 1ZDQA 3UBXA 2B5IB 3QUKB 5LGKA 5F70A 3JTSB 5BPPA 2OJ1A 2SEBB 3CH1B 1W8OA 1VHPA 2AJZA 4FZ8L 2XV0A 3BT2L 4GIOA 3VUAA 1IBFA 2EVFA 4N0FA 3NAAH 3G9VA 5E1GA 4Y4FB 1G7HB 1RJLB 2COVD 3EZ8A 1KENL 3C6SB 1AZUA 1LNUA 4IEFB 3V4UH 2FX9L 2IEPA 1FNAA 1ZK9A 4K3JH 3BVVA 4V1DE 3WUZA 5DFVC 2IFFL 3BCFA 4JG1L 1BOYA 4Z7OE 3H0TB 3D3VB 1DQQB 4YNYB 4Q89A 2EDEA 4PJHA 4R5VA 3OKOA 2VAAB 4F20A 4M7KH 4J4PD 5C0CA 1U91B 3E9UA 4A66A 3C5SB 3QUZC 2QVFB 3ZKMD 3OWEA 1P6WA 3OGCB 3QUXD 4G7SB 2WLLB 2CDEB 5ERWB 4A63A 2DL9A 2AMUA 1FL3B 5I15L 2NNXA 4ZOCA 3O9WC 1OAUH 1RURH 2CGRL 2DEWX 4FTVD 2CLRA 4QD2E 4Y5XB 3ALXA 1GGUA 2FHFA 2VDKL 2NZ9D 3FRPA 3N6YA 4HS6B 5FOBA 1U8KB 4MS8C 1BQRA 3WENA 2NY4C 4MA7H 3FOMB 4NFCA 5F7AA 4GG6B 3LEXB 1XGQB 3MYZA 4QHKJ 3S96A 3ZY7A 1IIIA 5JPMB 4JRXD 4XVSL 1JZEA 2X4NB 1TTCA 4PHZA 4WGKA 3H9SB 1TJHL 3KL3A 4O2FB 3CFNA 4LBEA 4MRBA 1ESOA 3H3KA 4M1DH 2XTJD 1NDMA 4EEEA 5FO8A 1UUSA 3IFLH 2ZYIA 5DJZA 1ODUA 1SHXA 4GSXA 4EIUA 4AQZA 4WI9A 5GGVL 1MELA 1C8QA 2OM5A 3BD4A 3PUUA 1ACZA 4JFQB 3KPPA 3EG9A 3QEHB 4JRXE 1CLCA 1XTMA 5AEAA 2BVPB 4BK5C 5ISZA 1TYEB 2FYYB 4ZNCD 4FL4B 3OMIB 3HC3H 4UAHA 2IANA 3MRHB 3E8UL 2XTJE 1YO4A 4NNPH 5JQHC 1XF2B 4A1RA 4XOBA 3C87A 4MDJB 4RLDA 1A25A 1IM3B 3RFRA 1WWWX 1O75A 3QDJB 1PAMA 2XKSA 4LLUB 2ALAA 3OHXB 4JFYB 2DI9A 4JE4B 1MCLA 1XDTT 2YSSA 2W94A 3CZFB 4PWHA 1RZJL 3M8OL 2HJLB 5JO5B 4TLKA 5T8IA 3QYCA 5IFJB 2WLKA 2F0CA 2X4SA 3OQRA 3SDYH 3T77B 3U2SA 4N8PA 1BWMA 2Y24A 5BV7B 2NY7H 1EO8L 3Q43A 4KRPB 4WQOA 2UYLB 2AV7A 4BDVB 4AYEC 4OV5A 3IJSB 2FYVA 2NTSP 3VTTA 4PUBL 4NYLA 2JXMB 2G9HA 2GBUA 2Q86A 1IC7L 3K2UH 2BW4A 2BO0A 4BKTC 2BOCA 5AOMA 3E9TA 1BPLB 1GYUA 1HQ4A 2X42A 3QDMB 3X14A 4FFZA 3NSFA 1N7ML 2OMXB 1SEBB 3EF7A 4F8PA 3JZYA 4KJYA 4UU9B 5HBBA 4LKXB 2H45A 4N2LA 2I7SA 1NC4D 3QPXH 1I3UA 1AVAA 4PS3A 3QZWG 2K6YA 1B6DA 4UQBA 4B9CA 3FSAA 2Q2LA 3WEAA 2I85A 1PKOA 1BJ1J 2FECL 2ICWA 4NT6B 4AYID 1A66A 1U8NA 1FDLL 3SE3A 3MXVL 1MSPA 3FDWA 1XL4A 3OAUH 5FECB 5HHOB 4HGWB 1KGWA 2ZF8A 2HKHH 3H9HB 2F1EA 3KJ4C 3L4YA 4HSQA 4Q2ZB 5DJAB 2EIMB 1I8IA 4KTEL 4DQAA 1SLVA 1JZHA 3DDFA 1CXHA 3OG6B 5D71H 2UY6A 4ZFGL 4ABVA 1KYFA 3LSOB 2FH6A 3B9KA 5FS5A 2WUBL 1JXGA 2JJTA 4OQTH 3DMMD 4P2YA 4P2QA 3MRFB 4AIEA 7TAAA 5EDXA 3CQQA 1S7WB 4Z7VB 1XFPA 3TBSB 4HJEA 4OZFG 2EIZB 3H55A 5FKPB 4C56A 5L2JA 5DMKA 4JMXA 3GYRA 2BM3A 2DQ6A 3WKML 2DQEL 5SX5H 3T2NL 5AVYB 4G8GD 1EAOA 1N3NB 4Y2DD 4I85A 1QPXA 5T1LD 1X5FA 1HKLL 4IOSD 5I6XB 5T33H 3F01A 3GSWA 4PQXA 3I3BA 3VXUA 3K8LA 1KEGH 1KT2B 2PF6A 3NJNA 3MV8E 2C7UA 4S1DC 5H2BA 3BO8A 4F27A 5FB8B 2GC4C 2V7NB 1KIQB 3LNGA 2VM4A 3HCVA 1PKQE 2EEAA 3L3KA 4F15B 4ISVB 4OV6F 5BZZA 3DSNB 2HN7B 4BQ6A 4S1QL 2HPOA 4L3CA 4JKPL 4L0ZA 3JYCA 1RCYA 4OSUL 3WNMA 2CJUL 3CV5A 4B50A 2A83B 4Q6YA 5AW1B 4P9HC 5MHSD 5LNDA 5T3XE 4MAYD 5I1HL 3WIHL 4X7CC 3FUDA 5GSRA 2OMVB 3UGUA 3I02A 3DUSB 2DQUH 2NNFA 4HBQA 5IJDC 1NICA 1M1XA 4KVCL 5DTFA 1VFUA 3VFWB 1G87A 4FQIL 4QHPA 4GBXA 4H0GA 1B4JL 1FC2D 1VPOH 3H6JA 3MLTA 4ZFZB 3W11D 5HD8C 4CN6A 4DQOH 1KC5L 3U0TB 1CLZH 4QOKA 1I8MB 3M1BB 4IIQC 4ZS6D 3NZ8B 4HT1H 3BSGA 2XZAL 2MMXA 3H42H 4YXKH 3TC9A 3AQDA 3RU8H 1HI6A 3MV7D 2EVHA 2DIAA 3QQ9C 4DPCX 3E6HA 4GUPA 3IDGB 3ARVA 4NQDA 1B0RB 5JYMA 4NKOB 2ZOLA 2ENPA 2X6MA 3LS5H 1FJ1B 2VZ1A 2DJ4A 1CXFA 4DZ8A 3JWNH 2WXMA 5EO1A 1Q90A 1JXKA 3UACA 3DV4B 3G6AA 3B9KC 2PW2A 5K39A 5KJ7E 2AJXL 2PYFA 2J43A 3FFOA 2RMNA 4DP1X 2X7LA 3FFDB 3OX8B 4NQTA 3S88H 1LL1A 4LKCA 2AKRB 3SQBB 5JHLL 1IBHA 3DJRA 2YUXA 3ZQXA 5AAWA 1RI8A 4DGWC 1F2XK 4PLOB 3VYPA 3PWJB 4ZPVB 4UNIA 4UQ2B 4Y5VB 3K6DA 3BAJA 3F00A 3GXPA 4RAVA 3KEDA 1NBCA 2XA8L 1D5BB 1CIDA 1FO0H 5FPIA 4KJQD 4NXSA 3GUTB 2XYCA 2ZX9A 3MRRB 2GJZB 5DD1L 4C57C 5I18H 1G5GA 4HJJH 4PJBE 1NIAA 4IW4C 1GC1H 2UXFA 5ENWA 5SWZA 1V3MA 2OSYA 4LL4A 2X1OA 5C08D 3SGDH 4ZO8A 1HHGB 3GXMA 1KCBA 3ZQWA 4BBWA 4YHPB 2XWBA 2Z4QB 4ZW5A 2YMOA 3RNQB 2UZIH 5D1XB 1QSFE 4AYFB 4LLWA 3A3YB 2DMBA 2WVUA 2MOGA 5B3JE 1VFMA 1TZHB 5EZIL 3ZLQC 1DE4B 3P4MA 4MKMA 2VDRL 2NT1A 4JFTA 2DAVA 5D7SH 4AC2A 5K33A 2R59A 2X0WA 2VDNL 5CSZB 5B4MC 5C08E 1M53A 2JELL 1WFOA 5ICYA 4GBXC 3N44B 2P47B 2ENSA 1SFDA 3OJMB 2AJVL 3GMMB 2VDPL 2CBTA 2VXQL 4LCWB 3SJVB 2FJUB 3T2OA 1R3JA 4GEJA 5C7ZA 3TF4A 3BHBB 2PLTA 3RG1C 2QSTA 4R8WH 2UV3A 3DURA 2XXFA 1KTJA 2PN5A 2CIKB 4FMVA 2HX7A 3ARRA 1BV8A 1O9WA 3X1BA 4ZMLA 3L3JA 4Q4EA 1E40A 3VA2C 1SJHB 2A6IB 2XU9A 3GTNA 3MA7B 5ID0B 2ILLA 4OZIB 3BQUA 1HT6A 4ODVH 1ZRUA 4H25A 2DLTA 1VFOA 3D1MC 2FRGP 1Q94B 2AEPL 2R0WH 4YHMH 3QG7H 5E1AB 4QRSB 4M7ZB 1CDCA 1JWSA 2CBPA 4UYPA 5I8EA 4LEXH 4UM8A 4I2XB 1CICB 5HHVL 5T1KD 1FIGH 4M7JH 2YPLB 1S9XA 2FATL 4KZEL 1ZGLB 1XSIA 3L9RB 3F7VB 1ES0B 2FB4H 3OKEA 2EXWD 4HEPA 3T0AA 4FXKA 2CJTA 2ZP8A 1P9MA 4I0CC 5IJKA 3F12A 1XCXA 1XAUA 2I60L 5C8JB 1L9MA 2KQNA 1BD2E 2DQJL 2FO1A 1MCHA 2XTSA 1USZA 4F3FA 4E2OA 5DD3H 5CEXB 1JDDA 5JW4Q 3D08A 2EYSB 3NEEA 2YAOA 2ARJB 2QQQA 2CK0L 5AAMA 4G7VH 4HC1A 4DK5A 4NGHH 1FAKT 3CFJA 2WBKA 3SBWA 1K8DA 3NABL 1NWOA 4UT6A 3UJTL 1OAXL 2KLRA 1RU9H 3F5WA 4JM2F 3OPZH 5EU7C 5I1LA 3EYQC 4N2FA 1QSEE 3UCQA 5HI5C 5CEYB 4Z3JA 1RV6X 3ARGA 2V7HA 1A3LH 4OIIL 1Z9PA 3O11B 3WFDL 5JXEA 4GOSA 1A1MA 3TT1H 3ULUE 5FK9B 2ICES 3D25A 3SPCA 3SPVA 1IIKA 1KJ3L 2WCGA 3L9EA 4ODHL 3NIDE 4L1SA 2UWEF 1IGJB 3O0LA 5F96H 1QACA 2VN4A 5E1QA 3RRQA 3UIZA 5F7UA 3U30B 1S9WB 3U9WA 3D50A 4E9TA 3SE4A 5L2KA 4OTXL 2G5BB 4TRPH 2E9BA 4XNQA 4GRLA 4IBYA 2ZOKA 1WIUA 5D2LE 4EBQH 1AQMA 3ATBA 3SEPA 3VE0B 2WQWA 4QXWA 5E8OB 5HVFB 5HXMA 2A0LD 3FO9A 3LKNA 1JN6A 2VLRE 1DVFA 3S3DB 3EXJA 3MFFA 4OKDA 1INEH 1QVOA 4XH2B 3WL9A 1PLCA 3WBDA 4AIZB 3BCDA 2FNWA 3OJDB 4JPVH 3LKSB 1VJSA 1RZGA 3IMRA 3LDBC 1YNKH 3DX9B 4YDJB 5KSBE 1FVDA 3CAFA 4ODTL 4AVJA 1J9RA 2R9HC 4OLUL 3CH8A 4HXAL 3U1SL 5B1AB 2PP8A 1IGFL 4NAJA 1YPZB 2E27L 2V8LA 1YEJH 4XVJH 3MROA 1MRFL 2A9ML 3DRTB 1RZQA 4HIJB 4GG8A 1UJ3B 2MSPA 3WFBL 4R7VA 3KPTA 4N2AA 1ZLUK 2XHNA 4R5XA 5I1AA 3QIBC 3FUMA 1YYLL 3RVTC 3ZIMA 4DT2A 1QW9A 3HLAB 3KPSD 4NO3A 5LVEA 1RJZB 4AKOA 1TVBA 2QKIA 3L1OH 4FXKC 2WBJD 2MOQA 4KJWD 2VXVH 5IJKC 1PDKB 2R7EA 1RFDL 2ZAIA 4L2LA 4PB9L 5TQ0L 4JDZB 1UZ8B 1A6TA 1AD0B 4HWZA 4LLYA 4WFHD 4GMSL 2VMJA 3NTCH 4HH9A 4FHBD 1T20A 2ICEB 4HX1A 2X4TB 1ET7A 4IKNA 4N22A 4XWGL 5AENA 3IJHA 3FU0A 2D3LA 2ADGA 4OLVH 2W59A 3WE1A 3KPSE 2N56A 1YNTF 4XX5A 2ZXWB 4LP5A 5EBGA 2L0DA 4KMLB 4KKLD 3KPMA 3SBWC 3QPQD 4YHOH 3WI9A 1HZLA 1JNLH 4N24A 3QEQD 3HZVA 3KXFB 4DKDC 3B4NA 4WFHE 1KJMB 3KPOA 5FV2A 5CF3A 3T6QC 1EEZB 2NX5A 3Q8AA 1ZLSL 1BAGA 2B8OT 4QI3A 2ESVB 3W9DA 1JNJA 1BW8A 1I7UB 2E0PA 3GUFA 3HPLA 2AJ3A 5JHDD 4J2XA 4L4VE 3QZWA 3PWVB 2LLLA 3U25A 4GRLC 5DVPA 2AS5M 4R2GB 3Q6GL 4LCYA 2NX5D 4PYHA 1U2HA 2YJQA 4FLQA 2E4TA 3WEXA 3MV9B 3FOLA 4JY6B 4DFHA 1JCVA 1M7IB 1DVFC 2DKMA 3CX5K 5DWPA 4FE9A 4Y2LA 1Z5LB 3HC2A 4ONHB 3O2WH 4YHKH 2EQDA 1NFIA 2NDGA 3DETD 4N1EA 4ENEC 4AZ8A 3GLEA 3L4CA 3U0WH 4Y9BA 4BUHA 5JHDE 2IFGA 4LRNH 4LT7A 4KKAC 3SB3A 1XQ4A 5EU6E 1IM9D 1FNEB 4YWGL 5JLZB 3IPEA 1GYAA 2KMWA 3IDMA 4JG5A 3VD0A 1BLNB 5EEUA 2EVGA 3KS0H 1TO4A 3P9LB 4OZFA 4UQAA 4PJCA 2OV0A 1IC5L 2Z0BA 4XBMA 4AVHA 5T5FA 5C09B 5KVDE 5EIQA 1SY6L