3ZDWA

Substrate and dioxygen binding to the endospore coat laccase cota from bacillus subtilis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Dioxygen Binding to the Endospore Coat Laccase from Bacillus Subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords COTA LACCASE
total genus 144
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA02
4CSPA 1YLBB 5I5IA 1CYWA 3FPXA 2HZHA 4YVUA 1UATA 4G72B 2PPAA 1AG0A 2A3TA 4DP1X 5I6PA 2RACA 2HLEB 2FQDA 1J5CA 2P80A 2YAFA 1E5YA 1T5KA 1W8EA 1E30A 3SBQA 2OV0A 2X88A 2R7EB 3CVBA 2YXWA 1NIDA 4F2FA 3IEAA 4KO7A 2JFCA 1AOZA 1QLEB 2FNWA 3X1NA 1R1CA 3OMIB 1CYXA 2PCFA 1AS6A 2XV0A 4WKXA 3TASA 4A2HA 2PCYA 2BW4A 1GYCA 2XU9A 2YAEA 1BXUA 1AQ8A 4HCFA 4E9SA 2IDFA 3ZIYA 3AW5A 2QT6A 1NIEA 1ET5A 2H47C 4GP8B 4N8UA 3UAEA 4A2EA 1JZJA 3OMNB 1BQ5A 1BYPA 4BXSV 1PY0A 3IE9A 5I6NA 4YSOA 4P5SA 1JZFA 1SDDB 2XXGA 5D4HA 4AZUA 1JZEA 2XYBA 5B1JA 3FSVA 4A2GA 1JZGA 1CURA 1HAUA 2YXVA 5PAZA 4GY4A 2QPEB 1IC0A 3QJUB 3KW7A 2J57A 4DP8X 2BP8A 1J9QA 5AZUA 3OM3B 5D4IA 2UX7A 1AZUA 1E67A 2W88A 5PCYA 1CUOA 2Q5BA 3T9WA 1SFDA 3H4FA 3TBCA 1GR7A 1JOIA 4YSDA 2ZXWB 4E9VA 3T6WA 2AFNA 1OE1A 3NJNA 1PZBA 2YAMA 1AR1B 2NRDA 1NPNA 1JVOA 2YAQA 2ZONA 2FT6A 1AS8A 3ABLB 5ANHA 5TK4A 1L9RA 2FWLB 2FT7A 1PCSA 3QJRB 4JHUA 2PP7A 1V10A 1J9SA 4NERA 1KCBA 1XMEB 2XX1A 4DPCX 3IN0A 1I53A 3N55A 1A3ZA 3NJGA 4W1TA 4YSQA 5B1AB 4GYBA 4BWTA 2UXTA 1WA0X 4HIPA 1GY1A 3G5WA 1SJMA 2WSDA 3NJJA 3BVDB 1NIBA 4MFHA 1PLAA 2FQEA 1IKOP 5E9NA 4DP9X 1RCYA 2IH8A 1ILUA 3AG2B 1W6WA 1TEGA 2Y69B 1NINA 3QJVB 4A2DA 2PPEA 1JZIA 3WKQA 1OE3A 2VSKB 5I26A 1WS7A 4ZK8A 1PLCA 1L9OA 3FU8A 3KW8A 3C75A 3TA4D 5B3SB 3H4HA 3S8FB 3FQYA 2UX6A 1BQRA 4DPBX 1M57B 3FU7B 4G7RB 3UACA 1AACA 2DYRB 3NSFA 3PCYA 4DP6X 1GW0A 1JVLA 3IN2A 1F56A 1A4CA 2PLTA 3FSAA 2IH9A 1KCWA 3WNJA 1GSKA 2IWFA 3NSCA 1BEXA 1FWXA 1DYZA 1NTDA 3UGEA 2YAPA 2XUWA 2J55A 4DP0X 1DZ0A 4X4KA 3CDZB 3NJLA 2BP0B 1ETJA 3ASOB 1OV8A 3FT0A 2IDTA 1NIAA 4BK5C 4BWUA 2DV6A 4FA7B 2DWTA 9PCYA 6PAZA 1A65A 2J56A 3GYRA 2BP0A 4HCGA 2J5WA 1AANA 1RZQA 2CJ3A 1J9RA 3H56A 1PNDA 2GC4C 2GSMB 3NSDA 2MRYA 1KYAA 2UXFA 4YL4A 2OJ1A 4KO5A 1AIZA 1SF3A 1ZIBA 2PP8A 2EIKB 1TU2A 5AKRA 4K9JA 1ADWA 2DYSB 2HRGA 4L0PB 1PZAA 1KBWA 1N68A 2I7SA 2VN3A 2GBAA 2BW5A 2GIMA 1J9TA 4UF7C 3RYMA 5I6MA 2DY2A 5AFAA 3QQXA 1ZPUA 3SBPA 2BHFA 4DP5X 3DKHA 3S8GB 3FYIB 4KOBA 2AZAA 2ZWNA 2VW4A 2LLNA 3FU7A 3ZDWA 5D4JA 5I6KA 2JKWA 1GY2A 1HAWA 4M4RB 4DP4X 1ASPA 1PAZA 4YSRA 5I5MA 3BQVA 2FJSA 1OCCB 3T6ZA 3CZUB 3T6VA 2H5UA 2PPFA 1L9PA 3DIVA 3NT0A 3X2QB 2BO0A 1VLXA 3QPKA 1ZV2A 5I28A 2MTAA 1WA2X 1XB6A 2UXGA 1SDDA 3FQ1A 1MZZA 1V54B 2IDUA 4HCIA 2BWDA 1V55B 4Q89A 3OD3A 4HZ1A 1L9SA 4E9WA 3S3DB 3AG4B 2BP8B 3ASNB 3OQRA 1KDIA 2IDSA 1ASQA 3U25A 2B3IA 3AG3B 2CALA 5EHFA 3V9CA 4G70B 5I5JA 1OF0A 3S3CB 4YSEA 1SFHA 3UAAA 3NJHA 2YARA 1PF3A 2XV2A 2XWZA 3X1EA 1PLBA 4BWWA 2HX9A 3EF4A 3FYEB 5B1JC 3MX0B 4GP5B 3UADA 1WAEA 4P5RA 1FFTB 2BZCA 2GI0A 3SQRA 3AZUA 1GS8A 3FSZA 2P80D 4QLWA 1N70A 2XLLA 3IBOA 2EINB 3PAZA 2Y1AA 3X1GA 4DP7X 4YVNA 4PCYA 1AZNA 1CC3A 1KV7A 1WA1X 2GC7C 5F7AA 2TSAA 3PAUA 2VW7A 3ABKB 3FPYA 4AKOA 2E86A 1OCZB 2CCWA 1MG3C 5I6OA 3NJFA 1RKRA 4QKTA 2BZ7A 4CSZA 3ABMB 4FAAB 3CDZA 4F7KA 1KDJA 7PCYA 3CVDA 1OOWA 3WKPA 2Q9OA 3L45A 4YSUA 4YSCA 3HB3B 2AZUA 1X9RA 3N2JA 3AG1B 1JXGA 4A67A 1BYOA 1WS8A 5A7EA 1IBYA 4NB7A 1URIA 1XB8A 1J5DA 1NDTA 2CUAA 1KGYE 2AVFA 1ID2A 2BWIA 3OMAB 1JZHA 3FS9A 3SBRA 3WG7B 3PLYA 5FC9A 1AZCA 3EH3B 1QNIA 4E9XA 2ZOOA 3QJQB 1TKWA 2YAHA 2CAKA 2PP9A 1ET7A 1L9QA 1KBVA 2EIMB 2N0MA 4ENZA 3V9EA 3X1FA 4BDVB 1NWOA 4EF3A 2JXMA 3NYKA 1EHKB 5B7FA 4KOCA 3JT2A 1M9WA 2CBPA 4AKQA 2WO2B 2OCCB 2W8CA 2XVBA 2FTAA 1A4BA 3NSYA 4GP4B 1OCOB 1ASOA 3WI9A 4JHVA 2B08A 1IUZA 2IWKA 2FT8A 3GDCA 3S3BB 3NJMA 4G7QB 3HEIB 3ERXA 1OE2A 2I7OA 3FU9A 4KNTA 3PXLA 2AANA 3GXUB 3T71A 4HALA 7PAZA 4YSTA 4KO9A 4TXVB 4E9QA 4UANA 4KNSA 4WTQA 5B1KA 8PAZA 1ZDQA 1JERA 1ZIAA 4JKNA 1JXDA 2EILB 4E9TA 5IY5B 1AG6A 2VMJA 5B1BB 1BXAA 2HX8A 3NP3A 2PPDA 2FQGA 2QDVA 3FSWA 2XV3A 5B7MA 1GS7A 4YSSA 1A8ZA 5B7EA 1AZRA 1AS7A 3JTBA 5TK2A 1ET8A 1ILSA 2GHZA 3QJSB 2HXAA 2VW6A 1MDAA 2HX7A 3PAVA 1NIFA 1SHWA 1NICA 1BXVA 2GB2A 2UXVA 1SHXA 2X87A 3UABA 3TBBA 4G7SB 1X9UA 2PPCA 1RZPA 4BXVA 1W6LA 1L9TA 4KO6A 4Q8BA 2H3XC 1BAWA 3T6XA 2EIJB 3WIAA 4W9ZA 3ZX1A 4KNUA 4A2FA 1GS6X 2I85A 2IAAC 2IWEA 3X1BA 6PCYA 3AY2A 1IBZA 3NP4A 2FQFA 3CVCA 3NJKA 2XXFA 1MG2C 3FQ2A 4DPAX 4YSAA 2XX0A 3NJIA 3D12B 3DTUB 3WNIA 4E9RA 2IDQA 1A4AA 1M56B 4BDVA 2VSMB 1PZCA 1EZLA 1HFUA 4AKPA 4F2EA 4HHWA 1PMYA 4DP2X 4RH4A 3PPSA 1AAJA 1AZBA 1SNRA 4YSPA 3EH5B 1NWPA 2HRHA 3ABGA 5F7BA 1ZDSA 3CG8A 1B3IA 1NPJA 1SF5A 4G71B 4HHGA 4AI7A 1OCRB 1TEFA 1E5ZA 3ZBMA 4HAKA 1E65A 3QJTB 1XB3A 4A66A 2YAOA 1JXFA 3EHBB 3TU6A 2QPDB 2VM3A 4N4YB 4A68A 2WO3B 4AX3A 1QHQA 2VM4A 4M3HA 4NAJA 1FA4A 2DWSA 3MBWB 1PNCA 1MZYA 1BQKA 5I6LA 4E9YA 2QDWA 4PAZA 3EH4B 4UAHA 2TSBA 2YQBA 5LDUA 4GXFA 2R7EA 1NZRA
chains in the Genus database with same CATH superfamily
3NFPA 3JQOB 1KYDA 1QLRA 3CCHB 1E6JL 5HHPA 3SKNA 1DLFL 4RDQF 2PPAA 3Q3GA 3O41B 2HLFD 3EO0A 2H3NA 5IB5B 4EI0A 2NQDA 5BV7H 1T5KA 4WK2B 5D1QA 1AYRA 3ZTJH 2ARJQ 1UADC 2X88A 4F9LC 1X44A 4F27A 3V4UH 1NIDA 3MLRL 1LQSR 3SDXA 4F2FA 3KYAA 1MIML 4MAYB 4D0BB 4FNLH 5T5NG 1SXZA 1AOZA 1JZ3A 1NFAA 4XOAA 1AS6A 1U4EA 1HNYA 1MI5A 1Q8MA 2ZWYA 3OAYH 5E8NB 2FB4H 3TX4A 4HS3A 1TZGH 2VXVH 5DD3L 4EIZC 4QUOA 3ZIYA 4V33A 2O6FA 1HXKA 3GMPB 3QC5X 3MRPA 3WTVA 4X2UA 3CHXA 1VGKA 3H55A 3BFWA 4MA1C 3U6XA 5LVEA 2X70A 3EFFB 5E9DE 3TYFB 3BOVA 2KT6A 5INDA 3WKMH 3BKJL 1I9IL 4JFWA 1JZEA 2KMWA 1WIPA 1E2WA 4EOWH 2CK2A 4GMTL 3U6RB 1CDHA 5DC4B 2BRQA 1NDMA 2HFGH 1GHFH 3CZGA 1LE9A 4IQHA 3GBMH 4N2GA 1YEKH 3VFTA 4S2SB 4ONOA 2VXQA 5IEHB 1A6VL 3TN0A 2UX7A 4RSVA 3JTTA 2J8OA 1E67A 3REVB 2F54D 5BO1L 1N7ML 3T9WA 4PY7B 1G9MH 5FV1L 4KHTL 3SN6N 4WO4B 5CEZL 5EO9A 1A7QL 3VXSB 1F6FB 4V1DA 5IVXE 1E4XI 2DQEL 2NY2B 2C4FU 2ZXWB 3IDGA 3RWFB 5I71B 5HJ3B 1OSYA 3RTQD 3V6OA 4K55A 4ODXA 5IM7B 2CR0A 3HHSA 1FZJA 5JR1H 5DMKB 3Q43A 4WWKC 3WD5H 3WHE0 3PS6A 5BV7L 2HJFA 4PRIA 5T8IA 3NCYP 4ZXBB 3UYRL 3VTAA 4JDZB 3GIZH 4NFCA 4N2FA 3QQDB 1QACA 2ADFH 3PREA 4HUUB 2K7QA 3QORC 1M71A 1PDKA 3GJFH 3RFRA 1CFNB 3ULVE 4LT7A 3CLEH 3QXTA 4CSTA 4P2RE 2XWXA 2ESVB 4NUGL 3ULVF 5KBNC 3MJ7B 3OKKB 4BA8A 4FADA 1X5FA 1LP9F 3N55A 3MV9A 3OJ2C 4LHUA 3NPZB 4QIRA 2FBRA 4CU8A 2ROYA 5DEFB 1ZT4B 5AVYB 3TCLB 2MNWA 1NCCL 3FN0H 1PY4A 4F15C 4NM8H 1X5HA 3N04A 1I7TB 5DJ6A 3TPUA 1T20B 5CNHA 5E9NA 4WV1A 5A6LA 3WJMA 6FABH 3RGBA 5FGCB 1PPIA 4POZC 2VZSA 1H3TA 3F2LA 4JPVH 2OJEA 5KVGE 5BXFB 1M2VB 4D9QD 3U36B 5F3HB 3PWPB 5FYLD 3S5ZA 1A1OB 5D93C 4FNQA 1JWSB 3LB6D 3H6JA 4PJDB 3J7HA 4GI6A 5DHXB 5FECA 4YO0A 1G6VK 2BVQA 3NPSB 1JV2B 2JKIS 1BQRA 2CRYA 3SDDB 3DK0A 3AY4C 4PREA 4PW4A 5HI4D 5LGKA 4JM4L 1B0RB 4OCRL 2NY3C 1RIHL 3LPFA 4TQEL 1FZOA 4JFPA 1S4IA 4Z5RB 4WHTA 5I18L 1X7SA 2IADA 1UC6A 5FA3B 2DMGA 2ATPA 3FB6B 4OV6F 4F8PA 2X4TA 4NWUL 3IYLW 1FDLH 3ARDB 4NRXB 3PWJB 5E9DA 3WNJA 4B9KC 1BEXA 2YOAA 3G6JE 1ZLWH 5D1QE 1KC5L 2WWKT 4Y4KA 3VGGA 3WBDA 1F11B 1P4IL 4UV4H 3MAWA 3LH2H 3V0WH 4BK5C 3Q3GB 5I9QC 2BSSA 2DV6A 1QNZL 3H3BC 4TMPA 3VFSA 2CBTA 1I3GL 3BLBA 1TMCB 4OQTL 2WUBH 4DUVA 5E2WH 2W95A 3PAYA 5MENB 3CFMA 3CH1B 3UTQB 3KBFA 3P9LA 4IOIA 1VADB 5F9OL 2C9QA 2F7IA 1HU8A 4Y9FA 5AW2B 3TCXA 3WIFA 1HDMA 3C08H 4UT6H 5AYUH 3RPIA 2E9GA 5CLXA 4ESKA 4JFED 5IB1A 5TD4A 3SGKC 4HUVA 3FFCB 3FU5A 3QQ9C 5IP4A 5DRXA 3S5LB 5CJOL 1W72L 2WCSA 4ABUA 3GMPA 3SPVA 1DBAH 1DQLL 5AKVA 3K6SB 1D5ZB 1ES0B 3T1FB 4OFQA 1AIFB 4H25B 2UVFA 5C0DA 1Z1WA 1P7KA 4ZSOE 3E8UH 2BW5A 1J9TA 3IB4A 3MRKB 4AQ1A 2E56A 1ORQA 3OR7B 1BVNT 4U1SB 1LXMA 4Z7VF 1K6QL 4MCZB 5I1JL 3DX1A 2F0CA 2IAMA 2ZX5A 3FJTA 4FQXB 4O58H 5BZZA 4H1LG 4TUOA 2A4CA 2H45A 2FX7H 3OLDA 4G1MB 1OGTA 5IFHH 4QTFA 1CN4A 3ILDA 3LZOA 2NNAB 1JGIA 1GJWA 3NG5A 4JY6A 4WFFD 3HRZB 4CUCA 3AS3A 1JGLL 1L9PA 1N4XL 2H5UA 1WIOA 3JV0A 5D1ZI 1MJJA 5JHLL 1MLCB 2VAAA 4PRIE 4FLRA 5HYSB 4RFEA 5EU3B 3SDYL 3NCJL 2VO5A 5E4OA 4CN1A 4HJSA 3DBXA 4GRLC 4CU6A 4H2CA 3FONA 2N59A 4I8DA 2P5EE 1GAFL 3X12A 4F7PA 3OD3A 3QR1A 4G6KH 3TBYA 4J7RA 1I8AA 2Z93A 4LIQH 1MWOA 4OGXL 1IM9D 3O9WA 5FGSA 4NO3A 3UG3A 4ZW3A 1XSOA 2OSLA 4M4PA 3FBQA 3MRMB 3L4ZA 1H3PH 3HZVB 3BAYA 5CSZB 4QRUA 1FVDA 1FN4A 1D2PA 4BWWA 2HX9A 4OUUB 3SHSA 3NSJA 3KR3H 3QO0A 3FK3A 5TDPB 3OG4B 4MJIB 4ONGL 5I8EB 1CT8B 4NC1E 5DZJA 1BJMA 2WD0A 1JV5B 1BLNB 3CFDB 3QB7C 4HFUH 1F6LL 2J71A 2GSIA 2VKWA 3KL0A 1BIIB 1CVSC 3IBOA 3IM1A 5I1LA 1MQKH 1ZXQA 3H9ZA 4PWKA 5E70A 3NJVA 4DH2A 1E9OA 4DP7X 4FI7A 4JPIA 4LPWA 4YPJA 1X7QB 4IDJH 4YQXL 4ACTA 1H3XA 3PP4L 4O58L 4PJ5B 4DF9A 2CCWA 4H44C 4XNBA 1IJNA 5A1AA 3O2VH 4QKTA 4CSZA 1JGUH 1K8DB 1IL1A 3II1A 2LLLA 4XHJD 4F7KA 4JR9H 4RWYL 4KH2A 3CC1A 2ADIB 1DLHB 3BZ4B 2EXTA 3TJEH 1ZLVH 5FW8A 4OTXL 2YPLA 3BH9A 2FJFB 2A83B 2EO7A 3RBGA 2OMNA 2XKNB 5T3XL 3MTXA 3NH7L 4HJUA 4Q6IA 2F08A 2XG5B 3WXWL 1NC2D 1ETZA 1I3UA 1XD0A 4R0LC 3QXUA 1DDHA 4FQ2H 2UWEA 3IGUA 4ZDHA 2QVTA 4HU2A 4D9RE 2XJKA 4OJEH 4QJ4B 1RFDL 3O3UN 4YHLL 4DT2A 1KBBA 1MCCA 4L8CB 5MP6H 1N3NB 4D8OA 2CR3A 3OZ9L 1F2XK 1W8OA 2Q76B 5T33H 4PGDA 3GPSA 2ESVD 4M5TA 1H9DA 1D5BB 1K2DA 1CXKA 2IBGA 1L0QA 1RIVL 2JCCB 2A1WL 2A0LD 2D7QA 4OZHB 4XCYB 4EI5D 2ZXGA 1T2JA 1XIWD 3VWKD 1HDMB 2X38A 1KXQA 1P4LA 4AKQA 5L9DH 3T3PB 4EN3D 2W8CA 1BF5A 5MP6L 5C0CB 3KJ6L 4NO0B 4Z76A 4MXVF 3HN8A 3P9WB 1CICD 1ZVHA 3QNYA 3CUPA 4IBYA 3WO3B 4R7VA 3D1MC 2X3BA 4G7YH 4AIXA 3ZKMD 4KFZC 4FQJL 2DQCH 4EZLA 4JFYA 1F58H 1HL4A 3FMGL 4CJ0A 5L2JB 3QAQA 4W81A 2XTLA 1OE2A 1DUYA 4PP2B 3V4VB 5C09D 4AG4L 2D03L 2WYTA 4WHYG 3UO1L 4GI9A 5AW5B 2M8XA 3GRBA 1DBJL 3UC2A 4FQXA 1OP3K 5DRWB 2WXGA 2WQ8A 3LSOB 4J4PC 5A40E 4BFBD 1BJ1H 3HN3A 3P2TA 4MQXD 5A3IC 1NOLA 3A4DA 5I2IB 3DO4A 4E9TA 1AG6A 1C5BH 2D31B 2B77A 4TOYH 2CPUA 1G7PB 2FQGA 1XX9C 3VMOA 3WLBA 2QKIA 2VN7A 4JO5A 3IGFA 5KAQG 5CZKA 1N6QH 3QIWD 3G5VB 1OGSA 5HI3C 4Y2DC 3RWCB 2PTTA 5KSAC 4MA7L 1JJUA 3MREA 2N7SA 3TBBA 2NLJB 4BXVA 2YN3A 5CGMA 3N43F 4LCUA 2X2UA 2YMTA 3K5SA 1ZS8A 4APQC 4KVPA 1NBVH 3L1EA 3BAKA 2IWGA 3QHTC 4ELME 3HC0B 2I07A 5FAAA 3BD5A 5FM5O 3E8VA 1E3ZA 4V1DB 3NJIA 2C3GA 2G5UA 4HG4K 5F7NC 5KVFH 3N1MC 4LP8A 2PW2A 3IJYB 3FXIC 2VO8A 5CCJA 3GNML 1VCAA 4N2EA 5JOFA 5F0JB 2DQEH 3H2QA 5IQNA 1LD9B 2XQBL 3UTZB 1XGRB 2EDLA 4U1LB 4IIZA 5DUJA 4AJ0A 1OB1A 1GSMA 1NA8A 3GUTA 4ES8A 1IC5H 2ITCB 1B3IA 1TNNA 3E2HC 4AQEA 1BQUA 2DEYX 3APFA 3L7FA 2DLEA 2SODB 1OCRB 3H9SE 5C0EA 2Q1EA 3TN0D 1JK8B 3PFUA 2BNRD 3QDMB 5JW4R 3PWPD 2V2WB 1Q9OB 1BBDL 4GS7B 2O5YL 3LH2L 3HLKA 4Y89A 3R1GH 3DRTB 2EZ0D 4Y4FC 2C3VA 4TVPD 3D09A 5FM4A 1F0LA 2FGWH 3LKQA 4S2SA 1MFMA 2YPLE 1X4YA 2XIDA 4F9LA 4F7EB 4M1CC 4B5EA 5C3TA 3LH8A 2VQ1A 5E7BA 2W91A 5IHZB 2D0FA 3GXFA 5IHUH 2TSBA 5FHAH 3AC0A 3MLZH 3KS0J 5DWUH 2NXZD 3ZU8A 1T2QL 1A3RH 1YMHA 4H1LA 1MFUA 3DO7A 4F57H 2X4OB 3C09B 1IEBA 3A6BL 3K3QA 4UM9D 1K3IA 2AHIA 1ZVNA 2ENJA 3NCWA 3VW3L 2QPUA 3WE6B 1Q1JH 2DD8H 3QR2A 2DLFL 2X4UB 3L3HA 1KTBA 4AC4A 25C8H 4N25A 4GMSL 4NN7C 1AGCB 2AJXL 4PCTA 2L7JA 2UUDH 3AXHA 1L3NA 3PWJA 1EAQA 4X5WB 3GIVB 1P9MA 1YEDA 3KWUA 1R9FA 3EBGA 3P30L 1ACYL 3V0EA 4BA0A 2FWSA 5J11C 3PWVA 2HFGL 5DA0B 1PY0A 2MOGA 3GGWB 2F1BA 3JWOL 1LWHA 4M00A 4FXKC 5CZXC 3WELA 3LNGA 3U4BL 3UTPE 5C2UB 2EC8A 1AGFA 3HG1A 1LE9B 2XPGB 4G5AA 4MMZB 3BUPA 4GRWF 2RIKA 3QQ4B 4HUMB 3BDYL 2AJSH 1WZMA 4ZMYA 4GRMA 3ILPB 4NWTH 5C71A 2KQNA 1AJ7H 5CMAA 1URLA 1P1ZA 1BZEA 2ZOUA 3FUEA 5DUML 5E6RB 1AFVH 1FG2A 1TJHH 1U58B 3AQXA 4XI5D 5DFWH 5IW1B 4BFOA 1OLZA 1F97A 5F9JA 3ULVC 1GCFA 1IBGH 4XPGH 1SM3H 5HYJD 4W4OA 3DMMC 3BVWA 4K3JL 3M45A 1TR7A 4OLXL 4XCEB 3U4KA 1G9ML 5IW6A 3DGCR 1AHWA 3MRGB 3N41F 1SXSA 2BDNL 2AFNA 1OE1A 5J0BA 2XY1A 5DJYA 1B2WH 5ADOH 3T65B 3Q6GH 2O1AA 3IFNH 4PTTB 1AR1B 1NBVL 2NRDA 4M9PA 4HUCA 1AQHA 1QWHA 4LLVB 5CLTA 5CEYA 3OKOB 2APWA 2D7NA 3QGVA 5EIIB 5HDWA 3WIHH 2J43A 2AJZA 2J25A 5ESQA 4JZJC 3CD4A 4FLHA 4IM8A 2MKLC 3FHAA 2NCMA 1I1RA 1BF8A 2UZYA 4CDGC 1Q0YL 5F7DB 2QHLA 2XA8L 4ZOAA 3ZL4L 1TITA 1T1ZB 2H2SC 4LAJH 2UY6A 4W1TA 1LO0H 3MRJB 5CSGA 1C5BL 1GYVA 1IVLA 3L48A 1FG9C 1ITCA 1MRDL 3US9A 3MCKB 4TUJB 2A73B 2QVMA 1H0DB 3DXAA 5IBUG 3O8XC 3VGAB 4F2MB 3QYMA 3FFDB 2P3YA 2WYHA 2GFBB 2WLNA 2PR9A 2XICA 4QOKB 5ALCL 1AH1A 5CUSH 3ULUH 3MRKA 1I85C 2PETA 3U0WH 1WWAX 3WKNA 3DDFA 4WEBL 4KKBC 4H26A 5DEJA 2EDOA 4KZEH 1F4WH 4LK4A 4ZD3L 1OW0A 3HC4H 1JPGA 3NIFB 4B0MM 3EBIA 1PLCA 4L4JA 1R3JB 2F8IA 4PREB 5LQBL 3SDCB 4LDEB 2ZX6A 5D1XB 3V5HB 2Y5TA 3KW8A 5IVZA 3TA4D 3WUWA 5J4MA 2OAAA 1OGTB 5AVVB 1BIIA 4M61B 3OQ3B 4AITA 1QVOA 1MF2H 5AG8A 1DVTA 5C0FB 3ARQA 3U0WL 3HZ3A 1BV8A 1H6UA 2NPLX 1X7TA 1Y6KR 4I2XB 2K8QA 3JWOC 3L4VA 3Q01A 2OMYA 1E27A 1JZDC 3CMGA 3G04B 5GJSL 5J1AA 1MJ8H 2HT4D 4CAGA 3LTVA 1AGBA 1OSZB 4LSPH 1XH2A 2R51A 1ZHLB 1GZQA 3MV11 4RESB 1INQB 3TF4A 4HD5A 3KDMA 1OARH 2CSPA 5HVFB 4QRRE 1R5IA 4MLSA 3K0YA 3GZKA 4P57B 2J56A 1U8OA 1BAFL 3RX9A 3QNXB 1QA9A 1RZQA 1TG8A 2HVJA 4JGNA 2CJ3A 3VTMA 3A24A 4O2FA 3MGOB 3VGAC 3HN5A 4N0FB 2HFEA 2CJTA 4HIEB 1Z9PA 4GH7B 4ISVA 4U1HA 3X11B 3DMMA 3V52H 3CWGA 3CHSA 4OTXH 4FFVC 4PUBL 4OIBA 2AK4B 4FC3E 1AGEB 1XGQA 1TJGL 4W9HC 1P69B 4Y5XC 5IMKB 4E41A 4A7QA 5EPMB 4ODUB 1X4ZA 3BPOC 3M17B 5DC9B 4NZDA 4PJ5D 3KJ4C 3WS6C 3EOYG 4M6OH 2R0LH 4OD2A 1NMBH 4GSRA 1RHFA 4RGMB 3SKUD 3VU1A 3U9WA 4LASH 3BQUB 4UF7C 5BS0E 2E7LA 1BBJB 2QMKA 1SJHB 3SYOA 2NW2A 4FXTA 2ZCHH 1HZKA 1OAZL 1PQZA 4OLWL 2KERA 4FEIA 3DGGA 1JZ2A 5LXVA 1KIUA 2AXFB 1KTLB 1SEQL 3ZTJG 1UUNA 1UM4H 4DP4X 2A4ZA 4LVHC 4WI5A 3X3GH 4FYQA 4ZTOH 4WQOA 1KELH 4HFUL 4N8VG 4LLQA 2IANA 2VDPB 2X6AA 5H4YA 5DYOB 3DIVA 3DV4B 2O6DA 3RVUD 1UZ6E 3DV6A 2NY0B 3ARXA 1O9ZA 4N90E 5TQ2H 1DEEB 1F4YH 2EXSA 3FUFA 1XEDA 5K9JL 3NACH 1OTSC 4Z95L 4ECNA 4WW2F 1H3PL 5D1QB 3OAZK 4WO4D 1ZT1B 3ECWA 3MSPA 1SY6L 1WT5C 4ODVH 4XWGH 4HK3N 3SKJH 4TYUA 2P8LB 3RGVD 2EYSA 4PTTA 1UOLA 1IE5A 2X4QB 4PWGA 4WW2B 1F58L 2Q7YB 15C8L 1ED3B 3R8QA 4PRBB 1CF8L 4PWIA 5HGAA 1V7NL 1MPAL 3H9SB 2Q76A 4DN3H 4IKKA 1OT1A 5ESQB 1NBCA 3KM1A 5KAQF 1XTMA 4G8FB 4TSBH 4UQAA 2UYLA 3EF4A 4I13B 5DI8A 2X6BA 2IXQB 4JJ5A 4AGPA 2C26A 1CLYL 1NGPH 5FCSH 3PWPE 1E5CA 5KJRH 2WLKA 1DVZA 4DGYL 2K4WA 3WNPA 1KGUA 4QLWA 5MENE 3W5NA 5D2LB 4U1KB 4HH9A 3WEMA 2AJUH 3DO3A 3U1SL 2QFPA 1SOXA 3CJJA 2ZZUT 2XZCH 4Y5YC 2JKTM 3VA6A 3IFLL 4HK0B 4UOQA 5F7AA 3PAUA 5SV3A 2X6UA 3ARGC 3ABKB 3IFLH 2P43B 2UWEF 3ZSTA 2ADIA 2XJLA 3MR9A 3MUHL 1K9TA 2WIIA 5CGTA 4ZX3A 3Q8FA 3SE4C 2HKHL 4QY8A 3IFOB 5FXCH 3QA3B 1NL0H 5HI3D 4PJIF 1EEUA 1U8LA 4U7SA 3RB7A 3THMH 4JAMB 1DCEA 1UD5A 1OB1B 2VDKH 2NT1A 3OHMB 1KDJA 7PCYA 1E8ZA 2VDNH 3WKPA 3HTLX 4GW1A 4G80A 4ERSL 1AMYA 1FZJB 1JUFA 4LSQH 5ICZB 3L2MA 4IKNA 2A9NH 4UCFA 3GINA 5E00B 1EFXA 1KJMB 4WNSA 4XP1L 1MOEA 3RHWK 4PG2A 4LL9A 3HS9A 4JDVB 3KPSD 3ZDZB 2VRKA 4GAJH 3H2WA 1WS8A 2AQSA 2WY3B 3VI4F 1YUHB 4NPYB 2LABA 1IC5L 1URIA 3VFUA 2YPKB 2DQJL 1ID2A 5JHMA 2V7NB 1AGBB 1MJUH 5IROC 1T2XA 3BIKB 1JCVA 4ZUVB 4PJHE 1CBJA 5LGYA 1WWWX 4UMGA 4K94H 4OJCA 4UNVA 4M7LH 5LBVA 1O7VA 4UINL 1L9QA 4L3EA 4E41E 1IVTA 1JYNA 1JGVH 1YC7A 4J3OC 2VABB 4WY7H 4Y2LA 1JF1A 2J88H 3RVUC 3VFOB 5D1ZA 3DVIA 1H8LA 3BRGC 4AK1A 1MHEB 3U82B 2QPSA 4WV1B 3KR3L 5GGRA 1UACL 2G4EA 1SEQH 3OKNA 4ZYKB 2I32A 1G0DA 3TIDA 4NRYB 4P2OC 5EA0L 1EXUA 2KI6A 5SX5K 3MV8E 4L29B 4ANXA 2M83A 3U7AA 5I74C 4JM2F 4OGXH 3RDTD 4GG6A 1S5IL 3ZRFC 5I1EH 2EO1A 2MTPA 3BJLA 4GIPD 4TOYL 3B5GA 4N2NA 5A16B 3Q5OA 4JPVL 4A7VA 5DHYA 1KJVB 1DBML 4HOZA 1A25A 1E5BA 1TQBC 2V37A 3SOTA 2O6CA 3N42B 1A6VH 4JGJA 5HGBA 1M71B 1PDKB 1YEDB 2P28B 2OFQA 3V7AE 4KRPB 4XP5L 5EB9A 3ZTCC 3DX2A 1G4MA 1YNLH 3PWVB 3ME0A 3ZDYE 3GJEB 4UT9A 2I9TA 2XZAH 4FJZA 4PRNB 5DS1A 3UBFA 4BGLA 2OMTB 3LIUA 4DKTA 3SD2A 3OR6A 2Z3FA 1E9PB 3H85A 4F58L 1IAKA 1U0QA 5D72L 2F8XC 3SZKC 4YWGL 5HI4C 3TIEA 1I3GH 4BSVB 1Z9SA 3WJMB 1I1FB 5I1IL 1AZVA 3MRRB 3N91A 2H3XC 4POUB 2ZF9A 2AMGA 1LWRA 1R33A 4U2YA 3CN4A 3IGAB 3D51A 3FCTA 1YMMB 5D7JD 1S7WA 2A6IA 2JF1A 4X98A 1NMCC 4ZNCD 3NGBC 3RWGA 2BS9A 1U95B 2XDHA 4MCNA 3D18A 1K8IB 4TL5A 5IGXH 2E46A 2O93L 3CSBA 1IFHL 4PR5B 3RB5A 3FB7A 2ZAHA 3CFUA 2F5BL 3KPLA 4QRBA 3TF7C 4CL7A 3ULAB 3L7EB 1UKQA 2X28A 4HHGA 3PQYB 4IGBB 3FTXA 1S9VA 2GK2A 1E5ZA 1WC7A 3LPWA 4HUUA 4IRZA 4HUWB 3UAFA 4WLCA 4R90H 2WYIA 5E0FA 3DLQR 3CFJA 1MXGA 3L3DB 4AYFB 4PGBA 5F0PB 3RZCD 4U33A 5E08H 4HQQL 4L3EE 2LAGB 2QPDB 2VLKA 5I1GH 3D8MA 2BNQA 3AFLA 4FXGC 2XXCB 3M86A 2E9JA 4U2ZA 4A68A 4GPVA 4CKQA 2O5ZH 2R4RL 2ZD0A 2N1KA 5EBMA 3RQ3A 4FTVE 4E9LA 1CD1B 4M6NH 4NXKA 4HWBL 4X4YB 4MZ2A 1PEWA 1JUFB 2N7AA 2X6VA 3FB8B 1SLUA 5T5NF 4Z7UF 4NP4H 1H5BA 2KC0A 4Q56A 5EIIG 1YNTF 3EUUA 4JL1A 5ITFB 5D7LD 3BT2L 1XF1A 3FPXA 3QHZL 3VG9C 4BFFA 3L3OC 2X5PA 3QZWB 4YZFE 3NZHH 2OR9H 1P5UA 5J12C 4ZSOB 3AROA 5E2UH 5TDPA 3C8DA 3O3BB 1M2OA 3H3KA 1B2YA 1E6JH 1FHGA 2O72A 3T8XA 3KNBA 4NX0A 4IBUA 4U6XB 2JFCA 1JZ8A 3B8YA 3X1NA 3QDJA 1MVUA 2ATPB 3FB6A 4XNYL 1A6PA 3U9UA 1THAA 1CXHA 2PXYA 2YJLA 4UOZA 2PCYA 5GHWH 4WWPA 5C8JB 5KBDA 1F90H 1MCOL 5DZOA 5DLML 4BH8A 4HVBA 3RJOA 4H8WL 1J48A 2KDYA 1T21A 4UMSA 4Y7MA 2DICA 3FRUB 3HPJA 4LCWE 3REWA 2MQ0A 2AQQA 2YLHA 1XCXA 5AVWB 1X6NA 2D0GA 3LZFL 5GRZA 2MJWA 1KPRB 4A37A 4P5SA 4FQLL 5B22A 4GMTH 4ZAKA 5D4HA 1A66A 3KPRA 4HCRH 3MRHA 1CLYH 5CP3H 1YN7A 3WNOA 3IFPA 1R3IH 4AMKL 4LQFL 1KSRA 4PN6A 3D9AL 4YFDB 3QJHA 4PHZA 3SDDD 5IFHL 3VXPB 2WGNB 3VFWA 5AZUA 3EBAA 4OCLC 1SJXA 4HUVB 4DN3L 2R29L 4NZJA 1YMME 3B2XA 3QUMA 4HSCX 5DJAA 1RUQH 5PCYA 1XD1A 4A6YH 1GXEA 1S7QA 2XN2A 1LHZA 3MV01 4TLSA 2OYKA 3PPEA 2M26A 4Z0BH 1FLTX 1T1XA 1U6AH 2CG9X 1JV5A 2NX5E 3B6SA 2C3WA 3JWDL 3CPLA 4P5TD 5GGUA 3AGVA 1Q9WB 4GSQA 4JREC 3VWKC 1OIOA 3GRGA 3PJLA 3KCPB 1M3IA 4DVBB 4A1RA 1A7NH 4N8VA 3GGWA 5E5MB 3RKDC 4F3FA 2AJZB 4L18A 4AWJC 1YEGL 4X0KB 3MV7D 1NPNA 5HY9A 3P4MA 3BWUF 2YAQA 5DUBA 5F1NB 5C3LD 3WNNA 1S78C 4YBQD 3MV7E 5HHXL 3ARZA 5BZWB 3BHBA 4QHKI 4DN4L 3SGJC 1OT4A 4YX2L 3BJ91 1N5YL 3KL5A 5HDBE 1MLCA 2WLLA 3KYMB 1NEUA 2XZZA 3MLWL 4ISVB 4MYWB 2KZKA 4J5VA 2OSXA 4ZS6C 2UZXB 1CLVA 2JB6A 4CMHC 5BOZG 4HIPA 1QUNB 1MCPL 3VFNA 5D7HA 3QQ3A 2WC7A 4N0YL 2EZ0C 1R34A 3SPJA 5IB3B 3C09C 3V6FB 1COBA 4M6ML 1FVCA 3H1ZA 4JFDA 5GGTA 3V7AG 1E4WL 4NKMA 4HJTA 2HRPL 5LN4A 7CGTA 2F7RA 4G7VH 4HUWA 3ZUCA 2DWEA 1NINA 1YCSA 1N3NA 1RIHH 4P5KB 1OE3A 3TOPA 3S2CA 2VZTA 1SQ2N 5D2NE 4BZ2L 4FLQA 3UBXI 1L3WA 4PJCA 3T3PF 1CT8A 1J5OH 4NAMA 4XOBA 2RR3A 5DMIL 1N64H 3MBEA 2X4RA 5FPIA 2AK1H 3PCYA 4FA8A 2JLPA 3CLWA 3S34H 5DTFB 1GW0A 3TO2B 3UGUA 1F56A 3WEXA 2PLTA 3G6JF 1XDTT 3NSCA 1M7IB 3SDDC 3TJPA 1CE6A 2MEJB 3UGEA 2FUTA 5DHMC 4GAGL 2CRMA 5D5MF 4K3HA 4EDWL 1U8OB 3ARUA 3JSSA 5L8JB 2IDTA 1L6PA 4N22A 4P05A 2VE6B 3GJFA 3ARTA 3FH8A 2X9YA 5I8KL 2ZUTA 43C9B 5JW4N 2LU5A 3FCSA 3V6OC 1UURA 2G2RB 4P06A 1N67A 5AL0A 5EEXA 5BRZA 1PX8A 1ONQB 2YPLB 3B1UA 3BH9B 3V5DB 1J9RA 3POCA 4KH9A 3HI6H 4PJIB 3DHUA 4F15B 3L7FB 1NFKA 2ZOLB 2XHNA 5T1LA 1SF3A 4N5EC 3VCLA 2IH3A 1B4LA 2UWEB 4HBCL 4J4PD 5LBSL 2APBA 3BFQG 4AQAA 1QFUL 4F37K 5J3HC 1UGKA 3CN1A 5L7XL 2ZCZA 2Z1KA 5D96C 4UOW0 1RJYB 1MFBH 1GGCH 3V6BR 4M5ZL 4Y1AB 3HZYA 2CUIA 3LZLA 4RQQA 5AW4B 3ULUE 1Y18B 3FNKA 1J11A 4MJJA 3MMEA 4UT9L 3CE1A 3JVFC 4F1ZA 3ZL4H 3FRPG 1LTXA 3Q6FB 4RDBA 1WLHA 2ZUQB 1G7JB 3GS7A 5F21B 2EDRA 4EN3C 3QPXL 4YDVA 4GT0A 4CC0A 5I5MA 2X40A 3MUZ1 3SKOA 2NY7L 4EI5C 2OSYA 3VDBA 3VGFA 4ZFOL 5DCCA 3GLAA 4NC2B 4OCXL 5AAPA 2JMRA 3QSKB 5D70L 2XETA 3CPLB 2GJZA 4K7PY 1S7UB 2Y24A 4O51A 3T77B 2ZPKL 1F11A 4IBVA 4CMMB 2IBZY 3GF8A 1PLGH 2MPVA 1DUZB 2XZQL 4NQCD 3LPGA 35C8H 4J3WA 3OQRA 1EJOL 3LSOA 3O3EB 4JKMA 3EYSL 2E6PA 1U42A 2VDPH 4KMLB 4AYSA 2A74C 1DBKL 2B3IA 4CSSA 5DI8B 3K71A 3RG1C 5EOTB 4JY4A 4LOUC 4XPBL 3OKDB 2LU7A 1FYTB 1I1YB 1I9JL 4PJBA 2WXJA 2CKNA 1Q90A 3MLWH 4XC1L 5F7FA 5LNEA 2I26N 4MNGB 2XRAL 1F42A 3OR6B 4AENA 2BS8A 2D0HA 4OJFL 3SGEH 5C2BL 2K3TA 4ZX4A 5ITBL 3RFZB 3HIZA 1QLEL 3HAEA 3NCMA 1D5ZA 1ES0A 5CU9A 1M3JA 1MUJA 1QW8A 1RJLB 4HUKB 4F8OA 4GIAA 3CC5A 2EINB 4LPXA 4S1SL 5KJ4A 1IGTA 4F7TB 5C1MB 3MR9B 3GSVB 3OR7A 1IZKA 2ZSWA 1JRHI 1CC3A 2M1KA 3GMOB 3O3AA 4PCYA 4QOKD 1DO6A 1UWYA 3GD1C 3TZVA 3R7RA 1JI1A 2DQUH 4MDIB 3L1FA 3COOA 1UZ8B 1SOSA 3LB6C 3QIUA 1XCQB 5GJTL 1Z0NA 3QNZA 2ED8A 3U4EA 4PRBA 4KJYA 4JG5A 1QRKA 2HWZL 4TVUA 3CH8A 2NTFB 5D1ZC 2YBRB 4N2HA 4EMZA 4YDIH 2VDOH 1QYGL 2LU3A 1ZA3A 4G8AC 1JVKA 4YSUA 1RZJL 4U4BA 5L88H 3SE9H 5IV2A 2BSDA 4G1EB 1JI2A 1IQDA 1X9RA 2JJTC 5BUAA 4KXZH 4G5ZH 2E0PA 2BHZA 4RZKA 4IOFC 2EYTB 3Q48A 4F57L 2MQGA 3A6BH 2Y2TA 4YR6A 3HG2A 4K9EL 1Q9LA 1ZE3H 2CM6A 2ZP8A 4YK4C 4GKOA 4B9ZA 4OCSH 1GVIA 2WLIA 1TU2B 5C6PB 3MHZA 4QRTB 3QZMA 5DR5H 3SBRA 1UVQA 5FC9A 2OR8A 3SSGA 4PG9A 3TH4T 4ALAC 4XN5A 1XCTA 1QTYT 5SWZA 4NGHL 1FRGL 4HBQA 1T22A 2R23A 4JHWL 4X98B 3DX8A 1ET7A 2F54E 3QDGA 4QNPF 1KBVA 4X4XA 4X6BA 3R1GL 5EC1A 4GAYA 5F9JB 4F8NA 3I6SA 1U8MA 4G9FD 4NRZA 5B7FA 2E7DA 2HKFL 4H8WC 4BFRA 3O6FA 3BRDA 3LZPA 1FCGA 4MRCA 4H1LB 5ANMA 1TJMA 2BK8A 3RZCA 3P0YL 1YZZA 1QMUA 3A21A 2K6YA 1EANA 5C0JA 4N3UA 2C3XA 5B39G 3LS4L 4HT1L 1J5OL 5C0CE 3KGTA 4XP9L 2VDQH 3SJVA 3TURA 1S9WA 2DMHA 4JHAH 4MA8L 2GVYA 4PHXA 2VN6A 1EJFA 4KNTA 5CZRA 3SB3A 5ECJE 3QHFL 2E5EA 2DQGL 3QH3B 5FO8A 2K78A 4Z3IA 4MBRA 4M7ZC 3QJFA 1YJDH 3VQ1C 2JVUA 1UH3A 4H4NA 8PAZA 5K1NA 1B90A 3SPIA 1JERA 3IDYB 1OTTC 3W1ZA 5D7LA 1R3KB 4N9GA 4AYBA 4DGIH 2VMJA 1Q72L 1ZLVK 5TDOA 2FD6L 3EJUA 4JB9H 1OXYA 4RAVA 1A8ZA 3C2SA 3LIZA 5EORL 1UT1A 1AS7A 3SDXE 4XNUH 1MH5A 2HAZA 1ZHBB 4RIRB 5GGTL 1IRAY 1KWGA 1BWMA 4Q7DA 4P8QA 4XCNB 3DJTA 3LN5B 2CLVB 4LSTL 3MTRA 2X87A 3IMWA 1JPST 2UXVA 2WBWB 3OXSA 5KVMC 2OI9B 1BVNP 3HBPA 4N6RB 5I6XC 4N0FA 4TLUA 5IB2A 4BQBA 2I85A 3NOIA 1PX3A 3T2OA 1JPGB 3BE1L 4G6FD 3NP4A 4YSAA 1EBAA 2AW2A 2JJUA 2JLLA 1OAQH 3WNIA 2L7UA 4GQZA 2GPZA 1RMFL 5JMRA 3HE6A 4KDTA 3U2IA 3GJEA 4Q9RH 1I7TA 1WAAE 5FWRA 4GO6B 4ZI8A 1ZT7A 3C5SA 4I4WA 5T3ZL 3SQBA 2EEDA 3ULUD 1WAPA 3ZMRA 2Z34A 3QCUH 4NUMA 4ZRGA 1BBJA 5IQ9A 3QO1B 1EUUA 4QGYA 1TNMA 3O9WD 1KIUB 2XWRA 1I1CA 4J6IA 4HPYH 3WS6A 2X4SA 5C0GB 4AEIL 3NTCH 3OJMB 3LZNA 5JQ6H 4DAGH 3I3DA 4GG8B 3TU6A 4NHUA 1QFWL 3L3OB 4AMWA 2DJSA 3WN6A 5JYMA 1CGXA 3EOAA 1BECA 2DDQH 2Y1ZA 4R4ND 5E6IB 4NSKA 3VRJB 3L9YA 5SWSB 4I0PA 2DDQL 4KJYB 5TDNA 2GYSA 3MBWB 1UD2A 4LLWA 2OK0H 2GQHA 1NGYA 2VDMB 1MCSA 5JIKA 5BZDB 1RFDH 2P42B 4N0UA 5ITFA 1OWRM 2WHVA 1NCDH 3US1A 2Y7QA 2BZDA 1G7QA 1NZRA 1R4XA 1CYWA 5GRUH 1LEGA 3MNVA 3QFDB 2X1OA 2QPFA 5L0QB 2ZNXA 3DPDA 3O0RH 4YHIB 1Y07A 4O02A 3WD5L 4QHMB 3VFTB 2NY5C 3O0RL 5EG6C 5JOPD 1OAYL 3GO1H 2R7EB 3NZHL 5EZIH 3O2DA 2X4PB 2Y07H 3TNNB 4CVWA 2XTJE 4QJ3B 1I7RA 2V17H 3ORJA 3CZNA 1HEHC 2CWRA 4L3CB 5EO9B 4GQ9H 4PB9L 4XB8A 4I2XA 4Y4HC 2BW4A 1W0VB 1OOAA 1QBLL 1KEML 1OF2A 3UTTE 5GSVB 3N0PB 4XBEL 5BW7C 1I7ZA 2HA1A 1U3HA 1S7VA 1AIFA 2FRGP 3H9HA 3O11A 3QUZC 3JZYA 3MJ9L 4NQSA 5LNGA 4DUWA 2A9ML 3OMNB 2VDOB 2EADA 1A2YA 1F41A 4WU7B 4YO0B 4PBVC 2VRQA 2EEFA 2L4OA 2YFNA 5ELIA 1TT6A 3PHSA 4GUOA 2WXNA 4JBSA 1INEL 1JZGA 1E9QA 3MGOA 2J4WL 5HGAB 4OBSA 1ZLWK 3C5ZA 1PKQE 4LSQL 4JFQB 4M48L 5D9SB 4NQXA 4AVJA 2CO3A 4W6XB 3PGDA 1WFOA 1XGQB 1AZUA 2PN5A 2PF6A 3DVNA 3EO1A 5DEFA 1F4XL 1V05A 3TCLA 3FO2A 4NPYA 1V3JA 2CGZA 2FJHA 1IBDA 4M8RA 5D8JL 4XNMA 3CSFA 4K0OA 1WUNT 5KW9L 5KANI 4OI9A 1I9EA 1MH5B 3P4MB 2A6DA 1EBPA 2YKLL 3FBKA 1FGNH 5E8DH 4PI0A 4XX1E 2FSEB 3I9GL 3KLAB 4FQIH 1RJZB 1EIBA 3F58L 4CBPA 4LPTA 2E6JA 3JV4A 2WVSA 2R8SH 2VDRH 1HKFA 1MN4A 4DEUA 2I60H 4YDMA 4PJCE 1CWVA 3VD5A 4HIIB 2Z4TA 3AT8A 4ZFGL 4NERA 4WU5B 1QSFD 4X83A 1Z5YD 1P7QA 4C4KO 1J7VR 3U9PL 2HVKB 4P46A 3KLDA 4QJ5B 4OGAD 4QPEA 2H2SD 2AEPL 4M5ZH 4GYBA 4LMQE 3MBEC 4PRPB 2AJUL 1HNFA 4ONHB 3WN5C 2X09A 2Y9RT 1HL5A 3GBEA 3TFKC 2OCFD 5JW3H 2FQEA 3JUYA 5K9JH 3IJEB 5JIHA 1IM3A 1H15A 3LJ3A 4MNQA 4UAOB 3SCMA 5KSBA 2A9CA 5FKPA 2F53D 3I6LD 2FZ3B 4IK6A 3KYKH 2WBJB 3B9EA 1LK2A 5CKGA 2UX6A 2W94A 4FP8L 3P4NA 4XMPL 3FU7B 5DQDH 3T04D 5E6IC 1GYWA 4P3CL 5D2LE 2GUOB 5B39A 5HJBA 3N06B 1EGJH 2P49B 5DD6A 5A2LH 2APVA 3B2UD 1P4IH 4FN0A 3AB0B 4K71C 3PHAA 1FV1A 5IQOA 1MCDA 2GIYA 3O6LL 1T1YA 3H9YA 5J11B 3ECQA 4DGIL 3FB5A 1FAKT 2VL4A 2XUWA 5LNDA 3MOQA 1DZ0A 2J2ZA 2PTVA 2NX5B 5C0RH 5F9WC 2FATL 2ZUWA 3O3EA 3P73A 1RUML 4HWZB 3TTSA 1DVFA 5D5MB 3RY4A 4YNYA 5D8JH 1D6EA 5F70A 5IVOA 1A0QH 5KG9A 4WSGA 4GKNB 1NCTA 3AAZB 5H4ZA 3QJOA 4JPIB 4DQOL 4NNXA 4WK0B 1CLZH 1U8NA 3WFDL 3T3MF 2XSKA 1QBAA 1XR9A 3Q8CA 3QNYB 2YQ3A 3MCKA 2F18A 3ZUNC 1G9EA 3MRLA 5DVLA 2W38A 4XZUA 1S9KC 1IL1B 1MUJB 2W1NA 3GI8L 3D3VE 4YGAB 3W37A 4YLCA 4RMTA 5KJ7E 5C09A 1KBWA 4AUJA 1UB6B 3HOGA 3D3VD 1UD3A 4QI3A 4CILA 1XGYH 3II2A 1ZY9A 1F3JA 4Z7IA 3B7TA 4MJIE 2W92A 3B9KB 1FRGH 2C9AA 2FVNA 1QHOA 3IJ7A 2VW4A 3PYCA 3V0GA 1HXYA 4L5FL 3I02A 5JA8B 1OP4A 2JKWA 5SX4H 5E4IA 5I73C 3FL7A 2GJZB 2N4IA 3T6VA 2BO0A 2ZXQA 2FYYB 2MTAA 4P9HL 5I30H 3WHXA 1BMWA 4KKQA 1HI6A 2YD8A 3ZZSA 4F20A 2K0RA 2PO6B 3OGCA 1MDTA 4BUGA 5KBLA 3EJPA 3QUKB 2D3NA 1VKXB 1R5IB 2H6UA 5E4EC 3RTQA 3WFEH 1JZ6A 1DJXA 2Q2EB 4B50A 1U8HB 4B9IA 4HF5L 1MAML 4HGMA 3HUJB 3S3CB 4G6JH 2CJUL 3K1DA 4HOXA 3KJ4B 4HXAL 2DIJA 2PTUA 2VLJD 3UZQA 5IJKC 4GP5B 4ZUWB 3WTWA 1GGUA 4Y5XB 5J13C 5ALCH 4JG1H 3FO1B 3RIKA 3AZUA 3RGHA 4BBWA 5DEGB 4YE4H 1JWSA 2P80D 2A6JA 1P7QD 5IBLC 4LSVH 1S7TA 2WN2A 1USQA 4Z3TA 1PFCA 5DHEA 3OAYK 2B0SL 3FFCD 2IPKB 2P24B 1SOKA 4C4BA 2GC7C 2Q10A 1MWAB 5F6IB 3ARGD 1TVHB 3D4GA 4XPAH 2W9DH 5DFVC 4LCWA 1IC7L 4XC1H 5TQ0H 1MFBL 4A04A 5DVPA 2E8YA 3O3BA 5BUPA 3GSOB 2XTJD 2ZF8A 1U8PB 2R4SH 3BZDA 4LHUB 1Z5LB 5FYLL 3L3IB 4PVBA 5BW7A 1OVZA 5HDBB 2H0PA 4MJ4A 1HQRA 3WGVB 4J3OG 3EOTH 1YYLL 2VXTL 5FFLA 2O30A 3IFNL 2ZP9A 2KYIA 3RAJL 3FQRB 2PKDA 4FTDA 4WENB 1UWXH 2KDGA 3ZZLA 2FH6A 1BD2A 3RAJH 4OZ4B 4JHZA 1JMZA 2DI9A 3V0VA 3F6IA 1T5WA 5ID1A 1KN2H 3KPMB 4XBGA 4H40A 5TF1H 2VWEE 4AEEA 4Z7VA 1T89A 4KMTL 2Z7WA 1HJBC 2C4FT 2PWDA 5DZ9A 1LO5B 3BZFA 3LQAC 5IFJB 4DOHE 4G82A 2Y6SC 4PJ8B 4G8FA 4XP4L 3QIUB 5C7ZA 4L3FA 5K39B 4Z7WF 2OZNA 1YNTB 5ECGA 1KT2B 1QSFB 4O2CA 5EU5A 5C0AA 1U41A 4J1UB 2UY7A 5FA3A 4LEEA 5I1GL 2IPUG 3QUMB 4I89A 2QV2A 2H6PA 2XQYG 3DYOA 3LV3B 2JXMA 4LHJB 4UTBL 5GIRA 4A7GA 3WTTA 1OAKL 5L6YH 3AU1A 2WWOA 2WO2B 1E3FA 3U79A 1KB5H 1B0WA 1U3JA 4MMYB 2IQAB 4L5FH 4Q2ZA 4R0LB 1YECH 4JGUA 2ZCLL 1A4BA 4WIQA 4LLYA 4HMEA 4HP5A 4R3SB 1A7OH 3EHBD 4JO4H 1K85A 1MHHA 3B2DC 2C9UA 4LLUA 2ZKYA 3HRZA 1BZOA 2QELA 1CFTB 2K9FB 2FNBA 3S3BB 3UJJH 1FSKB 2AQ1A 3P77A 3UJTL 4D2NA 1IEHA 3DSNB 2D3JA 4MBOA 1S46A 4KO9A 1W8NA 4UANA 4S1DD 4BH8B 4HH8A 1YYLH 1TMQA 2ARJB 5TDOB 1G7MB 4KDTC 4TNVK 2PCPA 5J6GB 2AXJA 4LFHD 3GRWL 4FFVD 2W0LA 3CMOL 3NZSA 5EU6E 5KVFE 4KK9D 3T1FA 3ML9A 3OKEB 2X4NB 4KQ4H 3GKWL 4FJ6A 1H6EA 2B59B 3LHPL 2EXWD 5LBSA 2DJUA 4EUPH 1FN4B 3F62A 2EVHA 1MDAA 3C60B 4JO3H 1SHWA 2CBOA 3BLPX 4PG2C 2GB2A 1BQHG 2BSRA 3MNZB 1EPFA 2X1PA 1N64L 4XRCA 1NEZA 2WB1A 2EIJB 3DURA 1WRFA 2VWEC 2C3VB 3SJVB 2IWEA 2X3AA 6PCYA 2VLRB 3NJKA 2F74B 4P2AA 5E1IA 3S96B 2Y7OA 2K70A 4LCIH 4N1EA 2FO4B 1KXTA 3VD1A 1J1OL 1QHPA 1YEFL 2NY5L 3B6SB 3G3LA 5GGUB 5HJDA 3RIFF 5LO7A 4TUKL 2XPGA 4AQAB 1YSOA 5FK9A 4WHCA 3ILQC 3VA2C 1KIPA 1HHHA 3W0WD 3O11B 5I82A 3RGVA 2W0KA 3ZJAA 2GTWA 3GMLA 3MA9L 2A5UA 4PJHA 2A6JB 4GUQA 1W9XA 3BD4A 3MMEB 2VXQL 3O6FC 5GGVH 1LNUB 2EABA 4PP1C 4PJFE 5I1KL 5KVFL 5K1VA 1A1NA 1ZV9A 4WJKB 1HWGB 2ZOKB 3FFCA 4IIQB 2GK0A 1JTPA 3VE0B 5A2BA 1GA2A 2XWBB 3FSOA 3FOMB 5DQJA 5DZLA 1QO3B 4ZTPL 1KPVB 1LO4L 4OD3H 2CCVA 1BLNA 3CFDA 1RV6X 3HC2A 5FYKL 5E8DL 4XNQB 1AYOA 3FQXA 1NUNB 2ZOLA 1KJ2A 3G5ZA 2QDWA 5D5ME 5IOPA 3MXWH 2JJSA 2G2NA 1MLBA 4V2BA 3ZO9A 1QFWI 5DHVH 5IMOB 2Q8BL 3SY6A 2IAMD 2WVUA 1H8SA 2I60L 1INQA 4WWOA 1D9KB 1KYFA 4MMZA 4Y4FB 2XN9A 4FKKA 2B1HH 4ADJA 5KSAA 4YVUA 1AI1L 3I74A 5DHDA 5E2UL 4PJCF 25C8L 5K93A 5E8NA 2V4LA 1C16A 5ICYA 4TNGA 5EBWB 3QHZH 1QD0A 3DXAE 4TVPE 5KYYB 3EUDA 1XAUA 5F71A 1QLEB 2UWEE 2YMXL 4JHAL 1LO3H 3OMIB 3NIGB 3QXDA 4IU2B 2NY1D 3WS3A 4B6ZA 1RURL 4XVSL 3EGXB 4G6FB 5IW6B 5FOBA 1YY9D 4RVBA 4KROC 1EERB 2CJSA 2VISB 4GBXC 5E03A 4TTDC 2F53A 4GP8B 4N8UA 1PYWA 3T8VA 3W0WB 1Q0EA 1SJHA 1C7SA 4XPHL 4AJWA 4HWEL 3L13A 1OAYH 3UP6A 1CFTA 3U1QA 3GWJA 4CGTA 3W57A 4G9DA 3L6FB 1EGJL 2IG2H 3C12A 3U83A 1VGKB 3QS3A 3GSNH 2FLBT 4N1CA 4P4RA 4R2GC 4UT7L 4G9FE 3OM3B 3V55A 1SLVA 3KPPB 3UTSB 1WVZA 4XBEH 4PBWD 1EO5A 5GRWA 5IJBC 3CZSA 3U7WL 1VACA 1W72A 2YMOA 3B3BA 5B3JE 1FIGH 1Y1UA 3BAIA 4FQ2L 1EEQA 3HAEB 1HXMB 5GHWL 4F8QA 1N2RA 4L05A 3J27A 4CADB 3WL9B 4D8PB 2R2EB 5I8OL 1UVQB 1MW2A 4RQQB 3GSNL 5HD8D 1ED3A 3WY2A 3BO8B 3WN5B 5FIEA 4YDKL 1QBMH 4EI5A 1JHTA 4BCZA 1A14H 2R4RH 4OZFH 4KKCC 2LFEA 5IFAL 2ORBL 3OC8A 2BX5A 3BAJA 4JO8A 5TK4A 1L9RA 4PV9A 2W59A 1TTGA 3ZT7A 5IF0B 4MA3B 3X3GL 2FT7A 4J8RB 2PXYB 4MJID 5DMKA 3NCXA 4FA6A 4H20H 3VGEA 4NYLB 3QZPA 2VTFA 2FIKA 1ZK5A 1YQ2A 4ZXBC 2WNWA 1N0LB 1U92B 3QG6B 3S35H 3SGDH 1U8CA 4JVPA 2DAVA 1ZKAA 4PJFA 2AXFA 1KFAH 3H54A 1P4UA 3HC3H 2I24N 3VO0A 2ESVA 1FL3A 4ZFZB 4XNDA 4G7VL 4D94A 3KM2A 5GS1A 4ONFH 4LEOA 5F7HA 2EXYD 2P46B 3HC0A 1QFWM 1F1GA 1LMIA 5KSBE 1DQDL 1CZ8L 3C8KB 3GO1L 3M1CA 3HZKA 1I7UB 3HS8A 4MCYB 3TBWA 1TFHA 1FVEB 3UO1H 5JMOC 3UPRA 1T7WA 1DJZA 5HHME 4FFWC 2ZUXA 1D6VL 3G5YA 4BH7B 1QWNA 3FU8A 2AF2A 3IT8D 1RULL 3ZVVA 2KUTA 3FTGA 1JAEA 4P4KA 3B2VL 2AK4A 3FAXA 3K2UH 3D39E 4JDVA 1NEZG 1FZMB 1U8MB 1GGIH 5F3HA 1DQDH 4DP6X 1XGTB 1OTUD 3V79C 4JL2A 4MRBA 4OH2A 1IM9A 1T0MA 4UIMA 3S36L 5MEQB 1HESA 2CRZA 3T2LA 4B9PA 4J3TA 4GRLA 5ALBL 3P73B 2DIAA 3B34A 4X4ME 3ARBB 1EO7A 1DBAL 1DQLH 2XN9B 4X4KA 1UB5A 4ATWA 2R83A 2HPTA 4W9FC 4B96A 4P5TA 3DJRA 1JTTA 4BWUA 2F8OA 5D7JB 4YDLC 5CJQH 3UROR 2V7HB 3QIWA 1CG9A 1IT9L 2YPVA 3EYFB 4ZW8A 1QTSA 1U6AL 5J56B 3HMWL 2VNCA 4LLQB 1MPAH 4A6YL 4RWHA 1MJ7H 1CDIA 3FTVA 4WW1A 4BV1A 4H25A 2GY7B 3DTXA 2VDLB 3GXMA 4NCDA 4QXWA 4LVNC 3S8WA 4UQDA 3MBXL 1HKLH 1QNZH 5B21A 3E1ZA 2VDNL 3T6QC 1CXEA 3F7YB 3IFOA 4ENEC 1I3VA 1TQUA 1O6VA 2F2HA 4KVCH 1W91A 3DI2B 3Q9PA 4NQDE 2QJDA 3MA7A 2DL9A 3LKNA 5A43C 1M6UA 4R96B 4XODA 2DY2A 3IDIB 4X6DF 4MXWL 1T22B 2R23B 3KYNA 4YHKL 4DP5X 3SYCA 1P9MC 3CK0L 1T4WA 1HH9A 2AZAA 3ZR6A 5EF2A 3D25A 2DQFA 3N9GH 3CV5A 5IEKA 2O61B 1DVXA 3VXNB 5FYJU 5L8LB 5ANMB 3JYCA 4U05A 4WUUE 1RZGA 4NO0D 4U7MA 3FTYA 3T6ZA 2EDFA 1DVUA 3X2QB 1DTUA 1D5IL 4G5ZL 1MW1A 1ZT7B 2VUYA 4FULA 4I4WB 4ELMB 3HNTH 4PWHA 2DQIH 5CD3A 4TNVF 2J8UE 4WY7L 4XO9A 1MZZA 1PZSA 1NGZB 1IKFL 1PW3A 5D55A 3TJHD 4NNPH 1ZPLA 3EYQC 4Y4KC 2GJ6D 1NC4A 2R0WL 2WBKA 3CSYB 1V55B 4Q89A 4HZ1A 4MDJB 1FE8H 4FYSA 3RPKA 4TTGA 4Q6KA 2JJSC 3QJFB 1RUPH 3RWHA 1P5VB 2FUQA 4Z78B 4GG8A 2BOBB 5JW4Q 5KVEL 3RFZC 4Y88A 4IJ3B 2Q8BH 3BC9A 1AXSA 2VDQL 5IK3B 3CDYA 5IQ7H 3IMBA 5GRJL 3RVWC 5E6IA 1U3HB 2A6KA 5E8PB 1N59B 3X1EA 5JZ7D 1LMKA 5D7IE 4OCYH 3A0OA 3O4OB 1QEXA 1FFTB 4WU7A 5ERWA 3F7VA 4XGZB 3WE6A 4XVUD 1TF4A 4X8JA 1VEOA 4XHQA 5DJYB 4IGBA 3OLEA 2OSLB 5IHBA 2WZ5A 2XFXA 1A9EB 1BVZA 2XLLA 1JXJA 1ZLEA 3A23A 5KTEH 3MROA 1YDPA 3X1GA 3BSZL 5AOKA 2BY0A 5ESAB 4ZMVA 3D50A 2BHYA 2COVD 1Y18A 3MNVB 3QFDA 2BNQD 5GGTH 1CFBA 5C0BD 3MN8A 3HCVB 4GRWB 4NQEB 1ZS2A 1G7LA 2VERA 2X41A 1SQMA 4FQ1H 4B5ZA 3HZKB 1E4KC 4YL9A 3DXAD 3NJFA 4W9IC 3D39A 3BIBX 4FFWD 1N5YH 4U0RB 1EJOH 1JN6A 3S98A 3WSQL 4EN3B 3TM6A 1NOFA 4FOMA 2UY6B 3G04A 3T4AA 3QI9D 4XVJH 2J6WA 4PGCB 5DF0A 3EF7A 3MLSL 1VPOH 3DK2A 2VZ3A 1YEGH 3MRRA 3NSXA 2VERN 1A1MB 2BRRL 2C3HA 3GQFA 3S37L 1TCRA 2EH8H 4YAQA 3M07A 1BEYH 3N1QC 5LB1A 5DEZA 4EOWL 4IMLB 1A3LL 1RI8A 1QA9B 3P02A 1ODUA 1WUZA 1CBVL 4I0KA 4UIMB 1LO5A 3BZFB 3DNKA 4BCXA 1KGYE 3CGTA 4M1GL 3BSHA 2DM4A 1HH6B 4BUHA 1IC7H 4XRCB 1QQDB 4HDIB 1KPVA 4YWGH 3RA7H 2W65B 3VFVB 3WG7B 5C9JA 3IJSB 2H8PA 3B56A 5BRQA 3IJHA 2PXYD 4WF7A 1HL8A 1I4FB 1M1XB 3HZMA 3VYNA 4I1NB 2FO4A 2FWOB 2CA4A 3B7YA 4N0UB 1JZ5A 3MLYL 2BNQE 2C1PB 4BDVB 1DN0B 4GSDL 2VYRE 2DOCA 3NYKA 1W2KT 2CGRL 2QQLL 3VRIB 1I85A 2DQHH 3BUYB 4F7CB 3LKPA 5D6DA 3VXSE 2BP3A 2FTAA 3QDJE 4GRWE 2KPNA 3KPRD 3QUYB 4WWID 3CDFA 4EQ3A 2DLIA 1DQJA 4JHVA 5DMJB 3LN9A 5I1EL 4KXAA 1CD8A 3B1TA 3C5XA 3QFJD 3D52A 1UASA 4H5SA 2YZ8A 4XNYH 5I8KH 3QUZA 4ZS7H 2G5BB 3T0EC 1IARB 2JQZA 3QEGH 2X4TB 5E7FA 2Z8RA 1GGTA 3WFCL 5AB0A 4Z3GA 3MRPB 1T1WA 5B1KA 2NY2C 1JXDA 3G9AB 4M93B 5GRYA 4PP2A 1JGDB 3V4VA 3ZKXB 5EU7C 2A74A 4X5XA 5B7EA 1S7XB 4N68A 4TTDD 4UYQA 1ADQL 3OJDA 4GBXD 1OAXH 2GHZA 2OXGA 3QJSB 1HWHB 2IAND 2VW6A 5DJDA 1MF2L 5JNYA 4R3SA 1BAFH 2X2HA 1HSBA 2P5ED 2YGQA 4P99A 4EIUA 1RZPA 1KIQB 1WZ1H 3BEVA 5TF1L 3RX7A 3ZX1A 5KUKA 3BP7B 1BVLA 3DUUB 4IRJA 3D85B 1V3MA 1T04A 2YD7A 4DJMA 4L37B 3GIZL 3DSNA 3D08A 3P40A 2ZKWA 3WEBA 3S88L 2Z1PA 5HYJB 2OZ4L 4LQ1A 3M6DA 4XMKL 3EFDH 4XX5A 3QJZA 2IDQA 4FTVD 4Z7WE 5K9QG 1JNLL 2AABL 1EZLA 2OMVA 3AACA 4IHBA 2X0WA 4H8HA 3SO3C 5C97A 3OPZL 2YUVA 1F6AB 4LKCB 4OCMC 4X8JB 5CZVL 3PV6B 3H6AA 4MQSB 3EH2A 5DJ0B 3B5TA 1SF5A 3WFBL 1A1NB 4FNPA 3VWKB 5DZNA 2P4AB 1J86A 3A6OA 2HFEB 3QUYD 4HIEA 3FUMA 4U1HB 32C2B 5I75B 1U33A 3HRPA 8FABA 3QJTB 2Z92B 2ZXEB 3RE0A 1ZRUA 2QQLH 3RL2B 1X5YA 2FE0A 4HUXB 4JFZH 3W38A 4ETQA 1CI3M 4WEUD 2CUHA 1R3KA 1NGWA 1PZDA 2ITEA 2MNJB 2WO3B 3KEDA 2OTWB 5C0EB 1FYTE 2R4SL 2DWSA 3MUGB 4NLAA 3VD7A 3SDCC 1L9NA 2PO6A 4OVVA 2WXMA 1Z0MA 3LYRA 1RL1A 3QI9A 2JCCF 2YHGA 3TBWB 2YQBA 5AW8B 3QORD 3W5MA 4X99B 4R7XA 3DUSB 3MU3A 3ARBD 1IILE 3B9AA 2K3HA 3RY6A 5IHZA 5F88B 3FTGB 2EE6A 4M3KB 4BZ2H 1XZWA 3CLFL 1GOFA 3VXPA 3APCA 4ZUWA 3DX6A 3UZEC 1JDCA 1NBZA 4PS8A 4WK4B 4ZFOA 4IKJA 1QRNB 1XGUA 1KB3A 1Q9KA 2R59A 4HXAH 3HZMB 3W82A 3E6HA 1A3RL 2GUOA 5B39B 5CM1A 5FOBB 3UBXA 3AXLB 2R9HD 3S35X 3VXTA 3WSQH 3KXFA 4C54A 3ME0B 3TASA 3KWWA 5KVGL 4PJDE 2CPCA 1UWXK 2IQ9L 2J21A 4ILDA 2OZ4A 2G3XA 4IDJL 4NKIH 3X13A 4PVLA 2NUTA 4WUKH 3FQUB 4DEWA 1CD0A 3T2NL 2AKRB 2ZKXA 2G75A 1XGYL 3CDGA 2AEWA 1XL6A 2J6EH 4LARH 2ED9A 4IU3B 3ATDA 4ZFFA 5BVPH 5A2IH 5KSAB 4NXSA 3BZ4A 4AQ1C 3NFPB 4MCYA 4S1DC 1PJWA 3IDJA 5B1JA 1IAIH 3S48A 1RVFL 4A2GA 3C6SA 1Q94B 3S2AA 5FKAA 1TYRA 2YD1A 3KPSA 4N3TA 5E2TH 1VACB 1W72B 3U0TA 4JANA 5H37G 3MRQB 5FGCE 2Z93B 1J9QA 2D73A 1Z9SB 5T5FH 1BFOA 1CXFA 1SXNA 4O4YH 3ZHFA 4X4ZA 3VFNB 2F9BT 3G08B 3KPMA 4XBGB 4KY1L 4O5LL 3BZ5A 1RLBA 1O7SA 3ZK0A 5AAWC 4JM2A 2UZIL 3GI9H 3UZVB 4R5TA 1WTGT 4DERA 3KPOA 4QMEA 5DJXB 1VIWA 5DWPA 4OVUA 4EXPX 4GEIA 4KTDL 5AVZB 4NKDA 3DARA 2YK1H 2FYVA 1E28B 4RAUA 1E4XL 1Z5HA 3I02B 3PRZA 1N4XH 2N3JA 43CAA 1RU9L 4OY9A 4LSUL 1S8DB 2BMKA 4X6CA 5E1AB 3S9DB 2FWLB 2X89A 4R83A 4I3SL 4AV0A 6CGTA 3PG2A 3V8CA 3INOA 1EMTL 2ZCKH 4RRPG 1CK0L 3RU8L 1THCA 4K5LA 3C8HA 1QLRB 3CAFA 3KH4A 2RGSA 4GQQA 4LLYB 2XX1A 1BG9A 1DJHA 1L0YA 5FDYA 1HYSC 3FQRA 3QIUC 4GXUN 4YHLH 5DS8A 4X6DA 2QFRA 5T1KA 3GDBA 4LOFA 3ULUC 2K6ZA 3HC4L 1HE8A 2DYPB 5E95B 4OAWA 5EUOF 5EIVA 5I19H 2HJLA 1BM3L 4LRIA 1JNJA 1BOYA 1YO4A 3RURA 5CEXB 2NXZB 2B4CL 3DOSB 32C2A 2A6IB 4JMXA 2EIBA 4H2AA 3SYPA 3NIGF 4W9CC 4ZZFA 4JDZA 5B4MC 4OFVA 2HPOA 5IF0A 3TESA 2H6OA 3ZYOA 4BFJA 3JWNH 3S6CA 5B3SB 1XGPB 3VVWA 3FQYA 5B8CA 2EDKA 5EFIB 4RZCA 1NC4D 3UACA 1ORSB 5G55A 1ROCA 2BXYA 4OF7A 4LF3A 4MAYD 5IBLD 4AUUA 4JRLA 3TGXA 2OR7A 3ZDXB 4Z8FH 3IN2A 4FMFA 1MFCL 4RGOH 3J2PA 1GZHA 3ETBF 4U1IB 4Y4HB 1X4XA 5FDWB 3L5JA 3MO1A 3O81A 4MD4A 3ZY7A 3DHPA 4EN3A 2DN7A 4ZW5A 4FG4A 1U8PA 4LEOB 5D7EA 2V7HA 4R4BB 1T3FB 3ZZQA 3V5KA 2NSQA 2IV8A 3C8KA 3T0EE 4W9KC 2Q20A 1TO4A 4MJ6B 1EO8H 4XMWA 2WKOF 1MI5E 5D7IF 3PWUB 5HJ3A 5TE7H 2J5WA 4JRYA 2ZCHL 1KPRA 1E8WA 3QCVL 3KLSA 3D34A 1ZGLB 2JKXA 1FI8C 1JK8A 4PSRA 2JK5B 4PRID 1YQVH 1ZHLA 1JWMB 2GSMB 4PW3A 5BCAA 4MHHI 4GAAA 2CHZA 3H7LA 5IIEA 2LHAA 1UH2A 1NUGA 4FNUA 4APXA 4BINA 3NDZE 4NOFA 4NZTH 3N6YA 5FB8A 2ITDA 2HRGA 1IM9B 4P2QE 4DKDC 5L9DL 3LRSA 4RMSA 4IIQA 5BS0A 4N24A 4JN1L 4P2QD 3HC3L 2WGXA 3RUGA 3RYMA 4Y2NA 4LHUD 4KDVA 3QQXA 3O3DA 1UA3A 2DS4A 4KKPA 2BHFA 4JZNA 1EK3A 4LCYB 5IQLA 4G8GB 4KQ3H 3SBPA 3ZL1A 5GZOD 5D2LF 2XVKA 4L4VA 4QO1A 3I6KA 4HLZH 4H20L 3O0LA 3T3ME 5EEUA 3CFCH 3FU7A 3QULA 4XT1C 3RJQB 3T4AB 5K9KA 1JL8A 4M4RB 3V0JA 1QLFB 1ZT1A 1K6QH 1NDMB 1JHLL 3K2IA 4PW9A 1F8TH 1SMOA 1LP9B 1UG9A 3V4VL 3UYRH 5I28A 5I1CL 2HTKD 1WA2X 4K94L 5L4JA 4H5SB 3TCTA 4Y2OA 2CGYA 3EJYD 4QT5A 4RBPH 4OSUH 4PMFA 3DX7A 4ANWA 2NXYC 4RAHA 1M7UA 3MOBL 1DVFB 5D5MA 3ZYJA 1QKZH 1T1WB 2FIRT 4ORGB 5C07B 1FO0L 4PLKC 4NJ9H 4WAFA 3K4DA 3MLZL 4FYRA 1ECYA 3EFOA 2YD4A 3QWRA 4N0RA 5H2BB 5JDSA 1CCZA 3ET9F 3VE0A 1L4IA 4FEMA 4DIXA 2XWZA 5IJVA 2Y2YA 3OKEA 2OXGB 3GZOA 5DC2A 1J18A 2QKSA 2OTUA 1CU4H 2Q7YA 5HHOA 4EZKA 3MROB 5C09E 4PJXB 4NNYA 5T1DL 5FUCE 4NCC1 4YR6B 1SJEB 5E1HB 5T1KB 2G0LA 4Q6YA 5GS0D 1IU1A 4FQLH 4UUJA 4G8EB 1R5WB 2Y6TE 2Y72A 5IW1A 4NWUH 2IXQA 2EUVA 5EOCH 4MD5A 1GRWA 4OGYL 4UZUA 1PD0A 2F74A 1KY6A 4KRPD 4AKOA 1KZQA 3NIFE 1JNHA 2X05A 1AD9B 3L3GA 4HH9B 2IFGA 1FO0A 1WD9A 4PWJA 2WQXA 3HE7C 4NRZB 1JF6A 2IPTL 4Q9RL 1IGJA 3D3VA 1TQBB 2CLVA 2ZAGA 4FQPA 1QUNA 2EDEA 2H7WA 2VLRE 4S10A 5D4QA 2AGJH 2Q9OA 5E2VH 3RWEB 2WBJC 3PGFL 4RFNC 5ESVB 3AMKA 3D2TA 3C6LB 5D93B 3U2JA 3SDYH 2WQSA 3VM5A 2NSMA 4JQXA 1U2CA 1AC6A 5E24E 3HNTL 4G83A 2J1ZA 3VD3A 1PG7H 4OLXH 5DSCA 2WUBL 4NM8L 3ZGHA 4KAQH 1B9ZA 1YDPB 2NNAA 5IREA 2VGLM 2XBTA 2ZUYA 1M6OA 3OZLA 4CVUA 2OMZA 3RY5A 4U1JA 2XVLA 3EXJA 2N56A 2QR0A 3BVNA 5EU6D 2NXYD 3IETA 2NR6C 4AM0B 1ZTMA 3D39B 2V5YA 4E9XA 1ZGLP 2PYEE 1TKWA 5TQ2L 3R18A 5EDXA 2J72A 1YC8A 4JJHA 4IMKA 4W68A 4MXWH 3FAWA 4ENZA 4FI8A 5J3HD 3N85L 4YDLB 1RY7B 3QUYA 4EQ2A 3MRIB 2J7LA 1UKSA 1VF5C 4JVWA 4MJHA 2AQRA 4Y4FA 1UM4L 2XVBA 1UCTA 3K2KA 1XR8B 3TBVA 3VJ6A 2WMPB 5AQ0A 3VD4A 1XFPA 3IKCA 4GP4B 3RPIB 4PJ9B 2UV3A 2W81C 5C08D 3VXRA 5ADPL 4MWFA 1MCNA 4B97A 1MHEA 4G7YL 2PO6D 1ICTA 4HJ0C 3TP4A 3NJMA 1CFMA 1VFBA 3ERXA 6TAAA 3DETC 3FO0H 3TEXA 5C9JB 1XWVA 2FEJA 1IX2A 1M7DB 2OMTA 2ESVE 2YSSB 1KCRH 4JX0A 5I19L 2DKSA 3PABA 1JNNL 4DVRH 1LEGB 3OJDB 4NO2B 4QLRA 2FIKB 1KBKA 5B1BB 3BESR 3GSWA 1NAKH 5DFAA 5ISZA 2F61A 4YSSA 5F9OH 2CO6B 5FW7A 2FECL 1QSVA 1NSNH 3JTBA 4FHBD 2OKMA 1F18A 5C7XL 1FL3B 3HLAA 1P1VA 4Y4HD 2JV6A 2NX5D 1U58A 4PJ8C 1VERA 2JJTA 4XCFL 3BGMA 3GBLA 1Z66A 4ALAL 2FWUA 4E5XB 2GCYA 4OJAA 3AWEA 2EECA 1BAGA 1OPGH 3HFML 4DPAX 1GKOA 1O7DE 5JR1L 3D05A 3GSVA 1NC2A 5E9AA 3AU1B 4JKPL 2ZSWB 1HXMA 2VJ0A 5KYXB 3BH4A 5MERA 3QYCA 3LXCA 4MAYC 5HBBA 4Q2ZB 1J8SA 5MEND 3S88H 4D7BA 1FZMA 4FKHA 3NEXA 1B6DA 5DR5L 3PPSA 4OCRH 1KFAL 4PJXA 4TQEH 3FO9B 1KIRA 3ABZA 3RVWD 1UJTA 2Z64C 4PBDA 3SCMB 1S9XB 2MIZA 4UT6A 3ZBMA 1KLGA 4IW4C 3OB0H 4FLSA 3GMRA 4TNFA 2BVOA 3LRHA 4XOCA 5JIDA 2J6EA 2KQMA 4PJBB 1ACZA 3T3MB 1A9BB 5C08B 2H0JA 1JS4A 4NFBA 4PGEB 4UTBH 2IH3B 4IRJC 4EKJA 3SDAB 1J1PL 3S4SB 1OAKH 2IH1A 3TJHC 2R29A 4NQDA 2CU9A 4AX3A 1QHQA 1B2WL 4M3HA 4R97B 1FA4A 2K4AA 5I8CA 2WLIB 3JT0A 2Y1VA 3QUYC 3QIUD 3KGUA 1VFAA 3ENEA 1OK0A 4OKVB 5DD3H 5AW6B 2PUQT 1FV1B 3AREC 4PAZA 4OLWH 2HT2C 4UAHA 2NZ9C 1M1SA 4MX7B 3JV6B 5CJXC 3O3AB 4RGMC 2GSGA 2VDPL 1BCIA 1FNSL 4L8DA 2DF3A 4QRSA 4XNZB 2HUEA 1A6ZB 4JFUA 1IV8A 3N0AA 1FGVH 1RIUL 2VDQB 2Y5QA 1SVZA 3OJVC 1RZ7H 3QQNA 4MQTB 2HLAA 5A6MA 3EAKA 3GBML 3P4OB 1O0VA 1W8EA 5I66B 2ZXCA 3ZL2A 2OV0A 3NCBB 3T0VA 3BQUA 4M6MH 3VRLF 3EOTL 4W6WB 2YPLD 2EACA 2YD6A 4D9LH 4ZQTA 1UXSA 3X13B 5ISZE 4P0DA 4FQJH 3BPLB 2DBJA 3NABL 1UB6A 2WZ0A 3QH3A 5D6DC 4PM1A 2QT6A 1TYJA 1AJ7L 1UUSA 4K8RC 4AYEC 1ET5A 1T80A 3PNWA 2FO8A 4U6XA 3QDGE 4B9JA 2ZG2A 3JWNC 4BFNA 4PJGF 4WFGE 2NY1C 3S5YA 5KEZA 3F7QA 4AENB 3OHXA 3SPGA 4BSWA 5TTRA 4KUZH 5K9OA 4U3SB 5E00A 4J3VA 5PAZA 3FFOA 2QQQA 1CFVL 2ITCA 3ARFD 4M5SA 2OXHA 2QLYA 2X12A 3DUHA 3LN5A 1CXIA 3BD3A 4APXB 3ZSSA 1UOWA 5TPWL 1BGXL 3MRHB 4N6RA 1CICA 1MNNA 3MOAL 3WJJC 4O02L 4AZ8A 2V2WA 3P3TA 3NDYE 2YLKA 4DZBA 4K2UH 1SHSA 1TSRA 1SFDA 3H4FA 4JKWA 3TBCA 4K3JH 1JRHL 2AABH 1E28A 5EBLB 3KYNB 5EU4A 4KKLC 4PYHA 5ESAA 4LU5H 3UG5A 2C7FA 5HHMB 3VW3H 3NACL 2VITB 4IJ3C 5T1MA 4LQFH 1GJUA 4FQXD 3TJEL 4AGMA 3VXNA 1KULA 5KS9F 3RNKA 4ODTH 3NQIA 3P9MA 1LK2B 4EI6A 3DA0A 2YUXA 3UOAB 3BGFB 3AB0C 4K71B 3FUIA 1MFDL 2NQCA 2PP7A 4JHUA 2APSA 4PB0L 4E36A 1J05B 4JS7A 4DCQA 1BDYA 2B3RA 4O00A 1FVCB 2AEQL 5EZLA 3NCFB 4DPCX 1W0WA 5CINH 2DYPA 4QHUA 2B2XL 5HYEA 1WCQA 5B1AB 1QFOA 3GS4A 4IOIB 2BINA 4OLVH 5MEPA 4FLOA 1KEGL 2BVYA 1P6WA 1QI5A 1FLRH 2JI2A 3OVUB 4Y5YA 3VFRA 3X3FL 4CVXA 2C9SA 5FA4A 1BWWA 1IC4L 1V7MH 2IH8A 2VZOA 2OULB 2UYLB 4FXLA 4KKCD 3EYVA 4MS8C 4EPSA 4D7PA 2FEEI 3L95A 1XEUA 1L6XA 4XTRC 1AE6L 1NAML 2DM7A 1QEWA 2R0KL 3IJHB 4AMXA 4TUUA 2OSWA 4ZS7L 4KKLD 4M9OA 2Y5EA 3KLKA 1GMIA 3O4LE 4HLJA 2ZYRA 1IAKB 3C75A 2WW8A 4MCZA 2WV3A 3ATBA 1H3UA 1Z3GL 1SYSB 4CADA 3V0VB 1WGVA 4BQ6A 5AD0A 2EDWA 1BREA 3QS2A 5L8KB 5I76B 4LPVA 3ZDXF 4LLAA 1E40A 1RVFH 1WZLA 2VIRA 4OD1L 5TF0A 1J5HA 3FN9A 2BNRA 1YHPA 4KJQC 3VXUD 2DQTL 2FJGA 4ZUSB 1FG2B 1DYZA 1OPGL 1IIKA 2YA1A 3RWGB 3VYPA 2ZWZA 5HGDA 5K5YA 1R6VA 3S37X 1CE1H 2XTJB 3PHOA 3DHJA 1U8KA 2C5DC 3BGFC 4D9RD 1OV8A 2NNXA 1AY1H 4NSKB 2E59A 5GGVY 1QFPA 1UYWL 3GRWA 4FA7B 2DWTA 1MY7A 4X9HA 5GIRB 2CO4A 3BUDA 4PB0H 4EAEA 5I1DB 5HHQB 4HIHA 4IEFB 4CRPA 4LBEA 3A47A 3MRNA 1TTRA 4KZCA 3WY3A 2D7TH 4HJIA 2VLLA 1AQKL 1WHOA 2IPKA 4LCCA 2GTQA 3HE7B 1PKQB 1WFIA 4P3WA 1YY9C 3STLA 3ZE0F 3DIDA 3MFGB 2ALAA 1U8CB 2MRYA 1AGDB 4ZMOA 4JQIL 4J8QA 3EHBC 4NQUA 2GKIA 5CZVH 4NNYB 2A74B 3PGFH 5D6C