3ZDWA

Substrate and dioxygen binding to the endospore coat laccase cota from bacillus subtilis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COTA LACCASE
publication title Substrate and Dioxygen Binding to the Endospore Coat Laccase from Bacillus Subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 144
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA02
4F2FA 2WSDA 1AZCA 1EHKB 4JHVA 2DYSB 4KO5A 1TEGA 3NJLA 4KO6A 1KDJA 4UAHA 1I53A 3AY2A 1SHWA 1JXDA 4ZK8A 1PY0A 3UAAA 1ZDSA 2GB2A 3CVBA 2XV2A 5I6PA 2J55A 4YSQA 3QJTB 1SHXA 1J5DA 1PNCA 3H4HA 1E5YA 2P80A 3S3CB 1GW0A 1KCWA 3T6WA 3AW5A 1WA0X 2XYBA 2CBPA 4F2EA 2XWZA 3ZDWA 2PPEA 4BDVA 1R1CA 3OMIB 4E9XA 2BP0B 2YXVA 3NJHA 1TKWA 3GYRA 3UAEA 4A68A 1GY1A 1NIAA 4AZUA 1CC3A 3G5WA 4W1TA 1ETJA 3T71A 2AZAA 4HCGA 4KO7A 4YSRA 3DTUB 2ZONA 1RCYA 1J9TA 3FS9A 6PCYA 1L9QA 4P5SA 3QQXA 4P5RA 2IH9A 2YAHA 3T6XA 5B1BB 1IKOP 2DV6A 4G71B 1CYXA 1L9RA 4A2FA 2XLLA 3AG3B 1PZBA 1ASQA 1SDDA 4YL4A 3UGEA 4DPCX 1X9UA 1A4CA 1JERA 1E67A 1T5KA 1ZIBA 2Q9OA 2JKWA 1KBVA 2VM4A 1JZHA 1TEFA 2DYRB 2XXGA 2XV0A 4KO9A 4E9TA 1IC0A 1BYOA 3IN0A 1ASPA 1SJMA 3CZUB 2AANA 4NB7A 3ASOB 3WKQA 2EIMB 2TSBA 2CUAA 2YAEA 2DY2A 3NP4A 1CUOA 1J9SA 1OCOB 2WO3B 4HAKA 2BZCA 1JVOA 4HCFA 3SBPA 2ZWNA 1PMYA 1W6LA 5PAZA 4YSCA 1AR1B 3OQRA 1ET8A 1PAZA 4BWTA 5I28A 3NJMA 1NPNA 1NDTA 5LDUA 3ERXA 1WA1X 2J5WA 2PP9A 3NSYA 3IBOA 1AS8A 2CAKA 1GS6X 4X4KA 2FQFA 5B1JC 4E9YA 1AANA 4DP6X 4DP2X 5E9NA 4G7QB 4KOBA 4GXFA 1A65A 2AFNA 4N8UA 3MX0B 4HALA 1RKRA 1BXVA 2LLNA 2UXGA 2B3IA 2VW4A 3PXLA 1SFDA 2BW4A 3IEAA 1OCRB 2JFCA 1B3IA 2VSMB 1ILSA 3V9CA 4UANA 3PLYA 2BO0A 1AAJA 2IWEA 1W6WA 3CVDA 1V55B 3U25A 2J56A 1BXUA 3FPYA 4A2EA 1IBYA 4YSAA 1ADWA 5AKRA 2HZHA 2FWLB 4G70B 2FQEA 2GBAA 3NT0A 2CJ3A 4GP8B 2W88A 1JZGA 1SFHA 4RH4A 3N55A 1BQ5A 3QJQB 4A2GA 4WKXA 2OV0A 5I5MA 1DYZA 3T6ZA 2FT6A 3T6VA 5B3SB 5IY5B 3T9WA 3KW8A 1GR7A 2HLEB 4AX3A 4A2DA 1DZ0A 1V10A 2FQGA 2N0MA 2CCWA 4YSTA 2BHFA 3C75A 4E9QA 2FTAA 3JTBA 1A3ZA 2XX0A 4YVNA 3EHBB 3DKHA 3ABMB 1BXAA 1TU2A 2FJSA 3FT0A 4W9ZA 4DPAX 1XMEB 2R7EB 2XUWA 2E86A 1KBWA 4HHWA 6PAZA 1ET5A 3AG2B 3OMNB 4M3HA 2NRDA 3QJVB 1GSKA 2P80D 2OCCB 2IWFA 4KNUA 4PCYA 3X1EA 1GS7A 3QJSB 4QKTA 2YAPA 2HXAA 4M4RB 1NWOA 3CDZA 4YSEA 2EILB 2YARA 1URIA 2ZXWB 3SQRA 1AZNA 2BP8A 1NIBA 2YQBA 5EHFA 5I6MA 3MBWB 1OCCB 1RZQA 2QPEB 3ZIYA 2I7SA 4G72B 1QHQA 2IDQA 4DP9X 2YAOA 1ET7A 1E65A 1A8ZA 3TU6A 1JZEA 3WIAA 3FQ2A 4YSOA 2QDVA 2XU9A 3TASA 2GSMB 5FC9A 4DP8X 1A4AA 3PAZA 2XV3A 2PPCA 2UX6A 3FYIB 2IH8A 3OM3B 4AI7A 2MTAA 1SNRA 1KV7A 1XB6A 1PLAA 1KDIA 2YAQA 4HCIA 4GY4A 1QLEB 3SBQA 1PF3A 3TBBA 2PCYA 4BWWA 1JZFA 4BK5C 4DP1X 4YSSA 4G7RB 4Q89A 2X87A 2WO2B 3FU7A 4KOCA 4ENZA 1BQRA 3FQYA 3GXUB 3UADA 1MZYA 3FYEB 1AS7A 3UACA 4L0PB 1PCSA 2B08A 2DWTA 4DPBX 1N70A 1HFUA 3CDZB 4BXVA 1MG2C 2BP8B 3NJKA 5AZUA 3RYMA 2Y69B 2Q5BA 3HB3B 1KCBA 9PCYA 1HAWA 1AG6A 3N2JA 3NJJA 4CSPA 4DP0X 2H47C 4UF7C 5I26A 4A66A 2FNWA 2OJ1A 5D4HA 4YVUA 2YAMA 3QPKA 2VW6A 4YSUA 2YXWA 1GYCA 5TK4A 1ZIAA 3S3BB 1W8EA 1UATA 2IDTA 2CALA 2R7EA 3FSVA 1AG0A 3GDCA 5A7EA 4E9RA 5D4IA 2QT6A 3NJIA 1ZDQA 5TK2A 1AACA 2VN3A 3S8GB 3ABLB 3FU7B 1OOWA 3JT2A 4DP5X 5AFAA 2XVBA 3NSFA 1NIFA 3FPXA 3BVDB 4QLWA 3NJNA 4JHUA 1PZCA 1N68A 3PAVA 3OD3A 7PAZA 5I5JA 4E9WA 4NERA 1JXFA 2UXVA 3S8FB 1HAUA 3IN2A 4DP7X 1IBZA 1OE3A 3EH4B 4HIPA 1L9PA 2J57A 1PZAA 2HRGA 1OV8A 1PLBA 1NPJA 1ZPUA 1AIZA 1J9QA 4BXSV 2IAAC 3WKPA 4KNSA 2VMJA 2X88A 4HHGA 1EZLA 3HEIB 2PPDA 4AKQA 4GYBA 3H56A 3S3DB 2Y1AA 1BAWA 1M56B 1PLCA 3AG4B 5F7AA 3UABA 1M9WA 2MRYA 5I6OA 2XXFA 3AG1B 3V9EA 1JOIA 3QJUB 4CSZA 5PCYA 2BWDA 2JXMA 2PP8A 1OE2A 3NJGA 2QPDB 1IUZA 1SF3A 1CURA 3NJFA 2FT7A 3WG7B 5ANHA 4YSPA 2PLTA 1BEXA 2BW5A 5D4JA 1NIDA 1NTDA 4A67A 1CYWA 1RZPA 3FQ1A 1AQ8A 3SBRA 4AKOA 3D12B 2GC7C 1ID2A 1QNIA 1OCZB 2I7OA 3FSWA 1E5ZA 3NYKA 3PAUA 3CG8A 3FU9A 1WS7A 2IWKA 1FA4A 4WTQA 1M57B 3X1GA 5B1AB 3EH5B 1V54B 2HX8A 1ZV2A 2IDFA 1WS8A 3NSCA 1AZUA 3TA4D 2W8CA 5I6NA 1J5CA 4E9VA 3IE9A 3L45A 5B1JA 3X2QB 2VW7A 2IDUA 2XX1A 1JZIA 1FFTB 2UX7A 1PNDA 3ABGA 3PPSA 2I85A 4PAZA 2A3TA 5B1KA 4E9SA 2HRHA 4AKPA 4DP4X 3QJRB 2TSAA 2PPAA 2PCFA 1AS6A 5I6KA 1BQKA 1BYPA 1JZJA 1AOZA 1L9SA 3CVCA 1L9TA 2DWSA 4Q8BA 1OF0A 1GY2A 2H5UA 1J9RA 2AZUA 1AZRA 3ZBMA 1FWXA 3NP3A 1MDAA 5B7FA 2EIJB 1JVLA 2FQDA 3TBCA 3EF4A 1E30A 4BDVB 1SF5A 2IDSA 4MFHA 3WNIA 1GS8A 2YAFA 4G7SB 4HZ1A 3WNJA 3FSZA 1MG3C 1KGYE 1JXGA 2HX9A 4N4YB 3PCYA 2GIMA 4YSDA 2AVFA 4BWUA 5F7BA 3H4FA 3FSAA 4F7KA 1A4BA 1XB3A 1ASOA 1NINA 2BZ7A 1NIEA 1L9OA 7PCYA 1AZBA 1WAEA 2HX7A 3NSDA 4FAAB 2UXTA 2EINB 1XB8A 3KW7A 1VLXA 1SDDB 2GHZA 2GC4C 8PAZA 4JKNA 4KNTA 4NAJA 3ASNB 1NZRA 2GI0A 5B7EA 2PP7A 1MZZA 3WI9A 5I5IA 3FU8A 1ILUA 2RACA 2VSKB 3AZUA 5I6LA 2BP0A 2PPFA 2EIKB 3X1NA 3EH3B 3ZX1A 4EF3A 1OE1A 4FA7B 3ABKB 3OMAB 4K9JA 2H3XC 1NICA 3DIVA 4A2HA 2VM3A 1F56A 1WA2X 3X1BA 3BQVA 1YLBB 2FT8A 1X9RA 4GP4B 4GP5B 4TXVB 2UXFA 1KYAA 1NWPA 3X1FA 2BWIA 2ZOOA 2QDWA 5B7MA
chains in the Genus database with same CATH superfamily
3QIUC 1IKNC 1XGPA 4LGSB 4X7EC 1GL4B 3ZQXA 3LZPA 3MCLL 5F6IB 2F5BL 3P9MB 3JWDC 1YEDA 2PF6A 5IVOA 2QGBA 4UAHA 4PJXB 3EFDH 2VXQA 4ZK8A 2V2WA 2R1XB 4UB0H 2DQCL 5A2IH 2XV2A 1JF1A 4IGBB 4X7CC 3FK3A 5JHLH 2XZQL 1Q9KA 2QKIB 1LO3H 4PTTB 1J5DA 5K9OA 2XQYG 4OBRA 1E5YA 1BIIA 2FB4H 2IG2L 2P80A 3S3CB 1F0LA 3KXFA 4EDWL 3BKJH 5MEPB 2HKHL 2WP3O 5F7EL 4ZRGA 1IM9B 2X40A 5F0JB 3G5VB 4H0IA 5J6SA 5KZCD 2A83A 3GTVA 1JD7A 5LB1A 4XVJL 3S5YA 2W60B 3N85L 5EDSA 2WCPA 1GJUA 1QQDB 2Z4TA 1TKWA 1MCWW 5FA4A 5F97E 3OSVA 3LPGA 4LF3B 3LV3B 4OM0L 4PJAF 3AQDA 4JGJA 3LZNA 4UOW0 5I71B 5KVGE 2EZ0D 3HE6C 2NY4B 4XCEB 4D9LH 4C56E 5IZ7A 3SDAD 5EIIG 1MCOH 2VR6A 3OR6B 2OMVA 2X3AA 4NRYA 4DN4L 1VKXA 2YAHA 4DKAA 5IB1A 3CFDB 4OQTL 3GF8A 4YFDB 3CXDH 1IKOP 3S37H 4E41D 3MNZB 4HS8H 2BXYA 3JTTB 3Q2VA 1L6PA 3SGKC 1EEYA 3BFOA 5L9DL 1U3HB 1JERA 1T5KA 1VAHA 2FWSA 2R0LH 2ZKWA 3ZQ9A 4Z6AT 4AUYA 3R1GH 1G84A 4BQBA 1CG9B 4X0NA 5FKPA 3D3VE 3CXHJ 3JWNC 4AV4A 3ARDB 2IO5A 12E8H 3D25B 5C09A 3RWJB 2W0KA 4HIJB 1ZGLB 1IGTA 1JPFB 3CLWA 1I4FA 2APTA 1OGTA 1BVNT 4N5EC 4NT6A 4PBWD 3RIFK 3ASOB 1A2YA 1UYWH 5IOPB 2IAMB 2EH7L 5JR1L 2TSBA 3NP4A 4WV1A 1RJLA 2R2BB 4XVSL 1DP0A 5L2KA 4RMVA 3VWJD 1J9SA 2WUBH 3NEXA 4G7VL 4LSQL 4HAKA 4CVZA 3EF7A 1SVCP 1HYSC 4B5ZA 1TIUA 4P2OC 3GIVA 4FMVA 5D7SL 4JDEB 4OLWH 3HBGA 5DLML 2UWEA 3BAKA 4AV0A 3EAKA 1XR8B 4JDTL 7FABL 4FFVC 3QEUB 1AGBB 1L5GA 1EQWA 3VO0A 4EN3C 2Y2TA 2O6CA 2QFPA 3CLFH 1MCFA 2Z65C 5L88L 3C60D 2Z93A 5D5MB 1SEBA 2V3DA 4N0CC 5SWSD 2L8AA 3JTSB 4YR6B 3RNKB 3Q1EA 5EWIL 3V79C 3QNFA 4PRPE 4M6NL 3EFFA 1ILSA 3B2UD 4QOKB 3A4AA 1GVIA 4JPKH 4M00A 5E8OB 3EZJB 2IQAA 1FF5A 2VZVA 4PEEA 1FHNA 3MLUH 3DETD 3FTVA 5D1XC 2E76C 3BH9A 2ENJA 3GZOA 2J56A 1F3JA 3ULSB 4ZSOE 1ADQA 4XH2A 1L4IA 1NGWB 4DZBA 1IBYA 3GUFA 3QDJB 1J10A 1OP5H 3QIWA 5CNHA 5AKRA 1RJZB 2C1PB 2ZCLH 3MBWA 1VEPA 1V3LA 2CJ3A 5ABAA 2XKSA 3PDOB 4MGXA 3P11L 5DC4B 4A2GA 4ZMPA 4TM9A 3KLAB 3MBEB 3GSUA 3LKOB 3CWGA 1BEYL 3VXMA 1BLNB 3WEAA 5HJGA 4KROD 3STZB 5IROC 3RFZA 4G3YL 3I50L 1F90L 5A6LA 4BFGA 1OD9A 3BEWB 3QIUB 4Z7QE 4OUUB 4L3FA 4ZTOL 2W0FA 5DHMC 2XZAL 4ZS6D 3H3PH 3G04B 4I9WD 1B3JA 4HHWA 5CM1A 3FTGA 5D1QE 1IB5A 1USQA 5JW4Q 1V3KA 1WITA 4FYTA 5HGAB 2FHBA 4I0PC 3L81A 2P80D 2J4WH 3O81A 3KXFD 4E36A 3OV6A 4DETA 2L4OA 5ICZA 4QKTA 2Z7UA 1F11B 1PIGA 4RMWA 5IGXL 1M1XA 1MFBL 3CFTA 1PDKB 2BP8A 3ABZA 3GBMH 2AS5M 2F19H 4JFOA 1IBFA 1RZQA 2CM5A 1QASA 3PP3H 4FXGA 5KYYB 3CVHA 2BS9A 4QD2E 4EI5A 4BSWB 1NJ9B 3S97C 3TV8A 4BJLA 5CU5A 1CO1A 3DO3A 1AR1D 3W37A 5DUBA 4OKVB 1KCUH 2QDVA 3TASA 3EYOB 5IB5A 3SKNA 1ERNA 1JZ6A 3HE6B 4IMKA 2XICA 1KJ2H 2X2IA 3B6SB 4S11A 5IWLC 3VWKD 3RHWK 4WWKA 4MJHA 1Q1PA 3LEYH 1Q8MA 1PLAA 3QEQB 2BM3A 2BVQB 4LBAA 2NUTA 2VMCA 5TF0A 4JS7A 4PJIF 5H37G 1UGKA 2ZG2A 2H9GB 3B7TA 1D5MB 2CUMA 2KLSA 1FNGA 1ZK5A 2JB6A 5M95B 1O6VA 4H8PA 4EVNA 4YSSA 3IAGC 1INQB 4LIQH 4AVIA 3NDYE 4QTHA 5FWRA 3AAZA 1BQUA 1IAOB 5AB1A 1TPXC 1AS7A 1C5BH 3VSUA 4JY5L 1U3NA 4HF5H 2FX8L 4OZFB 2DWTA 1YEHH 2CK2A 3ULUC 4X6EA 4MD4A 4UIMB 5DTFA 1M7DA 4JNXA 1GGBH 3RX7A 3VYPA 3BUPA 1XAKA 3E8UH 2B9AA 1B9ZA 1IE4A 1ZHKB 1IRAY 2B1HH 4PRIE 4ZXBA 5AW5B 4F20A 4N90D 4FDWA 4R4BB 5BJTB 2WIIB 3N2JA 2VITB 4N2GA 4CA4A 4D7PA 2VJ0A 4CU6A 2LU4A 3U4EB 5DZOA 1DLFL 4TKWA 3WOVA 3T0VA 1KG0A 3MGOA 3MRNB 4F58L 1X4YA 3FQRA 4XHQA 1MCSA 2Z1KA 3LB6D 2IDTA 4QRPB 2CALA 1MCHA 1UT9A 3O2WL 4XP5H 4L9LA 4G1MB 3VSQA 3APFA 4ZUUA 3U4BL 1F3DH 5JNYB 3MVSA 1AACA 1KZYA 2EXYC 3CFQA 3K2KA 3ABLB 4U6VH 4V1DE 1MWAB 4PREA 2HMID 5JHDB 4DGWC 2VC2H 3NJNA 3W9EA 1NAMB 4F7EB 3CQFA 3CZFB 4AYDC 1UACH 4JFQB 2WXQA 5TE4H 4XX5A 4Y5VB 3GMRA 1RI8A 5BQ7A 2FJUB 3O4LE 4U1MA 1JXFA 3FT1A 5HHMB 1ES0A 3OAYH 5D1XB 2QQLH 4BFFA 5I8OL 1P1VA 2FEJA 3V0WH 1JWSB 2XA3A 5INCB 4JO1H 1NL0H 2ZCHL 4BXSV 2BOBA 4ILDA 3SHSA 3K5SA 3ESMA 3CHPA 2L0DA 2LVEA 1WHPA 3QORC 4A7GF 3N43B 1UFGA 4ODHL 4ELKB 3QULA 2GCYB 3ZMNA 4UTBH 3VXMD 2UUDH 4XP4L 5DD5H 3IDNB 3S3DB 4XZ4A 1FL3B 2V5SA 1P6FA 1P4BL 4FYSA 3WNOA 5EMYA 3JWOH 3PE9A 1MJUL 3UBHA 4AK2A 2XPYA 3BPLC 4YDIL 3TCLA 1XIWA 2WLZA 3OAUH 1UC6A 5EBLA 3GRWH 4MHHI 2ZOKB 3CK0H 4NBZB 3GJFB 4XCFH 4NJAL 3BUDA 4FEIA 1JV2A 1RAMA 1WZKA 4IRJC 3TPUA 1MHPL 4AYFB 4ANVA 4XNYH 2ZUQB 5GIRA 1GOFA 4ATWA 4JVUA 2DJMA 4I0PB 4K7FB 5E0QA 4TQIA 2W65B 1J8HE 1N0XH 4KTDH 5I73B 5CGTA 2W80C 1DBBH 4YK4B 1G7JA 5F7MC 5AYUH 1KBGH 1VFUA 2YN5A 3UJJL 3MQIA 4MA1B 4HUVA 3X1GA 2C3WA 5A16B 5J56B 4EI5D 1V54B 3ROOB 4CBPA 3R06B 3WFBH 1NEZA 5F0PB 1WZAA 3H7BB 4XWOD 2CBQA 3RUGB 3PREA 5CUSL 1QSZA 1W8NA 3OHXA 2P45B 2W8CA 1OPOA 2VR5A 3OKMB 3V0VB 3IE9A 1IM3B 4E9VA 1WIUA 2ITFA 2VW7A 3HHSB 1KEGH 4P2RB 4OM1L 1T7ZA 2XWTB 1U3YA 4N2EA 1ZHNB 5T1MB 1YNTF 3CSBA 1KCSL 5AB9A 4OLEA 1ZSDB 2TSAA 1AS6A 4D0CB 5GRXG 1JFQL 2Y7QA 2MOVA 1TZOA 5T3XH 4MNQA 5C08E 1TPXB 4KPHH 4LO9A 4HK0A 4J7RA 3UPRA 3R0MA 3PABA 4PJGA 3DGGA 4JFEA 1AZZC 1U8MA 3NP3A 3HCVB 1E9PA 3NZ8A 1TTBA 1U0QA 2ZSVA 3T65A 1DEDA 1DEEA 1EDYA 1JVLA 3EADA 4UYQA 1F41A 1AMXA 5DZLA 3TBCA 4ZXBD 1ZVSA 4WY7L 3X11B 3F7YA 3HFFA 4FABH 1S8DB 3CQPA 4MJ2A 1ZANH 2E8ZA 1SY6A 4MJ6A 4R84A 3MXVL 5IJKC 3CX5J 4KAQH 4RA0C 4IMLB 1Y1UA 1Q90A 2NX5E 1XB3A 4ZW8A 1EFXD 2DQEL 1YVLA 4EPSA 3QDAA 4F8TA 1FPTL 2MQCA 2YPVA 5C0BE 4AJVA 4WI7A 5C0GA 3WELA 4NZTH 1P84K 1TZ8A 4N8VG 5ESAA 5AD0B 5IESH 2DQDL 3FC8A 3TM6A 3HNVL 4NI3A 3VTAA 2QR0A 3MV9A 1DQJA 2FSEB 2GI0A 1LE9B 4HC1A 4Q6KA 4FQXB 4WI4A 1PCXA 5I1KL 2AEIT 3ARGA 4KJPD 4FG6C 3FU8A 3TH3T 3IPEA 2IXQA 5FR3A 4P59L 1G7IA 2DWEA 5DJCA 3EJJX 1DQML 2QZ5A 4JKKA 4M48H 5I1EH 1L0YA 5F1IB 4QRBA 3SGJA 1ACCA 4NO5A 5HDQL 2D0FA 5MEOA 4OFQA 2VM3A 4UDTA 4OLUL 5FM4A 1XF5B 5CN3A 2OX5B 2E6PA 2EO1A 4IIZA 4RAUB 2XN2A 1YLBB 3F64A 4WSJA 4XCNA 5DRXA 3B7SA 3U6XS 5CZVL 1YPZE 3QORB 4M5YL 3X3FH 1E4XL 4XBPA 2QDWA 5KSUB 2D73A 3BZEA 1EHKB 1T4KA 1EJOH 4JHVA 1OGAE 5MENB 2C4FT 1FG9C 4FNPA 3RWDA 2YOCA 4YL9A 4C8XA 1KDJA 4JRLA 5FO7B 5B39B 1KSRA 4K9EH 2EDNA 1A6VL 3EYSH 5I6XC 3TLRA 3I9GH 3INUL 4MAUL 3BPLB 1RVFH 4GBXD 3CN2A 4QHPA 1DDHB 4XVUC 2R4SL 4FXKC 1PNCA 5DRWB 1DVZA 3H4HA 2VXVL 3EBHA 1ZLEA 2P49B 3IMSA 3C87A 5SX5K 5T1DH 1U41A 1YHPA 4IRJB 3TV3H 4YHKL 1U91B 1AGFB 4WIQA 5D7KD 3LVTA 2G4EA 2OSYA 1EZUA 4XN5A 1ZA3B 2BC4B 3OMIB 1MCWM 4OB5H 4JFWA 3UAEA 1MFAL 4A68A 3T8VA 3ZE0E 4YDVA 5GZOA 4U31A 3N44F 3KL5A 4YX2H 1BOYA 1JV5B 3SDYL 3D18B 3S35X 1OM9A 3IDIB 3T4YB 2XPGA 4AQOA 2GUOA 3RWFA 2LE9A 2AK4D 4RLDA 5GS2H 4P9HC 4XCYA 1ZLSL 2R23B 4O02H 4YIQA 2WXGA 2X89D 3DHPA 2PO6C 2QFRA 1T89A 3OGCB 4FQJL 3EGDB 1CYXA 2VXSL 3GIZH 4FKKA 1PZBA 4JPVH 5FYKU 3QZMA 1XH0A 3FB8A 4H8UA 4Y0GA 5I16A 5C7XL 3AS2A 4Z8FL 4YEFA 4MMYB 3NJVA 4L4TA 3QARA 1KELL 5DYOB 3UTSB 3VDCA 1PG7X 4L1BA 4MNQD 4OJYA 1IC0A 2WJ5A 4RMQA 3IN0A 1T21A 5EZJA 2SEBB 4TPRL 4BRVA 3QJHB 1XGQB 1IGIL 5GSVA 3CZUB 4DHLA 2AANA 3VRIB 2A74C 4Z7OF 3WKQA 2EIMB 2D7OA 1CICA 3VDAA 4GRLC 4JM2F 2YFNA 3HPLA 4XMKH 3QG7L 1UXSB 5EV7A 2PWFA 4MD5B 3NG5A 4B9JA 4BCZA 3HE7B 4X5PA 5AW3B 1MFDH 1PJWA 2EXWC 4FI7A 1G7HA 1KCRL 2ZWNA 4M8UA 5A2FA 1F86A 1R3LB 2VDRH 5HHPA 4BWTA 5I28A 1KXHA 1LYQA 3DIFA 3M1CA 2XKNA 2R29H 3B3BA 4J3OC 5ANME 4DGUA 4TYUA 2VR9A 1M1SA 4WEBL 4APXB 2FQFA 3S9DB 4KXDA 3GGWA 4YPGB 4HUXA 5ILTH 1QLEH 2QQQA 5F70A 1C1EH 2Q8AL 4WNSA 1FLRH 5FM8A 2AFNA 3MX0B 4QXWA 2X09A 3FT4A 1AHWA 4RSVA 2D7MA 3CCHB 5HYJB 4J27A 1EMTL 3KL0A 1XF2B 1SYVA 3QZBA 1RUPL 3HS0A 1B3IA 2E56A 4PJ7A 1X6NA 2NNAB 4AXWB 4NKMB 3EJQA 4MD0B 2CO3A 2EIDA 3ZMEA 4FNLH 5DVLA 5J7CC 2BOLA 1BVKA 2BRRL 5ISZE 3E3QE 4X9GA 2BP5M 4F7CA 1KXVA 4XNAA 4PJBF 4JPWH 3IJ8A 3SE3C 2WV3A 3H0TA 4MQXC 4QRRA 5CCGE 3QXAB 4NQEE 2ZF9A 4TNGA 4X6FA 2DQUL 3L4YA 3Q6FA 4ZT1A 4WKXA 3RX9A 2UYLB 1DYZA 3VFMB 2FT6A 4PLJD 5LAPA 5IY5B 5HHXH 5EOCJ 1NKOA 3QUXC 5HYEA 5C0CA 2FQGA 5KSBE 1MFCH 2D4DA 5IJCC 3FB7B 4N8CL 3W5MA 5FDWA 3QWOA 4XXCC 4ZW7A 3UAJC 5KUKA 3HC0A 1AXSA 2Y07H 1YQVL 3GSWA 4XO9A 1AQMA 1OAQH 4D0DB 4F57L 3FQ4A 3CHRA 1FBIL 2HRLA 2OAAA 5DS8B 5C0AB 3BWZA 5I6XB 2COVD 1E4KA 2O6DA 4Y5YC 5HDBB 3VD2A 4UZSA 1ICTA 1EGJA 1FYTA 5E6IC 1GSKA 2VL4A 2CO2A 4NQCB 1T83A 4JM4H 1MI5A 4KRMB 4TNVK 4FXKB 2OCCB 3UERA 1GS7A 3PWPE 3QJSB 1NMAL 3QXTA 4YDKH 2WXJA 3C8KA 1JZ5A 2YXMA 2YAPA 4XB3A 1L0XA 4ZG1A 1YSOA 2X7LA 4ZTPH 3BT2H 1URIA 3C2AL 4AYBA 1IGJA 3KYKH 2AK1L 4S2SB 4FKHA 2ARJB 1RUML 1HOEA 1CDIA 2WMPB 4UTAL 4JFTA 5GZOD 1D9KC 2ESVB 5EC2A 5EZLA 1A8ZA 4DW2H 2FGWH 3UTPD 3P9WB 3A5VA 4MASA 2GSMB 2W92A 4U2YA 4WUKH 3OM3B 4ZFOA 4AI7A 2MTAA 3VRJA 2V7HA 3MNWA 1DSFH 2VLKA 3RJQB 1PF3A 2CO4A 1NFAA 2PO6B 4N2CA 2WNWA 1MFVA 3KPQA 5F2FA 5BMFH 1ACYL 3FQXB 3RB7A 1OTTC 5J3HC 2YGOA 3QNXB 2E7LA 1ETZB 2EDYA 1TQCB 3HFML 1DQDL 1GKOA 3GK8L 4Y19D 4I48A 1IGYA 5ALCH 1IQDA 4L4TD 1SM3H 2QZQA 4PJFB 3AU0A 2H0EA 2PYEB 3DX3A 3L4TA 3QQ9C 4PGDA 4WU7B 1A8JH 1OSYA 5J4MA 4YXHL 3WHXA 1GIGL 3RAJL 3VFUB 3CDZB 1OAZH 3HG3A 4Y4KB 1CICD 1DBML 1P7KB 2A74B 3UL4A 43C9A 4A2MA 3B5TA 1JSYA 2QVFB 2LR4A 1Z9SA 2VZTA 2XG5B 2VDKH 4GRLB 5DJDB 1AMYA 1M05A 5SX4H 5DHYB 3WY1A 4LLWB 1TETH 5SWZB 2F54B 5E2WL 1I1FB 3PXJA 1CGSH 3NUKA 3PS6A 3H9SA 5IBUG 5JPNB 2AXJA 2YSTA 2NR6A 4UF7C 2ADYA 3DJRA 2ICWJ 4BH7A 2CLZA 1MDTA 1A6WH 1Z3RA 3CFCH 2HJFA 3ZN6A 3QNYB 3T2OA 4ICWA 4XNUL 2ZIDA 3B34A 4U49A 3RPKA 1QI5A 3MCKB 4BZ1A 1JP5A 1GA2A 3LKRA 1INDH 5FYJE 4XPBL 5C0IB 2C9UA 3W1ZA 3P3SA 3DGCR 3BVDB 3KPLA 4GQ9H 4YWGL 1FGVH 3SGEI 3FRPB 1PSKH 3HR5B 4ZDHA 3SCMD 1PZCA 2GPZA 4DEWA 5I1CH 3EO0A 3SDDD 4DOHE 5F7YC 3OTTA 2BSBA 1WCQA 4G1EB 4YLBA 5EO0B 4JKLA 3RGBA 1KXQE 4GAGL 4ZMOA 1BREA 2F1AA 3UZEC 3IN2A 5KVEL 1LO0L 2WLLB 2XVKA 4I4WA 2OR9L 3VXRE 3ELQA 1B2WH 1I8LA 1OV8A 3PWVA 3QA3B 3VH8B 1W72H 3MGAA 3OXSA 3WKPA 3C5JB 4PJIE 2AJ3A 3SDCC 1EO5A 4FFYL 4PJEA 4QI3A 4J6RH 5HHQB 2IQ9H 1G6RH 5CEYA 4OW6A 1EHLL 5KN5A 4K23L 5IMOB 5HI5C 1UA7A 1PLCA 3C60C 4BFEA 4FFWD 1UD2A 2C3HA 1QNZL 2FRGP 2H0JA 2BJMH 1MCPH 2J2ZB 5F89A 4N2KA 3S35H 3ALPA 1G9NH 4QCIB 1HWGB 4CSZA 1I1CA 5T1KB 2BWDA 2J8UB 2VLRB 3HLKA 4QY8B 3UO1H 1A3LL 3B2UC 4P2QA 2JE8A 1RURL 1KCVL 1IUZA 4WWPA 3SN6N 4FNUA 5KYXB 5J3HD 5CP7A 1CL7H 3CC5B 1YEFH 5T5FH 1PEWA 4Y5YB 5D4JA 2B4CC 4XMUA 4UINL 3MOQA 1MI5D 1CYWA 3APMA 5TD4A 1GC1L 2WGXA 3P2BA 4Q7DA 5K59F 1A6TA 1WD8A 1AQ8A 4TNEA 4D9RE 5B38A 1YJDC 4MXQD 4H1LA 4K55A 5A43C 3D87B 3H2WA 5FYKL 1QSEE 4Y7MA 1OCZB 3DROB 3BVUA 3EDFA 1PG7H 3TA3D 2OZ4H 5GQBA 4F8LA 3HZVB 3E1F1 1D5IL 3MTRA 4XMPH 4Z76A 4XGZA 3T08A 3TC9A 1E8XA 4U0RB 3L5JA 4KROC 3L13A 1B0RB 1D9KB 5FK9A 3RVTC 2AI0L 1WC7B 1XXFC 2DMKA 2DQTH 3ARBB 4Y9BA 2XYCA 3TH4T 4YQXH 4M7ZC 2J25A 3ZUCA 4Q9CA 2WLNA 2IG2H 1JZIA 5HGHA 3ZU8A 4U3SB 4GKZB 4WNQB 2JTYA 1YECH 3VGGA 1UZ8A 1EO7A 4ZS6C 1I7RA 2Q7YA 2LU5A 2YZ8A 2B2XL 4FTVE 4AKPA 2DQGH 2YKLH 1U8HA 3D2UA 4ANXA 3SKOA 2VISA 1BQKA 1ZY9A 4CC4A 5KJRH 2H6UA 3JV6B 4GQRA 4PWJA 4HXAL 3SD2A 4OM0H 4OI9A 4BUGA 3HG1E 1FDLH 4L3CA 4B53A 3FAWA 5IV2B 1U95B 2EXSA 3MGTA 5KZCB 4J4PA 5E94B 3RKDD 2YPLA 3G6JE 4GLRI 1F1GA 3AREA 2O61B 5G5DA 1U58A 1G4MA 3GMOB 3QO0A 1YN6B 4L5FH 4LASH 4JO2L 4C56D 4HKJA 3MSPA 5F96H 2OMXA 4LGPB 1AR1C 4NZFA 3TBWA 1WCBA 3C5ZC 5AL0A 1A21A 5D7LA 1BBJA 5ID1A 3U46A 3FSZA 4GJTB 3NCYP 3VWKC 2PMZA 2J8OA 1OXYA 2HX9A 3SDAB 5ICYB 5AVUB 1X5AA 3BQUD 3OF6D 3WIIH 3W2DL 3RX5A 4NEHB 2ZOTA 4Y4HA 1JVKA 3ZLQC 4F7KA 4HHAA 4I18B 3P73B 2HFFB 3BW9B 4E41B 5DFVD 2E59A 3D3VD 1IKFH 5FCUH 2Y36H 2X3BA 4PB0H 5JR1H 5GISL 3QJOA 2PCFB 4Z18A 3T0DA 4JPIA 3BIKA 2C9PA 1BZ7A 3T8MA 1HSAB 3T6QC 2AXGA 3ZDYF 3V4PB 4DGVL 2B0SH 2GC4C 4NC0B 2P8PA 3UZQB 2DW5A 1HQ4B 4Y4FA 3RGVB 4HIXL 4A6YB 1OSPL 4JJ5A 1H15B 2V6HA 3IFNL 4HEME 4GUPB 4NYLB 2JWYA 4KKAD 4XNMB 4WV1C 4PRNA 2EP6A 2DMHA 3WTVA 4RMUA 4NCDA 5FOBA 3ZX1A 3VWJB 3JVFC 4EF3A 3MYZA 3QJZA 2BSEA 1DL7H 4KHTL 4XBEH 2DWDA 5A6IA 4H40A 2R69L 1ECYA 1XR9B 2B59B 4PJXF 3V52H 1RZJC 2W1NA 4QAWA 1PU0A 3F2LA 4YO0B 4HX1A 3LB6C 1DUZB 1FJ1B 2V5RA 2HVKA 1SDYA 1R5WB 1XBDA 3TO4A 1XZ0B 2X6CA 5EUKA 4BHUA 3MRLA 2LGNA 4JLRA 3C60B 2L7QA 3QXUA 4PRPD 5SWSB 2YD1A 1G0YR 4YBHA 5KTEH 4WDIA 2HMIC 2YJLA 4DK5A 4UM9D 2JCWA 4WFHD 5E4EC 3MUGB 4KI5D 2G5BB 3WTXA 4JO3H 5BO0D 1F8TL 1XCWA 3QJTB 1TYEB 4AUUA 3QG6B 3SEPA 5LJYH 2VERN 1CLYL 1I9EA 2HFTA 3P11H 1GJWA 5KJ7E 5I17A 2WLMA 4M62H 4ELMA 3P4NB 4F2EA 3VQ1C 4Q0XL 3ZDWA 5LBVA 3D0LB 3CPLB 4G42B 3QCUH 3DXAA 2BP0B 4RVBA 2OMZB 2A6DB 4LLQA 3G5WA 5DJ8A 4HCGA 1MNUL 4R97B 2ZWSA 1MREH 2VNCA 1XGYH 3QRGH 1PD6A 3R7QA 2D3VA 1I8IA 5EFIA 3ZMRA 2Z91B 3ECBA 4I77H 2E74C 2CPCA 4PM1A 3FNKA 2A38A 1YEDB 1QYGL 1ASQA 4M6OH 3HOGA 1P6WA 2H3NA 3E80A 4WGWB 2V2WB 4HJGB 3BDBA 2A6IA 1KBVA 5CEZH 3D2UD 4YH6A 1UT1A 1FP5A 3MLWL 2AQNA 2DLFL 2ZSWB 5K9OB 1XGTA 3X12A 1BIIB 3P4MA 2V17L 3KXFB 4FQIH 3TO2A 2YC1B 3ZT7A 3W39A 4LCIL 1CFVL 3VMPA 2BH0A 4X99A 1RD6A 3LSOA 1XEUA 3MROA 3LMJH 4Z0BH 3E9TA 2HB0A 1JGLL 3PV6B 4R6UA 4RMBA 3UMNA 3V0DA 2IBBA 4NHCL 1TKWB 4RGNE 1SMAA 2AV7A 2AEPH 3WE6B 3WS3B 5FA4B 3QXVA 4ES9A 3F6LA 4B9PA 3FO1A 5D7IA 5AW7B 3SB3A 1IE5A 1AR1B 5C1MB 3DHMA 4UT7L 5LQBL 4ADJA 3LQAC 3GRGA 4FNQA 2GTZA 3VWKB 5BOPA 1BBDL 4LKCB 2CAKA 4NRYB 4HUUB 3BWSA 1VKXB 5IB1B 4Y4HD 4E9YA 2FEDC 2VYRE 4IDJH 4JY5H 4LDCA 5HVWA 4L8CB 2BHYA 1CT8A 2YQGA 4PYHA 2PETA 3CZKA 3MR9A 4OVUA 4XC3H 4JHBA 1UENA 1RKRA 1EEYB 4HD9A 1HL9A 4LLYA 4WW2C 1M7XA 5D2LA 5DUPL 4HFWB 2WY3B 2BW4A 3IEAA 3OPZL 1WWAX 4UT9L 3BD5A 2KH2B 4MZIA 3F7LA 5J12C 2VMFA 1OEZW 1OO2A 3B2MA 2EVIA 1IGTB 4K7PX 5DMJB 3ZDZF 3CU1A 1I4FB 1N4XH 5ETUA 1BZ9B 4PRID 4PGBA 2A99A 4MCNA 4Q9BA 1E6JL 2K3HA 4WV1B 1RJLB 3OAZH 1KULA 2XCMC 2FWLB 1CF1A 3NPSC 3EYUL 3VMOA 3REWA 1MJ8L 1ZHLA 4LLAA 4MJ5A 4AEHL 2BSED 3NCFB 4X98A 3VJ6A 5E2VL 2VUYA 1WVZA 3K80A 2UWEB 2YWZA 2JMRA 2Y25A 4OIIH 2BVOA 5CCKL 3F00A 3W0WA 3KW8A 3F05A 4AX3A 4A2DA 1Z5LA 3NPZB 3TO4D 3PRZA 3MJ8B 2YD5A 4I0KA 5D2NC 2XQYK 2E8YA 4N2AA 1A3ZA 2Z93B 5F71A 1PZSA 1SEBB 3EH2A 4Z7OE 1QKZH 3ZRCC 5E4EB 3P0VL 3FTUA 3DSNA 1HE8A 1XL6A 3O4LD 4N0RA 1KFGA 2OI9C 3EFFB 3QR2A 4O58L 5I0VA 4KJPC 2G3ZA 2KS0A 4B6ZA 4KNUA 2IQAB 2NY5H 5CCHE 2DOCA 2X9XA 3BH9B 3KMDA 5EOCL 2R56L 4XH2B 4H5SB 1CGTA 4DZBB 1K4DA 1RUAH 2JLLA 1MFMA 1NPUA 3EH1A 2RR3A 3MBWB 5EHFA 4YDZA 1CGUA 5E70A 2I7SA 4UNVA 2K8QA 3BPOB 5A7BA 4EZMA 4CKVX 3O9WC 1IGCH 5GGSB 3GSUB 1XH3B 3VXMB 3ML8A 4QF1B 4OKDA 2ZP9A 3WHE0 1MAJA 3QH3A 3RFZB 2X0WA 5K9KA 1UWEH 1G1OA 1WK0A 3EYVA 4N0FB 2FX9L 5HXMA 5J8OA 1KIPA 1ZV9A 5HDLA 1BZEA 4MZ3A 1L7IH 4L3EE 4GBXC 3QC5X 1TTFA 5JQHC 1MCKA 4WEUD 2JJWA 3DARA 4ENZA 3NFSH 3F7VA 4Y2OB 4OVVA 1H0DB 1SLUA 3FTGB 3UJJH 1UEMA 3AT9A 2F2HA 3L08A 1J8HD 1SPDA 4L05A 3FYEB 1QZNA 3QK0A 2H32B 1F3RB 2Y3NA 4OCYL 1R3JA 4Y9EA 1MHEA 1CDUA 5ICZB 4EDXA 1HIML 3KWUA 5I1JH 2VMEA 2CGRH 1HFUA 1HHJB 3BYYA 2BY3A 2BP8B 4OM1H 2C9AA 4GKSB 2Y69B 5TE6L 4P23A 5LBSA 3H42L 5EU3A 4YXLH 3CVHB 1BF5A 4EI5B 1NM9A 1ZGLP 3QUZA 1BOGA 5CFAA 3OHXC 4NAMA 4CSPA 4FP8H 4KHXH 2YD2A 4YE0A 3GTNA 3BPNC 5DUBB 5LDSA 5J1AA 1HCVA 2WKGA 3Q01A 1WUNT 3FZUC 4XZUA 3DUHA 3MJWA 1ORQB 5CO1A 1J5IA 1BGXL 4YGVB 2F7PA 1VPOH 1YN7B 2VSCA 1R3IH 1KOAA 2IGFL 4AL8C 3OKNA 1PAMA 1KYUA 2Y7MA 4EVNB 5C08D 5F1SA 4LRIC 3HMXH 2BVEA 2XVBA 1EIBA 3S34H 2EDBA 4OLXL 3ZTNH 2LAGB 3H9HA 1DHKA 3GMLA 4GKNA 1OVZA 5C07E 3G6AA 2Q6WA 3TFKC 5B8CC 7PAZA 5J12B 1MUJA 5IQ9A 4ODTL 3GDBA 4FX5A 5IJDC 3OB0K 3N43F 1OSZB 1J87A 4MD4B 5TFSH 3HLAA 5DTFB 1M7DB 3P2DA 5IHUH 1ZS8A 2JKIS 1HXYB 3FCTA 1DVTA 1U92A 4HBCL 2YUXA 4JR9L 4GRMA 5EU6A 2EUZA 4NZUL 4ZXBB 2C9SA 2DEXX 4I3SL 1R46A 2NX5D 1JYVA 4JFFE 2ICEC 1F4YH 3HEIB 5FGSA 1S5HA 1OARH 2HFGH 2XIDA 4W6WB 5MERB 4AIZA 5C0BD 3BRDA 3LPPA 5IQOA 1M56B 1EFXB 4H20L 2QBWA 3BP7A 3KPPB 2BNRA 1EJFA 2NY0D 2X4PA 4L9LB 4F9LC 3P2TA 3Q2CA 2FBRA 5D2NB 2WZPA 2JXMA 3NACL 3O6ML 4P59H 4PVNA 3EHBC 4BK5A 1KLUA 2O26U 3KVDD 3MRDA 4G5ZL 3IXTA 1GAFL 3PJLA 4EZKA 1DQMH 3LZFH 1C12B 3W9EB 2O6PA 4QJ4B 1A22B 4M7JL 4HPOH 3N1FC 1D5ZB 4X9HA 3MRHA 2OI9B 3VFOA 3DSFH 3IFLL 4U1MB 3PF2A 3RUGF 1IQWH 4YDMA 2WXLA 4U1IA 5CCJA 4DVRH 4RDQF 1RULL 2TRYA 5FV2A 3UEZA 3NQKA 2I9TA 4ZQTA 1G7QA 2CIKB 2VABB 2V9TA 3F3HA 3MNMA 4YZFF 3RILA 3GLEA 5L8JB 2EACA 3L7EB 4HZLA 4XXWA 3V0AC 2GVYA 4AMWA 3QULB 2IDFA 1WS8A 1OGAD 4Z5RA 2WLKA 3EJTA 1KJVB 4F8OA 2J6EL 3G7TA 1BPVA 3WFDH 4L3AA 1WQVT 5L6YL 4B97A 1AGCA 2A77L 2D7PA 4OFPA 4N1EA 1RIVH 4QHKI 1XF4A 4JQIH 3TCLB 3SKJH 1Z9PA 5EBLB 4EIGB 5K39B 1JGUH 2WJ7A 4GBXB 5E0FA 1JZJA 2HFEA 2BPBA 3L4WA 4JM0A 1JV2B 4K3GA 3QCVL 3ULUF 3TPUB 1WT5A 3L3KA 5H35B 1OF0A 3MPCA 1QPKA 1RUKH 3L3DA 4W9GC 2C7FA 1NQBA 4IQHA 4YHNB 4GSQA 3MA9L 4LSSL 5FKAA 2OULB 3HHRB 4HCRH 3X14A 3IKCA 1G7JB 1LD9A 4X0KB 1X5KA 4WUUA 5HI4D 4AW7A 3DV4B 2R8SL 4HUVB 2AXWA 2ZZUT 4K7PH 3F58L 3ES6B 3T4AA 3VVWA 2EDHA 3NQIA 2AK4B 5C7XH 4O4YL 5MHSE 2CRIA 4MZRA 3P0YH 1CTMA 4LARH 4UQDA 2H41A 4XMLL 3OHXB 4YSDA 5SV3A 2AVFA 4JHAH 3UYPB 3OL2A 5DD1L 1U8CB 1X7TA 3BPNB 3H4FA 4X8JB 4FQPA 3QJFA 3RJDA 4G8FA 2MCPH 5JIQA 5BOZG 4M03A 4PY8J 1IJNA 1WBYB 4ABUA 3PWJA 3TONA 2HX7A 4U3CA 1UKTA 4QGTA 2YXFA 4EZLA 2AQ1A 3MV11 5IW6A 1ZHBB 4N0UA 4DKEL 3FRUA 3GMPA 4RNRB 4MNQB 1H8SA 1A6ZB 3H55A 2NQDA 1R6VA 2IANA 1B6UA 4HK0B 1CICC 5E23A 5C9JB 3PABB 5I5IA 5KVDL 1MNNA 3DGGB 1IC5L 4ZFGL 1U8MB 4I88A 5DWUH 1TJIH 1TNNA 3T0BA 3X1NA 5I19L 3CXFA 2ZSVB 1RZKC 1JPSL 1WIPA 2WOBA 3LXAA 2HTLC 1NBYB 4QLRA 1OAKL 3BWUF 3QUMH 5DUML 4RMRA 1ZVSB 2Z8SA 4WZ9A 3ZHKA 3QYMA 3HG5A 4LBEA 1EMTH 4MJ6B 4OLYL 4YHIA 2EDXA 1KYAA 4JQVC 4N5UA 2ICEB 4OZGE 1NCCL 1R3KA 1FAIH 3BAEL 3US0A 5C0RH 3FQUA 5EO1B 3WN6A 1FL6A 4OV5B 1QVOA 1GZQA 3CE1A 4OCMC 2W07A 3CNKA 4MTMA 4M7LH 5J6HB 1KTDB 4JRXE 3QIBD 1ZDSA 5C0GB 3QHFL 3SCMC 2X6AA 5ESAB 1WWBX 2J55A 4WTZA 3SDDC 1XMWA 4PGJA 1AJ7L 3AC0A 5ISZD 1N7ML 4OZIA 3D85A 3AGVA 2QR0B 4JE4B 4BD4A 1HZHH 1WA0X 5GSRA 1KIUA 4J1UA 4L8DA 1N0LA 4NQED 4Q9QH 1R1CA 1XXDC 2X4NA 4PR5A 5JYLA 3QI9A 2AAVA 2XG4A 1JD9A 1G7IB 5EU5B 3W38A 4ETQA 5KS9A 2KZKA 1VEOA 3FT9A 4OGAD 1DO6A 2NLJA 4NO5B 1U30A 2W0PA 2HPOA 1IVLA 1EHNA 2Z35A 1G1KA 4NZRH 4UDTB 2YA1A 4NQSA 1CFNA 3WIFB 5DRXB 2CKBA 3DBSA 4XCNB 1OZUA 2YO3A 4IU3A 3L3HA 3S4SA 1UH3A 3DX0A 2VLJA 5IEKA 3CSYA 4K3EL 3ZDYE 2Z8VC 3FU5A 3BZEB 1ED3B 1T4KB 3SYAA 2KDGA 4M7KH 1HHGA 4UILH 1SXAA 3ARFA 3GLZA 3HRZA 4M3JA 1X9UA 3FO9A 2XN9A 1IT9H 2PR4H 2X9WA 2MOGA 4F2MA 1WLHA 2IGTA 2JTDA 3K6NA 4AJWA 3WJLA 1GGCL 4OTXL 1JTPA 1T1YA 2P5EA 3C9NA 3FQWA 1IMHC 4Q14A 2BNQE 1QSEA 2O1AA 2LU7A 1NAKH 2WPGA 3B2VH 4P5TA 5FF6A 3GUTB 5CLTA 1T22A 2IH1A 4RX4A 15C8H 4B3EA 2IWGA 2CUAA 3TA3C 3TJHD 2HRPL 4GW1A 5JIKA 2FL5A 4BINA 5ERWB 3GSRA 3HPJA 4PUBH 1BQHB 1KC5H 4WUUD 1W6LA 5HYSG 3IU3A 4YSCA 1QR1B 2XY2A 4ODVL 5FHAH 2GUOB 1I7UB 1IGML 4LLVA 3IBOA 1QLRA 2XQYA 3HI5H 4YIQB 2XIBA 3JV5A 4YC2B 2KHAA 5JMRA 1WF5A 3WD5L 2Y23A 4X5XA 4CVXA 4B7LA 4JPSA 5JIMA 4G6FD 5I18L 3FB8B 2FIKA 5I16B 1CZ8H 2HLFD 1WICA 2TRHA 4Y19B 4X6CA 2Y22A 3VM5A 1JWMA 5EUOA 4L4TB 3RKDC 4KMTL 3PLYA 2VMDA 5EZJB 3RWHB 1A3QA 5GSVB 3EOBA 4RZCB 5EIIA 3V4PL 5E1IA 1IFHL 1CICB 3DVGA 3HPLB 4A6YL 5I9QB 4WEEA 3DO7B 1E3ZA 3N91A 4H26B 2GBAA 4NGHL 2UZXA 3WY2A 1JZGA 3AS1A 1G7HB 2VAAA 4W9HC 3RWIA 3BLPX 3QJQB 3UX9B 5GGQL 4GAYA 3BQUC 1TJXA 1HDMA 4K94L 3NAAH 3D39E 3VW3H 2O6FA 3T6VA 2VLME 2OMTB 4ESKA 4HIIB 2EH8L 1NGZA 1MAMH 2YBRA 3Q2NA 2DLGA 5TGBA 2FD6L 4K2UL 5DFVC 3VB9A 1NKRA 4Z7WB 5BXFA 1DQLL 1WZMA 5HDBF 2NY1D 3GGWB 4LVHC 1SDAB 5FYJD 3C75A 4HUXB 4Y16A 4G59C 3JTBA 4UCFA 4GMTH 4TSAL 2DMBA 3PFUA 4NZJA 3FT4B 4X80L 1TU2A 2FJSA 1HS6A 3LKPA 1UXWA 4NUQA 3AITA 4CN6A 3SCMB 3HS0B 1CD1B 5IVXA 2P24A 2WZ5A 1G9MC 1K9TA 4KKAC 3UBXI 3VXRD 2ROXA 3D85D 1OTUD 1U6AL 2JJSC 3X1EA 3MKKA 4DGYL 3MNDA 1BVKB 5D5ME 2UV3A 1GZHA 2WWNA 3KPNA 3DRQB 1S7VB 3MXWH 4K8RD 4F7CB 5IOKA 1EHLH 2CK0H 3CH1A 4OR1A 1CDHA 1SJHA 3QI9D 1T3FA 3H0TB 1KACB 1QSVA 5JIHA 3TNMB 1QNZH 2QPEB 3VFGH 4DZ8A 3S8WA 1E7UA 3F65A 4Z7IA 4U3HA 2ICES 5KVEE 2MEJB 3ZKQD 4A38A 4AGPA 1OGPA 2P8LA 1QATA 5GRVL 5K93A 1KCVH 4GG6E 1V7NL 4R26L 3HS8A 3U0PB 1A4AA 2FATH 4PS7A 5KSAA 1I1AD 4F1SA 3QDJE 2B16A 3ZYOA 1H8LA 3JWDH 3HNTH 3WN5C 1H3PH 3EDJA 3QWOB 1RZFL 2WINA 4WFEE 1CGVA 1AXSB 3FTXA 3HHMA 3OR7B 4JB9L 4Z7AA 4PJFF 5HJDA 4AQ1A 1OAYH 2WXKA 3NA4A 3VAEA 1WWCA 2L7JA 2JV6A 2XN9D 3FU7A 4KOCA 4B96A 2BP3A 4D9RD 1FYTB 2P5ED 2C7UA 2VXQL 2WTRA 3L5HA 4RZKA 3ZHFA 1MI5B 3UACA 1QSED 2AEWA 3QRFM 3AY4C 5I5RA 2FWOA 3C8KB 1JDDA 1N2RA 5LGJA 1LQSR 3L9EA 4AK1A 4GG8A 3N9GH 3QAZC 4JGMA 5DFTA 1TFHA 3TA3B 1J5OH 2Q5BA 2WANA 2I07A 2MPAH 1CLOH 5ESQA 2XWBB 2YRLA 2A1WL 3D08A 4TUJA 5FYKE 5EZLB 3JQOB 4N2BA 1EHAA 1XH2A 2CGZA 1QW8A 4XOBA 4ZQKB 3SKUD 2Y7SA 3SYCA 5I1IL 2DICA 1IVTA 2VDMH 5AUMA 5B1CA 3KLDA 4HXAH 3VI4A 43CAA 4ZFOB 2WBJD 4OCRH 4QT5A 5D1QC 4GMSH 1IBBA 1TFPA 3CUPA 1SEQH 3IMWA 3L1OL 4KV5E 1UATA 4AIEA 2V7HB 3R0NA 4JG1L 4R83A 4EJ1C 2VLKB 3TJPA 3HJ0A 3V0GA 5GPRA 1ZT1A 1DBKL 2VN4A 5FXCH 5IFHL 5DHVH 4BM7A 5D7JD 3HG1D 3JWNH 4PJCE 1BSIA 3F12A 5L4MA 4LLUB 4KVPA 2V9UA 2JK5B 3NSFA 3QWRD 5F7LB 3RI5K 2F58H 4BFOA 5J0BA 4CDHA 4HS3B 5I66A 3ARXA 4PGDB 3P0GB 4QNPF 1WFIA 4ZOEA 3WHXB 3FTYA 2UXVA 1I7TA 4RRPG 2B9BA 3VFNA 4KZDH 43C9B 4LDOB 1SJXA 4C56B 1Z9SB 3UC0L 3FN3A 1SZNA 1M05B 5H37A 4LL1A 3GHEL 1GXEA 2VIRA 5BS0A 2NMSA 1IFGA 1JK9B 5JW5A 1VZIA 5CAYB 2EABA 4NFDA 2PPDA 2WYZA 3BQUB 2J8UF 2YIHA 5GGRA 4GYBA 4KKRA 3HUJA 4Y4HC 1S9XA 2AJVH 1GKEA 3K2UH 5IQLA 3CGTA 3CFUA 5DT1H 4EZJA 1OWWA 4QYOA 2CLZB 1F1DA 4P3DA 1OSPH 3D3VB 3P30L 3MACH 4PJ9D 1GYWA 1MWAH 1CE1L 5KOVC 4Y16D 1T20B 3SPVA 1DN0A 1FVCA 1JOIA 2VZOA 1NAMH 1RZJL 1D6VL 4XP6H 1UWYA 4FN0A 3IDYB 2ITDB 4ABVA 4LHJB 4JFPA 3FB6A 3NESA 4HH9A 1W2KT 4H0LC 2R2CA 3EO0B 5E5RB 3KNBA 1M3JA 4AKOA 1Y7VA 3D0VA 4LRNH 2JKNA 3JVGC 1FC2D 5EZOH 5IB2A 3L4ZA 4ENED 5IBLD 2I7OA 3MUUA 4YHOH 3PAUA 4HAFA 4PYGA 5IKCA 2VDLH 2XVLA 2ZD0A 5ITFA 3MFGB 3OXSB 1ADQL 2A6JA 5DEGB 3J2PA 2AJ3B 4X8XA 1HNGA 3VNYA 1HVXA 3HC3H 4PJEB 2FBJL 1HH9B 1FG2A 2CO7A 4P5KA 5HHME 1PZUB 3TO4C 4O2EA 1NGYA 3E8VA 4G6KH 2X4SB 1AO7A 4GFTB 4WHYH 4YMPA 1FVEA 4U1NA 1P7QD 3ABGA 4OJFL 4PRPB 3GJFH 4HWBH 5FO8A 2I85A 1NOAA 5F89B 2A3TA 4GQPH 4UM9B 3NGBC 3ISYA 2BXZA 2K4AA 2AF2A 4G9FA 1N18A 2RBLA 3KPSA 3OAWA 3ZE2E 3I02A 5JLZA 4ZSOB 4XC1L 4UYPA 5CP7B 3D0AA 4A37A 4Q8BA 5BRQA 1SLWA 5A6MA 4FYRA 1WSST 3T1FA 3VGAC 4UOJA 1M71B 4H1LB 5TE7L 4XWGL 3U1SL 5AKTA 1IGFH 2QQNL 4LSVH 1D5BA 3BMVA 4W6XB 1HSBA 1Q9LA 1AQDB 4XGZB 5K1JA 4JHZA 5FA3A 1HINL 1I85A 4FKEA 4OFVA 5DJAB 3TEYA 2ZT9C 3LIZA 1DVYA 3NTCL 4WFGE 5D6DC 3TT3L 4Z7QB 2ETWA 3MKGA 3L95B 1LNUA 1JRHL 1NA8A 2C9QA 2Y6TE 3CVHL 5DEJA 5C3LD 1HKLL 5HGHB 5I1DA 2ZP0T 1CXIA 4N6QA 4D8PA 1Y6NR 1RFDL 3OG6B 3SKMA 1NINA 4XP9L 1KGIA 1UZ8B 3V4LA 1U8PA 1I7RB 1JGDB 2EC8A 4QXGL 1MLBA 4OF3A 2Q7YB 4HG4J 4GFXA 4NN6B 4ABWA 3VD3A 1U8HB 2VQ1A 3D2UB 4NHCH 3RUGE 1LJMA 1NSNH 3KCPB 3VG9C 2KQMA 1MELA 1VFBA 1VLXA 2OL3H 1CFSA 3U7AA 1QBLL 1IBGH 3TEZA 3BT0A 3M7FB 1CD8A 4WJKB 4YZFE 4L3CB 3ULUH 3FMGL 3PQYA 2IPUG 1KB5A 3WUZA 2YPLB 1ILUA 5DDHB 5I0DA 5D72L 2PPFA 1U58B 3FHAA 3QO0B 4M6ML 4HKJB 4HOMA 1KIQA 4HK3J 2GJPA 4G6JL 3UDWA 5BS0D 2BHZA 3U46B 1IO4C 4EI6B 4GP5B 1RMFL 3TZVA 1SVBA 3OPZH 5CWSA 2Q8BL 2ZOOA 1E4XI 4MRBA 3AWFA 4Y4HB 3SE4A 1K2DA 4OGYH 4B9ZA 1QFWH 5GRJL 3NJLA 4KO6A 4M43L 1PTZA 3PGDA 4D94A 4RGOH 2GSGB 1I3RA 1PY0A 1NCHA 4YOKA 4M5SA 3VI3E 1A4JB 1CXLA 4DUVA 4JPIB 1BZ7B 2WXPA 4AH2B 2XRAH 4I5BA 3FFDA 3QW9A 2V5MA 4Y4FB 4ONGL 5BO1L 3OZ9H 5C2BL 4JJ5B 1LGVA 3O3EA 4PRIB 4LK4A 3QR1A 1JGVH 1EDQA 2RMNA 4ALAC 5FOBB 3IWUA 3GYRA 1O75A 1OP3K 3QEGL 3W9DA 4IBWA 2RA1A 1G7LA 1M7IB 2M2DA 3GSVA 4WK4B 1B4RA 2DWDB 3HN3A 3V6OA 4ZO9A 5CGMA 4K3JH 3K71A 4KWUA 1X5JA 1I3VA 2ZONA 4LCUA 3WFCL 4N8VA 3MTXA 1TITA 1FFOB 4X8CA 1PS3A 2B1AH 1XGUA 4HX1B 1A66A 2HVKB 2NY0C 2J7LA 3TO4B 1AO7D 1OT4A 2CZNA 3D09A 5EUKB 3WS6C 3WFZA 1WBZA 2D3LA 2QMKA 4G71B 4TUUA 4JLRB 3PHQB 2GI7A 2M26A 3BRGC 3AG3B 1SDDA 3L48A 4NUGH 3MV7A 4WDIB 3KPOA 1A4CA 2WVUA 4MAYA 1JPTL 2G5RA 2QLYA 4HVBA 2C9XA 3MLTA 2YK1H 3O4LB 5EIVA 5JHLA 2VM4A 4FL4C 1GRWA 1T7WA 3PWNA 1KBKA 1TMQA 4MSWA 5LNDA 3U9UA 3KWVA 1MRDL 1Q9WA 3JV4A 3AXHA 3DVIA 3P9LA 5C70A 1E8ZA 1TJHH 1WAAF 2VXUH 2ZCZA 3FFCE 2BIPA 3U9PL 3A6CL 5I1GH 3V95A 5F8RC 2NXZC 2NXYC 1B0IA 1P4IH 1YNLL 2NYYD 2W94A 5BVPL 5DJ8B 2KERA 4YN3A 1X5YA 4OZHE 2PXYA 3UCQA 2ID5A 4A7VA 3GMQB 4ICXA 2BMKA 1ET8A 3ERXA 2YD6A 5DHEA 5I0XA 3SPCA 3ATEA 1VADA 5CBAB 4Z0XB 3IAQA 4AT6A 4JFZL 4Z7NE 3A0OA 2IFGA 1AANA 5HD8D 3MRPA 3ECBB 4EO5A 4NWTH 4GAJL 5K9QI 1N3NB 3GXIA 1U9KA 1MCEA 5JXAL 3BAWA 3Q44A 2A6IB 4DFIA 1AY1L 1HC1A 1J8HB 3TT1H 3X12B 4AL8L 3P4MB 4J8RA 1P5UC 2NTFB 5CP3H 3TO2B 3NBNA 1SUHA 4X99B 2UWEF 3JZ7A 3MROB 3PNWA 4DN3H 3PQYD 3C6LC 3QNZB 2ZWZA 5GGUB 4A2EA 2PTUA 5HI4C 4L8BB 1LEKA 3CX5K 3X17A 2M1KA 3IF1A 2F61A 4JRYA 2HWZL 4BK4A 3UTSE 5ACLA 3FO1B 3G6DL 4EOWL 3NABH 3EOTH 3QQ3A 5IW1B 4YHZL 4D9QE 5KAQG 3DUUA 3CHQA 2HH0L 3PY9A 2GTZB 4LVNB 4NDMA 5CR1A 4XPTH 3TZVD 1R5VA 1XL4A 4RAVB 3QDMA 2W9LA 1SY6L 4Y1SA 4MXVF 4BFRA 4TOYL 4Q9RL 4F7PB 1IEAA 5C07D 2GITA 3N04A 1VGEL 2A7BA 4KRPC 4LLYB 4Q6YA 4DPAX 3ASWA 4CU7A 5F6HJ 4B41A 3LRLA 3L5IA 5D2LB 3LH8A 1WTLA 4F8NA 4JR9H 4NZUH 2AVGA 1MSPA 3WLWC 3MBXL 1EX0A 2EIBA 3T77A 1ITBB 2Y5TA 1J1XL 2QTVA 3KJ4B 1E8WA 5ADPL 4S0HA 1F4XL 1DVFA 1OK0A 2O5ZH 4BA0A 4PGBB 5SWQB 5E00B 1HILA 1FIGL 5C9KA 5HYJE 2ZXWB 1A7BA 3KD4A 5DMKA 4JFFD 4LKXA 4HPYH 5L0QC 4HC1L 2WVSA 5JIIA 3U2SA 2CDEA 1A7NL 1ZHLB 1EK3A 1A4KA 2OSLB 4ODUA 1JHTA 5KVFL 4G6MH 4XPAL 1RPKA 1CQYA 1ESOA 3O6MH 3QDGA 4JHWL 3U36A 3ZKNC 5CFHA 2VCOA 3KBFA 2XU9A 2RIKA 2YD8A 1OANA 5JORB 2FK9A 1ETB1 4TMPA 3I3EA 4UQAA 3ETBF 5C0BB 3QYNA 1ZJAA 2QPUA 2WBWB 3L9RB 3BZ5A 4AEFA 2W95A 4F1ZA 1KTJA 2NY0B 1UZGA 2APBA 3NK3A 3QIBC 4M9PA 4UQ2A 4XBGB 4BGDA 2Z64C 5F72S 4KTEL 4BK5C 4JFDA 3E3QC 3NVQA 4FFZH 3CDGA 5CMAB 2ODHA 3ZJAA 3LKNA 5J57B 4Z3FA 4F5CE 2G2RA 4MMZA 4WWOA 3MI6A 1T66D 4WWNA 1ZLUK 3LX9A 4FL4B 5DZ9A 5IBTH 1E43A 2B08A 3WAJA 2X1PA 2OTWB 3LAFA 2J6EH 3JWNG 5IEHA 4OGAC 1W0WB 3LDBB 1ULVA 2GIXA 1KPVA 1YPZB 5DZAA 1AI1L 2A77H 3RY6C 4MXWH 3UJTH 1KBPA 3UIYA 1NCDL 3OKLA 4PTUA 1SQMA 4P3CL 1AG6A 3FQTB 2EEBA 1M6UA 4XCCH 3NJJA 1OGAB 4P9HH 2VLLA 4F92B 2AJUL 1KJ2A 2JI1A 4HZAA 4NFBA 3BSZH 5AAPA 3K6DA 4RWYH 5DJYA 1GYCA 3P77B 2IPTL 3L4XA 5JXEA 1KFAH 3LS4H 3NOIA 4QDGA 4AMKH 3GDCA 3M86A 3TN0A 4FGMA 3MMEB 4YNYA 4RWHA 1YEJL 4KH2A 4RETB 1ZDQA 2ESVE 3PL6A 4DKDC 3BESR 3NZUA 5DJ6A 5DJ2B 1F2QA 3WKMH 1NFDE 3F7VB 4YUEL 1LK2A 5E5MA 3BEVB 4P46A 1R3JB 4M8QA 3SQOL 1MHEB 4R3SB 4CGTA 3RWGA 3TJHC 3BP5B 1P5UB 3PIQA 1DBJH 3NCCB 1XSIA 2H45A 4DP7X 4N8PA 1Z2KA 2ORBH 2DI7A 5HYIA 1RHHA 5MHSD 2E5EA 4ZW3A 4P23B 4XPGL 1ZTXH 1X5GA 2YD7A 5GRUL 3O45A 1WISA 4QHMB 1BVNP 3L4VA 3L1EA 5IB4B 1MF2L 1BOGB 1YEKH 1SXCA 3GO1L 2YGNA 3S2AA 4J3OH 4R7VA 3N1QC 1MRCH 4LT7A 2NCEA 4WHCA 1S3KL 3IMUA 4QXTA 5CJXA 2DQJL 1DQVA 1SBSL 1AD0A 1GHFH 2ENSA 3LS5H 2D4FA 3OSKA 3GXNA 3CN1A 1YEIL 2COQA 3CSTA 4PCKA 4O2CA 3OKNB 4JAMB 3FN9A 5SWZE 1LO2H 4GT0A 5CXPA 1WIOA 1QWUA 4FQLL 3TBSA 2XZCH 2ZP8A 2AQPA 4HKXA 1EEZA 4GW5A 5TDPA 1SF3A 3HR6A 1JPSH 2EE3A 3IDXH 1ML0A 2XETA 4O00A 3H9HB 4TVPE 2EC9T 1U2HA 3GMLB 4GKNB 4WHYG 4OJDH 5DUMH 3NZHH 3L6FA 1NMCC 3ZYJA 3LOWA 1MCLA 3SBWC 3FQ1A 3EYQD 3F6JA 1CF8L 2LQRA 4OGZA 2VDPL 2PWEA 4HLZH 3HLAB 4PS4H 5CGBA 3GSOA 2QQKL 4J3VA 25C8L 4NQVB 5FYLH 1ZS8B 1G5AA 1NC4A 2VRQA 2GSIA 4FLHA 1BV8A 5TTRA 5KVDE 1Q1JH 2VOTA 5ANMB 5F9WB 4EBQL 5L0QB 1C7TA 3OVUB 1UURA 1FZJA 1WFOA 4IOFD 4NXKA 1NCBL 3AVEA 3QWQB 1IFRA 4U1LA 5I8CA 2X4QA 2ALWA 4UTBA 1U36A 2AHIA 1JFHA 1TQWA 3U7WL 4RGMB 1J5CA 1GOHA 2PABA 1MFEL 1WGOA 3BVNA 4JRXD 4O9HH 4YPJA 1LP9A 1E3XA 1TENA 1LDPL 3JSSA 5LNEA 1FFTB 3U30C 3ARUA 4L23A 1NCAH 1MIEH 2ALAA 3ZGIA 1MFNA 4CAGA 5LXVA 4RDQG 3QIBB 5EO9A 5DXWA 1A5FH 3MRKA 4JFDD 3LKQA 2DPKA 3QJRB 3GRWA 1E5UI 1KLUB 4FI8A 1BYPA 4FLOA 4V33A 3IXTB 5ISZB 4TULH 1AOZA 2G2PA 4BQ9A 4WKZB 1O0VA 1TVHA 2ZOLA 5EA0L 3QHTC 5CHNA 2BX5A 1CXEA 3FT2A 4RISH 1XGRA 3SE8H 3VFOB 4CL7A 3I6GA 4K8RC 3WJJC 2O5YH 4NQEB 2NUPA 1J9RA 4KNQA 4M5ZL 1EGJL 2CWRA 2VLRE 3MAWA 1JTOA 4QRSA 4AC4A 4UV7L 1K85A 3JUYA 4NAQA 5DZJA 3SJVE 2WQSA 2IDSA 1S9VB 3VQMA 3WBDA 5KSBB 4JY6B 1UOKA 3JXAA 1I1AC 4P07A 4Z5RB 4ELDA 2GIMA 3PWUA 3B9EA 3LNFA 1IBDA 3B9KA 1IZJA 4G43A 1KB3A 2XDHA 4L1HA 4HKBB 1HEZA 1N19A 2I60H 4K4KA 3GSNH 3R4RA 1KYDA 2X4TA 3RZWA 5JPMA 4KGJA 3DHJA 2EDDA 4LFHG 4NKOB 5IG7A 1X4ZA 1XF4B 2BNQD 4GRWB 4ZFOL 2HRPH 3M8OL 3HC4H 4L4VA 5A2KH 4ZOCA 1NCGA 1O7VA 3AROA 3L3KB 5TF1H 3QFDB 3VNZA 1CCZA 4IGBD 2VDNB 3L3DB 4DGIH 4P46D 4CJ1A 5JDSB 1IC7H 2HYMA 3MA7A 4IIQA 1RZGB 2RACA 4HT1H 2V3FA 3HI1A 3X14B 5E2TL 1QWHA 3IT8D 1NCUA 4WUUB 4KQ4H 4UQ3A 3M17A 4QRFA 4A2HA 4FXTA 4NPYA 4C4BA 5C0JA 4PGCA 3ZIMA 4CADA 5I18H 5JW4R 3C6EA 3RURA 1CK0L 2I26N 3AADB 3NIDB 2WBJC 4LP8A 3LN4A 5IIEA 2FJHB 5F7FA 4LL4A 1F2XK 1OD7A 4F2FA 3DOHA 3FCBA 1KIRA 3QJFB 4G8FB 3BCDA 2UZIL 1D2PA 4MS6A 5D7JC 4MCZB 4OLVL 4TQEH 4C57C 5KJ4A 3PWJB 4G6FB 2FCBA 4RQQB 3UAAA 2ZX5A 3IJ9A 5I6PA 2B1OA 3U1PA 5IW6B 4N0UB 1ZCRA 2FVNA 4LPCA 4PJ8D 2A6KB 2V4LA 3FRUB 3GMPB 3MO1B 5E2UL 3GKWH 1ZVYA 3DMMD 5B39G 4BZ1L 3VRLE 4UT6A 4O5LL 2NSQA 3TWCH 1BQLL 2IANB 1QI3A 3ARDD 5I23A 3TYFA 4R8WL 4EKJA 1NMCB 2A9ML 3MODH 4R90H 2IMNA 2VAJA 3D39D 3WL9A 2VLMD 3HZ3A 4PV9A 4DCQA 2P42B 1ZV5A 3CFEB 4OCLC 1YC8A 4DAGL 4NUJB 2WXMA 4PG2A 5A2JH 1U93A 4UQIM 3C6SA 2ATPA 5L2JB 1J9TA 4N28A 4LBEB 4Q52A 3EOAA 1J88A 2WLIA 2IH9A 1O6TA 4PJ9C 4Q4IA 2NY1B 1ZTMA 5EBWB 1FL6B 2DV6A 3RIFF 4R7DB 1JZ4A 3U30B 2W07B 3QJXA 4HWUA 3IS0X 1NC2A 1TJGL 3OJDA 4IBSA 4DOHB 1S7TA 1P4UA 1EBAA 5AW1B 1EV2E 1RP8A 5TPWL 2B4CH 3MLVL 2WQUA 4Q6IA 1P2CA 3VXRB 3D85B 1OY3B 3L4CA 2RCSH 5GSRB 1ZPLA 1YJDH 3RG1C 1PKOA 1KIUB 1UWFA 4J1UB 3COOA 3Q5OA 1R0AH 5E4OA 5BV7B 4ENEC 3HZYA 5IBLC 2X4NB 1MEXH 4PR5B 1N6QH 3QI9B 4XPHH 2XG4B 1UXLA 2EYRB 2MMXA 5EEWA 4ETQB 3TOPA 1RZFH 3WLBA 4QXUH 3FDWA 4JB9H 1PYWA 4F8QA 5PAZA 2Z35B 2K45A 1E4WL 3NCJL 1IC1A 4XOEA 5IVNA 4BFJA 4WFED 3KWWB 1CLCA 4IU3B 3L3HB 2J6WA 1U8LA 3S4SB 1I1AB 2JCCE 2WZ6A 4O02A 4BH8A 4XE0A 4PHZA 5CIPB 4A55A 4ZJ9A 2K7QA 2NSXA 4B9IA 1BFOB 4PJHE 4M56A 1M6OA 2QPSA 3LD8B 2AJYL 2AEQL 3HRZB 5TH2B 4HULB 3FO9B 2VDOH 5FX3A 2XN9B 4N9GA 1CGYA 3EIFA 3RWEA 2HA1A 5DI8A 2Q7AA 2HT4D 1O6SB 2YRBA 3BXNA 1RIHH 4HDIB 2P5EB 3C9NB 2XBDA 3FQWB 3NFNB 4N0YL 1QSEB 4F7TA 5AW4B 4Z3TA 1NGPL 1T22B 1CBVH 3N42B 1R17A 4ZD3H 3UP6A 3AQXA 1U8IA 5E2JA 1ZMYA 5FYKD 4I9WE 4GW1B 4O51A 2Y7OA 5F93C 4Z7WF 3LRGA 4JG1H 2VDQB 3IK2A 3HPJB 1DVXA 2V37A 1I8MA 2L3BA 2OMWB 1T80A 1OIOA 3IU3B 3BKML 5IJVA 4B9KC 5AL8A 4PJAA 3BH8B 5DU7A 3B7UX 2R29A 1X5LA 3EXLA 1Z1WA 4BKLA 4IBLT 1X7QA 1QLRB 2E0PA 2WBJB 5DUJA 3WKYA 2BRQA 4X5XB 3TBVA 2P5WE 4CVXB 4PLKD 3QRLA 3S88L 4AG4H 5D7JB 3HG1B 4X6DE 1FZOB 2WWKT 3CVIH 2HT2D 2EDWA 2FIKB 3CBJB 4JZNA 4JKPH 4ACTA 2W38A 3G6JB 2Z3FA 2E4FA 2J1XA 4FQHB 2ZCKH 4M3HA 4RGNC 4X6CB 4K3DH 2P4AB 1MLCB 1IJ9A 3LH2L 3NEOA 2WC7A 4JCMA 4KXZH 3ETBJ 1C08A 1YMME 3EOBB 2CNYA 1NKGA 4M3KB 5EIIB 3IJHA 3RHWF 5CJBA 3U79A 4AMXA 4GI8A 2FR4A 3DVGB 3FN0L 3CMOH 4L8SC 2PW1B 1AZNA 1DLHB 2YQBA 3FTWA 5FW8A 4D3CL 1A1MA 3HKZA 4OGQC 3I6KB 3K6SA 3VFRB 4AYID 4LSUL 5C09E 2VAAB 5HHVL 3RWIB 1RZJH 3L7FA 5HPOA 1NGQL 1HDMB 2FIRT 1AGDA 1J8SA 1KLGA 1MKFA 1H5BC 5DR5L 4AQEA 4QRUB 3WCYA 4HGMA 1KYOJ 1NGZB 2YBRB 1TVBA 4LEXH 1E4HA 3K6OA 4Z78B 2XTJE 1XAUA 3VI3A 3F04A 4N26A 5BXFB 1KV7A 5L2KE 1WBXA 2WYTA 1EAQA 2OXGA 2YAQA 4PJ9B 1U8KA 3ME0B 3F5WA 4Y16B 4MX7B 1NCIA 1NEPA 2NDGA 2VZSA 2ZJSH 3KPMA 3TBBA 4A39A 5HYFA 3QS3A 5EZPA 1QSFA 2D8KA 2UWEE 1TU2B 1QEWB 4X7SL 5E1AA 5EBMB 3LKPB 4HSQA 2IOOA 1Y6KR 2D7TH 1QFPA 4H88L 1BAGA 4BQCA 1Z9OA 2CPUA 2OMUB 5JW3L 2VH5H 3HS9A 2P24B 5IVXB 1P1ZA 3DK2A 3MRIA 4MKTA 4WI6A 5I75C 3G08B 1E6OH 3L5WB 1A9EB 4BCYA 4JZOB 3RL1A 4MJIA 3CH1B 4PVLA 3ZOAA 5AZUA 3REVB 3V7MA 2EKSA 4GW4A 4DZ8B 2CHXA 3DTXA 2CU9A 3DBXA 1HAWA 1E2VA 5AVWB 5AOZA 1YAZA 1MW2A 5CKGA 2DIEA 3L3OC 4IBTA 1LMKA 3T0EA 1P7QB 1X5ZA 2R7EA 1HOCA 4MB5A 2YS4A 3CFBB 3FCSB 3FSVA 3LKSA 4LCCA 4Z3GA 5HVHC 3WUWG 3NJIA 5EC1B 5BZWA 3WYRA 3CZEA 2QVTA 4XWGH 1CR9L 2H32H 1P5VB 3FU7B 3JT2A 4J3OG 3VXME 4AZ8A 2HPTA 5JW4M 3C08H 3D51A 1DFBL 3WIHH 4P57A 5DSCA 4LSTH 2C7UB 3BI9X 4YLCA 1URZA 3QT2A 4FZEH 5ABZA 4F93B 1HINH 4IRSA 4P04A 4G8AC 2FWOB 4HJ0D 4JPQA 4LOVA 4EIUA 5EH1A 2NYYC 1WEJL 1HAUA 3CVHH 3C5SA 1XT5A 3CFKA 3D52A 3B43A 2H1PL 1WV7T 3DHUA 1Y0LA 4XN4A 3TEXA 3OKKA 4BEIA 1RFDH 1A0QL 1QLFA 4K71B 3GI9L 4MYPA 2QHRH 2P28B 3LQAH 2JSFA 4FCAA 1ONQB 2X88A 1I3GL 2ZPKL 2XTLA 4P9ML 4NM8H 2D31B 5HD8C 1BAWA 2AJZA 5AUMB 1QBLH 4HLZG 2WXRA 1XD1A 5F7AA 4QT5B 3DV6A 4GQZA 4WHTB 3RDTD 3CUPB 2VQTA 3VXTB 3FMGH 4DWHA 5I6OA 4RFEB 1ZT1B 2X12A 2IF7A 2XNAB 1QBBA 1SHMA 2E6QA 3B9DA 3TIEB 3V9EA 1N6VA 5TDNB 2JKTM 2QPDB 4ZOBA 4KKZA 3KCWA 1JNJA 3ZL4H 2APSA 4MA8H 4RFOL 3OX8A 3BFWA 4G6JH 4GAFB 3BKYH 1NTDA 5I66B 1ZAGA 3BJLA 3L9YA 5D71L 1IAIM 5DURD 5LGKA 1RMFH 1E0OB 2W9EL 1Q72H 1I7TB 2Q20A 4JBSA 4PJEF 4Y7OC 3VFNB 3IVKA 5CSBA 2X9YA 2EDTA 1UJ3C 2DQ6A 2A4ZA 1W72A 3AUWB 4JRWA 5E5UB 3SPIA 3O8XA 2GEQA 1UM4L 3EH5B 1BD2A 2ZKXA 5BS0B 5C8JB 3QB7C 5AW0B 5JW5B 4ZMQA 3WNPA 4ALAL 1G6RA 3D4GA 4KI5F 1WAPA 3X2QB 5KBNC 5E8NA 3FBKA 5FGBC 5GRVK 2ENYA 3KH3A 1WDAA 3MLXH 1A7OH 2NTSP 3KYNA 2NYKA 1D6EA 1W16A 5KBKA 2XJLA 4LOUD 3SPVB 4IK6A 1DN0B 2E7CA 3S36L 1QSFD 4F80A 2DI8A 3VMNA 1JXJA 1L9TA 2WN3A 4HH9B 2ARJQ 1KN2L 3BZFA 3UC2A 3ECQA 2FDBP 2W9DH 5T5FA 1FCCA 1KEML 1TQSA 3VACA 3APCA 4Z77A 4H7VA 2ICWA 3BUYB 2H5UA 4S1QL 1FGNH 6FABH 3D0VB 4ZMYA 1ZWIA 3H8NA 3QQNA 5I75B 4KXAA 1NUFA 4Z7QF 4E5XB 2O6EA 3EW3B 3F01A 3MRQA 4MJID 4NKIL 3EUDA 3VXNA 5FUOL 5IB2B 4Y2NA 5IB3B 4C83A 5IKCB 1Z3GL 2OZ4A 1MPAH 2A6JB 3D07A 4D0BA 5E95B 5EB9A 1KJMA 3KJ6H 3SODB 3N0AA 1FG2B 2CO7B 4P5KB 4A7GA 4O2EB 1OB1B 2G60H 1QHOA 1YY9C 1AO7B 2C1OA 5D7HA 1ZA6A 3L3OB 4X9BA 1FVEB 3T0ED 1MRDH 4NO0D 4ACPA 1PZ5B 1S9WA 4DT2A 3ULVL 2VN6A 2BERA 2CLRA 2PTVA 2NW2A 2GAZA 3A6CH 4ODSH 1ZK9A 2EYTB 2OA9A 5HVHB 3SPJA 1T66C 1I8UA 3IJEA 5L7XL 3B2DC 2ZXDA 2Q3XA 2X4UA 1XSOA 3FFCD 3I02B 5BVPH 4QMEA 1CPUA 4HJJL 4NO3B 1T7YA 2OP4L 2I69A 3ASNB 4NFCA 2AABL 5CJ8A 3KLHD 2OR8A 2FYYB 2J12B 4U6XA 5DO8A 4FQCL 3NFPA 1T2QH 5D70L 2AJSH 1TCRB 2IFFH 3SOTA 1TQVA 4J5VA 5EN2A 1OCWL 4OGXH 1KNOA 1OE1A 1D5BB 1HSBB 1TCMA 4KJWC 4S1RL 4G6AD 2AKRA 4GAJH 4W4OC 5G4NA 4L37A 1R5IA 1E2ZA 2N7AA 3GSXB 2EIZA 1JAEA 1A1OB 4GP4B 2I27N 5LBSL 2W81C 2FZ3B 3HAEH 1NWPA 5E7FA 4XX1G 1LNUB 4AW4A 4CBZA 3W5NA 5B7MA 3GHBH 4AL8H 1YYLL 5DD3L 3N5AA 1A3RL 4EUPH 4MCMA 1PJ9A 2CCLA 5DCCA 4BV1A 1Z5HA 1OM3L 4CU8A 1MLBB 2P8MB 1CMOA 1TZHA 5T33L 2Z9TA 3ZTCC 4XNXL 2YGVA 3CVBA 3HZKA 1YNTA 4XR8C 4KY1H 5T3ZL 3EO9L 1VFBB 1DTUA 3V5KA 2EVGA 1Z32X 4Y5XC 4PRBA 1KN4L 3MLYH 2DM4A 1INEL 2OBGA 5HHOA 1R34A 1GZPA 4KTYA 5G2NA 3ZE1E 3PQYB 2PCPA 1E27A 1KB5B 1A7PH 1QTYT 3DPBA 5E8PA 3UTSD 4UIKH 3JV0A 1OAUL 2WKLA 2E75C 1VGKA 4LEOA 3VFPA 4AZUA 1DUYA 1KT2A 4Z9KB 3SQBA 4D9QD 4F9PA 1LILA 2Q76B 1KIQB 1X9LA 1F6AA 1Q4NX 3NN8A 2HTKC 1NBVL 4LESA 4MNQE 1UJ3B 3DJTA 3O8XD 4WI2A 1VGEH 1RCYA 3GZQA 3VG0L 2YGQA 2VR8A 1DANU 3EXJA 3TZVB 2CRZA 4PJGE 4JFEE 3NCBB 1L6ZA 3BHBA 4CMMA 2JH2A 4JO5A 3BD3A 1BAFL 4XMZA 1K2DB 3L3IA 2EVHA 3WDIA 3MRGA 1EJ6A 3G5ZA 2I9LB 3RTLA 1V7ML 5C07B 3ZZSA 1JZ8A 1S2EA 1I3RB 5FO9B 4IOIA 5JDJA 4JN1H 4HC1H 1GPOH 3O2DH 3UYRL 4JUTA 1A7NH 5HYQB 1EXUA 2H26A 5GGVH 5KVFH 3L16A 3EYQC 5ECGA 4E9TA 3TJEL 2WVVA 3H53A 2F74A 2XY1A 4MCYA 4TRPH 4A63A 3HC2A 2O5XL 4I87A 4JFFB 5AQ0A 1OAXL 1OCOB 5KBMA 2WB1A 4JW3A 3OQ3B 4NM4L 3ZRFC 4NENA 4H13C 2X1OA 3EBGA 3MV9E 3M1BA 1KGCE 4LDLB 3OQRA 1MJ7H 3ULAB 1MQKH 4N8VB 3FOLA 5DA4A 1XGUB 2ZXQA 4HLJA 3D5OF 1BVLB 4FS0A 5M94B 3ZO9A 1DQKA 1ODUA 4L2LA 3QUYC 4OV6F 1A1NB 1WBZB 1J1PH 35C8H 1DJZA 1A65A 4FD0A 3ENEA 3FQNA 4HALA 2EEAA 3FCUB 3KPOB 1I8KB 2G75A 4HJIA 3RY4A 5I1AB 3QFGA 1J0ZA 2EDRA 4YBQC 3TYGL 1AE6L 3SDXA 2VSMB 2VB5A 3K72A 5GS1A 4ZX3A 4MSWB 5DRNA 3HN5A 3VFWB 3JV4B 1UD8A 3SJVA 5KW9H 2OJZH 4MVBD 1D2OA 2WK2A 3Q8AA 4ZFFB 4AEEA 3QUHA 2YD9A 1SGKA 5J13C 3L17A 5TDOA 2E27H 4CVWA 1J05B 3NT0A 4RH4A 1RU9L 4MZ2A 4BQ8A 4MBRA 2WUCL 2JKJA 4XO8A 3WTYA 1E9QB 3MRRB 3R8BB 4ATTA 4W9EC 3PDGA 3ARZA 2JJTC 1U3ZA 1PFCA 4P5MA 2R0WL 4ZAKA 5D2LF 2HLEB 2L7UA 2Z0BA 3H2QA 4AT6B 1B4JL 2XWJA 1U8QA 2BHFA 3MRPB 3S3JA 1W0VB 2Q10A 4PW9A 2XX0A 3O0RH 2LAAA 4S1SL 5DJZA 1YC7A 1CGWA 3UTPE 4QRTA 4PGEB 3APDA 2QL1A 4X9IA 4IJTA 4BYHA 4IGBC 1S9KC 4N3UA