3ZDWA

Substrate and dioxygen binding to the endospore coat laccase cota from bacillus subtilis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Dioxygen Binding to the Endospore Coat Laccase from Bacillus Subtilis.
pubmed doi rcsb
molecule keywords COTA LACCASE
molecule tags Hydrolase
source organism Bacillus subtilis
total genus 144
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3zdwA02
2DV6A 4BK5C 2B3IA 1J9SA 1AACA 2AANA 2IWFA 3ABKB 1XB3A 5PAZA 1NPJA 1GYCA 1L9SA 1AZNA 1GS6X 2FQFA 5TK4A 2BP0A 3TBBA 1SDDA 3EH4B 1IBYA 1KBVA 5I6LA 1E67A 3AG2B 3AY2A 3ZX1A 4BWTA 2XVBA 3FYIB 1JVOA 4GP5B 2BP8B 3NJIA 1XMEB 3DTUB 4DP0X 1JZIA 3NSYA 4JHUA 1AS7A 2J55A 4QKTA 3X1NA 2H3XC 2J57A 4UANA 3PAUA 5B7MA 4JHVA 2GHZA 3QJUB 2CCWA 4YSEA 1UATA 2FNWA 5PCYA 2XXFA 3TA4D 3OM3B 4UAHA 2YAQA 4F7KA 2FQGA 2FTAA 1NIAA 3JT2A 3ZBMA 1DYZA 4NERA 3T6WA 3UAEA 6PAZA 2IDTA 2P80D 7PCYA 1A4BA 3AZUA 5AZUA 1ZDQA 2LLNA 4YSTA 1MZYA 2XYBA 3X1FA 1QLEB 2FT8A 3KW7A 4AKOA 1V55B 2VW7A 1IKOP 4HZ1A 2BP8A 1OF0A 3KW8A 4YL4A 3RYMA 1CURA 3TBCA 5EHFA 2QDVA 3WNJA 2JXMA 1ASOA 9PCYA 2Q5BA 3G5WA 1W8EA 4HCIA 2AFNA 4DP4X 1PLAA 3HB3B 1NWPA 3SBQA 1W6WA 1CYWA 2CJ3A 4UF7C 1RZQA 3MX0B 3DIVA 1OCOB 3PLYA 1CYXA 2QPDB 2R7EB 2PP7A 1OE2A 1WA1X 2X87A 4A2DA 3QQXA 4QLWA 2DWTA 3T71A 3X1BA 3U25A 5I28A 2DYRB 3CDZB 5D4IA 3WNIA 4P5SA 2I7SA 3H56A 3GXUB 3UABA 1DZ0A 4WTQA 1PCSA 4GP8B 2IDUA 1GS7A 4A67A 4G7SB 4Q8BA 1PNDA 2FT7A 3QJSB 2H47C 3IN0A 4HHGA 1SJMA 3UACA 3SBRA 1BEXA 1AZUA 2Q9OA 1L9RA 3FU9A 3X1GA 3ABMB 3FSAA 3NSCA 3S3CB 1SFDA 3CZUB 2IAAC 5I5IA 2TSBA 4HHWA 1WA2X 3WG7B 1ETJA 2H5UA 4PAZA 1JZFA 2XXGA 4KOCA 2J5WA 2R7EA 5AKRA 2OV0A 1J9TA 1AZCA 1GSKA 4BXVA 4AKPA 1WAEA 4AKQA 4DP1X 3TASA 3CDZA 3NT0A 2DWSA 4YVUA 4F2FA 4YSUA 2X88A 2HRHA 3FYEB 2IDQA 5I5JA 3WKPA 1WS8A 2YAFA 1JXFA 5A7EA 3T6ZA 1SNRA 2VW6A 2EIMB 4YSOA 1AS8A 3NJHA 3NP3A 3EF4A 4Q89A 1PZAA 1FA4A 4MFHA 5FC9A 1AR1B 2IDSA 1QNIA 3V9EA 1BYPA 1JERA 5I6OA 4CSZA 5B3SB 1TKWA 2HX7A 4GXFA 2PPCA 1L9OA 1RZPA 3CVBA 3IEAA 4YSDA 3NJGA 3NJFA 4E9RA 3NJKA 1NIBA 2UXTA 5I6PA 3MBWB 1JXGA 8PAZA 2Y1AA 2DY2A 5B1JC 3BQVA 2EIKB 1L9TA 1E5YA 1A8ZA 1SFHA 1ET8A 4PCYA 5I6KA 3HEIB 2JKWA 1N70A 3FS9A 3IBOA 2MTAA 1E5ZA 1SHWA 4X4KA 3FSZA 4DPCX 1AG6A 3NJMA 4K9JA 1JZHA 4RH4A 2DYSB 4AI7A 2VM4A 1PMYA 1KCBA 4JKNA 4W1TA 1A4AA 1AQ8A 3NP4A 3ASOB 4HCGA 2IH8A 1PZBA 1PLBA 1SF5A 2AVFA 3X2QB 3ZIYA 3ABGA 4M4RB 2IWKA 3PAZA 4BWUA 5I6MA 2BWIA 1A4CA 2BZ7A 1BAWA 3H4FA 3NSDA 4G7QB 1SF3A 3AG3B 1M56B 1E30A 4KO5A 3NSFA 1JZJA 3UADA 5D4HA 6PCYA 2GSMB 4BWWA 1T5KA 3PXLA 2YXWA 1M9WA 1NZRA 2CUAA 1ADWA 3AG4B 5B1KA 1NWOA 1ET5A 2VSKB 1X9RA 2BO0A 2YARA 4EF3A 5B1AB 2A3TA 2HXAA 1BQ5A 1AOZA 1CC3A 2VN3A 3AG1B 3OMNB 2PPDA 1MZZA 5B1JA 3FT0A 2IDFA 1OCCB 3PAVA 1NDTA 2GIMA 5TK2A 4NB7A 5ANHA 2XLLA 4KNTA 3FSWA 4HAKA 2EIJB 2AZAA 1CUOA 2IH9A 2NRDA 2PLTA 1GR7A 3FQ1A 3QJVB 4DP9X 2PPAA 4A2GA 4HIPA 4G7RB 1QHQA 2YAOA 4AZUA 4TXVB 3ASNB 3UAAA 2VW4A 3ERXA 1BQKA 3FPXA 2WO3B 5I26A 2YAEA 1MG2C 4M3HA 2BZCA 2XV2A 2HX9A 2ZXWB 1HAUA 4KO9A 2AZUA 4G71B 3EH3B 2WO2B 3T6VA 1GW0A 4DP6X 2BWDA 1NICA 1ZIBA 3S3DB 3FU7B 1KDJA 3SQRA 1TEGA 2UXFA 1PY0A 3QJRB 1FWXA 1NIFA 1KCWA 2RACA 1EHKB 2VMJA 2YXVA 3S3BB 4E9XA 4GY4A 4E9SA 4KNUA 1NTDA 4AX3A 4YSSA 4NAJA 2FT6A 1ZV2A 2XU9A 2XX1A 2B08A 3S8GB 1L9PA 2TSAA 2FJSA 2CBPA 3OQRA 2YAMA 3QJQB 4A2FA 2PPFA 4DPBX 3FSVA 4E9TA 1PZCA 5IY5B 1URIA 1RKRA 3ABLB 2GC4C 1B3IA 4ZK8A 1PAZA 1AG0A 3TU6A 2EINB 3FQ2A 1J5DA 3N2JA 2EILB 1PLCA 1ASPA 1AZRA 4DPAX 2HX8A 1GY2A 2W88A 3FQYA 3IN2A 1A3ZA 2W8CA 2E86A 5B7FA 1GS8A 3OMAB 4WKXA 1V10A 3FU7A 4KOBA 3GYRA 1HFUA 1ASQA 2PP8A 4A66A 4YVNA 1J5CA 1N68A 2GC7C 2QT6A 1HAWA 2UXVA 1IBZA 2ZOOA 3NJLA 2WSDA 1AAJA 1X9UA 2PCFA 4GP4B 3OD3A 2MRYA 4BDVB 1PF3A 2P80A 2YQBA 1BQRA 3CVDA 2PPEA 1ZDSA 2CALA 4FAAB 4E9YA 3ZDWA 3T6XA 2XV0A 3OMIB 1BXUA 1WS7A 4DP2X 2YAHA 3D12B 1JZGA 1SHXA 3FU8A 4G70B 1GY1A 3NYKA 3H4HA 3GDCA 1ET7A 2Y69B 2UX6A 3NJNA 4N4YB 1TEFA 3NJJA 1NIEA 1KGYE 3CVCA 1J9RA 2JFCA 2VM3A 3AW5A 2OJ1A 1W6LA 3PCYA 1PNCA 4BDVA 1JOIA 2FQDA 1JXDA 1R1CA 2FQEA 1KV7A 2FWLB 4YSAA 2XX0A 1F56A 4BXSV 4F2EA 1WA0X 1OE3A 1TU2A 3T9WA 1E65A 2OCCB 3SBPA 4E9WA 1JVLA 1BXVA 1KDIA 2I85A 5I5MA 3QJTB 3DKHA 2J56A 3WKQA 2ZONA 4L0PB 3JTBA 1KBWA 4YSRA 4A2HA 1XB8A 3V9CA 2QDWA 4N8UA 1MG3C 2YAPA 2VSMB 3S8FB 4E9VA 1MDAA 1OCRB 3PPSA 4DP8X 1IUZA 5B7EA 3L45A 1YLBB 3WI9A 1AIZA 1RCYA 2UX7A 2GBAA 1JZEA 4YSCA 4KO7A 4YSPA 7PAZA 3N55A 2GB2A 1I53A 3UGEA 4FA7B 1XB6A 3EHBB 4P5RA 1ILUA 1OE1A 4HALA 2N0MA 2CAKA 1NIDA 2PCYA 4G72B 1ILSA 1AANA 3C75A 2HLEB 1BXAA 2QPEB 2PP9A 4A2EA 1J9QA 3EH5B 4CSPA 3QPKA 1V54B 1BYOA 5F7AA 2XWZA 5AFAA 2BW5A 4HCFA 1AS6A 2BW4A 1OOWA 2IWEA 2HRGA 2XV3A 4KO6A 3IE9A 2GI0A 1FFTB 2XUWA 4DP5X 1AZBA 4KNSA 4A68A 3BVDB 3WIAA 1KYAA 4ENZA 2BP0B 4E9QA 1SDDB 1EZLA 1NINA 4W9ZA 1ID2A 3FPYA 2I7OA 4YSQA 2ZWNA 5LDUA 3X1EA 1OCZB 5B1BB 5E9NA 4DP7X 5I6NA 3CG8A 1L9QA 4GYBA 2HZHA 1ZPUA 1OV8A 1ZIAA 1NPNA 2BHFA 1M57B 2UXGA 1A65A 1VLXA 1IC0A 5D4JA 5F7BA
chains in the Genus database with same CATH superfamily
4XAKD 1J9SA 1M7DA 5DFWH 1IIIA 5IKCB 2UUDH 4K23L 2UWEA 1BZDA 4GKLA 4M61B 5KTEL 4AK1A 5FUOH 4LLWA 1SDDA 1ETA1 1FFPA 1AKJB 3P77A 3MACH 3MUJA 1S9XB 3WTXA 3FW6A 3ATBA 5F7NC 2K4WA 3ESPA 2AQPA 1SYVA 2NY4C 3CMOL 3HI6H 3QUMH 2XTLA 3QI9C 1P7QD 4Y19A 3WNMA 2OJEA 2KZKA 2CR3A 2GK0A 2LE9A 5HD8C 2DQGH 3DSNA 1CXLA 3WFEH 3T0WA 2YIHA 4MXQD 2VTFA 3L17A 2AKRA 4N0FB 5FKAA 3OM3B 3CLFH 3PWJA 5DMYA 4ZS6D 1DUYB 1KNOB 1T03H 4MA1C 2YHGA 3SGKC 1KGCD 2B8OT 3RKDC 2I32A 1HE8A 3LZPA 4I18B 3EOBB 4PEEA 1NEZG 5SWZE 4S1RL 3AWFA 2Z1KA 2UZXA 3QO1B 3TN0B 4OCWH 5C0EB 5CBEA 3MLSH 1VCAA 3KCWA 4GSQA 3PNRB 2VW7A 4S11A 4YBQC 2W91A 1OP9A 2AJXH 3KGSA 1OF0A 3HG1A 3NRQA 5HPOA 1EXUB 1A9EA 2V4LA 5CO1A 5I16A 2IANB 4RFOH 4DP4X 3K71B 2QVKA 1R3IL 2WGXA 4LAQH 4E42B 2X6VA 4FQPA 1LO0L 4MSWA 5D9SB 5GRJH 4UTBA 3K1DA 3LZQA 3QIBB 2DB8A 4GAJL 5GSRA 4F8TA 1OHZA 4X5XA 4MVBC 3ULUH 2EZ0C 2IH1A 3CFEB 1CZ8L 4QLWA 2CA4A 2ENQA 3OXRB 1JJUA 3HNTH 2VDLL 5D4IA 3ZZLA 3KH4A 3CXFA 3NVQA 3F6IA 4JG0L 5DJDB 5B38G 2QLVB 3NBNA 3KGRA 1VFOA 5C0RH 1CLYL 1JGLH 2BSDA 3VXRA 3ZUCA 3GJFH 2PWDA 1Z9NA 3IN0A 3WN5B 2NW3B 1XL6A 2QMKA 3FTSA 3UACA 3UTSB 2G5BB 3H9SD 4KMQA 2X1XR 1A02N 2D31A 4B9KC 4JFPA 3RVVC 1PPIA 1BHGA 4WW2A 1F18A 2KDYA 2WMPB 4KTDL 4F1ZA 5GGRA 3L5IA 1NA8A 4X6FA 3CFDA 4HUWA 1J9TA 4MAYA 5L2KB 3RFZA 1TPXB 3KLHC 2E6JA 4DP1X 2LV4A 3TASA 5FO8B 2N1KA 1BJ8A 3T0ED 4QOKD 4ZPTA 3QIWD 3AM8C 1WS8A 3AXHA 1OB0A 4OY9A 3L1GA 4P05A 3UTZB 1WAAE 1TT6A 2JKXA 5JHLH 4X7EC 4UV4L 3WAKA 1FFNB 3QQDB 2Z64C 3ZRSA 2A99A 4GT7A 5H37H 2E6QA 3RGHA 4XMUA 5EBMA 3STZB 1VKXB 1JGDA 1JGUL 5EU4A 4N2AA 3QZWG 3L9RA 3P30H 1M71A 4OBSA 2P8PB 1IAKA 2HX7A 2F5AH 3OWRA 4POZC 4ZMLA 3QEQB 4YSDA 3U7WH 1SQ2N 1T7YA 3HE7D 4HVBA 1H3WM 4LPXA 1BWMA 3BP7B 4ZAKD 4KKBC 3D18B 5KANG 1CDUA 4JHAH 3FHAA 3RILA 3SE9H 3VWKD 2CR0A 2J25A 3HN5A 5EFIB 5FHAH 4G42B 1IAIL 1ZHNB 2BVYA 1AFVH 3DV4B 2R1WA 3QUXC 5EU6E 5AYUL 5MEND 1UYWL 4MNHA 2EYTA 3MJ7B 3LQMA 3VX0A 1GGCL 1HI6A 2X70B 1P69B 2DQFB 2QL1A 2VM4A 3WTSA 3NN8B 3AY4C 4W1TA 3ZDXE 3U9UA 4JL2A 4FFVD 1BFSA 2DLIA 4UI2A 2DI9A 5HYJD 1MCOH 4OCNC 4OQTA 5E5MB 1NAMB 1BQLH 1UACH 2O5ZH 5I6MA 2RIKA 4XOEA 1H8LA 2PW1A 1C8QA 1Q0YH 1LO4H 2BZ7A 4OKDA 2GK2A 1WFNA 4KI5C 4MJHA 4XC3H 3LXBA 1SEQH 3UDWA 4DOHE 3LEXB 4A55A 3CNKA 5I1AB 3K6OA 1Q90A 4TNVF 1J0IA 4UTAA 2BNQA 2QSCL 3D9AL 1FBIL 4PB9H 1LQBC 3CN3A 4OB5L 3LRMA 3QVAA 2Y6TE 3WFDH 1MRDL 2J12B 3C12A 3Q8EA 3CBJB 2BSED 5FS5A 4YPGB 5FYJH 3JWNG 2APBA 2BO0A 1OSPL 3FU6A 4MCMA 1W72L 3A4FA 3GMRB 5T1JA 5SWQB 1LO2L 5F9AC 4FNRA 1GC1L 3ILEA 4HDIA 5FPIA 1YNTF 2FZ3A 4JY5L 1L7TH 4GAYB 3TBVA 3TEZA 3B7RL 4G8AC 4H8UA 1OOAA 3HCVB 5I8EB 2V9RA 1DBAH 3FO2B 2BCMA 4TUUA 4MYWB 3X13B 4J1UA 4DVRH 3AB0B 1OCCB 2XA3A 1YEEH 1IGML 2CO4A 1BGXL 2IPUG 4K7PH 4OQ1A 2IC2A 4Q58C 2KUTA 2R23B 5AOMA 1JPFA 1PL3A 4DGWC 2AERT 2AK4B 2VSCA 3TFKD 1H15A 5HGGS 4FCAA 1FNLA 2PYEB 2VRKA 5AUMA 1RZ8B 3FT3A 4FEIA 4HKZA 2AEQH 4PP1C 1XIWC 4N9GA 4EI5D 5ENWB 25C8L 5CZXC 4LDLB 2YAEA 2NSXA 1G0DA 1R4XA 5F7UA 3BKYL 3G6DL 3R4DA 3P1VA 4XBGB 4MJ2A 1TQBB 5EUOA 1WZ1H 3ZHLA 1I9RH 1A7PH 4XAKE 4UWQB 4KY1L 2F74A 1GW0A 1ITBB 1U8HA 1BEYH 1C5BL 4I3RL 4QRFA 2HYMA 3EYFA 3O6FC 4X9BA 5AWNH 5JIKA 2X1WL 2P24B 2IAMA 1B0RB 1K6QH 3RGBA 2PTTA 5I17B 5JW3H 3SQRA 2FBOJ 1RAMA 3CV5A 4CILA 1BD2A 1HXMB 3FZUD 3KEDA 3G6JE 1BSIA 4M62L 4PLKD 3I6KB 4H5SA 4UTBL 4E9XA 4MMZB 1YEIL 4J12A 4LESA 5F3HA 5J1SC 5D7LA 4LVOB 4XNYH 4LHQB 1RZ7L 3Q2WA 4W9IC 1J8HB 2X1OA 4JGMA 4MKMA 3V5DA 1AVAA 3NCJH 3OAZH 2F08A 3FULA 4KH2A 3Q1SH 1ZJBA 2YMOA 3F7PC 1SJEA 1GYUA 1C1EL 3H9HB 4PGEA 1IRAY 4KX7A 2AXGB 5EZIL 5E6YA 3BPOB 1KGCE 1OXYA 1FZJB 1YMHA 2R0WL 4G6ML 4JFDD 4N1CA 5H4YA 1L5GB 4NFBA 1VAHA 2YSSA 1F4HA 1F3RB 1E4HA 4MQ7A 2FATH 1CD8A 4PRPD 3UL4A 1WLHA 4WNQB 1NMAL 3T3ME 1UXWB 4NIKB 4RETB 2E3VA 1WD8A 3H9YA 1IBZA 3FCBA 4KJYA 2PN5A 2VO8A 4FQ1H 1OAQL 4KFZC 2PCFA 1UWXK 2X41A 4P23A 1J5HA 4G6FB 3GDBA 2GSIB 2PCPB 1PTZA 5D2LA 3QW9A 4R97C 4P9HC 4DZBA 4M8VA 1KPRB 1TZGH 2ICEA 1YEJH 3HZVB 3Q2NA 4YHOH 2PPEA 2VR8A 4JDZA 3QC5X 1FL3B 2DQTL 3FQXA 3K2IA 4JBSA 3HR5A 1JZGA 3HC0B 1QSEA 4Y4KA 1JZ8A 4G70B 3BQUD 1IQWH 3L08A 4NX0A 5CJXA 4IU3B 4PS3A 1XCQB 3ULVF 1KJ3L 4PRIA 4Y2DD 1WCBA 2Q76A 3AT0A 3A23A 4N4YB 4N2NA 1MQKH 2N01B 4L9LC 1TFHA 2AK1H 3QUZD 5AYQA 4Q52A 3UAJC 5BW7C 1KEGL 3ZRFC 4HWUA 3FUDA 3H9SE 5CBAA 3Q3GA 3BT2H 4XMLH 5TQ0H 2B15A 4BDVA 3RPIB 4IOFD 2YUWA 4R2GD 1HH6B 5DFVC 5FYLL 3MYJB 4DF9A 3U0PA 3DK0A 2VLKA 3VNYA 3T9WA 3MRFA 2WLIB 1E65A 3EYQC 4XBPA 3LZOA 3AREA 2O6FA 4JCLA 1N7ML 2VE6B 4NUJB 4JO5A 3GM0A 4HF5L 3OAWA 3HG3A 2HJKB 2CNZA 3T5WA 3JWNH 1RZFL 3OX8B 3L3JB 1KGUA 5KSBB 5MEPB 1XB8A 2DW5A 4WWKA 5CLWA 2VRQA 3T0EE 3QQ4A 1RUPH 5HVFB 1ZGLA 2AGJH 1MW0A 2F5BH 3GSUA 1OK0A 1MDTA 1KB5H 4FQQA 1AY1H 4AXWA 4GKNB 1MFEH 5ESVA 3II1A 1GZPA 4TSAL 1XZ0A 1RZJL 3Q05A 2ICES 1WBXB 3A4DA 4WTZG 4MDJA 5AVWB 5HY9B 3D0VA 3EHBB 1N64L 1NBZA 2WYIA 1X7SA 4PG9B 3SD2A 5BJTB 1MCFA 1JHLH 4HALA 1A47A 2CAKA 2Z7UA 2FYYB 3NZHH 3TPKA 1O5PA 1E27A 1AANA 1KXHA 2H3NB 3SPGA 1S5HB 1I1YA 3HUJF 5J12C 3LQAC 2IBGA 3BN3B 1AHKA 4LL4A 5IQLA 1YUKB 1ZMYA 2XICA 5CEZL 4X6CB 5EPMA 3QXAB 5EC1A 2XHNA 4AQAA 4KO6A 2CKBH 3ME0A 5DJYB 1UCTA 4BFOA 5FA3A 1JHKH 1FFTB 2K1MA 5MENE 3KGTA 1T21B 3UYPB 4NN7C 4DN4L 4B50A 1ZS8B 1N8ZA 5HVWA 4NZ8A 8FABB 2V2XB 1MY7A 2XTJB 3WS3B 2X1QA 3TBWB 3Q43A 2F58H 5LUMA 2YZ8A 1NC2B 3I9AA 4DP7X 3O41A 3QDHA 4M9OA 2G9KA 4MD5A 4XPHH 3U9PH 3F7YB 5HYJE 3GRWA 3LPPA 4JDVA 4N6QA 4Y1AB 2FNBA 4JPWL 1KCSL 5CZKA 5HHXH 1KB9J 5HGAB 3RDTB 4CVXB 4I5BA 5IHUL 5D1QA 2VAJA 3EBAA 2WQXA 3CSFA 2CG9X 2IQ9L 4J39A 4YXLH 1WPCA 3N1MC 4FXKA 4S2SA 1NPJA 2KQMA 4JO8A 1E4WL 2R56H 3EDKA 1RMFL 1EEZA 1K2DA 1CFQB 2NXYB 2QQLH 1I7UB 5JIQA 1CFMA 1PFOA 2KT6A 3NSYA 4XVSH 4NWTH 1THCA 1U8JA 1ZVSB 1N5YL 4PU2A 2EC9U 4WNJA 3TIDB 2M1KA 2OCFD 3BMVA 3RWJA 4GEIA 3ZTNH 1M1XA 4K3HA 2DEYX 1PEZA 2XXFA 1PKQA 3DSFL 3G5YA 4DKEL 2CBMA 4ZW6A 3HC3L 1UWEH 4PJBE 1ZT7B 1ADQH 1UOKA 5CJOL 1I9IH 3T0DA 3CXHK 5HYQB 4HEPG 1QI3A 2NUTB 2IFGA 4N8VB 4WW2C 2GI7A 4H0GA 3WXWL 2KBGA 3ZBMA 1BQHG 1W0WA 3EOAB 4JQXA 1OP3K 4UQBA 4JKMA 1F3JA 1Z9SA 1UEMA 2LLNA 4LLVA 1JS4A 3KWWA 4MAYC 3RFZC 3HI1A 4FQCH 2DAVA 3Q0HA 1EFXA 2VABB 4ZFZB 3VX1A 4FZEL 1CURA 3ZT5A 3TBCA 1UM5H 3ARUA 4GRLA 5H2BA 5I18L 1UADC 4OFYA 2WNXA 2DM3A 5KVGH 1JK8A 1C7TA 3FSOA 3IU4H 3JZ7A 5AALA 3D3VD 2BNUA 1KYDA 2VN4A 4B9GA 3A6BL 1GAFL 3CPLB 2QGCA 4X99B 3RPBA 3U46B 5JR1L 4CNIB 1GMEA 3UTTB 1SMDA 2B3RA 4QXWA 2B59A 5DLMH 4OGXL 3QQXA 3GK8H 2BIIA 2NTSP 12E8L 2DYRB 3QHFH 5AZ2L 3TCLB 3WNIA 1FLTX 4P5SA 4AEIL 3GHEL 5LGYA 4Z7VA 4B9ZA 1AGEB 1H6EA 3B2VL 1Q0XH 2DYPA 1H3UA 4ZQTA 3F64A 2XZCL 1AZUA 1BMWA 1L9RA 2ARJB 5E6SB 5HHPA 1FUNA 1HILA 1K5NA 4LCCA 1GL4B 1P4BL 3K80A 4FQHB 4GINA 1URZA 1EXHA 3OG4B 1S9WA 2VZUA 5IP4A 4JFDE 1ZHLB 4MAUH 4PAZA 1CVSC 3RL1A 5IBUB 5T1LB 1Z2KA 2RB8A 3TN0D 1LD9B 3N43B 3O6LH 4PRPE 4JFEA 1UENA 1ZOXA 4HS6A 3VFWA 2H2SD 1SDYA 1NJ9B 2XPYA 3FO1B 4NPKA 3GMPB 1JF5A 3B43A 4XO3A 5JHLL 3A0OA 2IDQA 2APWA 3CLEL 3ZDZB 1GYWA 3CXDL 3KEHA 4P3CL 3U4BH 3UDWC 1LP9B 4U1HB 3UZEA 4YSOA 4GO9A 1U8PB 3RHWF 4ZMYA 2WW8A 1MJJB 5IMMA 2UZIL 3RTQD 4J4PA 3L5WA 3A67H 1VPOH 2UY6B 3FO0H 1NEPA 1J1PH 1U2CA 3UP6A 2WXLA 3N1PC 1WAAF 3SGDI 3LS4H 5EU7E 1S7QA 3VRJB 2N59A 4L2YA 4AIZA 1NEZA 4IRSA 4K3JL 2H4EA 3TXAA 2X7LB 4JHWH 1JZ6A 2HVJB 3PHQB 5FUOL 3VSTA 3QEHA 3MACL 3V6OA 3NEOA 3DMMB 1JGEB 1JXGA 5I9QC 2VZOA 5EF3A 3HI6L 3PIQB 3QUML 3WOVA 2Z31D 1G9ML 3UTSD 4PCYA 4AQ1B 3HE6D 5CIPH 3GUTA 3L2NA 4UIKL 4OI7A 3N0AA 1SN0A 4LLUB 3HEIB 1A21A 4IHOA 1N70A 1R3KB 2RFXB 4J3VA 4TLSA 2FEJA 5DEGB 2VQUA 3VM5A 1GGIH 2O4EA 3WFEL 5CN2A 5HI5C 1AG6A 3ZDYB 3ARPA 2IH3A 1JZHA 1GCFA 5I0DA 1ACXA 4NKMB 4Z7UA 3VI3B 4NXKA 5LNGA 1S7SB 3CHQA 1QQDB 5L4JA 3A3YB 1I82A 2E9GA 3GSNB 1T03L 1L3NA 3X17A 5F0LB 1SF5A 2SEBA 3FQUA 1UCBH 5HGDA 2W07A 3ZDXF 1A4CA 3OZ9H 2HKHH 4M03A 5AW1B 5DD5H 2OQJA 3S3PA 5IHLB 1OY3B 3OKMA 1JK9B 3BHBA 3E7JA 4GQQA 2C3WA 3MLSL 4L2LA 5B38A 4WSKA 4ODXA 3OQ3B 3QHZH 4G6JH 1IC7H 4OFKA 3UADA 2Q87A 6PCYA 2AJXL 1SEBA 3PXLA 5AB1A 2X2UA 1Z0MA 4IBQA 3QCTH 1E2WA 2F53D 5I1IH 4D0CB 1IEAA 2O5YH 2IAMC 4NNYA 2D0FA 4MLSA 5F7DA 4AJVA 4RFOL 4XB3A 4ETYA 3MLXH 1HZHH 3LZLA 3FU5A 4XNXH 5I76A 1RLWA 1Z6JT 4WI2A 1U8CA 2Z7YA 4RMSA 3TWCH 4EF3A 2UZPA 1JVKA 2JKSA 5B1AB 2A3TA 2G75B 5EUKB 5GRJL 5FA4B 4FP8L 3QAZB 3UBXI 3VVVA 1N59B 3ULUL 4GUQA 3GJEB 5BO0D 1IAIM 1ZK5A 4JRYB 2WOYA 2B1OA 4M1GL 3F01A 3AS0A 2R39A 2BIQA 3DROB 1MCIA 3P11H 1JNJA 1KC5H 4U1MA 5C0RL 3QC6X 4WZ9A 3BO8B 1JGLL 3Q13A 3NCXA 1YN7B 4Q9RH 4JB9H 1P4LA 2VDKH 1JN6A 5CSZA 4DCQB 2Y7QB 4FULA 4KJPD 3QDJB 3FQTB 5H94B 5DYOB 3D34A 3WNLA 2KZWA 3SDXA 2R59A 1O7DE 3ML8A 4PREB 4NRZA 4P23C 4LO9A 3SKNA 2AZUA 4CVWA 2HLAA 3VD7A 4LBEB 5JIHA 4YBHA 4DP6X 1BP3B 2ICEC 1MHCA 1NFIB 5DT1L 1KJ2B 5GGQH 3ZMRA 1RZGA 2HFFA 2QHLA 1CD9B 5CD3A 2E75C 4NCDA 5H35B 4EN3A 1C9SA 4AK2A 3WFBH 3TPUB 1ZD6A 3FFCD 3K4ZA 3IDYB 1RHHA 2Q86A 2A6JB 4Y4KC 2X4UA 3J7HA 4PBDA 5CJXC 1YNKH 4R3SA 2X9YA 1ORSA 4FS0A 4LMQI 1A8JH 5FB8B 1CJYA 3UPCA 3UTPD 3G6JF 3VFSA 1A2YB 4D8PB 2OMBA 4JFHD 2Z93B 4HWBA 3P30L 3DO4A 4J28A 1YYMH 4CADB 2P5WA 3WUWG 3BUYA 2F5AL 4WI4A 1UOWA 2X44D 5LBSH 2WXGA 4GIPD 1CDBA 3U7WL 3BVVA 5IHZB 1CN4A 3K5RA 4O00A 4YFDB 1KUMA 3AREC 4F93B 5A2KH 4JM0A 3C09C 2W8CA 5AKVA 3SE9L 4Z78B 3ARDB 2GTZA 3US0A 1U91B 2ICWB 5FHAL 3LKPB 3QDMD 1HFUA 4HJ0C 2GVYA 1RZIA 3V5HB 1CG9B 5INDB 2MKLC 4NUMA 1EVTC 2VH5H 2QT6A 2FJFA 1IM3D 1KBGH 1NFDB 2WBJB 4R7NA 2IXQA 4WWKC 3VSVA 3P54A 1OW0A 1U21A 2O5XH 2AHIA 3J8F7 3EGDB 4HZLB 4BRVA 4N8PA 3T3MF 3REWB 3G04A 5E8DH 2IADA 4OZGB 2AITA 2KZBA 3D3VE 5EF0A 3VD1A 1MCOL 3N44B 5J1AB 1BQLL 1JHTA 1AZVA 1DN0A 1UACL 2O5ZL 1ZDSA 2XZZA 3HMXA 1Q0YL 5E2VH 2D3VA 4B41A 4MXWH 1H6FA 1OB1B 2ZCLH 4XC3L 1SEQL 5F9JB 5IOKA 2VZTA 5DJ8A 5CEXB 1QWNA 2ROYA 1DSFL 4FLSA 3NYKA 4PB9L 1G9MC 4OFIA 3LHAA 2ZXCA 3UTOA 1MJ7H 1HDMA 3VTTA 3BVNA 3WIHH 5IJVB 4S1DD 3Q44A 4KQ4H 4QAWA 3WFDL 4XNMB 5FYJL 1ETZB 4J2QA 4TTDC 1OAZH 2QQQA 4NENA 3L7EA 2CKBA 4DTGH 2FQDA 1I9JH 3QPXH 3KLLA 3QB7C 5CSBA 2ILLA 4GAGH 4TLKA 5LO7A 3L5XL 2P45B 5EIQA 4U1IA 1L7TL 3CK0L 4CBZA 3UZQA 4DVRL 1DBAL 3OAYH 1S6NA 5BCAA 2MH4A 4RBPH 1YEEL 2ZE0A 4J27A 4BFEA 1I4FB 4K7PL 4QT5A 2YJLA 4V11A 3VXNB 3JTBA 1YMMD 3LKQB 4CMMA 1BV8A 2BCKA 1UXMA 2GTWA 3K8MA 2FO4A 2QDWA 3HHSB 2CHNA 2YAPA 1RUML 1D5ZA 1I7RB 1OCRB 2W60A 3PPSA 4X6EA 5E2UH 3S2CA 5D1QC 5HDRA 1YLBB 4J8RB 1P4IL 5CD5C 3ZL1A 4FXKC 1HNYA 2AEQL 4A6YH 4YR6B 1AR2A 3OB0K 2AQ1A 2Z4QA 5EZLA 1K8DB 5E56A 1I53A 4MD4B 5BS0D 2ZX7A 5GGVH 1WZ1L 4Q6IA 1I9RL 1OSZB 4UIMA 1A7PL 1GOFA 4NNPL 4K71B 4BK8A 1ILSA 5DJ0A 3C75A 3KM1A 1BEYL 3F83A 1OP5K 5AWNL 1CXKA 1HKLL 5DK0A 3VH8A 3FRPB 3DETD 2ATKA 2WQSA 5EF1A 1K6QL 1U8NB 3IPFA 5I8CA 5EV7A 5I1CH 2ITCA 5DMJB 1FG9C 1N4XL 5JIPA 4NO3A 4Z3EA 4N2BA 4ZFFA 3L3KB 3UTSE 1DE4B 3PNWA 1I3RB 1SHMA 3B1TA 4MLIA 4FG6D 4LMQE 2HLFD 4NZTL 1G7HB 2Q20A 5CMAB 1KYOK 4GB9A 2FIKB 1Q9KA 5CLYA 3NCJL 1E3XA 3Q1SL 2DQ6A 4WCYH 1XCTB 3MCKB 3QO0A 3TVMA 3MZGB 4HA1A 4PJFB 5IEKA 2Q6WB 4FFYH 2H6UA 3ZL2A 1CE1H 2WXOA 3B1UA 4RZCA 4GRLC 4ZW7A 4A7GA 4APQA 3MJ9H 4XH2B 1JPEA 1XAKA 3I6GA 2FATL 5D4QA 2B3IA 4DH2A 3ETTA 5E1IA 2JJVA 2BHYA 1OM9A 3ABKB 5PAZA 4YBLB 5IW6B 3BH4A 1KGWA 1G7PB 2EQDA 3IJ8A 4FQ1L 4GUPB 2F53E 3TBBA 2YBGA 2P5EB 3GFUA 5GSVB 4H8VA 4LNRB 4TVUA 4ZOAA 3V0EA 1GOGA 1VEOA 2ZF9A 3WKML 1DJGA 2O61A 3KYMB 3S8WA 4GP5B 3VWJD 3NJIA 2EVHA 5GZOA 4NQDA 1TZGL 4HSCX 4JHUA 4WO4A 5DFAA 4QTFA 5EEVA 2E7CA 5DZVA 3OLIA 2OYPA 4PLJC 1JXJA 3HPJB 2BOBB 4UM8A 1T1XB 1NGWA 1FL5B 3MSPA 1KLFA 5IW1B 1IQWL 4F7KA 3TNNB 1B0IA 1JSYA 1G7MA 3PAYA 4LCCC 3KPMB 5JHDB 3HZMA 3N42F 1AGBA 1NIAA 4QKXB 3VGBA 4YX2H 4M5YH 3VFNB 3M7FB 1HYSC 1MQKL 1TNNA 1WZKA 4UQ3A 2AK1L 2FD6H 2P8MA 2HKAA 2IDTA 2WAQA 2VB5A 3O2WL 4PJBF 1ZDQA 3U30B 2O5NA 4K7FB 4KJQC 3BT2L 1NC2D 4XMLL 4Y8AA 5TQ0L 3OG6B 4PWHA 1ID5I 2MOVA 5T1MB 4Y1AD 5DJZA 1QACA 1MFAH 2J5LC 5CGTA 4ZXBA 1HEJC 3O11A 2JXMA 3FB5A 5C7XL 1J5IA 2B77A 3N40F 4JPIA 3RDTD 2AFNA 1G5GA 2YKLH 1QUPA 1JV5B 3JYBA 3SBQA 3SDCD 1OAUH 4ABQA 5I0YA 3UZEC 4TRPH 1W2KT 3NFSH 2RH0A 1A4JB 3MRHB 3EG9A 1GGBH 3GWJA 1SXSA 3PWVA 4P48A 3FN0H 3PWPD 2LLLA 4IJTA 1RUPL 4J4PC 4ADGA 4XN8A 2VIRB 2AGJL 3VXOA 3M88A 2WN2A 1IVTA 2F5BL 1QFOA 4RGMB 1KB5L 1JPST 1AY1L 2A4ZA 3FFCE 1ZSDA 1MFEL 2A6DA 4HJ1A 2NXYD 1XGQB 3U25A 3VYNA 3L3IA 4IRSC 3H56A 3SDAB 4ALAL 4G7SB 4XP9H 3P4NA 3GRGA 5DD6B 3V6OC 1AXIB 3UTPE 5I73B 3IFLH 3LPFA 3B5HA 4J3BA 1SJMA 1JHLL 5FW7A 4JFHE 4JUSA 3Q2CA 1DEDA 2G4EA 2YPLD 5ABZA 2J8UA 3ABMB 1XH3B 5HTSA 4JKLA 1MFVA 5CIPA 5HPMB 4KKLD 4R84A 4F7CA 2J72A 1NC4D 4KNQA 5E8NB 3U36B 4F9LA 2CKBL 3IGFA 1BLNB 1NCGA 2R7EA 1ZLWH 3V6BR 3IMVA 4JLRA 1AZCA 3OGCA 3QDME 4NQCA 4AKQA 3FJTA 1G6RA 5K39A 1IKFH 4XWOD 5LXVA 4FYRA 1NLBL 2OA9A 2DBLH 3H54A 5D1XA 2HVKB 4RFNB 3EXLA 43C9B 2B14A 1X5LA 2R27A 2Y1YA 3WNNA 4IOIA 4PD4J 5DC4B 4KK9C 4RMBA 4Y2OB 4XPHL 3U9PL 4AMXA 4TF4A 4YL9A 3O4LA 3VG0H 1EGJA 1LO5B 2NXZC 4UT6A 4TNVK 5DI8A 4JG9A 1JNHA 2IIJA 3GXPA 1N3NB 4R96A 5C09D 5K93A 1PY4A 3I9GH 3UTTD 5C0IB 4HEPA 1E5AA 3PJLA 1EAQA 1UQSB 1BQHA 4YXLL 1TDQA 4XNQA 3VA6A 1GHFL 3IDNB 3KMDA 3PV6B 1GZQB 3CVBA 4GAFB 4P4KD 4X7DC 3X12A 3NJFA 2R56L 3EH1A 2UXTA 2YBRA 3MRIA 1OAKH 4FXGB 1QWHA 2QQLL 3PXHA 1TTFA 2CO7B 3D69B 2FRGP 3S37H 1OSYA 3TWYA 4WFHD 4G1MB 4EPSA 5E6UB 4XVSL 2YD9A 2FHBA 2WUBH 1L7IL 2GFBA 2J21A 1S2EA 2ENJA 5EH1A 3ZTNL 2CKNA 3T0XA 2Q10A 1MI5B 1PMYA 2WKOF 2YD8A 3EFFA 3T4AA 5FF6B 5T1LD 1UWEL 2WXMA 1KWGA 2YPVA 2VXQA 1ADQL 3IJYB 5AEAA 1I9IL 4MJ6A 1MIMH 1YMME 3GB7A 1AQDB 2IWKA 1M6OB 4G6AC 4C4KO 2Y72A 4RQQA 4JFFD 4YXKH 3P9WB 1KELH 4I0CC 3IDMB 1JDCA 2FJGA 3QR0A 4NHUB 3BGFB 1SJHA 3NSFA 2K0RA 2YRLA 1JNNH 3B5TA 3IFOA 4FQCL 4I0KA 2ISDA 3T77B 1PY9A 4LOEA 3LQZA 5E8PB 1HL4A 1UM5L 1Q38A 3HAEG 4H7VA 2DWYA 5F1NB 1O6VA 1MFDH 2V8MA 4EI6A 2EKJA 3HOGA 5BS0E 1OTUC 5KVGL 4EN3C 3IJEA 5J56B 3IU4L 1X9RA 1XBDA 1WAPA 4X5RA 4HIQA 2FL5A 4JREB 4EDXB 4DUWA 4NUGH 5K9QG 1Z32X 2KQNA 2AQ3A 2ZOTA 3N41F 3JWOH 4LIQE 3GPEA 4EKJA 3REVA 5IV2B 1TZOA 5EZOH 5DMGD 3Q01A 5DLML 5EIVA 4EE2A 3Q6FA 4Y9BA 5EG6C 3TEXA 5KYNA 4YDLC 2AV7A 1KTDA 3QHFL 2AQNA 4HD5A 1JYNA 1PZ5B 5BUAA 2X4QB 2P42B 5KJ7E 4FQ2L 4WWPA 3L7FB 4DO6A 4MCZB 1KY6A 5LBSA 2BSCA 3TC9A 4HCRA 1NEUA 1LO3H 4PGCA 1Q0XL 4ZOEA 1OKEA 1X4YA 4RISL 5JO5B 2XPGA 5HI4C 4NQXA 3FTVA 4Q9QH 3C60B 1BG9A 2YAOA 4C83A 1W9XA 3MA9H 3QUYA 4LP5A 2COVD 1MW2A 1BZEA 3FKUS 3DX1A 1ZLVK 2Q7YB 1CD0A 5TTRA 5I26A 3BGMA 1A14H 4FFTA 1OW0C 5ALCH 1U0QA 4L4TD 4MAUL 1I8LA 2WCSA 3NIFB 4OJFH 2A9ML 5CGMA 4OD2A 3FMGH 2YS4A 3O6LL 4C4KT 4MZ3A 4I89A 4XCYA 2R0LH 1X9LA 2A4EA 3RL2A 3S3JA 4HAFA 3DO3A 4YPJA 2R69H 1SBSH 4K5LA 3EBGA 4OGAD 1KN2H 4AC4A 4U6XB 2BXZA 4ALAC 3OLDA 3HC4H 4L8CB 3GD1C 3IU3B 1HHGB 4WW1B 3U4BL 4WGKA 4L48A 5K1NA 2RACA 2EDLA 3LKSB 3VUAA 1MREH 5D93B 1IGTB 3CBRA 3TV3H 3EZ8A 5F1KC 4NAJA 3A67L 1VPOL 3CE1A 3FO0L 1J1PL 4PVMA 2EUXA 4F8OA 2KERA 2CGRH 4NM4H 4UDTB 1QTPA 2GUOB 1MVFA 2WWKO 3EJZC 3F04A 3LS4L 3MJ8B 4JRYD 1JDAA 4LHUG 1FSKB 1XR9B 4U1GB 3IKKA 4ZYKA 3SPVA 4A2LA 4NDMB 1HEZB 5B4MD 1I9EA 4JHWL 4XI5C 1WAAA 2B1HL 4ZUSA 2OTWB 2JK5B 3FQ2A 5HYFA 1G84A 4R7LA 3QDGD 3WIFA 4HGWB 5HJGA 3QFJB 4L1LA 2FSDA 5ADOH 4KOBA 3GYRA 2JQMA 4HS3A 4BE5A 3NCYS 3KPQB 3NJXA 1WTGT 4M8QA 4C57C 2WB1A 4DVBB 4AY0A 1V3LA 3GXFA 3F5WB 3T0AA 5ANMB 2V5YA 4Y1AE 2C34A 1XEDA 2J43A 2ZX8A 2GG1A 5FIEA 4BZ1A 5MEQA 4I7ZC 2C1OA 4HJGA 1K4CB 1PQZB 2YRPA 2XNAB 3CVDA 2R2CA 3VFVB 1UCBL 2HT2C 1JYVA 5FKPB 2VT0A 3PWPE 3OZ9L 5DD5L 2GAZB 1U8OA 2KC0A 3KPOB 3OMIB 2JCCF 2NR6D 4Q6IC 2XKSA 2JJWA 3QHZL 4G6JL 4P06A 3S5LG 3WUZA 1IC7L 1PS3A 3LD8B 1FLRH 1WE5A 3H4HA 4UT6L 3HBGA 3P3YA 4JO2H 1AOHA 4ZUWB 5BZDB 5I1IL 1IB5A 2O5YL 5CCKH 3NJNA 4HJJH 3BFWA 2GJ6D 3WXVH 2MPVA 3MLXL 1HZHL 1HSAB 4XNXL 3WO4C 3GZQA 5DVOA 3MOBH 3TWCL 2YPLE 1ZS2A 1NCHA 4N5ED 5AW7B 4ABUA 1JXDA 3HBPA 4YSAA 1FFQA 3VTMA 2C1PA 1ZA3B 2WYZA 1PG7L 2OAAA 2JI2A 3HAEH 2VXTH 2X12A 3GMNA 3VXTB 3T2PA 2WIIA 3P11L 1NPUA 3WTYA 1WUNT 3TVMC 1HOCB 3ZSSA 1P0SE 4QRPB 4QXTA 1DJXA 4M43L 3UP1A 4OIIH 2WBJD 4APQC 3HS0B 2AJ3A 4MKTA 1MG3C 1IAMA 1EVUA 1MDAA 4JB9L 1TLMA 4AVIA 4F27A 2CA3A 4Q9RL 2VDKL 1S46A 4QHMB 3B34A 1JRHI 5C0CB 2CUHA 4N85A 3V4PH 4H8WH 2UX7A 1JZEA 4CSSA 2PXYD 3TYFB 3WUWA 5I8KH 1Z9MA 1WEJL 1N8OE 1B2WH 2EXSA 2E4TA 4KDVA 3UGEA 5KS9B 3MRCA 4C55A 2FWSA 3QYCA 5C09E 1ILUA 2C3VA 2WP3O 3UTTE 5A2IH 2Z8WC 3L95A 3O8XB 1RIUH 2H1XA 1H5BB 4F33B 4O2EA 5GZOC 3ZN6A 4JDEA 3VGAC 2ZG1A 4QHUB 1D5RA 5GGQL 4WO4C 3S4SB 1URLA 2XG5A 1X5HA 2L04A 5E5LA 1ULVA 4XOAA 3WFBL 2VR3A 3L3OA 5HHOD 4XN9A 4K8RH 4Z0XA 1X4XA 1YNKL 1T22A 4ONHB 3QARA 1AIFB 4WFHE 2AAVA 3GGWA 1QFUH 1LHZA 3BWUF 5B39A 1GTNA 1CLOH 4XMZA 1N0LB 3CX2A 3C6EA 2W0FB 3ZQXA 1A6WL 1MCKA 2YC1A 3MLYH 1SXZA 3G6JA 2IO5A 1R5IB 5LBSL 1P7QA 2HZHA 1AHWA 5A16A 4ZXBC 4ELKB 1M57B 2ZXWB 1HAUA 5D4JA 1R34A 4JFFE 5KBLA 4HIIA 5FOBB 3CJJA 5L8JB 4X4XB 2MTPA 4A7QA 4LLDB 3ZDZE 5G5DB 3L1EA 5DDHB 3FTZA 5CGYC 3VG9B 4C54A 3C5SA 3ZHKA 1LP9E 2ZUUA 4Z7QB 3AUWB 3NA4A 3MV9B 2FQFA 1LEGB 3O9WA 1KT2A 3RB5A 2O5XL 3FH5A 1FORH 3BIBX 4LPVA 1I3GL 5EORH 1F5WA 3ARBB 1JVOA 5E8DL 3CFCH 3MXVH 4JJ5A 3NCMA 5I19L 3KHQA 2OTUA 2WP3T 3GIZH 3QYNA 2EXYC 1A25A 3IYLW 5E2VL 4NCC2 5T8IA 4JHVA 4L0YA 5IVXB 4N90D 4MXWL 4QCIA 2ZCLL 3LCYA 5DUML 2GW5A 2PWGA 5F7HA 2NZ9C 2QZ5A 4F57H 5CP3H 2ICWI 2EIZB 3HB3C 1I8IA 1E8XA 3TBTA 3VCLB 3W9EA 4ERSH 4JFSA 1T7ZA 4FKHA 1UA6H 1MJ7L 3WIHL 3KWVA 3QRGH 3GKWH 4NERA 2QPUA 1NANH 3AACA 2B1AL 4F9LC 2P44B 1RP9A 4J23A 4WHYG 2WVVA 4ZUTA 1OAZL 3KYOA 4JZJB 3LEYH 3O4OB 2YMTA 4WK4B 1QLEB 4DTGL 1I9JL 3QPXL 3MTXA 1VADB 4R5VA 1HWWA 2H32H 4GAGL 4IKKA 2G3ZA 4YL4A 5SWSA 5I1DB 3FQWA 4OZIE 4QTHA 3RA7H 3PHOB 2D9CA 3TS8A 2WXHA 3STLA 5D1XC 4KKNA 4L4TE 1C12A 1CFTA 3SO3B 3M1OA 2OXGA 1KWKA 1U42A 2BSBA 4BH8B 4UDUB 1BVKA 4Y5XA 5CJ5A 3RI5F 1DANU 4OCXH 1LK2A 2K4AA 3E6HB 1OCOB 3CVIH 2OBGA 3PL6B 3HRZA 1L0XA 1IM9B 1CDIA 5E2UL 4Z1PA 3ROOB 2HMID 4P5MB 1FFRA 4OI9A 1KG0A 1BWWA 5ESAB 1M42A 1JWSB 4IMLA 1MCQA 1E4XI 2Z92B 3RE0A 2YK1H 4CKVX 3OXSB 1E4KA 1FZMB 4GBXD 3NDZE 2VQTA 5GGVL 3WLWD 2ADIA 3L2MA 2A9DA 3IDGB 1U3JA 1U58A 2R9HD 3OKDB 4BKLB 1AJ7H 4JRYE 4IDJL 4K4KA 4Y16B 3UPAA 3D4YA 3FHEA 3T08A 1RL1A 2J2ZB 5IEHA 1ACZA 5JHDD 5EOTB 3PP4H 2CLVB 2V2WA 3PXJA 1TVHA 3IS1X 3QDGE 5I1CL 4TV3A 5FDWA 3V55A 1KIUB 1E5BA 3R06A 5DTFB 2QFPA 4KUZH 3T4AC 1T0NA 2R1XB 5BOZG 1DVFA 2GY7B 4NQEA 1IEBB 5ERWB 2CM6A 4JN2A 3PE9A 4B95C 3FUEA 5FGCB 3DXAA 2X4SB 2X6BA 3FCGA 3HE7A 3KXFA 3TCXA 4W9GC 4ZAKA 4JGJA 3KE0A 2DJMA 3VWKA 4MNQD 3KS0H 3DGCR 1BVZA 5BRZA 3VFUB 1AS8A 1UOLA 4FFYL 4H8QA 2NY3B 2HKFH 4ZUVB 3CZGA 5CN1A 3MJ9L 4X9FA 3NGBB 5CP7A 3L3HA 3PWUA 5TQ2H 3SY0A 2X4PB 3TA3D 2HJLB 1AGCA 4KXCA 3RURA 3V0VA 1TKWA 1EH9A 1OLLA 1XD1A 3HRPA 4TS6A 4WHTB 4ABVA 1Y1UA 3K72A 5JNYA 3QNZB 2NT0A 3EO1B 3SKJH 5JXEA 2JB6B 3KPRA 2MEJB 5I6PA 3ZR6A 2GJ6E 4OAWA 4RIRB 4PJ8B 3ALWA 1QD0A 3WMPA 3ZO0A 1U3HB 3CFNA 2QVTA 3MA7B 3P9MB 4U6YA 2JWYA 5MI0B 3OMZA 4V2BA 1DP0A 3V5KB 5E24E 1GW6A 4TNEA 1S7UA 4DPCX 4ZBJA 5C6WH 4FQIH 3PGCA 1OIOA 3V7MA 1HJCA 1P6AB 2OMTB 4XP6H 2MOQA 5DQJA 4X7TB 4B9YA 3O3AA 3OKKB 5AOKA 3QUYC 4DZ8A 4IHBA 2FX9H 3MBXH 4NC1E 5C6TH 4YX2L 1X4ZA 4M5YL 3VD4A 5DZPA 2CU9A 1NFDE 2NNRA 1U8KB 4ODUB 2FD6L 2VSDA 3FUMA 1SF3A 1I8LC 3ELAT 2YXMA 3MCYA 4M1CD 4D0BB 3K3QA 1A6VH 1I1FA 3KJ4C 4AE0A 3MBEA 3L3DA 2ZCZA 2V2TB 2CHDA 4NOFA 1TTGA 2GSMB 1MWAA 1JD9A 1T5KA 2WXJA 4H1LB 3U4AA 1M53A 4XX1G 1MFAL 3MUHL 1KN4H 3N85H 3B56A 1WGVA 1DDHB 4J6RL 4TVPH 5EZJA 3GPSA 2FUQA 4LHJB 3UJTH 3EOTL 2X4NA 1E8WA 3F2LA 1OAUL 4TRPL 3CN4A 3DRTB 1LGVA 4LAJH 3X3FH 1GGBL 4OLVH 2G0KA 3GMOB 2CDEA 2BXYA 3FN0L 4POUB 4JY4A 5IMLB 2BVQB 5T3XL 3FUHA 4OV6F 5B8CB 1H3VA 4V1DA 1YUHB 5LN8A 1XO8A 5JHAA 4IDLA 1X5IA 5TE4H 4K8RD 2VDNL 3O6MH 4K5NA 5HHOE 1LLAA 3BPCA 2EVJA 3TOPA 3V6ZA 2OR8A 1E42A 5DJ6A 5EN2B 4XP9L 1KZYA 2ZZUT 2W9LA 3IFLL 3MRBA 4WJG3 2PLTA 3N91A 4FYTA 1SMOA 4N22A 3W2DH 3HHMA 1MI5D 2YQGA 4ONOA 2APTA 5FCUL 5HGBA 2YFNA 4DGVH 4PW9A 1ZE3H 2OLDA 4TXVB 1T2JA 3BSZH 1K4DA 3ATEA 4D9QD 1G7IA 2WLJA 2WQ8A 3ALXA 3H7BB 1Y07A 1C08B 4F3FA 2HX9A 1X5GA 3JV5A 2EDDA 4UQ2A 1T66D 4PW3A 3BYYA 3QJFB 2CIIA 1IKFL 4IGBA 2EDBA 3VXMB 3II2A 4MS8D 1R3LB 5FHBH 4YO0B 3V4VA 4JFDA 4I4WA 3V0WH 2UXFA 2XZQL 3KYNA 2IALB 4ICWA 3RJDA 2HFTA 1YQVH 4FZ8H 4X8XA 5DJ2A 1QRND 3C5ZB 4PRPA 3ECBA 5AOLA 3RVXC 2R29A 1NFAA 1M7IB 1C5CH 1LK3H 3VG0L 1NAMH 1ED3A 1JZDC 1T6WA 1MCDA 5CN3A 3VXSD 1NKGA 3E0GA 4N90E 2H6PA 2R4RH 1FAIH 5EA0H 2DQDH 2HPOA 2V7HA 3VW3H 5LN4A 3FUJA 2JNZA 2KKQA 1OF2A 2WUCH 4Y2NA 1Z9PA 2A73A 3RWEB 4M00A 3C8DA 4MJIB 3D87B 1INDL 3FTWA 4DFIA 1IAOA 3N2JA 2EILB 3LN9A 4GSDH 1DJYA 1N67A 1ASPA 1OAKL 3KPSD 4PJIA 3OKLB 4HFWA 3FQYA 4HETA 1GS8A 1V10A 2CO2A 2WXNA 5CCJA 1FCGA 1J0YA 3S37L 3P0VH 1DLFH 3UZVA 1HCVA 2Z3FA 2VISA 2ITDA 2FLBT 3BQUA 3GMQA 2XPZA 4OF7A 4X4YA 4Y2DA 4NCC1 3BESR 4DWHA 3CC5B 2I9TB 3OD3A 4YH6A 3QUZA 3UERA 2BIMA 1NGPH 4PS4H 2I07B 5KG9A 2WKOA 1MIML 2NY0C 2ZUQC 7CGTA 5L2JA 1LEKA 1PDKA 1QSFA 2D03L 3MRDB 3KDMA 5D6CB 4QMEA 4E9YA 3ZDWA 3UG3A 3F12A 3APFA 2FAUA 3CQFA 4PJXA 3U6RA 3FH7A 3NTCH 4RMTA 4M7LH 2EAEA 1JNNL 3FU8A 2ZUXA 2AXWA 2B16A 1FN4B 3GDCA 1XGPA 4MAZA 4P5TB 3E2HB 3T1FA 4LPYA 1CD1A 4PJCA 3E6FA 1GGYA 3HKZA 3UGUA 4H26A 1S3KL 3POHA 2YPKA 4RSVA 1IMHC 1F6AB 3JTTB 3PRZA 5DD0H 1W6LA 3NFPA 4NUGL 3CMGA 3KBPA 4OH2A 3KYKL 3JWOL 3GSWB 2F0CA 2B2XH 1E9OA 4MA7H 4IJ3C 1T0PB 4KJWC 4OR1A 1CQYA 2M2DA 4HIXH 5JHDE 5EZOL 4F24A 3SBPA 3UH8A 3GSOA 4QNPE 2VC2H 3U9WA 2I85A 3CHXA 5I5MA 3QFJD 2QZQA 4UU9B 4DGUA 4L0PB 2JJTA 5TF0A 1KBWA 2Y6SC 2C9UA 4JY6B 4WSJA 4U3XA 4P59H 1AHWC 1LO3L 4W6WB 3V95A 4LCWB 5J6SA 2XQYG 3KPLB 1ANUA 4AGPA 4MXQC 1UJ3A 5AAPA 4RGNC 4PGZA 5KYWB 4I9XA 3T0VA 2X42A 4MNQE 4F2MB 3D2UD 4B7IA 3MA9L 4Y5VA 3RIAF 3ZL4H 1EQWA 4O02A 4YSPA 3CDFA 3BSGA 3O9WC 1OTSD 2GB2A 3S9DB 4R4BA 4WFGD 5ALCL 5GZND 2ZOKB 5ACLA 2BY3A 4FX5A 5A6MA 1L4IA 5J6HB 4JM4H 3ECUA 3FMGL 1TENA 1D6EA 2R0LL 4EIUA 3FO9A 4OZFA 1LWRA 3NUKA 4KRNA 2R69L 4IS6A 4GG8A 1J05B 2VDML 1SBSL 1U8IB 1KSRA 1KN2L 2WLYA 5F7AA 3U4EA 2XWZA 4HK0B 5C0BD 4BZ2A 4DERA 2W65A 4I2XE 5IR1B 5L4FA 3HC4L 3G5ZA 4F15B 1WVZA 5I30H 3B2DC 5BV7H 2ZX5A 4Z3GA 1MREL 3FB8B 4WV1B 2GI0A 4XB8A 1WICA 4FFZA 2HN7B 3L48A 2BSTB 2H45A 2WJ5A 3P3UA 4KTYA 3RWGA 3X14B 4N8VG 5DWUH 5GS0D 3TV3L 4IBVA 1P6FA 2PWHA 4ZX4A 3QZMA 5E6ZA 5I6XB 5FO7A 1QX1A 3MUY1 3TT3H 1SUJA 4QHLB 4Z5RA 3B4NA 1PLGH 5LBGA 2CGRL 4MCYA 4DETA 2CO1A 3ES6A 5BUPA 1DVZA 1MLBB 3L4TA 4NPYB 2OP4H 1KTLB 1GVIA 4HH9B 5DJCB 5IK3A 4DJMA 2YEZB 1F11A 3N0PB 1WQVT 2N7BA 4MA3B 5ID0B 4ZZFA 5LXGH 1IBBA 4QDGA 1OPGH 4NKOB 4PSRA 4XMKH 5E1QA 1ZWIB 5HDBE 3IXAB 4HUUB 3IJHA 3IMUA 4YGVB 1JPGA 1QLRA 1YO4A 3EZJB 5DVPA 2CO6B 4U6VH 4FNLH 1SJVA 4GKSA 4N28A 1XHHA 1GYCA 3TO2B 4NC0B 3DO7B 4MD0B 4AH2A 3MV7B 3HMWH 3SE3A 3ZYJA 3ZDZF 3HRZC 4K07A 2NY7H 3QORB 1JE6A 1IC1A 3CBKB 4QO1A 4GW1B 4U4IA 5ICXA 2UUDK 5IIEA 4EDWH 3RIFF 2E27H 3ORJA 1EDQA 3O8XD 2P46B 3MRPA 3DIFB 2FDBP 2XFXA 1E4KC 1VEPA 3FOMA 2J57A 1A1NB 3GIVB 1P2CB 3BD5A 4A37A 3OAUH 1MHPL 2J73A 1D7DA 2F15A 5PCYA 4E41B 3IRZA 1SLUA 1FLRL 1DQQB 1JI2A 2XCMC 2W9DL 4JO2L 1S3RA 2ZP8A 5IKCA 1QBBA 5CCKL 1JPSH 4M61A 5F3FA 1LYQA 1UKQA 3B5GA 2HT4C 2MFNA 3WXVL 1AKPA 1ZA6B 1AKJA 1X44A 3LN4B 3S36H 1S9XA 5GGRY 1JL8A 1MI5E 1UH2A 2C9AA 3T2QA 1KY7A 5KVFH 2QADC 1DVFC 1IKOP 3BPNB 1B0WA 4MQXC 4PWGA 3HLKA 4KKCD 3FF7A 3PP3H 4J3OG 3BZ4A 2ED6A 3MOQA 2K9FB 4D9QE 5AVQB 3V0HA 5FGSA 1TTRA 2VXTL 3HE7C 4U7KA 1K72A 3WD5H 1J0KA 4PRNB 4ZAKC 2ZQKA 4M6NL 3VWKC 4N0FA 4OZIF 2OPCA 1DUYA 1WO2A 4AIOA 5EEZA 1WTLA 4JVPA 4OIIL 4AYFB 3TEYA 3MV9D 1KNOA 1NLDL 2ZKWA 3DIVA 4KV5E 4I18A 2GITB 3EOBA 3ARBD 1UH3A 2ZAIA 3QO1A 4JCMA 3TN0A 5C0EA 4PVLA 4H8WL 3EJUA 3LXUX 2J6WA 1DZ0A 3L1OH 4JM2B 5I8KL 4Q8BA 1FAKT 5JXEC 4N0YH 3FB6B 1EXUA 2ZCHH 2H6OA 1RZKC 3VXSE 4TN9A 4JO3H 2ICCA 4LDEB 4P46B 2VKXA 2IANA 5FUCE 3APMA 1F4WH 3ZMEA 1ZKAA 2LABA 3K71A 3RAJH 1XGTB 1H6UA 4HEME 4X2UA 5E1HB 4E42A 5J3HD 1WA2X 3CZKA 1FH5H 2NPLX 1F1GA 5D9SA 3TJEH 3ROLB 3QIBA 4NRYB 3KPSE 2OMNA 3CZNA 1KFGA 5KSAB 1OL0A 1NMCC 3CFEA 4AKPA 1QTSA 3CHPA 3G5XB 3OXRA 2F1BA 4NO5B 2ZXQA 3CTTA 1QFUL 5E0QA 5DJDA 4WU7B 3HZKB 1KBBA 4RFEB 3BPLB 3NIFE 1XR8B 3WN5A 1SZNA 3MBEC 2NW3A 5DEJA 3UTSA 2G5BA 4QHKI 2X4OB 3CGTA 5D70H 4HU8A 4HKJB 4QHNB 1U8QB 2X0UA 1DFBL 1AR1B 1ZT1B 4OFQA 4X8JB 3CX5K 3PL6D 4M7ZB 4PCSA 1LMIA 1JERA 1RSYA 3R18A 1XF1A 2WMPA 2FK9A 4O02L 1CL7H 4CSZA 1F4AA 4G43B 3KPPB 5L2KA 1YNLH 4AENB 1C8PA 3G08B 5T1KD 2YA2A 5FO8A 1AYRA 3TP4A 1NIBA 2KLRA 5EORL 8PAZA 3GXTA 4Y4HB 4LVHC 3VGGA 5C0FB 3CFCL 2C4XA 1L9TA 1SFHA 1WFTA 3MXVL 4S1SH 4BZ2L 5JPNA 3ILQC 4KRPD 3UTZA 3MNDA 1A6UH 2PR4H 1FFNA 4K9JA 1RK1B 1TEYA 2DMHA 3NZUA 3QQDA 4AI7A 1VKXA 4FFZL 3STZA 3NP4A 2VDRB 1NBVH 3QFJE 2WQRA 4N0CD 3HZ3A 2LGNA 3VDBA 4ERSL 2G2NA 3FDWA 4OLYH 4PLKC 3VM7A 2P8PA 1PLBA 2AVFA 1CLZH 3QRGL 4TUKH 4U2ZA 2C5DC 1MNUH 2XKNB 1KENH 3GKWL 3W1ZA 3OZKA 3QEQA 1BAFH 5E70A 1UFUA 1YNTB 5E95B 1M56B 2NX5B 3LEYL 3BP7A 4HKBB 1M6UA 4OLUL 1QZ1A 5B3JE 3D18A 3T8MA 2KMWA 5FOJA 3QWRA 2QSQA 4P2RB 5EFIA 1NFDF 2WXQA 2GT9B 4G42A 1ZHNA 3KM2A 3DV4A 2NY3D 5B1KA 3RA7L 4IGBC 4FQXB 4AWJC 3M86A 3TH2T 4WFGE 3J2PA 4G6KL 2QVMA 4IRZH 2VSKB 2X70A 2DQFA 3FQRB 4XMTA 1Q0EA 1WV7T 3NN8A 3N44F 1CDGA 1QFWI 4OCXL 2UV3A 5IFJB 1X5AA 3CVIL 2XWCA 5E5MA 1NAMA 5C0BE 3GS7A 4UT9A 5TDOB 1NCIA 5B1JA 5GS2H 2WLLB 5DO2C 2IDFA 4LB8A 4PJ8D 4PMEA 4LASH 4LP4A 2YK1L 3LEXA 2FX7H 3RVWC 5I1AA 1HHJB 2F2HA 2H8PB 2XLLA 5KVDL 3WE1A 1ONQB 3G5VB 4FQLH 2AAAA 2CM5A 3FQ1A 1AGDB 3EF7A 2EUVA 4KVNL 4M6OL 1AJ7L 4YK4B 4YPGA 5EU7C 2GQHA 2JJSA 1S7XB 3JVGA 4PQXA 1I7ZB 4HWZB 3AFLA 2C3XA 3GMRA 3BQUC 4DUVA 2DL9A 3LIUA 5SWQA 3PP4L 1P84K 2OR9H 3I9PA 3WEOA 5GGTH 2Y23A 3B2XA 2C7UB 1A22B 3ALPA 4KUZL 1ZEAH 4GAYA 2B7DT 4OGQC 4P3DB 2HUHA 1NMBH 3HCVA 5I8EA 3FO2A 3X13A 1KCVL 4KROD 5F6IC 5C0CE 1NICA 1J88A 4CVUA 4H8WC 2MKWA 2R23A 1KDJA 4NNXB 1MFCH 4I0PB 2CMRL 2GABA 2AK4A 2YXVA 4ES8A 3ARGB 4IRJD 4KNUA 1IC5H 2HKFL 3PDOB 2EVGA 3MHZA 4UT7H 2PYEA 1RZ8A 1W15A 3KCPB 2JI1A 5C8JB 1PBYA 5ENWA 1CMOA 3QJQB 2ZYIA 4PSPA 3RZCB 3SDDB 5TQ2L 4ZMOA 4XZ4A 1URIA 4AV4A 1JPTH 4XBGA 1VERA 1YPZE 1Q9LB 3L4UA 4H2CA 5EU3B 3D7PA 4QY8B 4G1EB 2IMMA 3SKJL 3ABZA 2IWGA 3BP5B 3MKKA 4NFCA 4PFEA 2W88A 2P24A 1A3ZA 1R33A 3KL0A 1B0RA 4QF1B 5I17A 2V3EA 4P2OD 4OVUA 1HXMA 4N2OA 2JJTC 1BZ9B 1BFOB 3T04D 1T1YB 3I6KA 2NNCA 4MMZA 4JFYB 2HFGH 3TGXA 4ZMPA 4FQIL 1HT6A 2YEVB 1J8HA 1UJ3C 4XP6L 2A77H 5IESH 1XGZA 3BUPA 1P1ZB 2QR0B 1BFTA 4Y5VC 3RX5A 5A2JH 3MBXL 5C6TL 4Z7WE 3MRNB 3H9HA 5C08B 1HNGA 3MV9E 1I1AB 2AXGA 3FCTB 4HG4K 4KWUA 1U33A 2ZSVB 4YDMA 4C56B 4ACTA 1A7QH 1FZJA 1A6VL 1L5GA 4GG6E 1CGXA 1YEHH 2CK0H 3MLZH 5K59E 3D12B 4D9RD 1NUGA 4EIGB 1ET7A 4WNQA 1UXWA 1KN4L 2VKWA 3N85L 2WLZA 4U3HA 4TVPL 5FGRA 1BM3H 4L3ED 4YIQB 4XCEB 1CGSH 3X3FL 2GSIA 4CGUB 2PCPA 4LCIH 4OLVL 5EO9B 4YXHH 5D7IE 5F44A 1KPRA 3HZVA 2E9WA 3EDFA 1PZSA 5TE4L 4MGXA 1FL3A 4C47A 3O6ML 3ESMA 2H9GB 1GYAA 2F68X 1D5IL 2FYVA 1O0VA 3FBKA 1KTBA 4XHJD 5D6DA 3HC0A 2I60H 2UYLB 4PJAF 3HUJB 3N5AA 4PJ5B 4QNPF 5TPWH 4IU3A 1BPVA 1XCQA 4QRQA 4BGDA 2WCPA 4RDQG 1F90H 3C8HA 3NAAH 1BJ1H 3C6SB 3U2JA 4CU7A 4DGVL 5DRWB 1EHNA 2GBAA 5JQIB 3MUGB 2OMVB 4XO4A 3RPIA 3TFBA 2ZOWA 4DEPC 4F1SA 7PAZA 1HH6A 3SE3C 3MYJA 1UD3A 1WFOA 2WLIA 1OE1A 3BH8B 3PFUA 2Z1PA 1J11A 2PCYA 1UHVA 1K5WA 1N5AB 2HLEB 2VE6A 4NUJA 2WLKA 5T33H 5LGJB 5C97A 2HJKA 3WFCH 2JE8A 3TIEB 3OX8A 3L3JA 2AXHA 3P3SA 4DKTA 5KSBA 5CUSH 1UD8A 5MEPA 3G9VA 3V0WL 1OOWA 2NYKA 3ARVA 4KK8C 5GRYA 1YQVL 4FZ8L 2PUQT 2OMXB 4A68A 4ENZA 5BQDA 4E9QA 1LK3L 4GKNA 1NAML 4RRPA 1KIRB 4RMVA 1ES0B 1BIIB 5IJBC 3N40P 4L8DB 1WBXA 1FAIL 2R4RL 2DQDL 3A6CH 3AXLB 2WOBA 5EA0L 5HY9A 3VW3L 2WUCL 2NDFA 5J8OA 2VDLB 3UO1H 4PG9A 5BJTA 2ZYRA 2FYYA 5C0ND 1KCUL 1ZHBB 2H3NA 2J71A 4PS8A 4TSBH 3VGHA 3E1ZA 3VGFA 1S5HA 2AF2A 2AQQA 4GSDL 1HL8A 1U3NA 1A65A 1QKZH 4NI3A 1ZV5A 3WELA 1SY6H 1HE7A 2F19H 1T5XB 4X6CA 5IHHA 3QXAA 3P0VL 1DLFL 1SLWA 3BZFB 4RMRA 4NGHH 5DHVH 4FFWD 5DJYA 3UEZA 5DRZB 4JUTA 5HDBF 2HUEA 4UZUA 1IEHA 2EE0A 1T21A 3UYPA 1TIUA 3RI5K 1ZS8A 2BSRA 4OLWH 8FABA 2V2XA 4I18C 1S78C 3WS3A 4B3VA 2CJUL 3RGVC 1NGPL 1QHOA 3TBWA 1AZZC 3TN0C 3W11D 2WB7A 1YY9D 2B0SH 3OBAA 1NC2A 1F3DH 3RWFB 4EUPG 3SZ6A 1F0LA 1J5OH 1YYCA 2APXA 2BM3A 3F7YA 2VQ1B 4OKVB 4Y1AA 2NY2D 1BZQK 1TITA 5SX4H 4J3WA 3UC0H 3NTCL 5HGAA 3RDTA 4CVXA 4Q9CA 1C16B 3WIIH 2RD0A 4WEMB 2CH8A 4L4VB 1MF2H 3SKUD 3MGOB 3QIBC 2A74B 3B9VA 3MREB 1MZYA 4R26H 1V7MH 3WU1A 4PWKA 4R8WH 1CFQA 2I5YL 1LNUB 4PH8A 2FBJH 1I7UA 4KMLB 4M29A 3NIGE 2ZP9A 3GXIA 5IQ9B 1KULA 1ZVSA 1UJTA 2VC2L 3I2CH 3OWEA 3TIDA 4KTEH 3WN5C 5J7CC 3AADB 3A6OA 3IE4A 4P59L 1ESOA 3LEVH 1J7VR 1ZT7A 4Y7MA 1P7HL 1PZUB 4PJDE 3T1WA 4AV0A 2VDQB 2J7LA 5HYQA 2NUTA 4N8VA 3BFOA 2BHZA 4R4ND 3EOAA 3FU0A 3GNMH 3V10A 1DR9A 1FYTB 2JLLA 2WBWB 3IDUA 4BQ6A 4BCZA 1MKFA 4KV5F 1TPXC 1MXGA 2EEAA 4KXZI 4WTQA 5I74B 1A0QL 3D30A 2VABA 4ZFZA 1SOXA 5D2NE 1E8ZA 4M48H 2X3AA 4JM4L 3WGUB 3B9KB 4HC1A 2X09A 4OJYA 2NY6D 5DJXB 2X5PA 1OP4A 4HW6A 5CHNB 4B0MM 3NSCA 2HG0A 1SFDA 4MB1A 4XPGH 4HHWA 3ARWA 1R9FA 4ZZKA 3CPLA 4PB0H 2FVNA 3GEFA 4X99A 3OR6B 5I30L 3U46A 1SN5A 2GSGB 4AQ8C 1W72B 3UTTA 4CNIA 4UILH 4Z7IA 4U3SB 1KGIA 4N2IA 3WDHA 4CBPA 4DGYH 3SCMB 4UB0H 3BN9D 4BA8A 1I8MB 2DQCL 1TZIB 4N8CH 3STBA 1K85A 3NT0A 4KK5C 3TCLA 3Q5OA 5DQ9B 5E6IB 4PWFA 1PLGL 2O6DA 1AGEA 4UYQA 4ZFQA 2E47A 3GQFA 4XODA 5IBTH 3TJPA 1X5FA 3BAKA 1JWMB 2OSYA 4B96A 2OP4L 4K3GA 2CDFB 4JDTH 3RVTC 2ARJA 5DHYB 4DN3H 4OUUB 5LXGL 2H1LM 2DM4A 1OPGL 3NIFF 5I75B 4FQHA 2XKUA 4C8XA 3JBG7 2DMGA 3B7UX 4N2DA 1ZHLA 4MHHG 5D96B 4IK6A 4P2YA 4U6VL 4D9RE 5T1LA 4FNLL 4M6AA 5KVEE 5EU6B 1LD9A 1BMZA 4K15A 1HC1A 3HMWL 3J27A 5IFAH 4JM2D 3AU1B 1NJ9A 2DMBA 3FO1A 4PJEE 3GMPA 3JUYA 5B1JC 5HVHB 4YZFF 3ZDXB 4L3EE 2R15A 1E5YA 2E27L 1ET8A 1IIKA 4KX8A 1ZVYA 1CFSB 1HKFA 1LP9A 4U1HA 2MTAA 2X9ZA 3OAUL 2R2HB 1U8PA 1YC7A 3VRLE 2VWEE 3EGXB 5J11B 1DJWA 1MJJA 4ZMXA 2NY1D 1PYWB 4HIJB 2UY6A 4DOHB 1TCRB 5KSAD 1KPUB 1ZVNA 5DR5H 3JVGC 4FNSA 4PJ9B 3VRJA 3W39B 4EUPH 3RWHB 1JPSL 2X7LA 1OT1A 3RNQB 2LAAA 2HVJA 3PHQA 2D8KA 3WSQH 4I3GA 4KKRA 5BZXA 3S36L 3O0RH 3DMMA 1JGEA 3AS3A 4MXVE 2W0PA 5KVFL 3MJWA 3ESVF 3AQYA 3PIQA 1BZ7B 4X7FC 3AB0C 2EXWC 4AQ1A 3G9AB 1M9WA 5IM7B 4LLUA 4FI6A 1R3KA 2RFXA 3GTNA 3HLAB 5DEGA 1AR1D 5DURB 3WD5L 4ETQB 5B3JF 2AV1B 3VI4E 1ET5A 3RUGF 1WITA 1B6DA 4NI6A 3UG4A 5J1TC 3Q1EA 1YEFL 4NKMA 4X6BB 4L8SB 3VI3A 5ITFB 1S7SA 1NQBA 4KZEH 4HMCA 1QQDA 1K3IA 4Z3IA 2YR3A 4G7YH 1XH0A 2Z7ZA 5D1ZD 2BY2A 5D5MB 3VFPB 3GSNA 2KLSA 4UQAA 1Y18B 2X6MA 3ASWA 4PRHD 1UTDA 1TVBB 1JYWA 5ICYB 1ZT4B 4P07A 1HWGB 4XC1H 4Y4HD 1JK9A 3KLSA 1MJ8H 1TQBC 2ATPB 2WWOA 3EJRA 3L1OL 4JO4L 5EC2B 5SV4A 3HW7A 1R3IH 2YO3A 4WWID 1LO0H 4N0YL 2VL5B 2ZCHL 2GUYA 4X7CC 3G3LA 1XGUB 4JO3L 1NGZB 4D0CA 4DAGH 1MVUB 5AQ0A 5F8QC 1F4WL 1RD6A 2EYRB 3RAJL 2JLPA 4OZ4B 2NLJB 2VZ1A 4LL1A 2VLJB 3MLPA 1JGDB 1A9BB 1TTUA 4MMZC 2QGDA 2G75A 5HYSB 4ANKA 5EUKA 4OZHE 2WO3B 5FA4A 3TJEL 4LVOC 4PGBB 1REIA 2Y9RT 1N59A 3QI9D 4FHKA 3DOSB 3GJEA 3TF4A 3T6WA 4JRYA 1UM4H 1AD9B 1E6OH 3C5JB 4LKCB 3OF6D 3LMJH 1TSRA 3DROA 4LSPH 4P2RD 1MPAH 1VACB 4AEFA 1TYRA 3M46A 5AW3B 3UEQA 5JPMB 1V3JA 4X6DF 1B4LA 1F58H 3I74A 3BO8A 3BPOC 2XFGB 3K46A 3HFMH 3FFDB 1YN7A 2GEQA 3L16A 1D7CA 4QRSB 2EIDA 1UZ6F 1RVFL 1EHKB 4B27A 3DX6B 4DCQA 2Y7QA 5D70L 4BM7A 3QDJA 1I31A 3FQTA 5H94A 5DYOA 3VFRB 1TQCB 4BH7B 4E9TA 4A2FA 2RQ8A 2MNWA 4YBQD 4LRIA 4HOXA 4PREA 4QUOA 1CL7L 5K9KB 3T3MB 3HHRB 1YNLL 3T4YB 3EO9H 2OMUB 3IM1A 4HWEL 4Z77B 4LBEA 3I02B 4FKKA 3QEUB 1NFIA 1PLCA 4E9LA 1KJ2A 4QTIH 2WXFA 2HX8A 1MW1A 5A1AA 5C70A 4ABWA 1YPZF 3BP6B 4X8CA 4U1JB 2E86A 4M9PA 4WKXA 5H35A 2A5UA 1SDAB 4S1SL 4P9HH 1I1RA 2X89A 3TPUA 3U0TB 2ZKHH 4M8RA 3AC0A 4WUUB 5D6DC 5G4NA 1J5CA 2A6JA 4MVBD 3MC0A 3FTXA 1A6UL 2PR4L 1D7BA 4I9WD 4ZFGH 2Z8RA 2X2IA 3SD5A 3ZTEA 5FB8A 3V0DA 3C08H 1PKOA 1SXAA 1NBVL 3IVKB 1A2YA 5E8OB 2N1TE 4IIQB 4NQSB 4D8PA 1TO4A 2Z93A 5FXCH 1KV3A 2N7AA 4CADA 2PCXA 4XE5B 5KUMA 1TU2B 1E6JH 4IEFB 4TUKL 1KENL 1NBCA 4KHTH 1VJSA 1ZVHA 3HVDA 3MV7E 5ETUB 1HN1A 5IHZA 2YRBA 5I1JL 1GGCH 1QATA 3H9SB 4Z7WF 1KTCA 4Z78A 3ARDA 1U91A 2ICWA 2QKIB 4OFPA 2MCG1 5INDA 3V5HA 1CG9A 1XVSA 2XWRA 3R0MA 3D39D 1TOXA 4WFEE 1A1MB 2UX6A 5JYLA 4GG6F 1F4XH 5K59F 2FEEI 2WBJA 1NFDA 3KLHD 4QHPA 1T7XA 3ZE2E 5FECB 4IRZL 4UINL 4K7PX 3EGDA 4HZLA 1MFUA 3KL3A 2YJQA 3WEBA 2JH2A 1JOIA 4PJHF 5ECGA 2A6KB 4F5CA 3REWA 3ZZQA 2XC8A 4OZGA 4BXSV 5I1HH 1BYNA 2KS0A 5FW6A 3T0EB 4QOKB 5J1AA 2QSCH 3D9AH 4JO1H 4MYPA 2AI0H 3QIWB 1YG9A 1WC7B 4IMKA 2FJHB 5MEOB 3ARQA 5LG1A 1OB1A 3EHBC 4LASL 5D7IF 5F9JA 2FX7L 1ERNA 5CEXA 1UD4A 4AJWA 2YA0A 4FD0A 5L4MA 2OYLA 4FQLL 5IJVA 2V3DA 1U2HA 1FNGB 1KTKE 1PIFA 1UKTA 4OCSH 3B6SB 4XNMA 4Y9GA 3WI9A 1ETZA 3LQAH 3ZTCC 3EIFA 3F6JA 4M1DH 2OR9L 4U7SA 5C08D 3S6CA 1UASA 4OD3H 5KAQF 3EDJA 4WAFA 1ZEAL 1TJXA 3QUXD 2EJ1A 2XTJC 4PYGA 3VD3A 1NMBL 4G72B 4PJ7B 2QPEB 1MWOA 2PP9A 3ARSA 3N6YA 3INOA 4LLMB 4XN7A 1I75A 5MENB 3H9ZA 4Y0GA 1I4FA 1OGTB 3QPKA 3IAPA 4XPTH 3RIFK 1V54B 1W80A 2E7BA 3VXNA 1HJBC 2JVUA 3LKQA 4MNGE 5DGQA 2ZX9A 2BW4A 3F7VB 3PG2A 3HHSA 1MFCL 2WZPD 2DM7A 3BKYH 3RDTC 1I7RA 4PN6A 3FTYA 4LEBA 5HYJB 1IC5L 4J8RA 1ICTA 4KY1H 4UT7L 3BGAA 4Z6AT 4YR6A 3M1BB 3L4XA 5L8LB 1K8DA 4MD4A 5E9NA 3CVHB 1JPTL 3DGGB 3VVWA 1JD7A 2HSIA 3EOYG 5IW3A 1OSZA 5C0JB 2WV3A 2NXYC 3RBGA 1NUDA 5JQ6L 4UTBH 2P8LB 2ARWA 1DQMH 1O6SB 5KYUB 4X7SH 1UWXH 3FRPA 5G55A 4AGLA 4AW4A 1U8NA 1TFPA 2Z4TA 4U05A 2OMWB 1AACA 2W81C 3R0NA 3AMLA 4A04A 2DH3A 1C1EH 3L3KA 3PYCA 1AZNA 2F1AA 1DE4A 2YD5A 4FYQA 2HFGL 4LE8A 5AVXB 5AB2A 1I3RA 2EP6A 1DQTA 5EZIH 2EE2A 4KKLC 3N42B 4UNIA 1O7SA 4AM0Q 5I6LA 2A77L 5A2LH 4RX4D 3GXDA 4U4BA 1G7HA 2CCVA 2DS4A 4PG2A 1X5JA 5CMAA 4ZO9A 2FIKA 2Q7AA 3CUPB 3ZKQD 4PJBB 4QJ3B 5AW4B 1XCTA 1DJZA 3MCKA 4QKTA 2OK0L 3HN8A 3KLAB 4HUNB 1ZTXH 4PJFA 1A6TB 2Q6WA 1DVXA 3FFOA 2C4FU 1IGYB 3D8MA 4UTCA 3JUZA 4PRHE 1A7QL 4UNUA 4XWOC 1OAQH 3O81A 2FNWA 2W0KA 2F7QA 2CK0L 2CK2A 3MLZL 4XH2A 4UAHA 4PPTA 3C6LC 4HOWA 1CFNB 4PP1D 1XIWD 4GLRH 5CZXD 3I85A 3ZE0E 3LH9A 1YEGH 4EI5B 3L1FA 5IW6A 5FYJU 2LFGA 3RG1C 1G7PA 3BCFA 4GUPA 4B9PA 1UM6H 7PCYA 1BM3L 2P5EA 5GSVA 2DQTH 4S0TD 2P9RA 4LNRA 1FC2D 5J9PB 2FT8A 1NBYB 3O6FD 3FUFA 1CGSL 3K2UH 3KYMA 1NGQH 4YXHL 1QPKA 1ZLUK 3WNJA 3MFGB 4UBDC 1LE5B 4X5QA 1CR9H 2XBZA 4XPBH 9PCYA 2H41A 3G5WA 1BLIA 3QUMB 3BSHA 3DGDA 3HPJA 3QG6B 2BOBA 4EMZA 1T1XA 2CBQA 3ZW3A 1FL5A 2ADGB 2NX5E 1PVHA 3LJ3A 3PV7A 4UUJB 3N50A 1A7NH 1EA9C 2XETA 4UM9D 5AENA 2I60L 4XO8A 3NIGF 5TPWL 5IW1A 3F3HA 1CDCA 3B8YA 3GZPA 4ODSL 4P2RE 2X2YA 1IX2A 3HN3A 3FAXA 3TNNA 3ZJAA 3KPMA 5LJYH 3DUHA 5JHDA 5AVTB 1F90L 3WY1A 3BWAB 3IGKA 2PP7A 1KMGA 4PRBB 3VFNA 4M3KB 5AOJA 4YDNA 4Q7DA 4PLNC 5I28A 3CDZB 2XXCB 3TEUA 4PJDF 1OQOA 4OF6A 2I7SA 3OV6A 4K7FA 5FFOA 1KXQE 3ZKMD 4DPRA 2W38A 1PNDA 5J4MA 5T1MA 3CZFB 2WXIA 2H47C 4J3OC 5ALBH 5DJAB 4WQOA 1KOAA 4OM1H 4L37B 3NCWA 1JV5A 5T33L 3WFCL 1G7LB 4OQTH 4L4VD 4G8GD 5CUSL 1A4JA 3MRHA 4L1TA 2MHAB 1P9MA 2VOTA 2VIRA 4ODWB 2WY3B 3QUKB 1BVNP 4NSKB 5EIIB 1TJHH 4H88H 3SE8L 1EJFA 4LPCA 1QSZA 1QVOB 3BUIA 4Q14A 4UTAH 4YSUA 1UEYA 1XGQA 1VFBB 4GW5B 3SDAA 4R7DB 3E80A 4I9WE 3LX9A 3A6CL 4PY8J 4D0DB 2YAFA 5CEZH 5DD6A 5T5NF 3LKOB 3UO1L 3DMMC 3WTTA 5B1CA 3DJZA 4H1LG 2V5SA 1NCOA 2ZT9C 1R47A 2K6YA 4PTTB 4TSBL 4ZO7A 4AQ1C 2BJML 3GJFB 1XH3A 3UAJD 4WWOA 1QKZL 2W1NA 3BCDA 3CFKB 3VSQA 5HPMA 1X5XA 1SY6L 2EH8H 3JXAA 1PU0A 2F19L 4AZ8B 2VN7A 2Q3XA 3ZZSA 5E8NA 3U36A 3V8OA 2LLGA 1Q1PA 1X5YA 3UX9B 5DFVD 4RAHA 4NGHL 4PIRF 1FYTD 1BLNA 3O3EB 3SQOH 3LKRB 4I48B 3NZ8B 4R2GB 1AYOA 5C3IA 4WGWB 2IGFH 3QDAA 3FT9A 4KXBA 1IBDA 3D39E 4E9RA 4FTVB 1E4JA 1CYGA 4YC2B 1KCSH 4Z3TA 2Y24A 4OLWL 1KIPB 1JFHA 2HRLA 2J3SA 4OFDA 5E4OA 1MCWW 3B9KD 2HVKA 3WHXB 43C9A 4E68A 2B0SL 3EH2A 5I6KA 2IQ9H 2J8OA 3CU7A 4PJEF 4QYOB 4Y2OA 3SO5A 4LARL 4XCNB 2V9TA 2J88H 1OP3H 3II3A 4UOQA 2GJPA 1LO5A 1LILA 3UC0L 4PVBA 4KZ0A 4ZMAT 2YEQA 1U92B 4L8BB 3KS0J 1N3NA 3WIIL 3PJNA 5C0IA 4GNKB 3CN2A 4ANWA 1GPOH 4XMVA 1UQSA 3VRLF 1TLKA 1MF2L 3GSQB 4BWUA