3ZDXB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdxB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdxB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdxB03
1CK4A 2NUPA 1BHQ1 1DZIA 1ZONA 3ZDZB 1YUKA 1OLZA 1SHYB 1OAKA 3GXBA 4WK2B 3NIFB 1FNSA 1JEQB 2WW8A 4PN7A 1M1XB 4UM8B 4JDUA 3FCUB 4Z7QB 3AL8B 1M2VB 2QTVA 5HGJA 3TW0A 4O02B 5E6UA 4G1MA 1RRKA 1M10A 1L5GA 5E6SA 1MHPA 1NA5A 4IGIA 1RTKA 3K6SA 2VC2B 4NEHB 4O02A 3EFOA 4MMXB 4WK4B 1M2VA 4CN9A 4IXDA 1YVRA 3RAGA 1JEQA 5E6UB 3K71A 1DGQA 4MMZA 1ZOOA 1JV2B 1MQAA 1PD0A 1MQ8B 2VDLB 2VDRB 2XWBF 1IJBA 1SHTX 1ATZA 2NUTB 3T3MB 3K72A 3N2NA 3EGDB 4C29A 4K3JB 2M32A 1M1UA 2O7NA 5HJ2A 4MMZB 4NENB 3EG9B 3PPVA 3TVYA 5KYUB 5KYWA 3EH2A 2VDMB 4M76B 5KYXA 3OL2A 1PD1A 3AFCA 3T3PB 3ZE1B 1T6BY 2ICAA 2VDOB 2X5NA 3EOBI 3EGXB 2ADFA 4G1EB 1IJKA 4HQKA 4HQLA 5BV8A 3BN3A 1JEYB 1QC5A 3QA3E 2NVOA 3AL8A 4JX0A 2VDKB 1LFAA 1JEYA 4CNBA 4G1MB 3IBSA 1RS0A 3F74A 1IDN1 4DMUB 3BQMB 1SSLA 4A0QA 4F1JA 3TXAA 2ODPA 3EG9A 1ZOPA 1PCXA 3M6FA 2B2XA 3EGDA 1FE8A 3K72B 1CQPA 5E6RB 3NIDB 2VDNB 2P26A 1JV2A 1MQ9A 2NUTA 3ZDXB 1U0OC 2XWJI 5KYYA 4XW2A 3ZE0B 3F78A 4F1KA 3PPWA 3FCSB 1U8CA 4MMXA 3ZDYB 3E2MA 3EFOB 3Q3GE 4O3TB 1Q0PA 3OKYB 4IHKA 1RD4A 4C2BA 4BJ3A 1BHO1 4G1EA 2XGGA 4GZ8A 1T0PA 3EGXA 2P28A 3EH1A 3HI6A 5E6SB 3TCXB 5KYNA 4Z7OB 1QCYA 4FX5A 3PPXA 4C2AA 5KYXB 3VI3B 1U8CB 5E6RA 3ZQKA 3EOAI 1YVPA 4MMYB 4HQNA 2I91A 1M2OA 5KYYB 4NENA 1U0NA 3IJEB 1MF7A 5KYUA 5KYWB 2I6QA 4CN8A 5ES4B 1AO3A 5HDBB 4Z7NB 3OKWA 1AUQA 3IJEA 2UZYB 2NUPB 5LN1A 1AOXA 2I6SA 4MMYA 3AL9A 3BQNB 3HXQA 1N3YA 1N9ZA 3ZE2B 3NVQA 3V4VB 4O3UB 3K71B 1JLMA 1TYEB 1V7PC 4WFQA 3K6SB 2ODQA 2WINI 1XDDA 2VDPB 4UM9B 4HQFA 4HQOA 1XDGA 1SQ0A 4UM9D 2IUEA 1QC5B 3OL2B 3V4PB 1IDOA 2VDQB 3HXOA 3FCSA 4WK0B 1M1XA 1L5GB 1PT6A 1SHUX 1UEXC 4WJKB 3PPYA 4FWWA 1MJNA 3VI4B 3NIGB 1XUOA
chains in the Genus database with same CATH superfamily
5K1ZA 4DN4L 4E42B 3LD8B 4GQ9L 2ZXBA 3MT9A 2FNAA 4M6NL 2RK6A 2FEDD 3OXRA 2CGEA 3F83A 3TIEA 2YPLA 4HIPA 3HZYA 4MUGA 1E4KA 1P4JA 2AA3A 1ND6A 1XEAA 4WBXC 3ET5A 3WLJA 4BV9A 2NW2A 1N70A 3G17A 1IM3B 5D3QA 2Y7MA 3CLKA 1BXAA 3T9AA 3HN6A 4CQMA 5EEYA 3KDMB 1CDCA 2V3DA 4BN5A 1DXQA 1SCUA 5IJ9A 2I60H 4N0DA 2GK6A 5EA0L 1YZ3A 3CXHK 2AF3C 2CXPA 5LWHA 1QEWA 1KIMA 2FN9A 4OIMA 3DVAA 1JI0A 3TFKC 2ATKA 2VDNH 1PUXA 4YR7A 2WIFA 3RVRA 2ZBVA 2FJSA 1EHLL 3OCZA 4M88A 1OXSC 1R46A 2DLCX 5LZ5A 3BMOA 4PYOA 3UADA 2I2BA 3PUXA 3PPWA 3B9KC 4XLZA 3HC7A 3E9DA 1NQXA 3SDCA 4GWKA 4GQPH 5D00A 4PJHA 3QBJA 5AVXA 1K6QL 1VPVA 3AHGA 2FOLA 3ZY2A 1UA7A 2VZ8A 2ITCA 2KB0A 1XB3A 2VZ3A 4F57H 1Q12A 4H77A 2M98A 1VACB 3K0FB 3VMFA 1E5DA 2JZCA 5JE8A 4OI1A 4DWVA 1LQTA 2QRVA 4EQ3A 3LUGA 4KVNL 3P97A 4OAWB 5JNLA 4LXYA 4EI5A 2BC9A 1W4LA 3V6LA 2ZX5A 1ISSA 3HC3L 3DXAD 3MJ4A 3V2AR 1QRNA 4MQMA 3EARA 1MX3A 3NVMB 5ALYA 4X6CB 2HRDA 1KQNA 2KI6A 4MQLA 2FMFA 2CR0A 4X62B 1HEZA 1YT5A 4ZAWA 5I17B 3DAPA 1LE9B 2V5TA 5JTTA 4MNGE 4WH0A 1NZFA 1TXKA 3QUXA 4FA7B 1XVVA 1KZ9A 3IGFA 3SPIA 4N3CA 4LPUA 1ORRA 5HDOA 3D08A 3D4GA 4D9QE 5HTKA 1XFPA 3M7OA 1FYTE 1I1AA 2J3MA 2PZFA 3WS3B 2PWPA 2JIRA 5AUQA 2H1OA 3AIOA 3PQYA 4TTGA 3HLAB 5BV8A 3LKDA 1LJUA 2P9HA 2PPAA 1W34A 3I9PA 1FIGH 3MAJA 4UOEA 5IJBC 1V71A 5HGBA 1VKXA 1WE2A 4G8GB 5K9JH 2VF7A 2VLJB 4P6VF 5E8DL 2WF8A 5KTSA 3HXMA 3FPBA 2YV2A 1IU9A 3BA6A 3DBXB 4NJMB 1RZJC 3RZCD 4XC1H 4DSTA 1JQJC 4NV3A 1EVYA 5AFAA 1QYXA 4LEBA 4JB8A 5DC2A 3TXXA 4AG3A 4Z0PA 3EEFA 4QNPE 3UO1L 1R8JA 3HSKA 4AUKA 2VPPA 3FTQA 4URUR 3SDCD 1LL1A 3KYAA 2DHQA 5DJ6A 4C4RA 1C12A 3RAJL 1HC7A 3OIUA 1MP0A 3TZCA 2FZLA 3QGVA 2BSSA 3TBBA 4Z23A 1SUJA 1WBJB 3U7QA 3QRGH 3QRFM 2WWHA 3IJYB 1MJGA 4KZKA 1GL4B 1W30A 1GEGA 5ETUA 3WL9B 3E9QA 1D9XA 4U00A 1Q0ZA 4RD3A 1E1CA 2X0RA 3VVCA 3WGHA 5CD5C 2W2LA 2PUGA 4X8OA 1F6AB 1G0YR 3DUFA 1T2FA 4UAOC 1UKYA 3KL0A 1XRJA 1ZVYA 3RSZA 3FA2A 3GBEA 3IIKA 5GJTL 3R1GL 3T2NL 1SXAA 3N2KA 2YD3A 5EKUA 1JWUA 4UDTB 1TF4A 2ENQA 4KX9A 4JLRB 4N8PA 4RLHA 2W2NA 4BTEA 4RRPA 2R79A 2G5PA 4V0LA 5E9NA 4FQXC 1XV8A 1PWEA 1RWOA 4BE7B 3BAEL 1EHXA 2FEEL 2AG0A 3U2IA 3APNA 1Z74A 4OCXH 4ZQIA 3RIAK 1GGCL 4KO2S 1GLGA 3UH1A 2R8ZA 3E8MA 4TSAL 4PXSA 5MEOA 2W11A 4B40A 3RZWA 1DBAH 3IJPA 1NN5A 1AK9A 4P5PA 3HBGA 3TE7A 5KSWB 2B1AH 1UVQB 2NY5C 2NCMA 2BSED 1AZZC 1NC4B 5JS1A 1TYCA 1C5CL 4TMWA 3LN5B 4HV8A 1MJ7L 1CUZA 3WE1A 4L5IA 2QZSA 3L6CA 5H94B 4KXQA 4L07A 4L76A 1XNRB 4J39A 5CJOL 1ULBA 3DWIA 3ZE2B 3N42B 2FN3A 5L4NA 5B1YA 1A6UH 1OM3L 4HMCA 1EO8L 3O4LA 1NDUA 2NGRA 3GLHB 2A7XA 4OF0A 1Y07A 4Y5VB 3DW1X 1H42A 2C00A 5DYTA 4HHAA 1U4OA 3HDYA 5K7SA 5JPMA 3I5YA 2OL3L 1KPVB 2YN4A 5B7MA 3U9SA 5FUBA 2ERJB 3SDAD 2E6PA 2J9GA 2F1OA 4JFTA 3U30B 1UQSA 2VLKD 3HG1A 1RFGE 5E7JA 2VDRH 1R3LA 4N2LA 4AY6A 5FFLA 3U6XA 3A4AA 3DTXA 1DHKA 2F74B 4MIOA 5EUKA 4TS3A 2DJSA 3CFKB 1CY1A 4A8HA 3RYHB 3FT2B 5DD1L 1C30B 3D3WB 2WV3A 4P4RB 4BO4A 2FP3A 1XCJA 3EOTH 1AKWA 3LPMA 1QRTA 3LZLA 2E1RA 4LAFA 1NBYB 4MHHI 4M6ML 2QGZA 1FC0A 2UZ1B 4L8LA 1NUUA 4EF3A 4OGQC 2F2HA 5CZRA 1XTQA 2P4EA 3NIDE 1FRGH 2D1TA 5EMHA 2IBZX 4EF5A 5KYGA 1NCWL 4Z76B 2ZGVA 1FFXA 1AF4A 3CUEF 2V4MA 1AQKL 4QHKJ 2XQYG 5ES4B 4G3YL 2R8OA 1KAOA 5ALLA 3IKJA 2BV3A 5F97E 2NQ8A 4RSHA 2RE8A 5B64A 4M9XA 3OJOA 4MIYA 2YPLE 4DDHA 4KXXA 1A72A 2WG2A 5CN3A 1FRZA 5KNCD 1DQPA 4Z51A 3TIVA 3TYXA 1JL8A 5C2UB 4W9RA 2YA2A 3PAZA 4XPHH 2J8ZA 1QRDA 1A7NH 2A38A 4AUYA 3H9EO 2WF7A 2DOCA 4AD8A 1TJIL 4ZQKB 1EJ2A 3UCQA 1ZESA 1AE1A 3O3AA 4HH3C 4D9LL 4GI9A 4BDSA 4M02A 1NQBA 2QBYB 4WACA 3KS0J 4OAPA 1NG9A 2PR9A 3T6WA 2O07A 5DLMH 5DV9A 2GZHA 5B38A 1BZYA 3H9QA 5CXXA 4R1PA 2BXYA 5E9DA 3QJRB 2O8VA 4C3ZA 5KZMB 3KPMA 1PKOA 5CGBA 3W79A 4L3CA 4PQEA 4DDVA 5EU7C 1J70A 1WRBA 1HE7A 2HFFB 3B60A 1Q22A 3MEQA 4B7UA 1B8OA 1EI9A 1IB0A 4FXPA 4HOWA 4F5YA 3QUGA 4I66A 2QVKA 3MV7B 3ACCA 4X2UA 2P41A 3DMRA 3MBXH 3FFCB 2OA0A 4YXHH 4BCYA 2BSDA 1TOXA 2E7DA 3HC3H 2ZAYA 3L4SO 3OKYB 3LQYA 5AB1A 3VSQA 3LQAC 1KT2A 2A94A 2OX5B 4LLVB 4O4YL 2Z5FA 4V38A 4JI2B 2FR0A 4FR0A 1PQZA 5AI9A 1OC2A 1S3IA 3N53A 3RSFA 1ZISA 1KTDB 1VE7A 4NBWA 5IJDC 1PKQA 1US8B 3FONB 4LDPA 1RJ9B 4FQHA 1HTWA 1XVLA 2V6HA 5HDRA 2BBTA 5FI0B 1SXCA 1TZ2A 3TW8B 1LM8V 1NGZB 3HA2A 3SY6A 2P8LB 1I3NA 4P3WA 1WP9A 3VNBA 4K8OA 2EFEB 4A8JC 5LU9A 4Q1DA 2FP4A 4YAOA 5JORA 2LLGA 4NDZA 2Y93A 1IOLA 3KPOA 2HBZA 5IPFA 3BD8A 3SU8A 1KJJA 2G9NA 4LJSA 3CR3C 2E75C 2COKA 1NFAA 1OY1A 1ITZA 1T1JA 3FN0H 2XA8L 1KPIA 5DYGA 1CUDA 1BEZA 3AU8A 3IC5A 1DVFB 5HYIA 4M29A 3HPQA 3AOEC 1VLXA 4HDIA 3IVXA 1SUWA 2H7CA 3U6BA 1G9XA 3PDDA 1ADFA 1EFVA 4IRMA 3H9GA 1KFEB 4PVDA 3OE4A 1A50B 2NU6A 4TZ0A 3II1A 3V0VA 1WZ2A 4FQ7A 1RQ7A 3A5VA 2C3GA 4RY0A 2CEAA 3MUGA 1JA0A 1UP7A 3Q87B 3Q2IA 1UM8A 3EZXA 3U1SL 1QBMH 3EF7A 1CEYA 4FQ1H 2WXPA 1I7ZA 25C8H 2OHVA 4JXKA 2RGGA 4MQSB 5AM3A 3N2KB 1NCUA 1YFJA 3MHZA 5CVVA 5B1EA 1KVUA 1S78D 2G17A 1M83A 1ZUWA 1FVDA 1FW8A 2GZRA 2PV0A 1BECA 4BPRA 4GRLD 3GQBB 3R7SA 4O00A 1IPEA 4UCXA 3C87A 2FZ4A 4U5XA 4WY8A 1DQQA 3SPJA 4WLEA 3RFZA 1V0JA 4DVBB 4C88A 2H29A 2GNAA 4Y4KD 2UWEB 2GLUA 3MCLH 4CSPA 3FSGA 4G4SO 4D8YA 3HNTL 2PSEA 1J8FA 3FSJX 4QSMA 5FEMA 3LWBA 4R54A 1OAYL 2DR0A 1MB9A 2IY8A 3DHPA 2IHKA 5CYFA 1AKMA 4YRLA 3L8HA 4F9EA 4DV2B 1JFFB 2HJGA 2AJCA 5EWJA 3OG9A 1T4DA 1VM6A 1KBGL 2X4TA 5F3HA 1VDZA 1EFCA 2R27A 5DMHA 4N87A 1F5NA 4MJ6B 4L8VA 3ZKWB 4J8RB 1R16A 4LLMB 1AMNA 4CAGA 4AIRA 4HIXL 2QD4A 1M7BA 3ROOB 3RAJA 1A02N 2VP4A 1FFOB 4K6KA 4UAJA 3M4ZA 2NV6A 4E1VA 2YRWA 3KPSB 2J4WL 1IBYA 3EOBB 2F9LA 4B0MB 3QEOA 3SC2A 5AYVA 3E0XA 1T4WA 4A0SA 3PHHA 5TQ2H 3BDIA 4BXVA 2PGAA 4YSSA 2OWEA 5GGUB 2FVNA 3HUJB 4S1SH 1KDJA 4MD0B 3IXTA 5TDHA 3REWB 1P1VA 4X4KA 4YJ2F 4U0KA 2BH0A 2QE6A 4OLEA 3C43A 3KDSE 2JF0A 3U9UA 3ANXA 1JU4A 3MRCB 5DZVA 4TMZA 3GO1H 2GHTA 1UD3A 5FPQA 3UHAA 5LOVB 5LVEA 5CA1A 4B9EA 3NT0A 4M1CD 3WN6A 3E8SA 4TTQA 1ZONA 4RY8A 4K73A 1ZXBA 2N7SA 1E77A 2QNIA 3APDA 4DQAA 5ESQA 4FP8L 1IAKB 3R1GH 3WCYA 4N9GA 2W90A 4X0EA 3MWKA 1U1FA 3B20A 1IGMH 3OU7A 1U8HB 5TGDA 4ZQFA 2ODIA 3GLEA 1VFOA 1PEYA 4PVLA 4M0EA 4ZHQB 1DQNA 1RZ7L 2APFA 1GS7A 1NBEA 2XCQA 2PTTA 4N01A 1FMTA 4OB8A 4JHAH 3P0YH 4IH9A 3GPDG 5E9WA 1MHTA 3IBTA 1PLGH 3V4PL 1E3DA 4KPYA 2WILA 3D33A 1PZFA 3IP8A 1L1FA 4L2IA 1K0UA 5FD8A 2IKSA 4YRJA 4MNQE 1K8YB 1KYXA 4YMGA 3FN4A 4FUQA 3SC4A 1FCCA 5HYSA 3EYSL 1XHEA 5AAWC 1JHDA 3Q7QA 1KJ2A 3JWDH 4LLYB 3E6HA 3NJJA 5SZJA 4C0XA 2DWXA 4KREA 4PW0A 5EN3A 1G6RB 2XNDA 3FFAA 4F9TA 2H2IA 1LO3H 5BPFA 1KRXA 2NY6D 4PJ5E 1LQ2A 3ETJA 4IO0A 3GG9A 5G1PA 1LLCA 2IPNA 3ZWDA 3OEYA 3ZWKA 1QO0D 1VHTA 2HW8A 3SE4C 3RBGA 5TDPA 2R60A 1P7KA 3CCFA 2XUAA 1EYZA 1UT6A 4KK5C 3ES6B 3P3RA 1J0IA 4X7MA 2I87A 1OR8A 2PTTB 2ZZMA 1T5XA 4Q8BA 2G0LA 1PUJA 2XB9A 2XOKA 1GNVA 3ET9F 3M17A 2HKHH 1KJQA 3MQ4A 1RQXA 3F6SA 3WY9A 4O25A 6PFKA 1NIJA 1TO5A 3CN0A 2MFNA 1GCFA 4NOJA 5EPEA 1AIFA 1I3RB 3OZDA 2AJDA 1LE9A 5TH2A 2AI0H 2QRMA 3D8UA 3T7TA 3QJOA 1ECPA 2J6HA 4KQCA 5JPMB 1Z18A 3FVTA 2O5VA 3VJLA 5F7JA 4DDKA 3QYMA 2AOXA 2VH1A 5ALPA 2DI8A 1YQVH 3ICQB 4NGHH 2H48A 1IUZA 1PF3A 1NFFA 1UA6L 3U7YH 4UM7A 1YC8A 5COQA 3WG7B 1AQDB 2MNUA 3QFJD 3DULA 4YO0B 4WI3A 1AG9A 3OLIA 5JUEH 4K86A 5TGTA 2YD9A 4FULA 3GIDA 4ZYKB 1AIZA 2VDPL 1U8TA 4JLNA 5FHBL 4FOOA 3GUVA 5T6MA 1DUVG 3PYXA 5GISH 1ZOSA 5EUBA 2UUCB 1WB6A 2FPIA 4YJGB 2VN5A 5FA6A 1A8QA 1SD2A 1NQVA 5GONB 2R7NA 2X8WA 3CTTA 4BBZA 1IM3A 1MCOL 3D6FA 3ZU5A 3F58L 5HP4A 5DTMA 5GIOE 4E14A 1UB6B 4BS9A 2WYTA 1JXFA 3T38A 4R81A 4G4JA 4OH1A 5DJXA 5LWYH 5TMBA 3FTEA 3F58H 3RUPA 4MXWH 2VDWB 4IDLA 2C5BA 3HG1D 4RQQB 2Q3AA 2HP4A 4FS0A 4EJ2A 1L1QA 1DKNA 1BXGB 2XVXA 3MJ7A 3LTVA 4BE9A 3GP5A 2WIJA 4B3DA 4N8SA 1REQA 3FOLA 5IIEB 1VG9B 2IZ0A 1MQAA 3U1SH 1XO8A 6PAZA 2OSLB 4FQCH 4ILDA 2ILVA 3RRZA 4GO8A 2R6JA 3GNQA 4IIQB 1E6JL 5D2NB 1GP2A 2FSIA 4A2HA 1UZ8A 1C3OB 1GNLA 1E9FA 4JBLA 3WS6C 3U83A 1L4HA 3CA8A 4Q3NA 4KPHL 3WKEA 1SA0A 1YS4A 2C9VA 1ARZA 3RTGA 3OMZA 3TOPA 4G8FB 3EGSA 4NSKA 3BGIA 2DQEL 2VAVA 3NQIA 1ZA3B 1OM9A 1FNSH 3HCVA 4RZSA 2Y23A 5DP2A 4GI1A 3KS0H 5DH9A 2FBJL 3MM4A 2ZYSA 3E7XA 3O1HB 1ST2A 1J0HA 1O6VA 3OKMA 4PLFA 2Q3LA 4C56A 3JYQA 2HWXA 4I5FA 3QE5A 3WTBA 2FHFA 5DQDH 1XHFA 5JYCA 2ZOKB 4W70A 1HILA 3FTYA 1TO2E 5JNVA 1FNCA 5JXED 1AXGA 2YJZA 1FNEA 4WEBH 3GBVA 4LLDA 2CV2A 1R74A 2F5AH 1PR9A 2ILLA 1V5WA 1WQVT 1UHVA 1KGWA 4C1NA 4YAQA 4W5JA 4WU5B 5IJZA 2J31A 3GCWA 1ORSA 1CK0H 1POXA 3ANSA 4XNYH 3H4TA 2AQ1A 1A9XA 3V6MA 3KVYA 3KPQB 1I85C 3KOYA 4JFWA 5IM4A 5HM8A 2RHJA 5DDHB 4XJVA 2UUPA 5ALVA 3WXVL 2WV7A 4RCYA 4PO8A 3TOZA 4FEEA 3CFIC 4RIRA 3ESZA 3O4GA 1DFBH 1ACCA 4TL4A 2WK2A 3QA9A 4JANA 4F80A 2BDUA 2VTBA 4BNKA 4RXTA 1NSFA 2OHOA 4WE3A 3GKWH 1IJ9A 1IJKA 4R8KA 2DLTA 1YOBA 2W0KA 1D1SA 2QZQA 3PDHA 3PXHA 4KVFA 1D5CA 2AEPH 2Z1DA 4YO8A 4DG9A 2Q8BH 2XT0A 4QPEA 4AZ3A 2ZB4A 3DEKA 5FO8B 3IPRA 2Q1UA 2YMOA 4KNTA 2F54E 4AQAA 4AOFA 1OX4A 4DS3A 3S8FB 1KYYA 1SLUA 1N2CB 3L4XA 1SBYA 4FGZA 5IULC 4NCC2 5F89B 4WRLA 3MRGA 2WPNA 3WXMA 3TASA 4R4BA 5CN2A 3F49S 4RLQA 3GXOA 2VZ9A 2QB5A 3WKBA 1A0OA 1EUUA 4J2QA 3KYDB 1T43A 1D1PA 5B8CA 3B2DC 5A02A 1JPFA 4JDZB 1D2PA 1J2JA 3PABB 2WTRB 4PJ9C 3BOVA 4P2RD 2X3CA 3R0MA 1M33A 4B44A 1PEDA 1MAKA 3D4BA 1MCPH 1P69B 5JAOA 4OGYL 3ASZA 4O2BB 4N2MA 1MAJA 3VMNA 4IMLA 4LVEA 1MI5E 4LTNA 2CSUA 4XQ9A 2N42A 4KTTE 1AR1D 3QLVA 2VQTA 5JCZA 3C6LC 3RB7A 1IZKA 4JHAL 2B39A 4P5SA 1KP2A 1YY8A 3OXSB 4E70A 5HY9B 3HZOA 3ZHZA 5I66A 3FRHA 2CRYA 1OTSC 2ASVA 3Q3IA 3O3AB 4L3EA 4CVNA 2CD0A 4IHBA 4LW8A 3EYVA 2Q8AH 4Q1EA 2AJUL 4ZTUB 4F2WA 2WAMA 1JQ3A 4KH0A 4OHVA 4XQGA 4IZOA 2O8CA 3DAHA 1HI6B 2OTUA 5IBRA 3T1YB 1NOIA 3HVRA 3U46B 5CH5A 2YWZA 3O8OB 3CRQA 4Y8DC 1LD9A 2GO7A 5D4HA 4YUYA 3C3BA 3R0IA 4DHWA 5HDBF 1EFQA 4C05A 2WD0A 1WMEA 3PUVA 2R83A 4JC5A 5E6RB 4A04A 2N1TE 3N7AA 3FQXB 3N1FC 2MEJB 4ONOA 2MQCA 2DF8A 3FB8A 3EW3B 4QF1A 3WP0A 1YMHA 1MH1A 2XRMA 4F3FA 3D0VB 3LCUA 3ISJA 3HJGA 2D13A 2CSPA 1OY3B 3QMVA 5KTRA 3GC6A 3RJMA 3LX9A 1IZJA 1IFGA 4XOCA 3DIVA 1KPUA 3QBDA 1NXQA 3H5WA 3X12A 1NAMA 1JDBB 5CUSH 2JWYA 2O4CA 4JQYA 1MFUA 1QLRA 4X7SL 2FX7H 3FC8A 3TA3A 2WV9A 3VSUA 3BVNA 3T5BA 2ABWA 5CA0A 3JUZA 4OM1H 3K80A 1FXWA 4JFXB 5LZ9A 2JEZA 3K4DA 3TH4T 1EGJH 5FYJL 4NDAA 2VXTL 1J8HA 4MA4A 3DHJA 4QD2E 2R4SL 1RD6A 2PY6A 1OPOA 4YN3A 2VP9A 2XJ4A 5CFPA 2XX3A 3BMNB 1CZ8L 1WW2A 1QZZA 4L0PB 1PEAA 4PCUA 5DJ8B 4HZUA 4BEVA 1WHSB 4YGVA 1I8KB 1XKXA 5T33L 1H8EA 2AB0A 3E35A 3MCVA 4DZBB 1FLAA 1E94E 3M6DA 2A9PA 3AM3A 1FFQA 2ICEC 1H8HD 1OFHA 1Z9BA 3SS8A 4HNTA 4LJLA 4UVEA 2PTHA 4H7HA 3A06A 3GSRA 1YKSA 1J5OL 2DJ4A 3DXAE 2BMEA 1J5DA 1DRJA 4TVSa 1TJGH 4ENWA 1PQUA 4D9FA 1P5HA 5DUPL 2FMTA 4CUZA 1FDWA 3GGCA 4ODHH 4F5CE 2OSWA 4JZOA 2OW7A 3OZAA 4NH4A 2AI3A 1GZUA 4I2XA 5HF6A 1WL8A 4EVIA 4WCVA 3AHEA 2KKQA 3QUKB 3DLBA 2X13A 1U0HC 3OC8A 4LRUA 1JNHB 1DLHB 3NG5A 5I7VA 2XRAH 4OJFL 1IQDA 3IF1A 4IV0A 2BGJA 4QKTA 3NGBC 5DHYA 1J42A 2E86A 5CB0A 3OBAA 2B1IA 1HH6B 3MRQB 1XXLA 1WC7A 4TXVB 2YXNA 4DPMA 3GT0A 3GBSA 1FMFA 3E03A 1PLJA 3A4TA 1KPHA 3T9FA 4CR8A 4URYR 3TA3D 1PR2A 2FMIA 1SC3A 2YWBA 3OE5A 1JNJA 4QJ5B 3WLRA 5H4ZA 4MPRA 5DR5H 2O5ZH 4M6WA 4IG9A 4FYTA 1EEYB 5H81A 2Y4SA 4TYQA 2PRZA 3W2FA 1SCKA 1JXAA 4QHTA 1J20A 2B14A 2GBGA 4C0LA 3NFRA 2ZJZA 2VERN 4CFSA 3M89A 4WU5A 5MDHA 1GZ3A 5DM60 4NZFA 4L5FE 4PJ5A 3OE7D 1PJ8A 3I3EA 3Q6GH 4XP6H 3QPWA 4G0VA 1K8DA 3GUTB 1R3IH 2PVCA 3NH7L 2EOAA 2GJ6D 5BN3A 3KHOA 1Y8AA 3A4EA 4B4OA 2FRVA 2H4FA 4BVKA 3NC0C 1JDVA 1VTKA 2WSPA 4ZUSA 3V5NA 3K8KA 3GIWA 2HM7A 1MQKL 1VCNA 1XAHA 5F5LA 1DCMA 2M2IA 3OKMB 4FYMA 2CLRB 4QJ5A 3QEKA 1V4BA 2ET6A 4AT6B 3UG6A 5AUMA 3FBQA 1E0DA 3AEKA 4C7KA 1UBKS 2NY7L 1U4FA 2RJMA 1IVYA 3TEWA 1ZOIA 4ZT3A 5C08A 1B0GA 3ATBA 4BNGA 1JUFA 1QYVA 2GCNA 4QG7A 5KTNA 3H0KA 5G1NA 3QI9D 4XI5C 2E4ZA 2NN3C 1ZK0A 3TONA 4DY6A 1JHTA 2HVKA 2C0QA 3RJ5A 4JVSB 4YBLC 3ZV3A 3ADPA 4DA7A 4R4FL 1E8WA 2NZXA 3PWZA 4HC4A 1Z4OA 5F8QC 5AI5A 3WFDH 1EDBA 4KFZC 3LXUX 2P91A 1WMFA 5E2VH 3EN0A 3CSTA 1TQWA 3EJTA 2O5YH 4WI9A 2ZE8A 1U2CA 2ZB8A 1TYRA 2ZXAA 2N46A 1RFDH 3RWGA 2BNRE 4HWKA 3AFLA 4JPIB 4BL5A 3GLGE 3OG4B 1G8MA 3I0MA 3N0WA 4K6FA 5JW5A 4GKZA 1UJ3C 5KVEE 3D4OA 3LQZA 3WR5A 4UT7L 2MWCA 3LUFA 3N41B 4UOJA 4MPJA 3F73A 5FBLB 1E5BA 4QRSB 1R10A 5F6HI 2E9GA 4AU1A 4X97A 3D6AA 3OZLA 9LDTA 1QNZL 2WM2A 2DQHL 3KPUA 1E6KA 5BPHA 3F90A 5L3RA 4C2AA 3WDKA 2HQSA 4LHUA 4LCEA 4PX5A 3IFNH 2EG5A 2DERA 2NWQA 2X4IA 3LFTA 5EQJB 4L4UA 4PJDF 5L3ZA 2F7IA 1DQDL 4O58L 4W8GA 2OXEA 5EUOE 1DBKH 1KELL 4U1IA 4KDCA 1XA3A 3VU3A 4CI9A 5FWNA 2BS71 3E9UA 3GP3A 1YR8A 4DXDA 3QDAA 3CT4A 3TW6A 2RSLA 3NVDA 1RTTA 2BNRA 3FQUA 4N40A 4YCAA 3STVA 4D79A 2DAVA 1H2XA 1UMCB 3VX4A 3K6FA 1E9RA 1BVKA 4DP6X 3DFFA 5JDJA 3BXEA 2A0LD 3BFXA 4BM7A 5LD2C 4ASUA 5CM1A 1UBSB 3AUSA 2OR9L 2RHBA 5DSCA 3EXFB 2COEA 1N25A 3QVGA 3AROA 1CG6A 5CLWA 2VR4A 4L1SA 4APQD 3AXLA 4XD7A 1IZZA 1Y4ZA 4KO3S 3OU6A 5D1QD 2NNCA 4FFVD 2Q6WB 1D7DA 4JN1L 3ZVRA 3SAJA 3IE0A 4FDLA 2X14A 1BD2A 4BLVA 3PFFA 4F11A 1GSOA 4YX2H 5EO9A 5KUMA 5HVHC 3CFBA 1IDN1 1O5TA 4IBOA 2VDUE 3CSDA 5KSVA 1O4WA 1GA1A 4FYHA 3DFUA 5A3RA 2HJRA 1OE3A 3ESYA 2H26B 4G9BA 1MQSA 4PTLA 5E94B 2NT0A 1I1HA 4P07A 4UIKL 3L8MA 1P6UA 1WXEA 4I8IA 3UTPE 1JNNH 4L48A 1I8AA 4I18C 3BIBX 3L9BA 3GSQA 2ZE6A 4D0SA 3DVSX 1CLOL 4JFUA 4HWOA 2IGTA 5FA8A 4ZMOA 1GW0A 3BAKA 1A27A 4M1MA 2J08A 2BVYA 3G7TA 3HPRA 4AEHH 3UW1A 2VDQB 4G56A 4IGAA 1RZ7H 2H2SC 5JPNA 1YK1A 4HNAB 1RP8A 1RZUA 4NX2A 3ZG6A 4EXKA 4MSWA 4M1CC 3EO9H 2Y2WA 4FKZA 4C4PA 2OV4A 2JJTA 2F8LA 1A9OA 4JAMB 4NKRA 3CZFA 2DPYA 1BJ1H 3DB1A 1YRAA 3OI7A 2UYYA 1SB9A 1DS6A 4AROA 4W99A 1M2FA 1X5ZA 4U3CA 2WJHA 3VDRA 1OJ7A 2I6UA 1SELA 1UFQA 4OFWA 4OJCA 4JZNA 3QM1A 2H2SD 1R4MB 2F08A 5I2IA 1AS0A 4WW2F 4CRPA 1S1MA 4U6XA 1Y8ZA 1DQML 3RP1A 1BBDH 1OAXH 2ZCZA 4OHCA 3THML 4J4PA 2G60L 3SGKA 3WIHL 1HKLL 5EMKA 4URXR 1G20E 3S1LA 1ZCJA 4EZIA 1T89C 2Z0UA 1MJ8L 1T5XB 3OCYA 1QIHA 1Q0PA 2WABA 4I0WB 1YNOA 4GO6B 2ENWA 5JZVA 4CM9A 3BT7A 2APWA 4LNUA 1T80A 2UY6B 5F0MB 5BXFA 3X11A 4L1LA 1E8YA 4YXWA 1F4AA 3GPEA 4IGBB 4B83A 5C70A 2IEBA 1CXLA 2UVQA 3DHWC 1QQ5A 4WT7A 3RWDA 5D70L 3RF7A 3CIQA 1SM4A 1HILB 3OZKA 4U3HA 1BVOA 1OXYA 2G09A 2F1JA 3E2PA 4XRCA 3PL6D 5A03A 2VM9A 2JFHA 4WK0B 2W5UA 1CXFA 2NTEA 3EPJA 4F2ME 1XQ4A 3BUDA 4BQSA 4BRZA 1P4IL 4KQIA 4F92B 2NT1A 3WTYA 8OHMA 1OV4A 2E7MA 1VYTA 3LJKA 3KKPA 4QDKA 2B9AA 2X87A 3IA2A 2L17A 3TO2B 5I7WA 3AM5A 4CWAA 4D7BA 2Q76B 1MTOA 4KR3A 1O3YA 1TSHA 2GEQA 4HMEA 4Y6GB 4UIMB 2PR7A 3X11B 2JHPA 4G4IA 2QTZA 4N3BA 3OSKA 2O2EA 2JVJA 1OQXA 3CUSA 2QLTA 5K03A 4L8YA 2WZQA 1WY7A 1ASQA 1NGQL 4BP3A 1OI3A 2JCYA 5CVDA 1ECFA 1QHGA 2H0RA 2YYSA 4B97A 4DR4B 4P46A 2EBFX 3FCSB 1EJ6A 3T7RA 3HN3A 2E7BA 3T77B 3PNSA 4X6LA 2KDGA 3WGJA 1S7GA 3IV6A 1PZ3A 1AQHA 3PHBE 3RS2A 4HFRA 3JBG7 4BKOA 3KYIB 2G04A 5TQ0B 4LYJA 3CX5K 2IGLA 4YRCA 4FLQA 3H0EA 1EFUA 3WIOA 5G2NA 1NHWA 3BVPA 5KSPA 1AZTA 4TL5A 3TPUA 3VX3A 3USES 2I9PA 4TRNA 1JYXA 5EXPA 1SNRA 4TV9F 2ALAA 2XV2A 1UM9B 3H7BA 3QNUA 1KEEB 3OAYK 3OCWA 4NYJR 1UACL 1EM8B 3GUZA 2O61B 3EGSB 5I74B 1FPTL 1MV5A 4Z4CA 1RT9A 4JNXA 2XJ9A 2FUKA 1VLLA 2GQ0A 1S7QA 1QSED 1SZPA 2Z58A 3GJFH 1FZMB 4ZTPH 2W59A 3HPLA 1CICB 9PCYA 2B61A 4WX2B 3VTZA 1GPYA 3SKNA 3C3KA 3O8OA 1VYUA 2CVOA 1L5HB 5CP7B 1GZSA 1BMWA 4BO6A 2EVHA 2R96A 4BAUA 5CLZA 4IRJA 2C4VA 1JHYA 2ZZNA 2ZBEA 2VXQH 2IYEA 1SUHA 2H9IA 3FTPA 1NGYB 1P75A 1CP3A 2G1PA 2OECA 5I4CA 2Y1KA 3CZSA 2XQKA 4TWJA 4IVRA 3U1VA 3O0RH 5AZEH 4PAMA 5HI4C 2ODAA 4JUTA 3QXCA 1H8HA 4W7SA 2AFHA 2VLRD 4M48H 1DCKA 4Q9CA 5JIKA 2BGMA 4EE2A 1HMPA 3QHFL 1OFIA 1ILSA 4CEJB 3PUKA 1U90A 3K5HA 3T08A 1BMQA 4ZMQA 1NIBA 3TA3B 3HZ3A 3TB6A 1I3CA 1Y0BA 3GRWL 3IB3A 3O3MB 2J7LA 1WABA 1U93A 3LNEA 4JFXA 2WKPA 1NVAA 5DJYB 1P1KA 2ZVPX 3TZQA 3TN7A 2EICA 3K2UH 4NC1C 3A1TA 3I6KB 3QNYA 1E8DA 2DUMA 5EZOL 2BX5A 4BRVA 1W581 5FR2A 3AETA 5C07A 3HBPA 1WZAA 3TRJA 2O8CB 2VDRB 5KKAA 3P52A 4A8PA 3ER9A 1XXFC 4MUXA 3FPEA 5FOWA 2EE9A 4JJZA 2P5YA 1J1XL 1WDMA 4RVGA 3JQEA 2H1WA 3UVEA 5BOJA 1R9FA 2YIHA 4D4GA 1F4WH 3KPRA 3PL6C 4MB2A 4NCJA 3NDIA 2OP1A 3LKRB 4HA1A 5B6IA 3MGKA 5AUPB 1PNCA 2IMMA 2W92A 4TQGA 1IU1A 1TSRA 4B6PA 3IDJA 4IBYA 5T3YA 1WB5A 1HHIA 2P26A 3CF0A 3D6JA 4Z9BA 4HOMA 1LJ8A 2H6PB 3QVUA 2E18A 1ZM2A 4LLUA 3PCXA 1QUNA 2VITB 5AWFC 3E4CA 5FO0A 2P42B 1RAMA 3KHUA 4D81A 1HYEA 4ZO6A 3FNFA 4J7XA 1WS8A 1N57A 3LHSA 1WLHA 4X24A 4F06A 1N2OA 2D2EA 4MI6A 3IT1A 1XF5A 2R2AA 2XIDA 4NE2A 1GKIA 4XHJC 2ORBH 1X42A 5FWRA 3IVRA 3NZHL 1OFGA 1WW8A 1NYRA 5AT1A 1DSFL 4FLHA 1YNTF 2EIZB 4RADA 4ZT2A 2VC2L 2ADYA 4EW3A 3IL2A 4GKAA 3RTLA 4EI2A 3ZHKA 4UATA 1L0QA 2F1IA 2WMOB 4JFDA 2CXUA 3H05A 4Y7CA 3G2NA 1M71A 3D18A 1NBHA 1Y48E 3OFND 3A04A 3MREB 1UQRA 1MWAH 2OSXA 4C56D 2OL4A 3OIVA 5DM70 4B6ZA 2IL1A 2J85A 3K9BA 1S3FA 3NWPA 4A4DA 2VJMB 5GY7A 1BYUA 1JXOA 4ZJUA 1P17A 2CMRH 4JCCA 1G7JA 4ABQA 1N9GA 5D2NC 2JB5L 5ESQB 2YBRB 5BNZA 4ANVA 1OSPL 1GG8A 2OD7A 4DK5A 3WK5A 3OZEA 3OOEA 1F90L 3E9RA 4QREA 4URTB 5EEWA 2ZUXA 2UY7A 3RFXA 3WKCA 5A2AA 1QYGH 5H8DA 3HACA 1RRCA 4OB7A 3AF5A 4ZFZB 5ED0A 1CKEA 4ZX5A 1E4JA 2Q7XA 5F21B 5ISZA 5A2FA 4G9FD 5ALRA 3UZVB 1KG0B 2I3ZA 2G0TA 2QUIA 2A78A 3V1TC 2R7EB 4LJAA 3N41F 4FNGA 3K2EA 3RVXC 5ESWA 1YD7A 1U5BB 3MBEC 2XUKA 3M4XA 2Q5EA 5K8LA 5IDVA 3JZDA 3I3BA 4JFYA 3ONVA 5IHZB 8CGTA 3AREA 2KQNA 3SO5A 1MC5A 2IE0A 5LZ8A 4K2UL 4V24A 3IN0A 3B3GA 1MT0A 1LZLA 1YI1A 4Y2OA 5D1QC 2EUZA 3MLWL 1T3FB 5T7BA 1YR6A 3NRQA 4OI9A 5FUQA 1AD9A 2X15A 2GFHA 4A7SA 4Y4KC 2DBVO 4EAEA 1M74A 1OF0A 2ZCHL 2XRYA 3MJ9A 2CGRL 4AYXA 2DQSA 2FIKB 4P54A 2BY1A 4C4YA 3DRQA 2FG7C 3G3EA 4EG5A 3QIUB 5D1ZA 3PNWB 3GO4A 2ID8A 1N78A 4WFED 4FQPA 3A4IA 1PBNA 2AQ2A 3KXFD 1XGZA 3D07A 4MMZC 4EJFA 4B2PA 1N3LA 5LA6F 1Z06A 2K5UA 4XRRA 3GL9A 2J8HA 3TCLA 3VNZA 4N76A 4AC4A 5E4AA 4Q52A 2BNQA 3C6SA 1E7QA 3O4HA 3AWDA 4JENA 3DDUA 1L5MA 1NNI1 1CETA 1IUOA 4MW0A 5AJYA 1M7DA 5DHQA 2PYEA 1V27A 2DQEH 2LFGA 2QX4A 3O73A 2V3WA 3UV3A 3U7QB 4JFFE 4TVPE 4DV6B 4ENRA 4P83A 2NRDA 3VPGA 3D85B 2X0NA 3FYHA 4DO5A 1I6WA 2Z6FA 4M8KA 3NFPB 1EXNA 4UJ3A 4E7PA 4Q39A 2MOKA 2X0EA 4ZREA 3K9FC 5CLQA 1FA4A 3GW8A 4K6CA 5LDGA 2A83B 3I4LA 1Z16A 4IFBA 1M1XA 2VLME 3KYOB 3UAYA 4RTLA 4D3CH 3F7OA 4FDTA 1JR2A 4C55A 5DO2C 4R2WA 4EGAA 3CUYA 1F3DJ 4YBQC 3LPDA 2RIKA 2M6SA 5JW3H 4L3CB 4HX2A 3LZNA 2PYEE 4WCDA 4TYYA 4QYAA 3D6VA 3BWCA 2YHSA 1NCBL 1YEFL 1V95A 2ZTMA 3SR4A 2NY4D 3RY4A 4K2HA 1JDBC 3GXTA 4ZKEA 1B3JA 4RTRA 4IIGA 3W3AH 3FL7A 3TW4A 1FFTB 4Q7QA 5SY9A 2YH2A 4BMZA 3OUZA 4Z7NF 4IJ3C 1GQRA 5JAUA 2F58H 4LSZA 2HMID 2I1QA 1CTQA 1BSIA 2A30A 4A0GA 3G9UA 3AY3A 3R3UA 1CFJA 3SODB 3VC7A 2D8MA 2ZJ3A 4UEOA 1ZS8B 5KOMC 3D6NB 1ZLEA 1PJAA 3EWSA 3VU9A 2R15A 4ZCTA 3QXJA 4OOFA 1F0LA 1VB9A 2YZ8A 5AVVB 1MENA 1YBHA 4M8UA 2AABH 4B3GA 2C9ZA 5HXMA 3KSDO 2DSNA 3U9LA 2DQMA 4HBGA 4P92A 3I2YX 3MRPA 3LQ4A 1FL6A 3PLAE 4RABA 1NYTA 2CK2A 4NOMA 8ADHA 2K7FA 4G6KH 2O2ZA 4O2RA 2JAOA 4ZUWB 3SB3A 1OXTA 4G0QA 4X6CE 1S7RA 3FBTA 4OOEA 4IIJB 4L22A 1BGXH 4NQVB 3RVUD 4ANWA 1TIBA 3RVDA 1XD1A 5TY0A 3UEZA 2CUNA 1Q77A 3R4VA 5IQMA 4OL9A 1X3DA 2AN4A 5FPPA 4E9VA 1LVUA 2AR7A 1QA9A 2OL3B 5KOHA 4N8EA 3RYHA 3HEIB 5KTOA 2XE7A 2QY6A 2JELL 3MRCA 4ELME 3ZHBA 4NV1A 3E8UH 3S4SB 1T4KB 2WVAA 4HYTA 4K3VA 1ZN7A 2NU9A 4GRWE 3GJEB 1PQ4A 1AQIA 1XGYL 3LRMA 1XTRA 3E3QC 5IXYA 2AEWA 2VHTA 4UQ3A 4HJEA 3VNRA 1CRLA 5EHFA 1DQRA 2BP0B 4BMNA 3D50A 3I9OA 5CCKH 5DZNA 2Z57A 3DT9A 1K89A 4FD3A 5I9NA 1CS4C 3KUXA 5LZ7A 4UQEA 4M7OA 1RJZB 1GZ4A 3IEIA 4E30A 2B78A 4RDQG 2G1KA 4KI5F 4W9MC 5AYUH 3RLIA 3O6KH 1ZRNA 3TJPA 2W93A 3JQDA 1YZKA 2I24N 1A82A 1XH2A 3PIQA 3LNHA 3MRLA 2OTCA 1TUEA 3WK8A 4YXFA 4TQUS 3A6BH 4PJHF 2G7MC 4PH8A 2AEPL 4IGEA 3H2QA 1Q0YL 2Q9OA 3EOTL 2G9QA 5CLHA 2YASA 5C7YA 3AWIA 3KLLA 1I8KA 1DOAA 4X44A 3LBAA 4QAWA 2GR9A 3AFMA 4OQFA 1FYVA 4K5PA 2C5FA 3EMBA 5F9HA 2B2NA 1KJ3L 3KWXA 4L9WA 5DGIA 1RLJA 4XIIA 2VBFA 2PCLA 5BSFA 3FN3A 5D3MA 2ATKB 3CU5A 4Q9QH 1MHPA 4J8QA 2OMXB 3ISRA 4X7CC 1OSYA 2W9DL 4M9RA 4G72B 5ACZA 1OPGH 3K0HA 3UGUA 2BZCA 3E0GA 1OVMA 1FLTX 5KNBD 4NU0A 1PSKH 1H3PH 5K9OB 3FFWA 3AQZA 5HI3D 3MJ6A 3RRNA 2FSPA 3QWHA 3FSZA 1DEKA 1ZC4A 4NM8H 4QNNA 3CZCA 1JMKC 1SK9A 1XZBA 1MCIA 5DXWA 4QRPE 2W5PA 3GMIA 3VR5H 3VB8A 2H85A 5KKNB 4KV5E 3MV8A 4MD4A 5EERA 3S5LB 1GITA 2FH5B 1ECZA 2PL9A 4PMFA 2BEWA 5EZJA 2WYZA 4G6AD 1SDYA 4QCIA 2XFGB 4BGUA 1HHGB 1USWA 1PGRB 1TTUA 1RZKH 2HK6A 1WD7A 1CJUC 1K5NA 1JGUL 3V4VA 1SHJA 1KWKA 2NXYD 2HSEA 1A4AA 2MPAL 3DE6X 3I2KA 5CAEA 1NYQA 1IAQA 4HKXA 4J2HA 3UCEA 1OSZA 2UYOA 2ZWSA 2GJ6E 5HGHA 5L7XL 1Q94B 1QW8A 4RSVA 4Q2ZA 3I8XA 2DY1A 4JREB 1Q7BA 4EDFA 1SUAA 3GDGA 3IMCA 4IFTA 2O8DB 4FOTA 4ZT6A 2PO6D 4JOBA 4N1AA 4GBMA 2ZYRA 2AXGB 1FAKT 3DOEA 3C6KA 1PBYA 1YQWA 3EEYA 4IJKA 2W00A 3KSAC 2VHUA 2GESA 4XOAA 1WPGA 4XCCL 3QEHA 3ARBD 4AE1A 2XCRB 1YVRA 4WKCA 1ZOOA 1BKSB 2P8MA 4HU2A 1FXSA 5HFAA 4BX3A 2DQDL 4JBHA 4Z4QA 1BIHA 4J90A 1QATA 2W2MA 2WNWA 3KBEA 2XCOA 3O6LL 3BN3A 1SUSA 4HT1H 2JK5A 1P80A 4OJEH 4P23D 3D30A 2R6HA 3N7TA 3E6HB 1D7FA 4C4UA 3P4YA 1NKOA 1SF3A 3QG6B 4UNUA 2ON6A 1IC4H 2OHJA 2C95A 3B1XA 4LNRA 1JZGA 3QEQE 2W83A 1HL5A 2WBKA 5HYEA 1VP9A 1Q21A 4OCYL 3I9KA 2C34A 3H8WA 3DETD 4DWWA 2FN7A 3R0NA 1ODFA 1V5JA 1KV7A 4PB0L 2I6QA 4ITUA 3QH3B 4APQA 5BWBA 1OIXA 1AQYA 2VL5B 1PZDA 4K8RB 1VG0B 4UB0L 2NZ9C 3C8MA 1CS6A 2AG6A 3RPIB 3Q8FA 4L5YA 3AB0B 3EUEA 2CLIB 1WXIA 2AXEA 5D87A 4NP9A 4XYEA 4P5MB 3GCZA 1SJXA 5CTJA 1PKQE 1JD9A 1F5SA 4HCFA 3BRSA 1NCGA 3ZCQA 2JV6A 5BSGA 1NLBH 3OJXA 4D9GA 3V5DA 2D7PA 3JYNA 2GJAA 1WBYB 3KETA 2WUDA 4B33A 1ZH0A 4TRRA 1KJMB 5DHTA 3MI6A 2BSQA 3VGFA 4MTCA 1GFSA 2GPNA 1E4XI 5ED4A 5EWMB 5DEJA 4BP8A 4RANA 3Q13A 5CDFE 2AR0A 1UKSA 3GGDA 3ZDYE 3O2VL 4X98B 3LDUA 2P30A 5EXTA 4PWZA 2XDHA 4D8VA 4DZZA 3L45A 3OQPA 3EZNA 1UZNA 4PZLA 4K15A 3NIDF 3B5HA 1R9MA 3DCJA 4UBDD 2XWQA 3QXVA 3G02A 3CFEB 2FL5A 2NY1D 1HOXA 4G8FA 3QFRA 3TFKD 4NICA 3CVUA 2VYFA 4AKGA 2J55A 3F1LA 6ABPA 2QM7A 4R0NA 2WYVA 2VDVE 4RWYL 2HUEA 3L9WA 1PI3A 4O4IB 4JC4A 4DK3A 2YD5A 1JT2A 4XLLA 1VHWA 4FDVA 4TL9A 5TGBB 2Q2WA 3VWJB 4MRPA 3BWYA 2NLOA 4RWYH 5BWLA 5DXJA 3AUWB 1G66A 1ZIAA 1H0DA 4CC4A 4XNXH 2VCHA 3DA8A 4CPDA 3CD4A 2GN6A 3VFTB 2B92A 3MTXA 3OKKB 2VWEE 3BD5A 2E4VA 3EXIA 3H7AA 5LDDC 4LRXA 3HU5A 3IKKA 3LQRA 3FOFC 2V9ZA 4YFDB 4QASA 3U9PL 4N41A 2MTAA 4KH1A 3BIKA 4MWFA 1OI7A 3AC0A 3FPAA 5FF6B 1XZNA 3OLXA 3ZIUA 4B47A 1H8LA 1FS4A 4PJ8C 1CTNA 5I6MA 1JV5B 3E38A 3HCAA 3NB0A 1EZ4A 3HVDA 1OPXA 3HE3A 5EV7A 5GZND 3OG6B 1DC5A 3WIBA 2I9TB 4FBGA 2ZI9A 1G2PA 3CVIH 5C0BE 2F1RA 1SKAA 3ZDCA 4D9IA 5E1GA 1KEML 1U0LA 2BPOA 3ZE6A 3WO1A 2DM6A 3MMXA 3NHFA 1BG6A 3MCYA 3Q8EA 3BMCB 3KB2A 3TSYA 1KEMH 1UKVY 4YONB 1AP2B 1QYWA 1A47A 3JWOL 1S8NA 2EJWA 4QOSA 3GOQA 4KEAA 1I8IB 1G7CA 1QBAA 4GQRA 5TS2A 1ANUA 2IXEA 3P2OA 1G38A 5JS7A 2GHIA 3LO8A 1XGUB 4DOHE 3KE0A 1XF5B 3EJCA 3RDTC 1IC5H 2FX2A 4UIKH 2OVBA 4KRFA 5CN1A 2VE6A 3IJYA 5ENVA 3HG1E 1LDMA 4EGCB 5BRZE 2Z0MA 2O6HA 1DKMA 2QAIA 3D4NA 1E7YA 1NXXA 1TZIB 2NZ2A 2P2GA 3N87A 1FQOA 1W0JA 4ARIA 4AMVA 4G11A 3ARYA 3ZR6A 3KJEA 5K0CA 1QFPA 1N6IA 3E5HA 2YJLA 3RIFK 1UXLA 3C4VA 4XAWH 4RJ2A 5JW4M 2YSSA 1A4KB 1DJSA 2G40A 3RI5F 1ML3A 4FZRA 1R0AH 1FGNH 3GMQB 3FUJA 4HWGA 1XLTA 5FAAA 3FDXA 1M2VA 1E0KA 3DR3A 4WBNA 1Y6QA 5E1MA 1NAIA 4Y9GA 1YULA 4HX1B 4M1SA 4E15A 4CR6A 4KXMA 4I1NB 2W60A 4MDIB 3K72A 4LARH 4RWEA 4OQPA 2DRUA 3FTDA 4A6YL 3W9SA 1O7DC 4GOOD 4BAZA 2AMUA 4Q03A 4AECA 2JA1A 3PI6A 3NHRA 3S8WA 4JA0A 2BRRH 4U3JB 4ATNA 3WHE0 4JRYB 3G2IA 4N8CH 2CK3D 2ZEJA 4QFCA 5LMNB 4DT1A 3DOSB 2Y7SA 1I5RA 1J39A 2IIQA 5FHQA 4DW2H 3KBOA 1B0RB 2QN1A 3AZQA 5FWYB 3WE6B 4C0HA 2JIMA 4I87A 2XMRA 3F7VA 1FUUA 5ICZA 1NQWA 3C74A 1N6QL 3EGXA 3E6FB 4X8GA 2JLLA 2WWTA 5IW1B 3ZWBA 1KIRA 3ZT5A 4MAYB 2IEZA 5K0LA 1E66A 3CRRA 1LI5A 3GGWA 3UT6A 5B4TA 3PRYA 3Q10A 4Q47A 2PP9A 3AG2B 1OLSB 1EBAA 2Z31C 3RASA 3I5MA 4U02A 2HJLA 3FTZA 2UX7A 3CRNA 5IT2L 1R4MA 3H17A 4GUPA 4UEKA 1E98A 3WI9A 3GF8A 4H1LH 5KDOA 1QQDB 4I88A 3DV6B 3UJTH 3FPKA 2Z31A 2EABA 3ZL1A 2BJHA 2C1EA 2GPZA 3F6PA 5FAXA 3X0DA 2YAMA 1VGRA 3I6MA 4PJ7E 3R19A 3PFGA 4D9KA 4HXBL 3BAWA 3FHLA 1KZ1A 5TQJA 3QIBC 1KTDA 4XWKA 5E0KB 4NABA 5F72S 5AW4B 5JSFA 2CLZA 5JRDS 3EUAA 3H4VA 5EULV 4H8WL 2HRHA 4ESOA 3GLIB 2R48A 3EGDB 3STHA 2BUCA 1JIUA 1U6JA 2ZOSA 4H3HB 3FT2A 2QT1A 1FTNA 1MIML 5B1JC 2BM9A 1TLTA 3FNBA 2A84A 2C8KA 2IDSA 2C92A 5KJCA 1JJBA 3IBSA 4V0SA 2JXMA 5I7SA 2UU9B 2WZAA 1P74A 2F7OA 2OMUB 1MEOA 2WLLB 2XNHA 4E4TA 2VDKH 2GCGA 2WO3B 2A0UA 4F57L 1YDFA 3M45A 2RCYA 4KPUA 4ZX6A 5AKLA 1MCRA 4GT1A 4TMTA 2XYHA 2H54A 5DTQA 3GCGA 1NT4A 3PQYE 1J9CT 1P2GA 4FFNA 3GXMA 1TT6A 4N0YH 3MUZ1 3L4EA 2PIAA 3X3FH 1X1QA 2H32B 5EA2A 2GBLA 4XN9A 1X1TA 3VHLB 3A21A 2MINB 1WIOA 1NFRA 4WY5A 4BJLA 3SDAC 2BMAA 4Y4FD 4XO8A 1BPLB 1Y82A 3VOBA 4PJBB 4QY8B 1BHJA 3FYUA 3OLQA 2H9GB 4OK3A 1T10A 12E8H 1C8PA 3C0KA 2W80C 3U19A 4GYYA 4JO2H 1YBAA 1W4ZA 1F2UA 1X4ZA 2Z8RA 3VWKC 3FRIA 3MRJA 1XDSA 1T0UA 4EO5A 3BERA 2J72A 1H93A 4E32A 5E0FA 2Q5QA 2VRWA 2R00A 4DREA 1SCUB 1Y6RA 3DLQR 5AAMC 3AR4A 5DLYA 2Z09A 3SR3A 3F7QA 2V7QD 1MJ5A 2BFEA 1UM4H 1FYEA 3RHFA 2JWHA 3EEIA 2FUEA 3OJDB 4C0AC 4C0WA 3F5WB 1E9SA 1F86A 1CJSA 1UINA 2OAGA 1G7PA 3MLTA 5EZ5A 2O2JA 3E5MA 2RHCA 2FZKA 3HBFA 3L2MA 1G8HA 4GM0A 2XYPA 3RTAA 3OKDA 3UL4A 4DN6A 4RK6A 2ZP8A 3B2MA 1GRQA 5HF5A 2ZULA 4NWIA 2ENUA 2B4YA 3HDTA 2F61A 5ISZD 3ROLA 2AJXL 2QJRA 1QUPA 3OJLA 2Y69B 1BX3A 2WWNA 1T0PA 2CE2X 1O95A 3VKGA 2H4JA 4DV3B 3HI6A 4ZAYA 5L3QA 3G5ZB 5CP3A 1MH5A 1N26A 5DBFA 2AG1A 4MAFA 4C14A 3RFCA 2LQRA 1A9VA 1RU9H 3IJ8A 4O33A 5C2JB 2ZPUA 3CZ4A 5CW2A 3DMYA 1GVNB 1N9PA 1ZT7A 2VLKB 1KCVH 4YREA 1WFJA 4FQ1L 1Z17A 3V1NA 4B8ZA 5D2LA 4ZTOL 4M03A 3KHKA 3US9A 1KAGA 4QT4A 4PV9B 3ED5A 5CDSA 3MN8A 4JZJB 2IXQA 2MCFA 2W70A 3COPA 4MB5A 3WTTA 5IEBA 3HJEA 4YPGA 4JJ4A 5EHXA 3RVWC 4O02B 4ZK6A 1TQ2A 1AXRA 4RKYA 1KDTA 2G67A 4X7PA 4JG0H 2UYQA 3MT0A 4NZDA 4J4TA 3NNNA 3H18A 4IDPA 5D5HA 3IVAA 4HGPA 3JTTA 1OKEA 1IZ9A 2FG6C 4FQLH 4WI6A 1GKYA 3VD5A 3O4LE 5HGBB 4JPWH 1AKPA 1YUHA 2L3BA 1BWRA 2J8UF 2OE2A 4EUPB 2CL0X 3M86A 2AZUA 3BO8A 1YKFA 5CB4B 5G0VA 3KDPA 3EBOA 3OCVA 2MCAA 4Q4JA 4ZAVA 2QL7A 5MN4A 4JL1A 5IMOA 5HG0A 5IX8A 3RL2B 2MQGA 5FYJU 3ADKA 4ZANA 1JP7A 3ZZMA 4NXKA 1O1YA 3DTDA 1UD5A 4AEHL 5H4GA 5CX1A 1PLGL 4M83A 2EZ9A 3L6FB 4N0PA 3B2NA 2DICA 2CO1A 2IANB 1JPJA 4HWEL 1RYBA 1WMSA 2QHXA 3LZOA 3LKQA 3IQDB 1MFBH 3C3YA 4IIFA 1D6JA 4XAWL 3RG2A 3G5VA 4K0KB 4B3CA 4H8UA 3OSVA 1T5OA 4B50A 1TT7A 3B8YA 3K6JA 4CM8B 1C7TA 3SWWA 4KNUA 2WLMA 3GYGA 5EIHA 3CNKA 4QU9A 1MZVA 5DJ8A 4HZUB 4NBTA 5DD0H 1UB5A 5ENZA 5G0WA 3AQXA 2C2MA 3NBAA 2XVKA 1EGAA 2PRJA 3ZD6A 3QKTA 4KVZA 5CGQB 3UTTD 3D64A 5JUWA 3STWA 1I2ZA 2FWIA 5AKXA 3KOMA 3PJSA 2EDFA 1RJYA 1ZAKA 1JR3E 4KO4S 1ITBB 1F56A 4MQ7A 3OIGA 2QD3A 1DGQA 3JRXA 5FYLH 3FOCA 3VGHA 3M88A 4QRIA 4FI3C 1XNJA 2J6EA 1CYXA 2G30A 1GPKA 1DFIA 1RMFH 4V0NA 3VJ6A 4AH2B 2DHDA 1EB8A 1P2BA 2BLFA 5L8VA 4ANFA 1KLUA 3NHYA 5AFSA 2KSQA 3DLPX 2I1LA 1B00A 2NY3B 1KDOA 3TV3H 4R90H 2BW5A 2X6MA 2CHGA 1R5VB 4NAUA 2WNSA 5A5DA 1E9BA 5HCNA 4RJKA 1U92B 1IAIH 3MC1A 4Y16B 4XUCA 1P5VA 4FYKA 3C7TA 2WZPA 2YNMD 2I54A 3AT8A 2VQ1B 5MERA 1P4BL 2X76A 1T8PA 1UXMA 2XUWA 1WDLA 4PGBB 3EZ7A 4ZTBA 2P6OA 4MVWA 3UTSA 4LYFA 3GNMH 3JARA 1PZNA 4PC7A 5KX5A 2VJ0A 2VDQL 1RLUA 5C0BB 4CDNA 4OLBA 4RH4A 2E6KA 5HBRA 3MLPA 1WFUA 4GOKA 1ZDQA 1WZMA 3RHTA 1LNQA 1OHZA 1G5RA 2BNUA 4GXNA 2XQIA 3VD4A 3D1MC 2C3YA 2IWGA 3MV7E 1N0IA 1U7HA 3VYPA 4KY1H 4XVJH 1XU7A 3EA4A 3KCPA 4BZ2A 4L8CB 4DSZA 2W94A 4WKPA 4OFKA 2VRCD 4UV7L 5TE4L 1Z88A 1KMHB 1Y0LA 3PNLA 4RPHA 3DE5X 5D84A 3B5JA 2PXCA 1FV1A 1VE3A 1J5PA 3B1YA 1MWOA 4JDZA 3G0HA 2IYSA 2CM6A 4LMBA 2VLLA 2VN3A 3ARGB 4OCRL 3OLWA 1NPUA 3T5GA 2P9FA 4KWHA 2HSGA 1EDHA 4X8MA 3ZJUA 4C0SA 3O8XB 1U3HD 5DRNA 5I71C 1DLJA 5BW6B 1T21B 1ONBA 4PHHA 4QWWC 4HS4A 3E0QA 1Q9KB 5JHMA 4BMVA 5C9JA 4Y2OB 4CFZA 1JIBA 1AZVA 5H4HA 1VMAA 1REIA 4JM4L 1I7DA 2YXFA 3ZDYF 4KC3B 3V52H 4O1MA 1M3SA 4Q21A 1BJKA 1BVLA 3Q7PA 5K5YA 1AQ8A 1NP6A 3CVXA 4ZXBD 1OE2A 3DOHA 3O84A 1N7IA 2CCGA 4GKBA 4NGHL 2B8TA 3GLRA 4WKOA 3QX3A 3IDUA 2ORIA 4X99A 2GSMB 4Q9BA 2FO1A 4B3MB 3TZVA 4LB8A 1E2FA 3BIOA 5C09A 4K7PL 4WZAA 4ENVA 4Y4HB 4ZDKA 4IIEA 4MOWA 3WJ1A 4LG1A 1UM4L 3CCHB 1UEXC 4BVBA 2NY2B 2Q9CA 4Y6RA 4KO8A 5JCXA 2AQNA 3LMKA 4NUMA 3I2FA 4DSNA 2NX5D 1R3IL 3ABMB 4DY4A 3FSAA 4PJCA 1DQJA 2C9YA 4AQDA 3RBVA 5EP1A 4D8UA 3L3KB 2FZ3A 5GGRB 2J9XB 3QVOA 3OURA 3FUXA 2D59A 3JWEA 1ZXQA 3F85A 1CPUA 3GGJA 1PBTA 3L4ZA 1PLCA 2WU3A 1DWOA 3C9NA 4LMPA 4C7OB 3OKCA 5M5BA 1YE5A 3QCTH 4PWIA 3GBPA 4Z0BH 4HULB 4LCYA 3KFLA 4L4TA 3FPLA 1NCBH 2VDKB 4YPGB 2I3DA 3IKVA 3ZCRA 5FBZA 2UVDA 3CW2A 5FGSA 4ZFQA 2RGNC 1DQSA 3HUJF 2XG5A 1X7HA 2CO6A 1YA4A 5HDQH 5DD6A 3G1WA 3PHCA 1D03A 1CWVA 5HPYB 2VH2A 4XXDA 1HQKA 5JSZA 5ALXA 2PL5A 1VMKA 1U8OB 4WU7B 1CR4A 4K6HA 5DGQA 5CDHA 1IM2A 4BZ1L 2FY8A 2EZ8A 2CKBL 3JWJA 1OGAD 1C5BH 1W88B 3X44A 3WLSA 1OAKL 5E5RB 2LU7A 1FDUA 3OPZL 4L4YA 5D93C 3WSTA 4PR5A 2CHDA 4X80L 3JSAA 3FO1B 3ER6A 4KK9C 1Z68A 3Q8AA 2W88A 1C5BL 4LNHA 1XDDA 3NBKA 3DDHA 4YCMA 4WINA 1ZT7B 1WDTA 3EE6A 3OFVA 5B4VA 3LI2A 4PLVA 3R6GA 3PNQA 4ZXBB 1D4FA 2G28A 3THXB 1ISMA 3T3ME 3Q7EA 3KJXA 5LL6P 5DMIH 3RU3A 5T1DH 5CVUA 4OXXA 3QIUD 4HVBA 2F3PA 2JAXA 1QSFA 2I3GA 3HE6D 5JSZB 1U8JA 2MOQA 5JMTA 4YRRA 1MX9A 3BCDA 1YB7A 1YB6A 2NZJA 1DC3A 3MJ8B 3PU7A 5F12A 2PGIA 3AS0A 4MDRA 1DPGA 3ONNA 1X5LA 1WCV1 4Q7DA 2DG2A 1N2JA 1SGWA 4MD5B 2OZLB 3WY1A 2F4VB 4KFCA 4OD3L 5ILGA 3RGVC 2J21A 2AG5A 5I8ZA 1UAAA 4B3XA 5BR4A 2Q0ZX 4OGZA 1TF2A 3F6EX 4HPOL 3PENA 4UMGA 3IDQA 5KS9A 1PL3A 2OR9H 2C96A 5FP0A 1N0XH 2IKQA 2CQVA 3PXDA 4AG5A 3EYAA 3RYCA 4DTIA 1YDMA 1TZGH 3GMDA 1CXIA 3TQRA 1K86A 5IK2D 2XR1A 4EMZA 5F2NA 3VX0A 3CHYA 4GW4B 2LRHA 1B88A 4DKTA 3OLZA 1YRHA 2QYSA 1G7MA 2CV1A 1DZ0A 1U0QA 4V1CB 1R0WA 2YGVA 5TFSH 3HZKA 4QU5A 2P2DA 4JZJC 2KMLA 1DTWB 4JUIA 4Z4HA 4YX2L 5AKYA 1A8JH 1CGYA 3AXIA 1ADBA 3L1EA 4MCZA 4TQPA 3GK8L 4IU3B 5E6IB 3KO8A 4DIKA 2VXVH 4GVLA 1CYDA 1I4WA 4DV5B 1HAWA 3FMIA 2H08A 1K3UB 4PRAB 3FB8B 2FEWB 5SZIA 4LASH 4F6RB 3U7AA 5G0SA 2EW1A 3ANNA 4LRNL 4MVXA 3UMNA 4NVRA 3VFRB 1QGOA 3SMVA 2HFJA 3EFFA 5AW2B 2W0FA 3CR8A 1W0KD 3RW9A 4FVTA 1PK9A 3X1EA 3WDJA 3LNFA 2D0IA 4QHLB 4HL6A 1H4TA 1UQUA 4OZIE 5EWIH 4IPTA 3KWWB 5F3RA 4P8QA 1D6MA 4J1NA 4DHLA 2C3WA 2O3RA 3E3QE 3TJEH 2V7VA 3U3JA 5TPWH 1DQYA 4JR0A 4LA4A 2OK7A 3V4ZA 1LGYA 3BVTA 1GPLA 2YZ7A 1R8YA 4X8HA 5DT1H 1U8PB 3R8BB 2BP7B 3A58B 2ANBA 1W9MA 3SC6A 2Q3JA 2WJIA 4HLQB 1E2ZA 3MMEB 1EXGA 1WR8A 3KDPB 5FTLA 5GSVA 4D9QD 4WJ5B 3OTQA 1AUXA 4ZUVB 1W8EA 5AVTA 4XBEH 5IK2A 5BQDA 1CDGA 3HWRA 2GILA 8GPBA 3AEZA 2SKEA 4J91A 3TX2A 2WMPB 3L40A 3VI4A 1CD1A 2HX9A 1SXBA 4HG2A 5C53B 3U3KA 1GTNA 2W07B 3D3NA 4BQQA 5BRZB 5AHXA 3L8YA 2OUIA 3L01A 3GSNA 4JFFA 2ZUTA 4E9SA 2XWPA 3NTQA 4PGZA 2B6HA 1U5CA 2JFXA 4NCXA 2QLYA 1EQUA 2H2GA 4G5AA 3GROA 2GUOB 3F4KA 1NYLA 3F62A 3TJHD 3RC2A 1YAIA 4JRYA 3K1DA 4L4VE 5DFTA 1L2TA 2GM5A 2CA4A 2DIAA 4DA0A 4FC6A 2HUPA 2P5WB 3IQWA 2OYCA 2GK3A 5I51A 2G3XA 2MSEB 1SOMA 4HJSA 2VYCA 4GSYA 4BKSC 4AQ1A 1FJHA 2BFVH 1Z3GH 3QFGA 2L82A 1J8HE 1M1UA 3Q85A 2LIVA 3WMXA 1MPAL 1FBNA 4Q4DA 5ISZE 2MOGA 1UANA 4ZKDA 3BFQG 1L1RA 2AE1A 1VHJA 4Q56A 2DLFL 1LZKA 1Q19A 5D4IA 3QOFA 2J0VA 1T35A 4MH0R 1QVOA 2EJCA 4Q89A 1XFDA 1QQTA 3Q2OA 1KGXA 3C6ZA 3VCLA 2JCCB 5EIWA 1B0GB 1IE5A 1EP3B 3A6EA 4TROA 4G42A 3Q72A 4MLIA 4I6JA 2X0UA 4CMKA 5DVLA 3FKJA 4KAFA 4KLAA 5GHWL 3RS3A 4PY7B 1DOHA 1XBTA 1DJQA 5FK9B 4NJOA 2H07A 1YMMA 1NUPA 2BDTA 1U58A 4Y1TA 4ME6A 4M22A 5LWQA 1Z6ZA 1IAIM 3IAEA 3TQOA 1XGPB 3CNEA 3VPAA 4MHTA 4E7OA 5J3JA 4NPKA 3T3PE 2P5ED 1IBLB 1X9IA 4EFMA 1JIJA 3G6AA 4UPDA 4JVMA 3HUFA 3PFKA 4YP7A 2HXSA 2DQUH 2AWOA 4JI5B 3L93A 4WA8A 5E38A 5FO1A 1WLSA 4A6YA 4OX9B 2HVJB 4TSCL 1HUQA 5CILL 3J7HA 4CMEA 4A66A 4CSZA 5LMUB 3L3KA 1A5BB 1Y3HA 2CJPA 4YRFA 3AVYA 3OEEA 3NRJA 2IAMA 4JJ5B 4Y9CA 1UFRA 1C3OA 3QNWA 1FZOB 2PQMA 3OU2A 4MW4A 1SZNA 2W2PA 1SQ6A 1V5EA 2GTPA 3MERA 5I8OL 2K45A 3K15A 1NBVL 4HS3A 4JJ7A 3B9PA 3WLMA 3V4UL 2VCYA 4NO0B 5BS0E 2W4IA 4RVSA 2GK4A 1V7CA 3PQ4A 2FAXA 1WS6A 1A4XA 1S7CA 1SU4A 4RHUA 4AZ0A 2X5XA 4WTZA 1U8OA 1W1IA 2HPZA 4EKXA 1WU8A 2HDOA 1L3CA 5F7OA 1D1TA 3PC2A 5C0BD 1XMSA 3A2LA 5A7HA 2IOOA 2JARA 2QDXA 1QG4A 3TMKA 4YHKL 4KTEH 2NNAA 1N5IA 1P5FA 1P45A 3D39E 5DCLA 4ZHSA 1TAHA 4U2DA 3VTFA 1U98A 4IJUA 4YV7A 3QIWB 3M1CA 4WGKA 3UZEA 4OIBA 3NYQA 3E1KA 1HZZA 1Q0XH 5A1AA 2Z65C 1W85A 5H7XA 2PX6A 2BCKA 3UYRL 4R1SA 2ES4A 1ZS2A 3DVIA 1HNNA 1G5HA 3VE0A 3OJDA 4PSAA 5I1EH 4KKNA 4YAIA 2QN7A 4QGAA 3DX9B 3C6MA 2V9TA 3VU1A 1OLZA 1K6JA 2EDRA 2CKMA 2FJPA 3EYQD 5DZSA 1MXDA 4XXHA 1HHGA 4HH8A 1SVNA 4O29A 4NI6A 3KT3A 1ZUD1 4HP8A 3THYB 4IRSB 2X22A 3RDJA 4QBKA 3MV8D 5B1JA 4BJHB 1GT91 3EQ9A 3G68A 1ZK3A 2CFIA 2J71A 4XZUA 4FG6D 1BQLL 1ZTMA 1C9SA 2MTPA 1XIVA 1G6RA 3UDWA 4I1OA 2Q3DA 2X0WA 1XMXA 2YIVX 5C0AD 4DOMA 1F06A 5AWNL 1RHUA 4XYGA 3H97A 4U8GA 4LK2A 4K94C 3SDDC 4Z7NE 1FFEA 2VFAA 3NRBA 2WB7A 4M37A 1ZCFA 1EJBA 1T1RA 3PRZA 4F3KA 3C70A 5CEYB 2B7DT 2QTMA 3VXUE 1CF8H 3O6MH 4M87A 1NRJB 1QHIA 1CC3A 2BVQB 5H02A 4HYEA 2NQDA 1J2UA 5EZYA 3DWTA 5BV2P 3ZQKA 4O9HH 1NOKA 3N1PC 4DESA 3I6GB 3QDGD 5C9ZA 4NYJQ 3KSMA 2JIZA 1YMHB 2C5HA 5KYTA 2VUKA 5L4LA 3BUYA 4IGBC 1E1CB 4FGMA 1R8QA 3MOAL 1XZAA 2X8JA 5INCB 4RNRA 3GQVA 3T7CA 7MHTA 4LOVA 1W52X 4QHSA 4ZPJA 1LLDA 4X8JA 4QECA 3V8CA 4N3UA 3J80A 1NZJA 1KI2A 4LMRA 4PVCA 1T3GA 3V5HB 2VRAA 3KXFE 4S1RH 2CBGA 4GRIA 3HE7A 1WGOA 3AJAA 2C98A 4JO1H 3X1KA 2QS9A 5FWYA 2A73A 4YHPB 2XYVA 5HR5A 1UADC 2DMHA 3MNVA 3UXMA 2QP9X 4LPCA 3DPUA 5IZ4A 4JFFD 3V6OE 1DADA 2RALA 4PWFA 3WEXB 3HRKA 1SKBA 2X88A 1OALA 1E61A 1FNDA 3P9YA 2VKWA 4ZSOB 3K1AA 3DKVA 2HDHA 1TGVA 5LG1A 2FN4A 1DE0A 3TG2A 2R0LL 4KQWA 3V79C 2OY0A 1E9CA 2PW1B 5FBKA 1P73A 2WZDA 3SE7A 5B37A 2DFLA 5H83A 3OBIA 1S3GA 3PZRA 1IG3A 2H16A 4Z3FA 3E70C 2LLLA 4YXHL 3UHFA 2H1PH 2WJZB 4HH9B 4P5DA 4DAGH 4WUUA 2WT8A 1F3JA 3RC7A 3G2QA 3O74A 3NPSC 1MVYA 1E28A 4Y5YC 4AY4A 2X4PA 3RRQA 4EVSA 1LBIA 4XEUA 2A6KB 1S7TA 3GU3A 3D25A 2G9RA 2RGUA 4I55B 5I1GL 2YJNA 1BA9A 3N75A 4Q4HA 1B4LA 4FQXA 5IJVA 4WXEA 5IFHH 5CYGA 5IHXA 1MPAH 3G7UA 2MTBA 1IEAB 3WQSB 3JU3A 4JASB 3V42A 1DHRA 5IW6B 3CNQS 1PX4A 2DFTA 3ABKB 5EGSA 1U30A 5H35B 5FH9A 2XTJA 3JQ7A 1SUEA 4FERA 4KBGA 4WXMA 7MDHA 2B1HL 1XMEB 2FPMA 3TKLA 1CXKA 4GFXA 3DO4A 4P57A 1ZVMA 1RAFA 1GPMA 4BO8A 5LBSH 2J2ZB 1UPAA 1CIDA 1M6VA 1TQ8A 1XB2A 1G6OA 4BDTA 3MWJA 2E76C 3B13B 4OCSL 1M73E 4D45A 4K8RL 1H1TA 5CCXA 3VBCA 1YEEL 2XWZA 4A8TA 3OECA 4QYXA 2ADJB 5JO5A 4F93B 3IERA 3MCKA 1KCWA 3I73A 2ZTHA 1QLJA 2F18A 5F7ZA 1KGCE 1CS0B 5C1IA 2QJTA 1P5ZB 2B20A 1SUIA 2F1HA 4KKVA 5CIQA 5IKCB 4P2OA 3IILA 4Y2YA 1O5IA 1OCWH 3KQTA 3FUMA 1L4EA 4LTDA 3FT0A 1UXSA 2Q8NA 1IOZA 1M6OA 3QRBA 1EFVB 2A3RA 1EWRA 5GGVL 1CD0A 5FKAA 2W6JA 4ZCIA 5D96B 1A9XB 5IQ7H 2QUAA 1KBOA 2FB9A 5AOZA 3BSFA 4JGGA 4FXGC 2HF8A 4WCFB 2FUCA 4BQOA 2AFRA 1G5AA 3IAGC 5J58A 4AG4H 3V0WH 2GHQA 2VOJA 3QX8A 5KSZA 5JDSB 3W8RA 1OGAB 1SJEB 1PE0A 3VPHA 4N0YL 1ZLVK 3FQWA 3U6RB 2ED8A 4GAJH 3M5PA 3RG1C 5FHAH 2C3UA 4I5BA 1EAMA 3VHXA 3GR6A 3WQBA 1N5RA 4XGZA 3WBKA 2FLBT 2LU3A 1MO4A 2W1NA 4YO0A 4FFOA 1ISHA 1V16A 3W8DA 1FNAA 4G1VA 1QYIA 2IUFA 2YWYA 1E5AA 4IGIA 3MS4A 1UDBA 2GAJA 3ATDA 3WV4A 1TC2A 4MUBA 4YP5A 3QBTB 1UQTA 2GWRA 2FPWA 1JPST 3U40A 1KR2A 3Q2VA 1GZHC 3LWZA 1P2TA 2RKBA 3HYTA 2HLFD 1NFDA 1FZJB 3FQNA 5C81A 1HXYA 3S70A 4TTDC 1OXBB 3PKZA 3MB5A 1T5KA 1H69A 4ZODA 3K09C 3BP7B 1J4AA 3ILPA 4N6RB 3ELQA 4X6FA 4A7PA 3LH8A 4MVJM 4XCFH 3GOHA 3B4NA 4GLRH 2ZKHH 1NBZA 3MRIA 3A9UA 3AJ7A 5F96L 1N77A 3KTOA 2XZCL 1TO1E 4HDAA 1CUBA 4YPFA 1BZOA 1TZ8A 1JGEB 4CM6A 4Y1AD 3H6GA 3L9EA 1O9BA 3B9DA 4N5UA 1LDBA 1SBCA 3C2QA 3O82A 3L2LA 1QVRA 4DE5A 5HJ3A 2Q3MA 4FDAA 3E48A 1DB3A 3KEFA 3WXVH 1XSEA 1EFDN 2PSDA 1R00A 1IDOA 5ADWA 4XH2A 3FMFA 5EP2A 2G71A 4OGKA 2K8QA 3SP1A 2FDCA 4EAAA 1NOLA 4DGIH 4BFKA 4B5LA 3FZNA 1U2PA 4A8JA 3ABIA 2P5WD 3AQIA 3RGVA 5A16A 3IVKB 3QORD 1ET7A 1PMYA 4JZYA 2VYVD 1LC0A 1XMVA 3AP1A 3FPGA 2FAUA 3W1VA 4EJSA 1K5WA 3EDCA 5K6TA 1J21A 4F7MA 1DJOA 2JFWA 2DKUA 2DIBA 1Z9NA 3OKKA 4QRPD 2HNKA 3KLKA 1TMOA 3AM1A 5C0OE 4IRZH 4KZDL 3E9MA 3WFDL 2ZRHA 3A2NA 5AVVA 2JCWA 5EZOH 2X8JB 4ZDIA 4B9GA 4RS4A 4GLJA 1CT9A 1LI4A 3OM8A 2BD0A 4EH1A 2JIZD 2Q2LA 4AM8A 1FLDA 1A9EB 4KRNA 2JLXA 4MXVE 5E5MA 3NT4A 2C5EA 4ZXFA 2VJXA 2AHIA 1VI5A 2BS9A 2GVZC 4TF4A 3DKRA 1LD3A 3TBTB 3KYBA 3JQAD 1QM5A 1SVOA 2QTAA 1U0OC 4DR5B 4OKDA 4UNTA 3UP6A 3PK0A 3ZCVA 5EJ8A 5F3BA 4EFDA 1N33B 4RYDA 4YJZL 3C2SA 5JQGA 3CFKA 1ACLA 3ACDA 5EIQA 2QPDB 3PABA 3QPQD 3JD3A 3TCXB 1TJHH 5LPNA 4XXCC 1PR6A 1OOWA 2GWHA 3RJZA 5HKKA 1CR6A 2OMBA 2I62A 1NN3A 1D8AA 2D4AA 1U28C 3VAZA 3BWUC 5F51A 1SBZA 2N0KA 1WV1A 1PG0A 2LTQB 1IN1A 4Q2ZB 1T0IA 5KNDD 1KP3A 4KQ4H 4E2WA 1JXQA 4FDWA 1PL0A 3OX8A 4QBFA 3KLMX 3CLUC 2LDBA 5E9DB 1CZKA 4PC3A 1R27A 1AKNA 4II7A 4A5OA 4BCDA 3LK6A 5BNWA 1PFWA 3V9FA 2NXZC 3ZTJH 2ZKWA 3IPAA 3NUQA 3H5OA 4WFKA 4WIAA 1EINA 3ITEA 4WKZA 3LSTA 2F68X 4FNMA 2IBZY 4KXNA 4J7CA 2AERT 3VFGH 3S3DB 2E5LB 2EE6A 1RC0A 4TQAA 3UH8A 2XLLA 3N9GH 4PJ7A 3U6RA 1NDTA 4PS7A 3QDHA 4M6MH 4CVWA 1WXXA 3DX1A 2XUFA 5KCZA 3KXFB 4PBWD 3EIUA 2FL5B 1MFMA 4B84A 4MO9A 4MR9B 2W2TA 3SQLA 4CE6A 1AUVA 4M1QA 3HMXH 13PKA 1F3DH 4MXDA 4BP9A 3VZSA 3CNBA 3O3OB 2WHXA 3GHYA 3W4KA 1NJ5A 4BUHA 4ZFNA 1YVLA 2GXSA 2GBUA 2QHRH 9GPBA 3RK0A 3NJLA 4O02H 4GVPA 4X20A 1XA0A 2DFDA 2J7PA 4KTGA 2DQCL 4WADA 2Y1GA 5HGGS 4A1FA 5HE8A 4ZHQF 1CU4H 2FCAA 3LAFA 3MCZA 4B4UA 4EARA 3LDAA 3NORA 4HGWB 3K6RA 3E9YA 5LJLA 1F2DA 1Y9AA 3V33A 4P2OB 3ENKA 2EECA 3FAWA 2TMDA 4Z7VE 3LHIA 2QTVB 4BK4A 2ONZA 3V7WA 1CVRA 2WM3A 4FZEL 2NUPA 4OXYA 1H3TA 4N8DA 4R2GC 4QTIH 4LZWA 4I13B 2ID9A 5HYJB 1DEEA 2MPAH 3RD5A 5DJ2A 5A40E 2ISQA 3CKKA 4NLAA 4H26B 4BO7A 3LKSA 5GAJA 2YXMA 3TVMD 3K1YA 1JHAA 3RLSA 3UKJA 1ZCRA 3TGPA 3GFBA 4RK5A 3S2SA 4KQMA 4M8VA 4NQDB 2OP4L 2OD2A 1DJXA 4H4CA 2ZUBA 3T6ZA 5IR1B 4TTVA 4XNQB 5T5FL 5KDLA 5HMMA 1P18A 4OJDH 1KO1A 3PHJA 2PQ6A 3RS0A 1W2KT 4XN2A 3HG0A 3PWVA 4QLAA 2PR4H 1RRFA 2BVPB 5K93A 5U4QA 4DA8A 4JO3L 1F0KA 5TEVA 3VO1A 1BS2A 1U42A 4DP4X 1IB5A 1VG1A 1IT9L 3QBTA 3R5FA 3RUAA 2C78A 4B8WA 1HG1A 1QRKA 5DOVA 4RQUA 4PQRA 2IP1A 1KTJA 1DEEB 3TRKA 1K98A 2XECA 4JG9A 3SDZA 1GC1C 3SBWC 1OYVA 5BJTB 4AZ8A 5TDPB 1M72A 4NENA 2YD1A 1AZLA 5DK6A 4FGJA 1COWA 4P2QE 3W9DB 2BKUA 4M1GH 4G5RA 4HKJB 2ZJ1A 2NNAB 4FN5A 3LMJL 3D5QA 4KUCF 4FIZA 3C5EA 3HXQA 5IESH 2IS6A 1RWPA 2AV1A 3QKUA 1QYGL 4H35A 2F74A 5JJ5A 1X1SA 2IHYA 4DMCA 4LHSA 1QGYA 1E28B 2YGNA 4AGQA 5E4TA 4N2FA 4NDNE 2J6BA 4L29B 1HQ4A 3RYTC 1UA6H 4GS7C 5IV2B 3TURA 1ZBDA 4UQOA 3T4AA 4WHCA 4GR4A 4RPKA 3BFVA 1ZLXA 2Z5GA 1CBJA 4P7KA 4AX3A 4P2OC 3EISA 3SLRA 4CMHB 2RB8A 1L5YA 3JQGA 3NEEA 4WERA 1XGRB 5IHLB 5LCXA 1A5AB 2XMSA 1M2OB 4EO9A 4MDYA 1VACA 1U95B 3R4RA 5GZ3A 3T4YA 4E5NA 5L7WA 1TYZA 4QFDA 5E6IC 5EBLA 3IDOA 4MNHA 1KN4H 3STUA 1H22A 3REQA 2W2XA 4FNRA 1PEZA 3MRPB 4LCVA 4M21A 4HJIA 3VI3F 1G3MA 5F9MA 1IEHA 3AU9A 1UZLA 3QDGE