3ZDYB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
464
structure length
464
Chain Sequence
b'NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 110
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdyB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdyB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdyB03
3AL8B 1M2VA 3Q3GE 3FCUB 4G1EA 1JEYA 5KYWA 1JEQB 3F74A 1LFAA 1SHUX 1RTKA 3EH2A 3FCSA 3K6SB 1SQ0A 4WJKB 4FX5A 4MMZA 1SHTX 4MMXA 3EFOB 3RAGA 2X5NA 1DGQA 3T3PB 2VDQB 2P28A 1M10A 2XWJI 1AUQA 3TXAA 4WK0B 3EH1A 1L5GA 1MQAA 1SSLA 1Q0PA 4IGIA 4M76B 4C2BA 4MMYA 1ZONA 5KYUA 1QC5B 1MQ9A 1AOXA 4Z7QB 1N9ZA 4F1KA 1IJBA 1JLMA 5E6UA 3TW0A 3E2MA 5KYNA 4UM9B 4IXDA 2NUTA 3VI3B 5E6RA 2NVOA 3K72A 5KYYB 4G1MB 4A0QA 3OL2B 4NENB 1QCYA 4WK4B 4Z7OB 4FWWA 3N2NA 4HQOA 2I6SA 3NVQA 2VC2B 1AO3A 3HXOA 1T0PA 2M32A 4NEHB 1FE8A 2ODPA 4Z7NB 1IDN1 3HI6A 3PPVA 4HQFA 1MJNA 3EGXA 4O02A 4WFQA 4DMUB 3HXQA 3ZE2B 2IUEA 2WINI 1M1XB 2VDPB 3ZDXB 2I91A 3EGDB 1MF7A 4O3UB 3QA3E 3NIDB 1U8CB 2B2XA 4HQKA 1M2VB 4JDUA 4G1EB 4CN9A 1T6BY 1JEYB 2VDRB 5KYWB 4K3JB 1IJKA 4UM9D 1RD4A 1XDGA 1JV2A 3FCSB 5KYXA 4MMZB 4HQLA 4MMXB 3ZQKA 2NUPA 2VDOB 3OKYB 5ES4B 2ADFA 1ZOPA 3EOBI 1U0NA 4BJ3A 1YVPA 1L5GB 5LN1A 2WW8A 4MMYB 4PN7A 2UZYB 1OLZA 2XWBF 4F1JA 5KYUB 3EOAI 1RS0A 1V7PC 2I6QA 1MHPA 3AL8A 1PD1A 3PPYA 1PT6A 4XW2A 3TCXB 1JEQA 1XDDA 4C2AA 5E6SA 5E6UB 1NA5A 1YVRA 2QTVA 1JV2B 3AL9A 2VDMB 5E6RB 4GZ8A 2O7NA 4O3TB 2NUTB 3IBSA 1PD0A 3EFOA 2NUPB 4HQNA 3EG9A 3K72B 1IDOA 4IHKA 3K71A 1BHO1 1RRKA 1M1UA 2VDKB 1ATZA 3PPWA 3NIFB 1DZIA 3IJEA 1XUOA 3BQNB 4CNBA 3TVYA 1QC5A 3V4VB 2VDLB 3EGXB 4O02B 5E6SB 1YUKA 3V4PB 2P26A 1FNSA 3VI4B 3GXBA 3AFCA 3PPXA 2ICAA 1MQ8B 1BHQ1 4UM8B 3EG9B 3BN3A 3K71B 1SHYB 5BV8A 5KYYA 4G1MA 2ODQA 3ZDYB 3OL2A 4NENA 1CQPA 3IJEB 1N3YA 1PCXA 3ZE1B 1TYEB 5KYXB 1CK4A 2XGGA 3K6SA 3OKWA 4CN8A 3BQMB 4JX0A 5HJ2A 1OAKA 2VDNB 1M1XA 3F78A 5HGJA 4WK2B 3T3MB 3ZDZB 3EGDA 3M6FA 1ZOOA 4C29A 5HDBB 3NIGB 1UEXC 1M2OA 3ZE0B 1U8CA 1U0OC
chains in the Genus database with same CATH superfamily
2XG5A 5C6TL 3QHTC 4PO8A 2QAIA 3HUUA 3I3SR 3SDCC 4OH1A 3GMLA 4OTXH 3CE9A 4R7DA 2YWHA 2AXEA 3MPOA 4BX0A 2WG0A 5LSAA 5AYVA 1RFLA 5I6XC 1RBYA 1E5BA 1YY9D 3KOMA 4QT5A 1PYGA 5I1EL 3D3EA 3AHCA 3DQZA 4TOYL 3T4YB 4PJBB 3RILA 5HJ5A 2QE7A 1I3GH 3C08L 1DBPA 2ZTMA 1A4CA 3NC4A 3STXA 4EDXB 1OK8A 2ECPA 2R7EA 1GZSA 4BDVA 1ZANL 2PMWB 2CJXA 3LHPL 1G63A 3HKEA 1Y18A 3AXLA 5KQLA 2H16A 5F93C 5HI5D 3DO4A 5H70A 5FPPA 3ZWAA 2KHAA 1K85A 2ZB8A 3SE0A 4BFWA 3C8MA 2VHZA 3OGOE 3QIWD 3VXPB 2Y22A 1X5HA 5FYQA 3FWZA 4QNRA 4X9XA 3SDAC 1OUMA 3WAGA 1ZT7B 5SYNA 2X0FA 1JQ5A 4ZFNA 3IBCA 5JDIC 1U41A 4MNQA 3DUSA 4OXXA 4MDJB 4KZKA 4NKMA 3JUYA 3L9YA 3OT5A 3ZWYA 4ZTUB 4PZ0A 3ICCA 5IS2A 2X6UA 3W4JA 1EDHA 2CMGA 2EXXA 3AB0B 1AQDA 3S36L 2VSMB 5FYKE 1YDPA 5IHUL 4EW3A 4R97B 4EZEA 1J0DA 1K06A 5F6HI 3JQBC 4O1HA 1ZVSA 1DARA 2JTYA 4NBXB 1OH5A 1AQKL 4WO0A 3AUWB 4BB6A 4HB3A 5JSUA 3BXGA 3HR6A 1GZHC 1L5SA 3AUXA 5E7IA 4UDNA 1SBHA 3VUFA 1PK9A 5AIAA 3RWIA 4P53A 1AQMA 2CLRB 3UABA 3AUSA 3QKSA 2NP6A 1MDTA 3I2CL 2XTAA 3BAZA 2XZZA 4OLUL 4RWYH 2WYVA 3M1BB 1N7IA 4ZAZA 1XZ0A 3F90A 2C3VA 4N0YL 4EJ2A 5AW9A 1VZ3A 3VGBA 3F6EX 2OV0A 4M1ZA 1DINA 3WBBA 4XVHA 1KDYA 4IRJC 1QTNA 3O6KH 5GJSH 1MCPH 4AL4A 1MEXH 2AV1B 2H1WA 1Z88A 1FLRL 2MYNA 3GIWA 1QYVA 2KZKA 3AMVA 4OA8A 4KH1A 3G08B 4NUGL 1D5BB 3PUCA 2A3TA 1ABBA 4BKPA 4PJDA 3EYSL 3ARGA 2NY4B 1Y6KR 1ZLVK 3I3OA 1Y5LA 2PWPA 3DFFA 4GWLA 4DVGA 1VG9B 3QBJA 1O5OA 2FEXA 1SBTA 1KXJA 2Y9RT 3LOQA 4ZN6A 3VR5H 4P23C 3I34X 1VGKA 1NE2A 4KV7A 4CIXA 4WOKA 1E3XA 4MRAA 1KEMH 1R16A 3B13B 2V7BA 1C0PA 2QXUA 4NN7B 1N9ZA 5JIHA 3OPMA 3HZZA 1Z83A 4Z0HO 4D9EA 4Q7DA 2FPIB 1I1AC 5DK4A 1A9SA 1XXLA 5CAYB 3HVNA 1U58A 2NO9A 3GM8A 1AHMA 1VMKA 2YYAA 4HK3J 3KSMA 1DVTA 5ALIA 4WTZA 4LFCB 3GMQB 3FBWA 1XEWY 1VF5C 5EO0B 1WTAA 1G19A 4TVOA 4WUUB 2EECA 5TGBB 2WXIA 3T4XA 1AACA 5I0WA 3MRLB 4NEQA 4LVOC 1WA1X 5CEXA 3FO0H 5CIWA 5C8VA 5ESDA 2ZYVX 3BDIA 1T20B 5DGTA 3WGLA 1TTCA 3STVA 3IEKA 4QJ3A 2DF3A 1LE9A 3MXVL 3UZVA 1PZUB 1ZMBA 5G1OA 4MI3A 4PWJA 3V7NA 4IXWA 4CE6A 4AROA 4YQZA 2EZ9A 1A8QA 2AOTB 4N9GB 1ROCA 1IOVA 1KRHA 3K6DA 3FH0A 4WTWA 2XADA 3O6FA 1OZHA 2Z1KA 4K73A 3BYTA 5HDRA 1P75A 3UW1A 4QOKB 1YZYA 3WFEL 3WTSA 3UYRL 3BSFA 2OP1A 2HPTA 4AM0A 3VD7A 1HVXA 3JV4B 1VPLA 2BSQA 3L2OB 3AFLA 2HJKB 4W9NA 3I42A 1BJKA 2ZIGA 1MRSA 3JV7A 2P1DA 3ZY5A 5I8PA 3C16C 5D6DC 1NKRA 4PVLA 1XJ0A 4P9NA 1KEUA 3SE4A 2DD8L 3A4EA 3RQ3A 3WFHA 3EBGA 4IGIA 1D5RA 5JW4N 5F72S 5B1DA 1EEXB 1O0VA 4C3UA 2ZRLA 4WDIB 4XXWC 2QVMA 3W06A 3S7GA 2WAAA 1HEUA 4PZEA 4HVBA 3FC8A 4MRNA 1DV2A 4WNQB 2ZDHA 4DR5B 3WK4A 3OQJA 3IFOB 1K98A 3CBGA 1P1VA 4N54A 2G4GA 1BMFA 1TFRA 3HZVB 3IT0A 5B3JA 5TDHA 3C5CA 521PA 1Y3CE 2I87A 4M1YA 2OWEA 3PHQB 1DRJA 3Q1SL 5DJXB 1R5WA 1W44A 5ED4A 3D64A 1GGFA 4KZCA 2WJIA 3CSDA 3ROTA 5IANA 1QTQA 3WHE0 4WUVA 3OJWA 5J1SC 4PJCA 4IMIB 5K8IA 3Q06A 1BG1A 2Q27A 3UHAA 1PWZA 4FEMA 4S1RH 2BBOA 5FTKA 4P2OC 1YS9A 5EBMA 4PAGA 2POQX 3DX0A 1Z22A 3C5JA 1J0JA 2XJ4A 4RD3A 5DD5L 3WO0A 3TH3T 3D39A 3AM1A 1PVHA 1J5OL 3PP4H 4IU2B 4ITVA 1ECYA 3N39C 3SGDH 3O2DH 1LXCA 2VJLA 5KBMA 2FRGP 1MOQA 3QOFA 4WW2F 5KVEH 2P91A 3V5HB 4NI5A 5DJ0B 4G5OA 3LD9A 2UXGA 2GCNA 2AVNA 2EQ5A 1XF5B 2PJDA 2GCIA 3T38A 2PIDA 2HJHA 4CW1B 4LP4A 4S0XA 4N8VG 2VUKA 3VCLB 4YUAA 3WMEA 2FHCA 4EI5C 3Q5EA 3WLNA 3HAEA 1ECBA 4IDJL 1LC3A 2ZZKA 3U4EB 3SWWA 2PWDA 3PGLA 1P1JA 4G5GA 3HM9A 4L8LA 4HGKC 1IC5L 1SYVA 1H4SA 4M9CA 3SDAA 3QMMA 1SRDA 1SOXA 2K2QB 4YJHA 3QA9A 3ZJVA 3H75A 2NDFA 4XP4H 4RPCA 4EZJA 2AOUA 1L3IA 1W4AA 4K26A 3DB2A 4H2AA 4PG7A 5J5VA 2JIXB 3BP5B 1HILA 3W5HA 3LT1A 1KEVA 3WXVL 2JK1A 4R05A 2W6MA 3B1XA 1KGDA 2FX9H 4LAQH 4HJGA 4G5AA 3R5JA 4PG9B 2VW4A 4XMWA 4YAKA 3WE6B 4OA5A 3K4ZA 5DWVA 4YONB 1JDDA 4DQ0A 5F1PA 1GA4A 4EQ6B 4UB0L 1ZMRA 1MMFB 3V32A 5BSWA 3MUFA 2BELA 4ZX5A 4ZT2A 5LOVA 3QI9B 1KAMA 4HCRH 4NZYA 4KREA 1PNOA 2XZTA 4G9GA 3U40A 2FK7A 3KZOA 1CFNA 3IFSA 1S7XB 5IFLA 4AI7A 3ZJ4A 1RUAH 3UMRA 1G7SA 4R1QA 1SVMA 4KMTL 2DM3A 2JFCA 4AJ1A 4N2CA 3B7TA 1H65A 3E8MA 3I45A 1BZ9B 1DTUA 2AC0A 4AF6A 1I7SB 5SYMA 3A3OA 3QCTH 1SRRA 5BZDA 4MCZA 1EGHA 2DL9A 4HUWB 2V96A 2PGJA 4K9DA 4OXIA 2VCYA 4B3RB 3FMOB 4CUKA 3D0KA 1PPIA 2OK8A 1F3RB 2YEZB 1PR9A 3QLVA 4GIPD 2NSMA 2GPJA 4XR4A 3KBFA 1XEFA 4TMFA 4Q6IA 5C2UB 1YR1A 1XAHA 2LLNA 4R2GB 4YAQA 4E9TA 5IKCB 5JD6A 2MINB 4DZRA 3KR3H 5LP6F 3OKLB 1QE0A 4R8MA 4G3YH 3DVLA 4H18A 3OETA 3LEXB 4EUHA 1SDYA 2G9HA 3AWGA 3IQEA 4GRDA 2R4SH 4YAOA 3QPXL 3TJEL 1PT6A 1X3LA 2Q87A 4XJXA 3OHMB 3NKVA 3HYLA 4KQJA 1MW8X 1H3GA 1A25A 3L40A 2EDOA 4LDOB 2RBGA 3WKBA 5E4IA 4RA9A 4P99A 4X41A 5DJCB 1CXHA 2GCYA 3FAKA 3AREA 2DQUH 4ECAA 4MQSB 1ICEA 3BB3A 3SJZA 5HFNA 4UYPA 4HYYA 3Q8XB 4FQCL 3ZD9A 1KYOJ 2ZLBA 3RBVA 2G1KA 4ZMNA 1N5JA 1TTTA 1I1AA 1INEL 3U6RB 1T0OA 1JRHL 1T04B 3DXAA 4N3CA 3Q8KA 4M0UA 3ASWA 3FUIA 3D6JA 5TF1L 4NMHA 4P7JA 3L45A 3PNRB 1CK0L 2OJ1A 2W65B 2PFKA 3E3QE 3MLYL 2RSLA 3FGOA 2ACKA 4D8XA 1HZJA 4MQXD 1GILA 2GZ2A 2OO5C 5LU9A 3O8CA 1X8KA 3E1KA 2Y5EA 2AAVA 3QJTB 2IVZA 3L1IA 1Q0RA 2HLFD 4R1NA 1NSTA 4BVAA 3VHRA 1IDN1 4Z4QA 1M34E 1VTKA 3O8RA 3D6AA 4OM0H 4NAUA 3N2LA 1OW0A 5HHOE 2OMZB 3ZXXA 4HKZB 3UBFA 2NNAA 2QJFA 4C4KO 4FYYA 3EUAA 1WDAA 4AO7A 2NVUB 1PLGL 3LQKA 4DKAA 1IBGL 2NV6A 4J3WA 1YDWA 3DEZA 8PAZA 3AKYA 5DVNA 2X0RA 2F53A 4DVBB 4QHUA 1P2DA 1VFNA 3SZOA 4WBNA 4RE6A 3GMOB 3DM9B 5B7EA 3Q8MA 5AJVB 1UP4A 1YEJH 3P4XA 1YQGA 2ZJ6A 4KZDL 2ZI4A 5H7XA 3EY9A 3JYLA 5DYIA 4G8EB 2DKFA 1NOLA 4FR0A 1A2YA 1JDCA 5BMOA 5JH7A 4UNUA 3UHFA 2WWTA 1ZA2A 1KUMA 4JB9H 1Q0ZA 2FF5A 5L3RA 4KK9C 5KBLA 4NQCB 2D1RA 4ZVUA 2WBWB 3OKWA 2PYFB 5IFAH 5DHAA 1I10A 1ZHNA 1IWBB 1VRVA 2VDJA 2X6QA 3WYFA 1CFMA 4XNYH 3KUUA 2CSUA 4K2HA 3FTQA 1DLHB 4YHNA 2NR6C 4YO0A 3VTTA 4TXHA 2QMEA 3OKOA 2GT9B 2HUHA 4O5AA 1SD5A 5ENWA 5CTAA 3PNBA 2FEKA 2HFFA 4JDEA 3L5HA 3R06B 4HG4J 2FPPA 4XLLA 1BWPA 5FIEA 3UTDA 1IGJB 1K6MA 3THOA 1QVRA 5I26A 4OZHE 3MNVB 1B8UA 3DBHA 1QRSA 1N2ZA 3DXXA 4XD7D 2Q3MA 5AVRA 2HU5A 3NV7A 1M1ZA 2WBXA 1AS6A 1G8YA 4G6ML 3OX1A 1RSYA 1CRPA 2VDOL 1NTRA 4D79A 2MCPH 4APQC 3ZQKA 4W9GC 1J8HB 2PE5A 2R79A 2IXEA 3S68A 3NOIA 5T5FL 2AC2A 1RH8A 4QU0A 1LDSA 2B37A 3RWDA 1N64L 3PSAA 3FWYA 1QGOA 1QSEB 3GXMA 4UU8A 5LR6A 3B3JA 1HIMH 1BIFA 4AKGA 4FQ5A 4BY9E 3O3CA 2GESA 3LA8A 1GKYA 2EX1A 4OXYA 2JLVA 4PEEA 2QD1A 2P2YA 2AX4A 3HU3A 2YFQA 3B1JA 5I7SA 1Q14A 1IV8A 2Z9TA 1TNDA 5CX4A 4YASA 2EP6A 4IKJA 1QGUA 3KJZA 5CVUA 1JG9A 4C0JA 5EHIA 1OAZL 4QYIB 5FADA 2AN5A 3DSFH 3A5VA 2W2KA 5CMLA 2X4RB 5KVFL 1O9GA 2AJTA 1UKTA 3GB9A 2KLTA 5I1KL 1A6VL 5E4AA 3P4YA 5D7BA 2WT8A 3IVGA 2B7LA 2E55A 1XVIA 4X1YB 4P4KD 2XA2A 1IY8A 2Q1EA 4DPCX 3JVEA 1E0SA 2OO3A 5AL8A 3JVVA 3DTXB 4QO1B 3PRJA 3NAAH 3VXMA 4O02A 4OAOA 1ZL2A 3PT9A 1UZ8A 5ABAA 5KTMA 3M8OH 4AJ0A 5IJVB 4LRYA 1J8FA 1DBVO 4ZP1A 1U7OA 4BNWA 1QLEH 2WKGA 5EIIB 2GYYA 5IGXH 4ADJA 3QWBA 5K3DA 1YEWA 1B4RA 5CZVH 2X8WA 1BPVA 1D3AA 1W0JD 3DD1A 3O3BB 1I4EB 3OJVC 4KL8S 3TVYA 2X0VA 2Y7NA 4OJMX 3H1BA 1RXEA 5LKAA 3T94A 1T8WA 4TKVA 3CDGB 3OJ2C 3OUTA 5B36A 3UK6A 3P2YA 3K71B 3DTDA 3D18B 1XWWA 3EJJX 3VQTA 2CA3A 4LHJB 2VXTL 1OAUL 3MRTA 1Z5NA 1AG9A 4IL5A 2WBJB 2X6TA 5I9IA 4KYUA 1AXRA 1JIKA 2UUDK 5C3TA 3HNTH 3R7RA 5KU7A 2WNWA 3HDYA 1DX4A 5KQSA 3O9WB 4B7ZA 3WIEA 4FXGA 4FNLH 4R9NA 1Y80A 3BA1A 2W8BB 1B6TA 3LN5A 5KJ6A 2FSIA 4OQMA 4PZCA 3MYYA 4QXTA 4BFFA 1BEUB 1ZK5A 4GRLC 1PG0A 4C0BA 3VACA 3WK9A 3HUJF 2JIOA 5A6SB 5DJ2A 4GI3A 2PXCA 2WU1A 2P8JA 2BNUB 1DAOA 5BQ3A 5JS7A 1K89A 4ADSG 1E3DA 5CDHA 1X7DA 1NTDA 4BX3A 1S2OA 3NCYS 5DS8B 4LLMA 1B3BA 2UWEF 4XQ9A 1JIQA 2BY1A 3LFTA 3ZQ4A 3CCCA 2IXFA 1G5PA 2BDNH 1RXCA 3DLQR 3ND6A 1F4YH 5CMAA 3AVUA 1TLTA 3R6WA 4ZYUA 3VSVA 1K9VF 5IG7A 2I9LB 2NO4A 1A9YA 3IAFA 1FX0B 4RX4A 2DQGH 1WZ1L 3CQ9A 3RAFC 4HAUA 1A7NH 3TNNA 3VR3A 1P2TA 1GAQA 1Z0ZA 2Z1PA 3TGWA 3E2IA 2EKZA 4ES9A 4X42A 1YBMA 3EXEB 3EDFA 4OSPA 2ICAA 4CMAA 2HWZH 5GPRA 5F3BA 3F5SA 4FGSA 1Z75A 3UFBA 3RU9A 1HV8A 2PFGA 1TAHA 4TN9A 1M2HA 2K7QA 1E61A 5IQ9B 4Z0BH 4C2TA 2D1YA 3I3EA 3RE0A 5E8DH 1U2SA 4IJTA 4GIBA 2R0WH 3JVDA 5IDVA 2P80A 2X87A 4B47A 1N78A 1GW0A 4CT0A 4UTAA 3G6JE 1E1QA 5AK0A 1ZNYA 4FU0A 2REQA 3CRW1 1QSGA 2V45A 5A7FA 1KGJA 1PGOA 2VMDA 1MC1A 3CLSD 4F33A 3HBQA 1R0RE 3PSHA 3VYRB 2H2SD 4TZTA 5JCOC 3WDKA 2DQIH 3WC4A 4X92A 4KR2A 1Q90A 4WY2A 3BUSA 4D9LL 3N1PC 4HI0E 4NQVA 5J2TF 2M1KA 3S6CA 2M98A 2JVUA 4Q6WA 1FI8C 3F58H 1OBCA 3CBQA 1WKCA 1UDWA 3P9LA 2CHUA 1JVBA 5DJYA 4I50A 4FXKB 1W2WB 2N1KA 1KQ3A 3GTVA 1XB2A 4ZFFA 1AGBB 2DPMA 4QRAA 1EK3A 3RVWC 2PZLA 3DO5A 3KPUA 3VG9B 3UHJA 5ALCH 3IPFA 4B3EA 4NS0A 1JIIA 2YN2A 1FSKC 3BXPA 1QFMA 3ETBF 3OE5A 4JANA 1FFXB 4R2WA 1M1UA 2J8OA 4QHKI 2DTSA 4ZK6A 2C4MA 1D4ZA 2WIMA 3FR8A 5C0FB 2FP4B 4XVQA 5FWQA 2ATAA 3MTRA 3E7XA 3GQVA 2NR6A 2VE6A 1JZIA 5KSOA 3OCVA 1ZAYA 3HVDA 1VIDA 5BMFL 3QGMA 2WQZA 4NU0A 4AK9A 4BLPA 3O1HB 5D93C 1Z33A 2IWEA 5F89A 5TDOA 4XIJA 5EZIL 4KXFB 5EE1A 4YUZA 1H2BA 1PT8A 4H25A 3H2SA 2IXAA 4ZAGA 2ZRIA 4I18A 1Z15A 1UWVA 3DUUB 1N6QH 5KBPA 1SOUA 4ZO6A 3PA6A 4LOFA 4HIIA 1TZKA 4XNMA 4TUOB 4MDFA 4QRPD 1QFWM 2YD0A 2LXNA 2Q3HA 2E5WA 2XC8A 1YE8A 1OAKL 1PZFA 4M1QA 5CYGA 3WIFA 1PKXA 2YVLA 1WD5A 2WHEA 1FBIL 2RHTA 1QLJA 2YD6A 4XAKD 3WELA 4Y2DD 4AKEA 1G5HA 2J33A 1A5SB 4IIQB 2OT3B 4PVMA 1ZRUA 1DJSA 1FN4A 121PA 4EUPA 2XNSA 1MCRA 4G3XA 4JR9H 5IJAA 5EPEA 1AUVA 2BI8A 1YAJA 4R0VA 3QTLA 5GINE 4O2RA 4UNQA 3L1KA 2XYHA 1XTIA 3WADA 5JOPD 3THYB 1FZQA 2IPUG 4HZLB 3CDFA 2GEBA 2YRFA 3KFVA 2M1ZA 3WAJA 3A47A 4G5ZH 2Z93A 1H2AS 4EHLA 3HG7A 3TR6A 3VGDA 1II8B 3RFUA 3FAXA 5T6BA 4JHAH 3BZEB 2WJ4A 4WXPA 2ID4A 2RR3A 3X44A 5J43A 4OHPA 4U1HB 3OVMA 1I7RA 1M8JA 5JAZA 4NZPA 3SLRA 4CSZA 1XF1A 1YDMA 3NHBA 3ZY3A 3CTMA 4CDNA 3QAQA 2RI6A 3UJ6A 3OQHA 1EUCA 4X62B 1VFMA 1Y89A 1C30B 1TITA 5GIOE 4X6UA 3V4ZA 4R51A 5T4FA 3SPIA 1UD3A 5GZNC 2PLWA 2ZQ5A 3ICVA 4F9GA 1FIUA 1FXUA 4OBXA 2G3NA 4BSJA 5T3XD 4WNSA 5K0SA 1AOXA 2C3YA 4L27A 2MPAH 3DL4A 4IS6B 5D7JA 4XYGA 1KN2H 4HQQH 2Y2TA 1LPAB 2YSTA 1JPFB 1CTQA 1KNQA 2ZW9A 3ECCA 1BDIA 4F2MA 2QMOA 2X70A 4KK8C 3TJMA 3NIWA 2NVWA 4ROSA 1Y48E 5HHOA 2PEYA 5B55A 1XZBA 1OPGL 1JPSL 4R8WL 3KBBA 3SYMA 4GLRH 1NUGA 2H2FA 2W0LA 3K6KA 5J4HA 1TQWA 2NSYA 2OGUA 4YUEH 3T3ME 4BJ3A 3AUVA 4ELMF 2WTUA 4H7FA 2OBBA 4N9WA 1ZGBA 1CGVA 1NYQA 3QISA 1FRNA 3V9EA 2IY8A 2XKNB 1I7NA 2YD3A 3KS9A 4KNUA 1LL1A 1IPEA 3CU7A 4F37K 1ZLEA 2KLSA 4PW3A 2WAMA 4YCMA 2V3FA 3NVKI 2BOBA 1WV7T 1ODTC 3KYMA 3GQBA 4N3GA 1C3LA 2XWJB 1KPGA 3FFDB 2YWZA 5AKLA 1AAJA 1A9BB 5EIOA 2Y2VA 1IQRA 5LYJF 1BA2A 4IUDS 2QR2A 1OROA 3EDYA 1NLFA 1KDRA 5AUMB 1KVTA 3FT2B 5L3QA 5HBRA 2ZU6A 3NJFA 3EJTA 5H81A 1A1OB 2OX5B 2ZBDA 1FSSA 1VLHA 4GXVH 2MSDB 1XGQA 2CUAA 1N12A 4KPHH 1YZQA 4HHAB 2YBRB 2HK7A 3OPZH 3UERA 3TTUA 1KYOK 3KPRD 3EYQC 2IEAA 4PHHA 5ECWA 3KH4A 1YRWA 5IVXA 3N07A 2ZM6B 2PKDA 2AJLI 4WGKA 4DLWA 1RM0A 2HADA 2E7DA 1F11B 2G63A 3S1AB 3MUGA 3IHWA 2PR2A 2A99A 4J7UA 4PJAE 1AQ8A 3HZYA 3QZWG 4CDHA 1U8PB 4JQSA 4DREA 1HR0B 3RAJL 2BHUA 3DZHA 1WZIA 3TOSA 2A3NA 5DSCA 1TW3A 3JXAA 4HWKA 4IIBA 1LTQA 3HE7B 4NPJA 3QQ5A 3HMXL 3ZCPA 4G63A 1ZEAH 4JW3A 2JIRA 2JI6A 5LBSL 1LQSR 3KVDD 3H19A 4HDSB 4YAGA 1TTAA 4OCSH 2FSUA 5EESA 1WUNT 3SC3A 4ZXBC 2K78A 1NI3A 3EYOA 4CGTA 1L7IL 1GUBA 1L5WA 4G6AC 2Y0EA 1N0IA 4XYEA 4FFTA 3GNSA 5BMVB 4MYCA 4JPVL 4ZNEE 1CZRA 2AFHA 2PMEA 5MGBA 3H8VA 2CUHA 2YAMA 1XV8A 5E8PB 1UD4A 3S8WA 1OCWL 5HHMB 4ZZ0A 5AVXB 3VFUA 1PS3A 4K5LA 1ADCA 1JEJA 3KKQA 3U4GA 4XXHA 3WNJA 1NBME 2NO5A 4QBFA 2OCLA 1J8QA 1SVIA 2BRQA 3H84A 3IDNA 2DVMA 5JFOA 1BVZA 3WN5C 1W47A 2ID8A 1UBMS 1QGED 2O30A 4UEWA 3DW1X 1BQ3A 1B6GA 2GKIA 2WV3A 3FK3A 3SE8L 4OL0A 3WYGA 3KWWB 2D5CA 1CXLA 3U1QA 3FFWA 4JL1A 1P69B 1ZT4B 3H1EA 3MFFA 2EF1A 1XD2A 2OMVB 5DO2D 4JY5H 2R9HC 4XCQA 1HYSD 1QHSA 3V0JA 4PS1A 3MFQA 5DZSA 4JM2B 1TVHA 3ZN2A 4JN1H 2PY6A 1OANA 2XT6A 3ISVA 1E6JL 4HG4K 4LYJA 3BUQA 2VWGA 3AVQA 3SYPA 3WKYA 2XUGA 3MJ7A 3PHBE 1X6LA 3BMOA 4BMXA 5F2KA 2Q29A 1Z45A 1MX1A 3HI6L 3VG0L 1WABA 4L4RA 5ESQA 1W76A 4NM8L 4PRIA 2VDMH 4CMEC 4KXBA 4B34A 1UENA 3MJ8A 4II2A 2X9ZA 3BULA 1YHZA 1KKUA 3WMSA 3LS5L 2K7ZA 5JDCC 4TVPD 3BMWA 1DKMA 1HC1A 1HAWA 1ZXQA 2R60A 1A8ZA 4CLOA 4WI6A 2GCOA 4A2WA 3FMIA 2WVHA 5JW4R 3EJZD 5D96C 1JPEA 5CCKH 3P0VL 2R9VA 2G5UA 1E92A 1SUAA 4Y1RA 4PXYA 1AYOA 4U1NA 4RETA 2X4UA 3NIDF 4HY3A 2IBMA 2RARA 1W1IA 2CNWD 1Z2CA 2LCIA 5AVUA 1NAMH 3KL3A 1KIMA 4YDKH 4XGNA 4XC3L 1DYZA 4RDBA 5JJBA 3FR7A 2WUCH 1G64A 4FI3F 3K72A 3AQXA 3X1JA 4B80A 4IVRA 3E35A 2NY1B 2NNWB 5DHXB 3ZDCA 3GSUB 1AF4A 1UB5A 3ZTNH 1NVWQ 1F58H 3VFGL 5SWSD 3S8YA 1BF5A 1QUNA 3FL7A 5GRWA 4F84A 3BFJA 3O45A 1MWAA 3B70A 5DTFB 3RWBA 4JFDA 4F58H 4TMVA 4B9GA 4JUAA 1NCNA 3LZ6A 5GRJL 3AEUB 1ACLA 1S6YA 2HLAA 5AD1A 4MZXA 5DUMH 3BD5A 3LH2H 5AOJA 5GXBB 1U92B 3IKJA 4KTYA 3LKQB 5A02A 4M54A 1UZMA 1GZUA 4LKRA 3W9UA 2JNZA 3L3OC 1ZISA 1XLUA 2FRVA 2P11A 5JSHA 1R37A 1UMDB 1JLHA 3TB4A 3O3EA 2OYSA 4X5OA 1RJYB 3ULUL 4OLZL 3LB6D 3BM5A 1OREA 2AC4A 4WDRA 5DW0A 4OCXL 3QU2A 4RRPG 3V0GA 4ZIRA 2BTOA 4G0MA 1RJEA 5I74C 4AENB 3PUVA 3F1LA 3W1WA 2QE7D 4EPVA 3CVIH 3SVLA 4RPHA 2R1XB 5KSZA 3BWDD 3T08A 3WS7A 2RCYA 2JB6A 4QU8A 2I1WA 4O58H 3BC1A 5D5MA 2QLVB 2FFJA 4NL4H 5JPNB 1P4IL 4ALKA 3LD8C 3A6BL 1FF5A 3W3AH 5JECA 5F5LA 4C6TA 4Z3GA 1DQNA 4ZZ3A 4QRPE 4WCFB 1TZIA 4B2PA 1K6EA 4DXAA 4II3A 3V8OA 5C0AB 1JGLL 2COQA 1ZSDB 1RFDL 4ANKA 4ZWNA 5GOTA 1NUUA 1RYNA 3LOWA 1ZESA 4MNQD 3MV7B 3OLWA 1DCKA 1DQRA 1SOVA 1X92A 3EHDA 4KE9A 3CY6A 5J58A 5J6SA 2PUVA 5JOPE 5ISZB 2ZANA 2YV4A 1CLYH 2J3QA 2WUBL 4PAQA 5F7BA 1ISIA 3G6WA 4LSDA 3L3JA 4X1IA 3GRCA 2A2QT 2D5LA 3U7QA 5JMTA 5LBGA 1A9ZA 2VTBA 4BSVA 3L04A 3NA9H 2ET6A 2XGMA 3U37A 2UY6A 3ETNA 5BSGA 1C3OA 1J39A 3TEFA 4U1MA 3DDUA 4TUJB 4ARSA 3F5WA 1NIBA 3K74B 3P9ZA 1G7MA 4YMGA 4P2GA 4C07A 5JUEH 2IAMC 4GPTA 4Z78A 1UC6A 3RYIA 4BQIA 1DHKA 1TO1E 5K5YA 1PKEA 3D31A 1FMTA 2DKUA 1I7LA 4WWID 3HFMH 3WGZA 4BINA 1YYMH 4DKEL 1L5OA 5T3XE 2AC7A 1A4XA 3LWBA 1B2YA 5HQ3A 4MCNA 2IXGA 3T77A 3DFUA 3TUZC 3HC7A 1QQ6A 2P9BA 4KIFA 3IDSA 1CUFA 2AZXA 4C4YA 4LX8A 2XRYA 3BZUA 4CVNA 3B1YA 2XVZA 1L7AA 4BK5C 5AKRA 1ND5A 3MGOA 3WS6C 3IU4L 1QAMA 2DWDA 4AX4A 1GCUA 1KELH 4HCFA 1ZJWA 3DL2A 2K4AA 3ARGD 4ZMOA 3MFGB 2I80A 4GP4B 1ASOA 3L4WA 4G65A 3WBFA 1FNGA 1EE2A 2CZNA 5HE8A 5BSHA 1P4SA 2BP3A 1UC4B 1DRKA 1JNLH 1VIWA 3GRYA 2YSSB 4U3JA 4GL2A 2QHRL 5HZKA 2CK3A 4KXWA 4BZ1H 2Y93A 2HRPL 1NCUA 4YCAA 3MEQA 4GW5B 3C6XA 4KAXA 1BQRA 1KY5A 2PPEA 2EOAA 3GOHA 1EX7A 4Q8BA 2VZVA 3KXKA 4O4HF 2RHGB 2FWOB 25C8L 1GZ5A 3UG4A 2ZJSH 4Y2YA 1QX1A 2VLRB 3MF4A 3MLZL 3T9WA 4P83A 1IU1A 3FWKA 3HKDA 3LRLA 2P3YA 1SXCA 3COJA 1X4XA 1L2TA 1ODAA 3RVRA 3RRMA 4X94A 5EOCH 4AQDA 4COKA 1JEQB 2VAJA 3AP2A 2OV8A 3E6HB 2ED6A 5KBDA 3W11D 3U4KA 4N25A 2A0FA 4Y30A 4JAVC 4YXHL 1RK0A 4LNRA 3KPRE 1AR1C 3T71A 3HGMA 5FUBA 4TKMA 1FGNH 5CU5A 2W07B 1QW9A 1JN0A 1L0QA 1R6VA 1FRGH 1FUNA 3WTWA 4POUB 1DQSA 1BM7A 3DV4B 4CLRB 3ITDA 3K9HA 3CH7A 3G1TA 2Q3BA 3O6FD 4QRDA 1EUUA 3BEOA 1QSFE 3V4RA 1Y4AE 2BZDA 2HJFA 1SXHA 3M5CA 1P9LA 3ULVL 1G7HA 1BFKA 5DRTA 2NZIA 4ODTH 2XWBF 1JDJA 2QT6A 1HHIA 4DXHA 1TIPA 5JDCA 4V0SA 1NLDL 2G5BB 1TU3A 4ESVA 3JARA 2BM9A 2AIRA 1G9EA 3BVDB 4Q7MB 4OT1H 2ZJ0A 2NW3B 4O8CA 1LP9A 1R4MA 2ZWVA 3IKLA 1PAUA 2X4PA 1BW9A 1SK8A 4L8SA 4F4HA 4PGEA 4FDAA 1NFDE 4JT2A 4OSUL 3QMPA 4RJKA 3NCMA 3RK4A 5DCCA 2C4TA 4X7CC 1P74A 2O8BB 3I5AA 3SHVA 4DPKA 4KIWA 2ZE0A 3O2NA 3L3GA 5KSVB 4I4TB 2HCJB 5CD5C 1CVLA 2BMFA 2LPMA 2ZTLA 3PABA 2IOMA 3TS8A 1JGTA 4GYWA 1BMFD 3FDWA 4P8RA 3GFFA 5J47A 4UMGA 1AUQA 3AL0C 2DWOA 3IPAA 3NEOA 4BQ9A 4DM4A 2YC1A 1CX9B 3LG2A 3MUEA 2XNAB 1S9VA 2MSPA 4QKXB 3GFSA 4P2RB 2J25A 5EJGA 2XQKA 4NP9A 1MOZA 4S1OA 3FTZA 2CJ3A 3RWHA 1AZTA 5KVDH 1KMNA 4F2FA 1T22B 4A55A 3E5NA 3OURA 2GJKA 4UNNA 3V5KB 1EAOA 4U6NA 3MV11 2VQTA 4TV9A 4JZNA 1TXGA 1VE6A 5FI3A 1GR1A 2RD0A 2TRSB 2OCIA 4UYQA 2LT9A 4MMYB 3FNRA 1MQSA 3D39D 2A30A 4AJPA 1Y9DA 4ZQGA 5AKKA 4BHUA 3U2SB 4J7CA 2VDMB 3FPHA 4R96B 5F7NC 3ZCXA 1I7ZA 2P2GA 4FC3E 3M1IA 3MRRB 3CFKA 1UDCA 4FXPA 3KYNA 2O2SA 4XP9L 3FT4B 2BIQA 2NY6C 1Z26A 1B8OA 3OI7A 1ZXBA 5D1QB 4TVPE 3ZMRA 3V00A 3MV8B 1NAMB 2FX8H 3LRSA 4KP7A 4G5YA 5AQ0A 5KAPA 1RCUA 1AG6A 4HIHB 4O63O 5E3JA 1V3JA 3TXAA 3SDAD 4NG5A 1GGJA 1FNSL 1NBMA 3OZSA 3KFLA 3X3GL 3B78A 4AG4H 3G2MA 4Y5XB 1TQTA 4FNGA 1UPBA 2WINI 3GPLA 1GZPB 4UQBA 4G0OA 3KKLA 4NJEB 3IFLL 1XZDA 3HZKA 2H1XA 4P5SA 5SWSE 3MA9H 4PSRA 4BYMA 5IKXA 2B1QA 2F19H 4GAAA 1RWOA 2XF2A 4EHDA 3TBKA 1YNLH 2W2LD 4NULA 2OTPA 4P3CH 4FTVB 3KKOA 2YZNA 1A72A 3HLKA 3CNNA 4DKJA 4TV3A 2A1IA 3RU3A 1TEGA 2GEQA 4JVUA 3GIZH 3RUGB 2QLFA 1Z5LA 2IAMA 5TT0A 3VX1A 3QEMA 1X13A 4RBPK 3VE0A 3L6OO 2W71A 4N0FB 3GN1A 3I5UA 2PVCA 5CLZA 1IZZA 1Y1RA 2LBPA 5DZJA 2G8LA 2ZJ8A 4AXWB 4B43A 4MXVE 1DO0A 3H6GA 4NDMB 4CKYA 1YNKH 5A9TA 1BKDR 5HDBB 4IIHA 3AZUA 4DDVA 4HWUA 1JV5B 3ARTA 1IEXA 2R1WB 2PT9A 4IDQA 2A0KA 2A4KA 1W6LA 4L73A 1FDRA 4E5XA 4PSDA 3QDJE 1E4KA 2GY7B 2K8MA 2DUNA 4BK5A 4NARA 2RH4A 3WS6A 12E8H 2OYLA 1JHTA 43CAA 3CGWA 2QW8A 3GGDA 1G7PA 3DMDA 5BURA 2HCTA 4HOWA 3DTNA 3OD5A 1NBOA 3PVCA 3KXLA 3TW8A 2W81C 1NC1A 4DNOA 3D48R 4KTVE 5I76A 1VBMA 1CNEA 4H60A 5AOLA 2IPOA 3CLKA 4LG1A 3WJ7A 3VHQA 2FBOJ 1OSYA 2I7DA 3ARED 2QX6A 1E4XI 5F3DA 2Y36H 2FGWH 3LXXA 4F7PB 5DGDA 4LJLA 4MSUA 4D3DA 1A4IA 3K1DA 1RRGA 4LZNA 4E41B 1APBA 3PWJB 5IK3A 2CSPA 1ETZA 1M5UA 3SY0B 3X3HA 4D9NA 4G7RB 4ZTPL 2WVUA 2CHDA 1CC3A 5BQ7A 1ZAGA 4D2IA 1TUBA 1L9QA 5LGHH 3X3FH 1SUPA 1I1AD 3SI7A 1P1HA 3MTEA 2F9MA 3WNIA 4G80B 3DXAD 5HYQB 1MPXA 4X60A 4I55B 4CL3A 3BTUA 4HFJA 3CPUA 5FWXB 5J4MA 2OHFA 4J6EA 4PRNB 1EXNA 4R26L 1E2WA 1ROWA 2YMLA 5IN5A 1RCFA 4XCEA 3U0TA 4NQUA 1B3JA 2X4GA 3TQHA 1HXHA 4NKQB 4H2CA 5JORB 3SGJC 3CE6A 2WZ0A 2A9FA 4H8QA 4F9LC 2BVYA 1S01A 1C5CL 1K8QA 3MRDA 3GWZA 1U0SY 2UZIR 3VMMA 4UV4L 3ROOB 1J07A 1X2EA 3PZRA 3K6SB 5EPMB 4JDTL 4PREB 3GLVA 1IXZA 5DHDA 4AKQA 1JMKC 2PCPA 2BC9A 4DR3B 2C7BA 5H82A 1BQEA 2OYPA 4Z8FL 1EUQA 2EBWA 2Z3WA 2SKDA 1XWFA 3BWUF 3Q43A 2A92A 2F1BA 5GSRA 1GN9A 2ARJB 5E5MA 2F53D 1TU2A 5KS2A 4K6MA 2RBKA 3U46A 5AW3A 5K39B 4BAGA 2H47C 3EUEA 2F54B 3R4CA 4PRBA 1OPRA 4BCYA 2YVUA 4M8SA 1S96A 4U1IB 5JSZA 1J5DA 3K09C 3MOIA 3KQUA 3UTQB 4QXMA 5ETUA 2VM4A 1JYNA 4LOHA 1SQFA 1KPHA 4UFPA 4PJDE 1OI4A 2DR2A 3SZMA 4DW8A 4BQNA 2I6QA 2BCEA 5TPWL 3M4NA 1V8ZA 4ZK8A 3DRTB 5E08H 2X8AA 4C05A 2YWYA 4L75A 1QEWA 2Q76B 4HGOA 3TQIA 4OZHF 2OD7A 4OQTH 5MI0B 4M7JL 4N40A 4B82A 3S4SB 3VXUB 1G8GA 3UJCA 4LP8A 2PA0A 3KR1A 3FMGL 3NATA 4FDUA 1RSFA 3ZRCC 2QELA 5I6PA 2J8UB 5L4FA 5BQXA 4ZT3A 4JG0H 3ZHLA 4GQ9H 4HAXA 2XCUA 4ZRDA 2B1AH 1K2DB 1E69A 3H4HA 5EWJB 4WO4B 5L8KB 4QAMB 1FMJA 4ZMRA 2WFZA 4CEIB 1RHQA 4LMAA 4IGFA 4A63A 2WUDA 4BNKA 5D6CA 2F8VA 2K1MA 3GX1A 3L7YA 3MTDA 4EOWL 3NM4A 4FQQB 1IQWL 3QU5A 3RK0A 1REQB 2ROXA 5B1JC 1U2TA 1R46A 5T5FA 1JDZA 3SBQA 2QQQA 2FW9A 1H1DA 3R6TA 4YPGB 2BBTA 1I31A 1C16B 2FEAA 5HQJA 1A7OH 1UJNA 2VOEA 1FFOA 4FLHA 1DSFH 4ZZIA 4YFLI 2ZR8A 3GBNL 4RZKA 4MPJA 1Z7YA 3M4JA 2QENA 2VJAA 5E4EB 4YQXL 1L7OA 3QELB 1MB3A 3HJRA 8AT1A 3BGIA 3BRDA 1JGDB 5HMMA 3FWPA 1EUZA 1PX8A 3OG6B 5I45A 3JRXA 1NNUA 4HDKA 2CLZB 2ITFA 5DHYB 2AR7A 5IB3A 3I5YA 4EMTA 1A8PA 4KBGA 4NUQA 5T5NF 1DEHA 4DTGH 2Q3CA 5DO8A 3AEKA 3HUFA 2IOFK 1MJ7L 3RGGA 5FM8A 2Q6LA 4GOMD 1YCHA 4DA9A 3U7JA 5JQ6H 3HRHA 4P5TC 4YEDA 1OHZA 1OALA 1YJQA 2QV7A 1VERA 3WYAA 2Z30A 1U0RA 4Q14A 4U1GC 2OI9C 5SWZB 4DR4B 2V3WA 5A5EA 3D9QX 3D3QA 4L6IA 3OA2A 4I9GA 2D7MA 1JJVA 3AS1A 3VXMD 4FA6A 4YRNA 4YREA 1NBVL 4MHHI 1CO1A 2CNOA 3IFPB 2R62A 2Y3NA 1PD6A 4K5PA 4QUOA 3T3DA 3S7ZA 2A6DB 4URHA 1WISA 1EK5A 2VABB 3P2KA 2UZYA 3TYFB 3U4HA 1BAGA 3X14B 1L5QA 4OQPA 4CM8A 4U1SB 5B3JE 3V1LA 5CJ5A 4GMDA 3M6LA 2VTEA 4EAEA 4C57C 2ZOTA 1O7JA 4FOSA 4PM4A 1V8FA 4RELA 4LHUA 4RPJA 4CDGC 3CMMA 3M5WA 1I3NA 3SKXA 5BWCA 3S98A 1KARA 2EIJB 4B71A 1FZJA 3ILVA 3ZTYA 3SDXB 4LSWA 4OG2A 5LUAA 3COSA 4UM7A 3QO1B 4CL0A 1FNBA 3WQQA 2NLOA 2J1LA 3GSNL 1XZMA 3WJMB 3NDRA 5TMDA 4L0PB 2EDLA 3ZPXA 2NUPA 1QSFA 4NERA 2FB4H 2XOKA 3P73B 3BSGA 4BKTC 4NE9A 1T3TA 2AN3A 1MSPA 1FL3A 4IBWA 3PU7A 1H3NA 4M5YL 3D39E 2WHPB 3EFOA 3RYFA 2EACA 4DB2A 3KNZA 1XRRA 5JWOA 2ZX7A 3NIFB 5B64A 1K3TA 2R8ZA 2J4FA 1S7RA 1ZHBA 1KJ2H 3MXWL 1Q38A 3EVBA 4KSBA 3GTTA 5BSVA 1JPUA 1T2UA 1G6Q1 1T6XA 1UOQA 4Z49A 4OLEA 1T8YA 5JO5A 4ZI2A 5F9HA 4JV5B 2DBVO 1I1YB 1XCWA 1NFDA 1WT5C 1AD2A 2PWYA 1R50A 1EZ4A 3ROZA 4IQ0A 4Z7WF 2I7XA 5LQMA 4H31A 3WKML 4DP9X 1XMOB 2O0KA 4AV0A 4DUPA 4I4IA 4X6DF 2Z31C 3D6FA 3TO4C 2WD0A 1KMHA 4MIEA 2CBTA 4JKPL 3S3PA 1RHMA 1H5QA 4GQAA 4RX4D 4MJLA 4PCAA 1IFHL 4KXZH 3I02B 5ECDA 4WKPA 1YVEI 2GC7C 4NEHB 3V9CA 4AMGA 3VR3D 4QIHA 5A03A 2A74A 2BOCA 3QIUA 4E5PA 1K5HA 3OLGA 1BRTA 4ETQA 2O3QA 3KYBA 4B9ZA 1S7QB 4NIMA 3G6JF 1OCCB 1BEZA 1E4WL 4G1FA 1NF9A 4JQXC 2C2OA 1U3JA 4YCNA 2IFGA 1Z08A 3MCZA 4XDHA 1X8JA 4J0FA 1KK3A 3VXTA 5JAOA 2FFQA 1PD1A 1P5UB 3ZQXA 1QBBA 1DL5A 3U7AA 3NJNA 2QLTA 3GD5A 3GO4A 3W2TA 5HI3C 2P80D 3ZWOA 4A1FA 4JI2B 1P39A 4PJEB 2G83A 3O4RA 4XWAA 1VKHA 4F9LA 1X5YA 2GJZB 4LLWB 4WGWB 4MRSA 2ZWLT 1E1QD 1TCMA 2AXGA 1KIAA 1IB5A 3N2YA 1T3FA 2SODB 2O5EA 3HHSA 2CDEA 4IBLT 1R6AA 1VGEH 2ITCA 2NYZA 3NQKA 3OKNB 5ENVA 3PQ2A 4AJNA 1XEAA 3A9VA 1IKFL 1X1CA 1JL8A 3R7LA 4D0DB 3HRZC 4ND7A 4EF5A 4YDLC 4GE0A 5CT4A 1A7RH 5K0ZA 5AWNL 3D3NA 4I46A 1H3UA 3J81k 1V7NH 5CXXA 2Q5FA 3VDQA 1YV9A 5IT0A 4Q3CA 5FTJA 4PP2A 4DV6B 5JIKA 4JLWA 4YJGA 3GUUA 3GEGA 3N0PB 4E6EA 5AVVB 1F8XA 1S9DA 4FQLL 4APXA 3I9LA 2WHRA 2GK4A 5BO1L 2E2WA 3M4ZA 4A6YL 3QIBB 4PHZA 5L3SB 4LRIC 1RVFL 3AH8A 1YCFA 2CKBL 1W72L 2OULB 4MWDA 4PC7A 1UBRS 1UIMA 1IC4H 2QVIA 1Z38A 3DL7A 2QSTA 4KK9D 1YIOA 4YHOH 4ZVRA 2CMRH 4Y1TA 4JRLA 5ICZB 4GBMA 1U6JA 1CFSB 3ZBUA 4HJSA 1C9MA 4RIFA 1Z0IA 4MI9A 3LO5A 2YAEA 5HE9A 4MRRA 3VXQA 3T52A 4PRAB 2EW2A 4QHNB 4KROB 4MYRA 5MN4A 3KLQA 4NO3B 5DBGA 4AICA 1NDGA 1U91B 4TL8A 1GRWA 1QOZA 2UXBB 5E2WH 3KX2A 3W5BA 3K16A 4RO0A 1SKBA 3RHWK 5EYPA 2DQTH 4MAYC 2GAZB 1NM9A 2NZ2A 4LSSL 2R4TA 3IJYA 4M3JA 4KQ4L 4XGZB 2BZ1A 5C1BA 4Q58C 1LPMA 2DHEA 1EFUA 5K03A 1TZGL 1NNEA 4JJ5B 4QRRA 4YRBA 2V6JA 3HADA 3DXAE 3LI2A 2HCZX 4QDXA 3D09A 1E7WA 4I9WD 2DM2A 1EGJH 1OTSC 4P38A 5JDSB 2HRQA 2H2AA 4RNDB 4F06A 4LECA 4BZQA 4AECA 1K9TA 4B17A 1BMTA 1PTZA 1OAKA 4TYPA 1XXDC 4R2XA 1SOAA 2H1RA 4EG0A 1JU4A 4X9FA 1TQDA 5CA1F 1CULC 1VLXA 3QMVA 5IEKB 4BGIA 5I9BA 1PGPA 3GZTB 3R1GH 4B96A 1U3UA 1CR9L 2XZAH 1EGVB 1V16A 2HJSA 3BCHA 3AFHA 3TEJA 1R0CA 2Q8AH 1MY5A 2R8SH 3QDJA 4JGBA 3AJ9A 3KJHA 3L3KB 1UKCA 2UX7A 2UYLB 2Q45A 3ZKWB 1DQZA 1E32A 5JY6A 1NZJA 1PSDA 2QPDB 2F9BT 2I3AA 3KS0H 4KO3S 3EYFB 3DSNB 2J5XA 4UEOA 2F53E 3QVJA 4L9LC 1BDYA 4EYSA 4OLXH 2DAVA 4BHTA 3MRCB 2XMDA 3HCNA 2VZ1A 1C5BH 4M1CD 3HCEA 2NXZC 3RFZA 2O8FB 1LJUA 1D6EB 4HH4A 1QH8A 1DBKH 2ZWNA 2B0JA 3I8XA 3AGVA 2WVSA 2WB2A 4MRPA 4PRHB 1UPCA 2XT0A 4P5TA 3IVXA 1IIKA 4A68A 4BFIA 2IWKA 5AM5A 5KJEA 1XIWA 1ET5A 1GLNA 4HWPA 5IABA 3DUHA 2OFXA 2HX8A 1ZOSA 3ULUC 1M7IB 4J28A 1WTCA 3CKLA 2EIMB 1ECFA 3ONNA 4X1KB 3QUKB 3OC8A 1ADWA 2ALWA 3MTJA 2AJUH 1WBZB 2BONA 5FHBH 4QKTA 32C2A 3ANNA 2IF7A 4EBFA 1KEZA 4K03A 3L3HB 5H37G 5D7JD 2VMEA 4L4SA 1FXWF 4NH0A 3DMMB 1DC7A 4IW3B 3W05A 2XBMA 2KBEA 3WTYA 4R9SA 2PH3A 4JLRA 5JC8A 1ODJA 4KPGA 4CT4B 4FF9A 5KNCA 3K92A 1O4VA 4RTMA 5HHOD 2IYVA 1TL7C 3LPOA 4P5RA 4N9QA 4EBBA 1T0MA 1MB4A 5J3HC 2GTZB 4LVNB 2MWMA 4HNHA 1ONQA 3GK8H 3LEYH 1POWA 5C0JA 3UK0A 2IF0A 3FA2A 4ZQCB 2Z35B 3ZKMC 4EL0A 1OZTG 1QNZL 4DGVH 3NIGE 1D2AA 3OE4A 4G8DA 3N3AC 2PS1A 4Q3OA 2CWDA 1ONSA 3HS3A 4MNGA 1BG6A 4G9DB 5CFHA 1MEJA 5MP6L 1VJSA 5MERA 5T3ZH 1XIVA 5JALA 3C48A 3TQQA 4TQEL 1ZU5A 5KTKA 2OV2A 1W36D 4P36A 3G8AA 5FYJD 2F1EA 3EH5B 3VPGA 3KXFA 5EUCA 1KGWA 1RMYA 2TSYB 3TG8A 4WSOA 3K0CC 2R86A 3HG0A 2VDWB 4AWAA 4UEQA 1Q1NA 1N25A 3DBXB 3FW6A 4QNNA 4CR8A 5FBHA 3CLEH 4GXUN 2BM0A 1PGNA 4A7PA 4AW4A 5H3CA 2I7OA 4PJAF 1CFTA 3L7DA 3L4JA 1KDTA 2ZR9A 1WZAA 1OKEA 5D8JL 1PDOA 3TO4A 3L8ZA 3WLRA 4XM2A 4LQLA 4LKXA 4DIBA 4U1LB 5T67A 5JJKA 2JS7A 4KRYA 4CCWA 1FFAA 5AHOA 2FW7A 4WRLA 3VXME 5A62A 3FOMA 5HGHB 4FNSA 3CLUD 3RAJA 4C7MA 4HAVA 5JZ9A 2Z4TA 1YS1X 5K4GA 3O8OB 2BFEB 3DJFA 2ZXDA 4GS7C 3P4NA 3HMXA 2FAUA 5B39G 1L7TL 2RB5A 4KO2S 3P77A 1L4IA 2QY9A 3J07A 2VNJA 3MRFA 5LBSA 1K72A 1OJ7A 2OJZH 1D09A 3RZCA 4BO5A 1U30A 4IIVA 1B2RA 4JGUA 3QUXC 5DHPA 4C7OA 4KMMA 1WXGA 3RL1B 4RY8A 1YQWA 4IOFD 3T5TA 3V9AA 2GO7A 4WKBA 4G6ZA 3Q3HA 2WFLA 1R33A 3JD4A 3NNDA 4YP0A 1FGVH 4P46B 5L6LB 2DT5A 3QH3A 4QAJA 3JZ7A 4J3UA 4YK4B 1KCUL 1JHAA 1KJ2B 1EEZB 3WGHA 4HDCA 1ESCA 4TVKA 5ALLA 4AMYA 3EE6A 2AW5A 1Y5MA 4KQGA 1JDTA 5IM4A 4RTPA 2DWSA 5TX7A 4OCWH 3J7HA 4WSKA 2D59A 1Q1JH 1JFTA 5F97E 3WRXC 5D1ZB 1OB2A 1ND0A 4DDKA 1X7ZB 5IT4A 1LEGB 3RQIA 3BQUC 3ZDYB 1XT6A 5DX1A 1TDJA 4E11A 3UG6A 4W8HA 2YLHA 3OZGA 3SK0A 3S2YA 2VJMB 2BSTA 2QGCA 1GXSB 1YUNA 2C07A 3EGOA 3I6MA 3VA7A 4MWEA 3QG7L 4AXXA 3ROLB 4F15B 2C9AA 1PZMA 2ERJB 3MRBA 2AITA 4HTFB 2L7EA 3H5WA 1J7KA 3TIFA 1MFDH 1SK9A 2FN7A 5JR1H 3E1ZA 3DZDA 3KALA 3O8DA 3SZKC 2X0JA 3GSVB 4G01B 3WLJA 2HTLD 2FG7C 3QPKA 4NWUH 1UM6L 5BRZA 5FYLH 1O0SA 1IL1A 2D0GA 5JAQA 4P31A 4QDKA 1KIQB 1WEJH 5CA0F 2DZEA 2FTKE 1C1EL 1GNRA 2A7QA 1HZZA 5FOTA 4XZ3A 3K5IA 1P1ZA 4TM9A 3VNSA 4K8RH 1U1CA 2E7HA 3WGGA 3ULAB 3HI6A 1YVPA 3MBWA 1ZRMA 1IZKA 1SQGA 1IFGA 2W5PA 3MODL 3IXQA 2YBEA 1GOHA 2R7AA 5JTWA 3CV3A 5KPJA 3ULVC 2W9DH 1YB4A 1Z9SB 4PRID 4Z77A 4N0MA 4DSAA 4XPAL 2PL5A 3Q41A 1DT5A 2I9TB 4HWEH 4G0WA 4KHPB 1DBML 4IIJB 4DKTA 3SC4A 2QJTA 3SDCA 1S3IA 3JQRA 3PAYA 4BVKA 2GMWA 3FN0H 2NU7B 2RB8A 3BZFB 1WB6A 4EKXA 3SKMA 4KSYA 2IUYA 1Q74A 1YB2A 2LFGA 1DZ0A 5H1YA 4AMBA 5B57C 3T6XA 5E7FA 3SYRA 3LIZH 2WVGA 4QXUH 1GAWA 1QZ1A 1OTHA 3EASA 4FQ7A 5CEEA 2XPYA 4PB0L 4DZTA 3OR6A 2GARA 3RVXC 2FO8A 2G08A 5DX0A 3FSEA 4P7FA 4Z7NE 1VFOA 3MLBA 2AE1A 4Q1BA 5IULC 5EQDA 1RP1A 3FCTA 4G42A 4ACAA 3TWOA 4K71B 1KI6B 1VZ2A 1Y6ZA 5CK4A 1DBJL 1YA4A 3DYOA 5HRCA 3KDMA 4I8DA 1GSMA 4ZXPA 4DA6A 3WSQL 3OIFA 1KI8A 2IY7A 1J0ZA 3BWVA 1YOVB 5FUWA 3CW8X 2BUAA 5ADUS 3K6NA 2DPHA 4UW9A 1JZDC 1B0PA 1SUDA 2Y6VA 3AY2A 2GWHA 1SVZA 4CBZA 3I5MA 3J7TA 5FXCH 4UUQA 4JFDD 4UAJA 5E6UA 5L0QC 5HTSA 4C7XA 3KHSA 1GY8A 4RJIA 4ISVB 3U9UB 4JBGA 2QVLA 1J9TA 3G9UA 5JDIA 2P75A 4FEYA 4RF2A 5IBPA 4J3XA 3TEMA 1L9NA 3QZBA 1EVIA 4L0ZA 2R56H 4NMMA 5D7LB 1CGXA 3IE0A 2H5UA 5KYWB 3S3BB 1H5NA 3CCHA 5KTRA 1ZUNA 1JV2A 6ABPA 1G7JA 2X1WL 1RUMH 3ZBTA 3NZHL 3RU2A 1CG6A 3FQTB 1DUYA 1XMPA 2J7KA 1AIZA 3JQBA 3N59A 3R8XA 3WMXA 4A2GA 2GKOA 3BZ4A 2WSMA 3ZGHA 1QAQA 5DF0A 3LZQA 3Q98A 3BFWA 3U9TA 2OE2A 2B7DT 4MKFA 1GZHA 3GMIA 1T6YA 4D42A 3RC1A 4KUZH 1KWGA 4KXUA 3MHTA 4NT6A 3U3DA 5H94A 2H2HA 2K7PA 4L18A 4BQPA 1BGVA 3N7UA 5D7HA 4GQQA 1MJ5A 4I9WE 5B3NA 3FQNB 1HDMB 5DP1A 3BKMH 2DN7A 2Z0BA 3WLBA 1JE6A 1W52X 3EMDA 3ESCA 2NQ3A 2Q6WA 1DS6A 4DPBX 3PQ3A 1MCEA 4ENTA 1QO7A 5AKIA 3WIHL 1NCBH 1PFKA 1QHNA 4X98A 3PFWO 3LL7A 1K27A 3W5CA 5B1CA 2WQUA 4BAZA 3C6QA 3NHAA 2ZRNA 2QN3A 4IRJA 4R98A 2C9XA 3W9DB 1P5HA 3T2NL 7FABL 3AADB 3F7QA 1BD3A 3ACBA 1ZJJA 3NUGA 1D2GA 1N1EA 1TMKA 4WNJA 2A9DA 4Y5VC 1U8OB 4ND6A 2D2VA 3IFNH 3L5WA 3WYNA 1W4ZA 3UAYA 1YIDA 3TWCL 3GRKA 1I2MA 2J0QA 4C22A 3CRNA 3R9KA 3FFTA 5J5CA 2BINA 4UNSA 5DT1H 3AWIA 1PDVA 4MJJA 2AFRA 3LV3A 4P23A 4J0EA 2QV0A 4DG8A 4PS4H 3EW7A 2YJLA 3TBFA 5BOPA 3VRLE 4P4NA 3UA4A 2EJCA 4Q1FA 4ANVA 3BO8A 1J86A 1FV1A 3GLHB 3WVNA 3Q0HA 2EJVA 2UDPA 3EYQD 4N20A 3RWEB 3L9RB 5BN3A 1HQRB 4RXTA 5B6IA 3K0SA 2G60L 1V55B 1CL7L 2KB0A 4P9ML 2P26A 4QPPA 1LI7A 5HHVL 3NG5A 1PR2A 5JYMA 1MEOA 4XQEA 5HYFA 2FLRT 1JSZA 4Z3EA 3MRSA 4OAQA 2V97A 2BVQA 5BQFA 2YYYA 5DZVA 3AEQA 3FULA 5AZ2L 2ANCA 5FNZA 4QGTA 1YN7B 3FU5A 4UBNA 3GZQA 4AL8C 2VQFB 2VJ0A 1J8KA 5L2KA 4MARA 1I5RA 1ZOOA 1UJ2A 2VH2A 3F65A 4LVOA 1CDDA 3ABKB 4F2ME 5JHDB 4YCBA 2R2BA 5GGUB 4IKEA 1BRMA 3EH2A 4KDWA 1JGUH 2QGDA 3MRMA 4J3SA 1L5GA 3PJGA 4I77L 2O48X 3LU1A 1J10A 4WUKH 4OD1L 3WIOA 3O4OB 1OX4A 1U9JA 3KE8A 5C0CA 1I7UA 4AW7A 3PFQA 1SXJC 1R5BA 2XXCB 3BCUA 4MUEA 5CCHE 5JPMC 4R4BB 3P9IA 4BNUA 4OVVA 3PFFA 2O72A 4PHCA 3TZ6A 3V7WA 9ABPA 4I7ZC 1FTSA 1WU7A 1TFPA 2JAWA 3FSAA 1J9ZA 2IUEA 4F4CA 4C0HA 2CK3D 1ZD4A 1H6EA 2O8EB 5EN2A 2JMRA 2HIAA 3V6ZA 3K2EA 3OXSA 2WLNA 2BGWA 2Q7DA 3V2UA 3QENA 5D6DA 5LG6A 5CPBA 3ZLBA 3A9WA 5FYJE 2IV9A 4TOIA 4O00A 1ORSB 3F3SA 2YXBA 1P1BA 4LF6B 2ZSBA 3O7WA 1C8VB 5IQLA 2C29D 1JBKA 3EGWA 4QGSA 3R3JA 2VNSA 4L22A 4XXWA 1QQTA 4L5AA 3MXTA 3V95A 2VAMA 3C6BA 4R8RA 1W8EA 4BEVA 3ZO0A 4CNQA 5HUQA 5JLZB 3DLBA 4O4YH 2H11A 1KC3A 3CRRA 4GVXA 2ATEA 2DTMH 3SPGA 3UYLA 4JQCA 4X63A 2R9HD 1CLZL 5CHNB 2EBFX 2Z3ZA 5B38A 1YRLA 1SCQA 3K0WA 3E22A 4DR2B 1GA2A 5G4NA 3PXEA 3U39A 1P7BA 5IVXE 1K5DA 2Q86A 2J56A 4PPQA 2PW2B 1Y0LB 3PGCB 2DWQA 4FHBD 1KG0B 5BW6B 2CZCA 3BFVA 3RRZA 2HN7A 2PS0A 4WJKB 4QBKA 4MHOA 4EECA 3I4FA 2HRZA 2FATL 1VSUA 3CEAA 4F7CB 4DN4L 1Z6YA 1GSKA 1KTCA 1N1DA 2B5WA 5DEJA 1N5AB 1H94A 1W7AA 5BQDA 2NPOA 4ANWA 3AJRA 4WESA 4IFTA 3WLPA 4XNUL 5IMLA 1H5BB 1T21B 2ADIA 4ZJPA 4P2OA 1JPJA 4JS7A 4S1PA 3S2UA 2N01B 5E8EA 4O4IA 1LE5A 2JJMA 1BP3B 4Q7LA 3VI4A 3ARUA 2QADD 3NHZA 4FQ2L 5A06A 1NOAA 3GBMH 4BMPB 3C4QA 4ATNA 4KCGA 4CGUB 1JHXA 2AN1A 1B2WL 1ZHHA 2QZPA 1I6WA 2BI7A 1NMAL 1Q91A 3JASA 4PJGB 4YS4A 1WHSB 2QN8A 1QFPA 4GC5A 1H0HA 2AFHE 5C6PB 1DANT 1U90A 4XRGA 4EI5A 4JDPA 2B14A 3OIVA 2OMBA 2W94A 1BGXL 3TF4A 2F74A 4CM5A 2BP0B 4OFVA 4IRUB 1OV6A 5D3MA 4O2BB 2AYZA 1Z18A 4RDQG 1E6OL 5DI8A 2H9GA 1I9CA 3DMNA 1KZ9A 1EXMA 2P6PA 4C76A 1E2DA 1ST3A 5F9WC 1P6UA 3KPPB 3ZG6A 3NBQA 1ZW6A 4CF7A 1D0SA 2G7MC 1ERNA 4IMRA 4N5UA 1FLVA 4FCTA 3DTUB 2QKIB 1LKZA 1WAAA 4NB7A 2G0TA 3D2BA 4MVJG 3A27A 4E5UA 1T7VA 2PVSA 1U8IB 5DURD 3G04B 1CF8L 2G17A 1BVKA 1YJBA 2ZX6A 1FDVA 4F8OA 1B76A 4K8RB 3WJLC 5FUCC 2Y1DA 1TQBC 3QYFA 3T3EA 3KXPA 4YMWA 2RGXA 4AEFA 3SHFA 2HKHL 1KO1A 3EZFA 1TYZA 1H42A 1MDAA 1KIRB 4ZZKA 4AYEC 3BQVA 2NT3A 4OX9B 2C0CA 3OY7A 3RIGA 4G7YL 1KLFB 3F62A 4RACA 1FF9A 1NLZA 4EHKA 2ZE6A 3CUWA 3KO8A 3HO6A 4ND8B 10MHA 3PDCA 4Z7QE 1JG6A 4PRIE 4OMUA 1HFWA 5AQEA 4AIIA 1MD9A 1Y9JA 2ZYAA 2V17H 3D6HA 2LV8A 3CXDH 5EEVA 2NP7A 4HHGA 3ROEA 1V7CA 5IIEB 1Q21A 1Z47A 1NANH 3QAZC 3N42F 3AILA 1KCRL 4C0KA 5AVZB 5CVDA 3I52A 3T15A 3G0IA 3I50H 4UQCA 4CF6A 2CRIA 4Y1AB 3FTDA 2ODAA 1FNSA 3O5AA 3WL6A 4JUFA 3SGKC 4PRPA 2VJXA 1NBMD 5E23A 5I1HH 1HJCA 3ZE1B 4RFOL 2LGNA 2HLPA 5KVSA 2Z09A 4LARH 4HBZA 4CQMA 1RKXA 1NVKA 2FSGA 3ARZA 4I13B 3REFA 4KC3B 4Y5VA 1E2ZA 1H8NA 4P2QA 1SXQA 2A5LA 3B3GA 1MCKA 4UMEA 1YS6A 3SJBA 5FGCB 3DLHA 1OSZB 2Y9MB 3NGBC 3QG1A 1WBBA 5BSRA 1EAQA 4Q7QA 1XWIA 3D33A 1PQ4A 4RULA 3OQRA 5F3HA 4DMHA 1YN6A 1OA1A 5FA4B 1F8TH 3ZI4A 5E0QA 1M67A 1GZ4A 1UWXK 4JFDE 3PNMA 3BL5A 1NKSA 3QZWB 2JELL 1K4CB 1RJZA 1E9PA 1AXSA 4DGWC 2KI5A 3HXOA 4MXVF 3SF8B 2ZOLB 3QUYC 2NAPA 2REBA 4KK6C 3KD2A 4ES6A 2DQSA 2XCLA 4KKPA 3KTFA 2IAMD 2EDCA 5FA6A 2WTXA 3OOYA 2G67A 2VZSA 3BK2A 4TSAH 4M61B 3SCMB 1MFBH 1N8ZA 2ZSWA 1CUVA 1QP4A 4TMPA 1OYWA 3MJGX 2FW6A 4RABA 4X99A 3HYSA 3WA6A 2QL7A 4MEBA 5T4EA 5DWUH 1MRCH 3C6MA 5DMJB 5H16A 4PR3A 2PX8A 1Z37A 3SJUA 2VLMD 3UYKA 4U7JA 4KTDH 4UBKA 2WKRA 2OO5A 4TSBH 1TT5A 3QWOB 2BVPA 4YT5A 5AHWA 1Z2OX 4M6WA 1F3OA 3CVCA 3KPNA 1BIHA 2VXSL 1FU7A 4KTGA 4JHBA 5D5ME 1WQ1R 5ALPA 1SJXA 1E79A 3S35H 2IOOA 3SG0A 5K59E 1CZ8L 3KE9A 4LDPA 4BNGA 1UC5B 3AIOA 1T4CA 3GI8H 3JAMA 4XVSH 1BWWA 3VMOA 4D0GA 1C1YA 2QTVB 2ZOOA 4ELKA 2ZONA 1RWQA 3AVEA 4NC9A 4YXWA 2NOAA 3FTWA 2PSEA 2JHFA 4MI1A 1SY7A 2OWDA 4PJ5B 3H9GA 2C82A 2CM6A 3TBWA 3RY5A 1NJ5A 2IEPA 4HXAH 4FONA 5HI4C 4E33A 3FONB 3HWX1 3NCWA 4P58A 2NY2D 2PUFA 1KFJB 2VR1A 1CD9B 2CFIA 3KR0A 5FH9A 3C60C 1MXGA 2QR5A 4GKVA 4G25A 5CP7A 1QR1B 3ACCA 4HKBB 1GHTA 1JHYA 3DI3B 3C98A 3R9WA 3I6BA 4XYMA 4U0RB 5EJ4A 1CDIA 3JQGB 4FBLA 4OVUA 5SZKB 1W6UA 4U1JA 1Z2DA 2QZ5A 4IDLA 3O26A 1QLFB 3DX7A 2ADYA 2PSJA 4M7OA 4A2QA 1ZPDA 821PA 4ZMXA 4FFSA 5ESRA 4MXQC 1IONA 5BRNA 4DCTA 1Z6XA 3TRDA 4ZUTA 3EOTH 5EE9A 5CB8A 3WBKA 2AEPH 4HMPA 2QTEA 2VH5H 1RBMA 4NVRA 2AEMA 3EO0A 4PJDF 4A8TA 5AYQA 2X4SA 3A6LA 4APQA 5KN5A 1G38A 2JFQA 2WA2A 4N0EA 1GA1A 4OK5A 1QO9A 1NXTA 3TZLA 4HJEA 1R4ZA 4J1QA 1E2MA 4KHZA 1T03L 1KLGA 4IHJA 4QHPA 4PIMA 4JLOA 4QUKA 3D8RA 4QEZA 1U8NA 2OBNA 2BMWA 1DSWA 2IEGA 5TPWA 3N6RA 1OMOA 1NBYA 5DMKA 3HWWA 3KKZA 3V7MA 2OXGA 3OHSX 5LMNB 1E1YA 3P2IA 1YEGL 3DVAB 5KVQA 4U2KA 2QUJA 3II3A 4W9JC 4QRQB 3ZJTA 3KEQA 5DFAA 1Z6JT 1G8JA 4XVRA 3UTZB 1HHGB 3R6LA 4HS3A 2NXYC 3KOYA 3FMGA 1A2BA 3ECSA 2Q2QA 3IKCA 4PC6A 2WSIA 1EHNA 4HKJB 4I5IA 4ONOA 4XB7A 2WAHA 3H5VA 3RIYA 3KH3A 4WLVA 5JAHA 3ZJUA 1I4LD 3KLHC 2YMXH 2ZOKA 1GEGA 2I2XB 5D6OA 1DVYA 1C7FA 1AMYA 3G5UA 3IJEA 1R5IB 1M0EA 4DSNA 4UE2A 5AW2B 3K0FB 3MU3A 3M70A 5DOVA 1FMCA 3DGCR 4PJ9B 2OM2A 5H2BA 3DZ8A 1MWOA 4JO1H 4AEIL 4QWMA 5B1BB 2A5YB 5TQ2L 3IPBA 2HCRA 1WFIA 1U2ZA 3CJTA 5G4LA 3OAUL 1W19A 4JL6A 1JI0A 4S10A 4A9AA 4NXSA 3RD5A 3P3UA 4CG0A 3CZAA 3K8OE 4UBMA 1GRQA 2ZSJA 1JNHB 4EOGA 5KMGA 4ILEA 2AD1A 4JP3A 1CY0A 2IOFA 3V7AE 4X91A 1UM9B 2VZOA 3HBZA 5SZHB 2NY6D 4ECEA 4JREC 4YP9A 2ROYA 5CJXC 3KNBB 1WP6A 5B22A 1GQOA 1AGYA 1DDGA 4UOJA 3CMGA 2VPWA 1LO0H 4OIFA 2DLDA 3GJEA 4Q9RL 3S2AA 1GVNB 2HFKA 3GJ6A 1A5ZA 1LP9E 4Q56A 4XMKL 1G9HA 1AXEA 2UYQA 3IAM1 4RSVA 2DR0A 5K6TA 4PBSA 3M3HA 2F3RA 5B3JF 3QE4A 4ERSH 4BUHA 3U44B 1MNUH 2AFVA 3LQAH 1PR0A 1CW2B 4RPGA 2J1WA 4H8WC 4XGRA 4GRLA 4C83B 1PSKH 1TCRB 4LF5B 1YXMA 3MA0A 4F0JA 1MT0A 1P4LB 3DE6X 3D6MA 2OV6A 4BCBA 1W85B 1WDWB 3R7NA 4I6EA 5B3AA 4NHUB 3ZVNA 4Z9KB 4LFAB 3QF4A 4ZS6D 1ZLSH 4PJCF 2ZKWA 1AMUA 3QFHA 4LLUB 4OB5L 5FO1A 4DYDA 5FA8A 4AYWA 1A9RA 2CO6B 2MRYA 3HC0A 4LHUD 3PQYA 1VE3A 3G0BA 1QWUA 5G4OA 3H7AA 3QPWA 3L5XH 4H5SA 4GP7A 1PN3A 2CF5A 2ZCLL 5K3FA 3ZL4L 4YHYC 4AOFA 1QLEB 3GSNA 3QUYA 4RZSA 5F88A 4QE3A 4JHWL 2WOOA 4IEEA 4ZOBA 2O2ZA 3KPSB 4UVHA 1H2RS 3DM5A 4ZI3A 2RHHA 4MW4A 3EOYG 3SN6A 1QSFD 2XOKD 5CR9A 3HCVB 4HAOA 4JPQA 4RESB 3W90A 3U1BA 4J12A 4AJ4A 2Z7WA 2X5XA 3AXHA 3QRGL 1IAIL 4U8GA 3L1GA 1TEXA 5J4YA 3CIQA 4U2ZA 1WSST 5DJ8B 1HM5A 3M9XA 1PIGA 3PGFL 3JYQA 3EBLA 4RDHA 2DLFL 2WQSA 1B3IA 2P7TB 2OTCA 1CEEA 3ASNB 4FNQA 3OFSA 2C3XA 4RV5A 3VD0A 5JY1A 2H3NB 2WWKO 2R0ZH 4DEYA 5FUYA 4JB8A 2FMTA 1JNNL 4BWGA 3FRPB 3H3PL 2IAAC 1Z5UA 3U62A 2BGGA 4JUSA 2V7GA 1V1MA 2Y4NA 1I51A 2G1JA 1W88A 5BVGB 1UPAA 3QBTB 1KEEB 3URMA 5JCOA 4AW9A 1MDBA 2M1XA 3T1WA 3FOCA 5G3ZA 4IV8A 1BZOA 1CE6B 1E2QA 3N3EA 1AZVA 3WQHA 1F3JB 3D85B 4UCWA 4RJ2A 5LQCA 4TTRA 3JT0A 1CR2A 4JDZB 3SDDB 3WP0A 4RMWA 2II6A 3U3JA 1LDGA 4P9HC 4UOW0 2PH1A 1BEEA 3JWNG 2CL5A 2IU3A 3OPXA 1K4YA 2VEOA 3AUFA 5TQ0H 2QI9F 2BFMA 4AKSA 3WZMA 5LOVF 2AK4B 2LTAA 4DG9A 1A6AA 2VYCA 3UMFA 3QIUD 4U6YB 3LRMA 3ESMA 3OAWA 2YFHA 1BFVL 1GTVA 2FPUA 4Z1MA 5LWHA 3LKSB 3Q6GL 1ABFA 5F4BA 2ZYUX 4GX2A 2I3GA 2VRBA 1ODSA 4KH2A 3RYCA 1DAMA 4IJMA 3RTLA 2IXQA 1SOKA 3KWLA 1OE2A 4MJ6A 4YHIA 3E4CA 3AOEC 3NX4A 2ZYIA 2ICEB 3CVHL 3P9CA 1HT1E 4NRYB 4QXVA 5CEYA 1JPTL 3S0PA 1RZGA 2R1VB 4RZQA 3MO1A 1BAFL 2RFXA 3HJCA 3P11L 1KO4A 2GX6A 4ORGA 3UZEC 5AW1A 4ODHH 2TSBA 4HZUA 1G59A 2W93A 1JWLA 1S8OA 3GZ4A 3AP3A 2FMIA 2VN5A 5IYZA 5LAXA 3D8HA 1NXSA 3MDJA 1LSOA 2C1OB 3E9ZA 3Q2KA 5HK8A 3MTXA 4X80H 5DM1A 1SYSB 4LHQB 2VLME 4FERA 1BZQK 1GKOA 3A6HA 3QX7A 4A6YA 2CDNA 3PD7A 3HI5H 2D2XA 4LSRL 3R40A 3SMVA 3L1JA 4FHKA 2V6GA 5C7ZA 2OAGA 2CKBA 5DC9B 3F9CA 1F7VA 1W72A 5C7IO 4PY7B 4ML3A 4OQYA 3DGFC 1X0XA 2NLJB 1L4BA 4OKSA 1I8MA 3HXLA 3FF1A 1DEXA 3M1OA 4UT6L 4UQ2B 5CHEA 3FQXA 4TL7A 3FUEA 3P2TA 4WKXA 5LXTA 2VR5A 5SICE 3R4VA 1ZWIB 1HNNA 3OPYB 4KQIA 4DO4A 2XMRA 3U3ZA 2OL3L 2WHVA 2R65A 4AMKL 5TIIA 3QORD 1BMZA 4EKIA 4WGVB 1UP7A 4GFDA 4GG1A 1EFLA 1HLGA 5IKEA 4W70A 4XVUC 1K5GA 1T0NA 5TE7H 4TS4A 5C7LO 4OFZA 2HDHA 4KJQD 2QRQA 2OYMA 5L4MA 4BMYA 3SYOA 4QRRD 1FA4A 3CONA 5A3JA 2F59A 2V0AA 3IAPA 2F90A 4CHGA 1Y1KE 4TQUS 2C4KA 5GZNA 3T0EB 1O6TA 1XYYA 4QUHA 2I6UA 2Y06H 5HVHC 2VIIA 4QXWA 4DJEC 3OJOA 4DGUA 2ADGB 1A21A 4LCBA 3IBGA 2GAJA 5EIHA 4PFSA 2PJRA 4DNLA 1CY2A 2CWWA 2P6MA 2OAEA 4K0RA 4L29B 4WBNF 1TMGE 2E9SA 5HHNA 1JA0A 3KQHA 3NT5A 3D4ZA 2E1RA 2P2SA 3M6AA 2A9OA 5EMNA 3QDJD 2WXGA 2KLHA 1IJNA 4I4WB 2WVVB 2COUA 3HCPA 2AW3A 2GTPA 3T7IA 1IGIL 3HOGA 2OKCA 4ABTA 4HX1B 3MRJA 3MLXH 2RD2A 4LSZA 3ZZUA 4YRKA 2YY5A 4KWIA 5JH7F 1MGPA 5EZOL 2J3LA 5KVGL 1LBIA 1M2WA 1RNLA 2JK0A 3VD4A 3IQXA 4HLDA 2ZROA 5KO2A 1L7RA 3UT5A 5BPHA 5CJXA 4UUBA 1QFWL 4LRQA 5E3HA 1C4WA 3SGDI 1Y07A 3ES9A 2PTVA 2D7QA 5BT8A 3HLAB 4DFDA 3FFXA 2GM5A 4YLGA 2QIPA 5DVPA 1DUIA 1PWYE 1SC3A 4YMSA 3OEHA 3AQYA 2ZIZA 1XIWD 2JGAA 4EHBA 1OAJA 3G2LA 3VR1A 3ILSA 3H0TA 1QV7A 4NWTL 1OF0A 3UFIA 1BVLA 3WZLA 2VCOA 4KY1H 4FYKA 5CLLA 1MC5A 4I9UA 1TZAA 3OB8A 3B5IA 5AOBA 4U0KA 5LJYH 1UDRA 1DX6A 1QACA 1SHJA 1R3IL 3IUMA 3ABMB 3AVVA 4OI1A 2EWWA 3K91A 4D9CA 1J0BA 1LBEA 1UKAA 4B3FX 4J7AA 4CKZA 2BEWA 5ADHA 3B9EA 3LBFA 4L4TA 1DIAA 3NIGF 3BIKA 3LAWA 4BCDA 1FL9A 4MITA 1XQVA 3S29A 5KNCD 2DQDH 3MSCA 4DVJA 5DMHA 5LMCA 5A1AA 1RFGE 1WX1A 3ETLA 4MP3A 5BYJA 4OFPA 1XE3A 4JG9A 4P5KA 4KZEL 3PXGA 2BFBA 2P24A 4YPJA 4HMOA 5IMOB 1J8SA 3BPCA 4PU2A 5DCYA 2ODBA 3H4IA 2JVJA 4Z2YA 3L0DA 3UT0A 4C8XA 4PGAA 1DEDA 5DK2B 2V8LA 3X0DA 1X9HA 4LOUD 4A6EA 3HI1B 3DE5X 1XD1A 3HLYA 1KPRB 4JFFB 4A39A 2ZAHA 3KXFD 3MAWA 4ZXBA 3FT3B 3CO5A 3OZFA 4NENB 4GRWH 2CO4A 5JNUA 2JJTC 3VAEA 5I18L 1FNEB 1KTKE 5TTRA 5BSFA 3P5BA 3ZTEA 4R01A 2PX2A 2W2TA 3AHGA 2B1HL 1DTSA 2OUIA 4IOMA 3EYVA 4K9MA 4U2DA 5KVFE 3T4EA 3C7DB 3WGYA 4NCIA 1T5LA 2B08A 4ZDHB 1T5WB 4WQOA 2NPFA 3TO4D 4BLOA 5HP4A 4D94A 4LOKA 3IDAA 4DLTA 1V5FA 4AC4A 1TRHA 1L5NA 1U7UA 4PX2A 5E4YA 1FPTL 1DWOA 4KVFA 2DCMA 5BVJB 2J4WL 1I4FA 1T0PB 3WN5A 2CH8A 3IF1A 4MUYA 2C92A 3PXAA 1VG1A 4DJ5X 3E05A 1FZOA 5DKFA 4FYHA 3ZE6A 2JSFA 3ZHBA 4KPYA 3RX8A 3GR6A 3RZCD 4BYHA 2VHTA 5C46F 1EDDA 4KHXH 2B21A 3AOEA 4EMSA 2HVJB 4NYLB 4V0OA 4YSSA 3PGKA 3BPLB 3ME0A 3KTDA 3L41A 4HRVA 4GXQA 1MCDA 5KSBA 3F4BA 4Y4KB 1HWYA 4DDUA 3LTEA 2D2IA 1WNFA 2JLBA 4CMEA 4LVCA 2ENYA 2QW1A 1IAVA 5JQIB 4X95A 4ZQFA 4DIFA 4JY7A 4OM7A 2XUIA 4XI5D 4LSTH 4LE8A 2IPAB 1BQSA 4L9RA 4BNHA 4ACTA 1Y34E 4K9PA 1VIVA 3GMTA 5EZSA 3SYCA 4JB3A 4HHWA 3GDHA 1V7ML 5E2VL 3MOAL 4MNHA 4Y6LA 5DJ5A 5L2JA 1D2OA 3W4KA 3GROA 4M1EA 3RTQB 3W2EA 5IB5B 5JW3L 3VNYA 3U6XS 5FPIA 3DV0B 3T0AA 3DROA 1P1RA 1YUKA 4ZW8A 4BVLA 3GKZA 5HS4A 4KR0A 2I62A 1YHPA 2Q8BL 4NABA 2H7WA 2IDFA 1DL7L 2OY0A 4HUJA 3UAVA 5H37H 4UVDA 4AKTA 4K23H 3UG7A 4DK3A 3MRKB 2CK0L 3FFOA 2JXMA 5PNTA 5DSTA 2GEUA 3QR2A 1Y1QA 3N2KB 4Y2HA 2CJTA 4IXNA 3H16A 4N3NA 2YC2C 1MQAA 4Y1EA 3VH1A 4PJIB 4PYKA 4PU0A 4B32A 3IMRA 2Q6TA 3TNDA 1UKSA 2G2RA 1VEOA 3L3OA 3SDCD 2DULA 1A14L 1EDOA 2OMWB 1TJ4A 4UUJA 3HJNA 1OTSD 3GLIA 3OL2B 2FWLB 5HJDA 3DW3X 4B4DA 3A6OA 2I25N 3CQFA 3O8XC 5HSFA 4G7VL 2DUWA 1BFOB 3SX0A 1JT9A 5C0EB 4MO2A 2XX3A 3SQOH 1ZUWA 2RONA 4HX2A 4LBYA 5GSVB 2YCBA 4CKEA 4D9FA 2CHEA 4HAZA 2XPGB 2GAFA 3FFAA 1Z35A 2B94A 2IK8A 1S7WB 3QWHA 4UAOC 1OX5A 2DI9A 4I50F 1AQIA 3WV5A 3WNLA 1XGTA 4J76A 5CFQA 1U0QA 2CG9X 3HY6A 4NOLA 1DXHA 4ZD6A 4Y19B 2WWWA 3GT6A 3AB7A 4IDNA 4S04A 3HB1A 3AACA 3AGPA 4WBXC 3TVMB 1F6WA