3ZDYB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 110
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdyB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdyB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdyB03
4UM8B 3OKWA 1UEXC 1FE8A 1FNSA 4JX0A 1MHPA 1PD1A 4JDUA 4MMZA 4MMYB 4WK2B 3V4PB 3V4VB 1YUKA 5E6RB 4A0QA 4MMYA 1PCXA 2VDLB 3EGXA 4MMXB 1SHTX 1L5GA 3K72A 3ZDXB 2XWBF 1AOXA 2VDRB 3ZE0B 1BHQ1 1M1XA 1JLMA 1OLZA 1MJNA 2VDKB 3PPYA 1L5GB 4Z7NB 4HQKA 4FWWA 4NENB 1MQ8B 3FCSA 1PT6A 1XDGA 3EOBI 1IJBA 1AUQA 1N9ZA 3VI3B 2VDNB 5E6RA 3AFCA 2B2XA 3NIFB 4MMZB 3TVYA 1LFAA 2ADFA 3OL2B 3VI4B 4WK0B 3EGDA 1JV2A 1QC5B 5KYWA 4G1EB 3IBSA 1U8CA 5KYUA 4O02A 3AL9A 1ZOPA 4Z7OB 1DZIA 3EH2A 1AO3A 5E6UA 3EG9B 2WW8A 1JEQB 2ICAA 3HXQA 5KYYA 1JEYB 4DMUB 3K6SA 2VDMB 1Q0PA 1SQ0A 1DGQA 2M32A 2O7NA 3NIGB 3T3PB 4Z7QB 1MF7A 2NUTA 4CNBA 4UM9B 5E6SB 3E2MA 4UM9D 3IJEB 1OAKA 2WINI 4HQLA 3EGDB 3ZQKA 4HQFA 2NUPB 2QTVA 2I6QA 3TCXB 4IXDA 3TW0A 4F1KA 2P28A 2XWJI 4FX5A 1N3YA 5KYNA 3EFOB 4G1MB 2ODPA 2ODQA 4WK4B 1IDOA 2I91A 3BN3A 3K71A 1U0NA 3OKYB 1NA5A 1M2VB 1RD4A 1RS0A 4G1MA 1MQ9A 3EFOA 3EH1A 4HQNA 1BHO1 3AL8A 4CN8A 2P26A 1SHUX 2IUEA 2XGGA 3FCUB 4IHKA 3NIDB 4WFQA 5KYXA 1SHYB 2NUPA 1IDN1 5ES4B 3EGXB 4C29A 2VDOB 3IJEA 5KYXB 5LN1A 1CK4A 4K3JB 1T6BY 1M1UA 1M2OA 5E6SA 2UZYB 4WJKB 1CQPA 3AL8B 1M10A 1QCYA 4GZ8A 3K6SB 2X5NA 1JEYA 1M2VA 3RAGA 5HGJA 1U0OC 3ZDZB 3N2NA 1XUOA 5HJ2A 3K71B 3HI6A 3PPXA 3Q3GE 4PN7A 5E6UB 3F78A 1U8CB 2VDQB 5KYUB 4CN9A 1RRKA 4XW2A 3T3MB 1YVPA 1SSLA 3BQNB 4O3TB 4IGIA 3OL2A 4C2AA 5BV8A 3GXBA 2NVOA 3ZDYB 2NUTB 3PPWA 1T0PA 4C2BA 1YVRA 1ZONA 3FCSB 4HQOA 3TXAA 4NENA 5KYYB 1V7PC 3ZE1B 1JEQA 3HXOA 3ZE2B 4BJ3A 3EG9A 4NEHB 3NVQA 1XDDA 2VDPB 1M1XB 1PD0A 1ZOOA 3M6FA 4O02B 3QA3E 4M76B 1ATZA 3F74A 1TYEB 2I6SA 4G1EA 3PPVA 1IJKA 1RTKA 1QC5A 1JV2B 3K72B 4O3UB 3BQMB 4MMXA 3EOAI 4F1JA 5KYWB 2VC2B 5HDBB 1MQAA
chains in the Genus database with same CATH superfamily
1IONA 1ZCZA 2B15A 2YJNA 5J06A 5M3BA 1MCPH 3GO1L 1VPTA 4X8XA 4E36A 2ZJAA 3D48R 1VMEA 3S1AB 2F53A 2X86A 4PJ5B 1DVFB 4TKZA 3CJTA 3DDUA 1NR1A 1LFDB 3AOGA 4J75A 4G6MH 2AJVH 1E43A 1Z1WA 3NFSL 1U8NB 1MAMH 3RS5A 3ESNA 4QHUB 5F7HA 4MLCA 3H2KA 5IF9A 4M6WA 1KQOA 3FNQA 1WLYA 1TDQA 4UUMA 4KLCA 2AK3A 4J90A 5LQJA 4TKLA 1FYWA 4G80A 3N40P 2BGJA 5ALNA 4FHGA 3MXVL 1L7TL 1L2TA 2DN7A 2DYSB 3C60D 2Q28A 4BKPA 4NQQA 2NU8B 4JQIA 1NC3A 4FYRA 1NG1A 3VUEA 1JZGA 3ZY6A 3DYOA 3O8RA 4BTEA 1BW9A 4P92A 3MLPA 1U8PA 1ZXKA 3GJEA 3B5EA 4S0XA 5CJXA 5ERXA 3SE9L 4JNKA 4I9XA 4A03A 3P02A 2IDTA 2BR3A 5B4MC 1KE2A 5A7BA 4CCAA 1BDIA 3IMEA 4B80A 5B36A 2AFRA 3U4EB 4FE3A 1R9JA 4MW9A 2YWBA 2NSXA 2LRHA 3KL5A 2FXVA 3HNPA 5IBCA 4U4IA 3HFML 1MHPA 2NOAA 3DB2A 2R25B 3VZBA 3U0VA 5DS8B 2YZ8A 1I75A 1X19A 2FDXA 2W91A 3QDME 2VWPA 2CLOB 3FHQA 3MOQA 2D3LA 3VYWA 2BRRL 2YXBA 3D25A 4DKFH 4LSPL 3KOUA 2FQEA 3NIFB 1RJCA 1GAWA 3OM1A 4AY3A 4QYMA 4PRAA 1N34B 4PLYA 3P2MA 3QVOA 4DLTA 3ZDWA 1MPAH 2IE0A 5K9KB 1H5NA 4B9KC 2FMFA 4M87A 3BL8A 2NUTA 4ER0A 5SV2A 4PC2A 5ABPA 1UUNA 4PEEA 3Q15C 4NMHA 4L5YA 1VG9B 3VM6A 3KCNA 4D0SA 1OB0A 3S36X 2JSFA 1R0ZA 1T66D 3B3FA 4PVMA 5EKUA 2PRYA 3SKXA 2EQAA 3G68A 3MOAH 4H2DA 5K9OA 2F8VA 1G41A 2VL5A 1O7VA 5IHPA 2WU3A 2A2ZA 4FZRA 1RSYA 3PJNA 2QRJA 3OGCB 4XIJA 3UKDA 4A67A 5U4XA 3ZGOA 3SBDA 3D1JA 2EE2A 1QO0D 4JJFA 3ECVA 2ATKA 2J8UF 3T0BA 4PLGA 4IW4C 4Y16D 1R6UA 1U3FA 3O31A 2A57A 4FKBA 5HJ5A 1SG6A 4DUXA 1N36B 3FN0L 1XGUB 2EKDA 5AOAA 2FETA 4XNQA 1NURA 1Q7BA 1BPLB 2ZJYA 3ZIYA 7REQB 5AYUL 1TK2A 2EDYA 3N0RA 2A9PA 1UPXA 4JVOA 3WUWB 1E65A 3VHLB 4OIIL 1RFGE 5DWVA 3O0LA 5KVEL 1NCNA 5IBUG 3KQYA 2NQ8A 1OO2A 1VRCA 5I01A 3N44B 1QC5B 2H7WA 3AI3A 3FTGB 2RHLA 2IC2A 1G21A 4JL8A 2J56A 4MYPA 5F9OL 1CF2O 5AVTA 3TS8A 1O4WA 1NVWQ 1W9MA 3O91A 1XXHE 2RGRA 2CLVA 4G9DA 2X3AA 2FUNB 3UIEA 1EEYB 1Y5RA 1U6IA 1FUIA 3LVQE 2R4RH 2JGDA 1JCKA 5J3HC 2OKGA 3TLYA 1OLUA 1HRDA 1V26A 1B16A 3LD8C 4YJFA 3K2UH 5IG7B 3ZJUA 1CGXA 3AY7A 1P7ZA 5AUMB 3KPQA 4UIKH 2PJRA 1CDZA 3CX8A 5LZ7A 3DUHA 2ZULA 3S8YA 5HZKA 4LOUC 1IUPA 4DAOA 1PFVA 1H9AA 5BQOA 1FZOA 2E5FA 3V00A 3FSAA 1JKJA 2P0AA 1N3NA 2QYOA 3IERA 3HG1D 4MP3A 3ECBB 2ORED 2PT6A 1N57A 3MLTB 1D7CA 4DCCA 5GGTA 3LYUA 1LDGA 5YASA 4C21A 1NIPA 3E7JA 3OZFA 1X1EA 1ONNA 2R5FA 3ESAA 5AUPB 1R3LA 5AVOA 4NCC1 3BD8A 5EE1A 3IN2A 1CI5A 3T1YB 5REQA 4HNAB 3S2SA 1YT5A 2ZOWA 1IGML 5AW1B 3EASA 1ET5A 2G75B 3OHXA 3ZI0A 4DLWA 4UM8B 4KKVA 1GKOA 3SKMA 2IHZA 4CKYA 3PWUA 1J8HE 1EZVX 3ZWWA 2ZE6A 4DN6A 4ETQB 3ZCRA 2R5NA 1S8DA 1H5UA 5I18H 2Q2NA 2CO2A 3ME0B 3WZ2A 3BMCA 2V7VA 4P3DA 1JDDA 2P8LB 4JP8A 5K4HA 2DBLH 4YHPB 1SRQA 3JTSA 2B35A 1LP9F 2YPLD 3U7WL 4O2FA 4QWWD 3TEFA 4TTIA 1K3IA 3NN8A 1I9IL 1I9JH 4HJEA 3EZ6A 5DEJA 2Z91A 3K4PA 1DXYA 2R2HB 2Z6FA 5L8LB 4TTSA 1QG4A 2X2IA 5J40A 4ARUA 4M7ZB 2QIOA 3HNSH 4LG1A 1P1FA 1CG6A 3EJTA 3FRJA 2JWYA 1VPOH 4N01A 4D2IA 1LCIA 1YNLH 3AF0A 1RRMA 4MNQA 3AEYA 1DQLH 4ZJYA 2M83A 2NO5A 1DBRA 3CONA 2QZSA 1NI4A 3VXMA 4LBYA 2K5UA 4DF3A 4B7UA 2FX2A 4ZICA 1ZLYA 2YRPA 4KI0A 3IAM6 2W8ZA 2IYLD 2Y0SA 1M83A 3WIDA 1K5NB 3OM0A 2YKLL 1UAYA 4H1LH 3UADA 2F1IA 1HSZA 5JEEA 4ELKB 4M9QA 4OLUL 1XD2A 2I07B 3FNKA 2J9GA 3HS9A 1JE0A 4JX8A 5FT9A 4E9QA 1JEOA 1SVBA 2NYYD 4YA6A 4G0PA 4WW2B 2D0DA 4CL7A 3AUYA 3THSA 4ONHA 4QEGA 2X9GA 1MGOA 1C1EL 2OILA 3KOMA 4QQFA 1Z16A 3K53A 3RYTC 3PJEA 3CFNA 1L7TH 3BP7A 3R5XA 1TO6A 4JEGB 4FJ1A 1WEJH 4HETA 4NWTH 2UUDK 2QN7A 3UG5A 3EQ9A 3KTDA 1KY7A 3WTSA 5FWYB 3PPSA 1E1YA 2AV7A 1KZQA 4J1NA 3ILSA 1HSAB 3PFNA 3H85A 4ZCSA 2GVDC 2QTTA 3I0NA 1MFVA 1XP8A 5HIKA 2Q8AH 1BU5A 3JVDA 5EUBA 3IVAA 2TECE 3WGUA 1DZ0A 2IWFA 1DLHB 2V37A 5TD4A 1D2AA 1ZOLA 5G1OA 2H0FA 3P0JA 3QQDA 4KKCD 1T3GA 3LNFA 1U7PA 1U63A 4B73A 3BGAA 2O48X 4IZIA 1LK5A 4LCYB 3S35X 3ZMNA 3DZFA 3KCWA 4I08A 3FMVA 4CTOA 1E5CA 3UT5A 1U9CA 1NYRA 1XGRB 5M95B 1CR4A 4Y9GA 1HYHA 5KVSA 1GEGA 4HXAH 4LLVA 2C7FA 2ZW9A 2JATA 1J1XH 1DJIA 5FO0A 5MN5A 1R4XA 4U1MB 1CUDA 4N2GA 5AVQB 1VE3A 4PXAA 2Y69B 1U3HB 4WWKD 4ZUVB 4BJ5A 4TT3D 1OOEA 4DO4A 2EARA 1KO7A 1XWWA 4TS1A 3GA5A 5DMXA 3LYLA 5IJ9A 4P9MH 1MPXA 2VSMB 4JR1A 4BRSA 2A9QA 3HZHA 3O45B 5HY9A 5EPMB 5EE5B 4XO8A 2IY7A 3N50A 5JXGA 1TZGH 5IY5B 1P17A 3KGRA 2XVAA 5D7BA 4YRSA 3GMNB 2GCEA 1NJFA 1THCA 5CDSA 4L0YA 3EXEB 1ML0A 2WP3T 4OTXL 4JYAB 1O96B 5I7WA 4LE0A 1EFPA 3LEYH 1Q15A 3FTYA 4LLVB 3E9RA 2G75A 3OHXB 2A73A 2VDRL 3WEAA 4YCNA 4N85A 1D07A 3K7EA 3L07A 3WL7A 2B3IA 4LMPA 5BQPA 2UKDA 1JQEA 4LY9A 3RUGB 2DKOA 5M5BA 3CN0A 2Q8BL 3A6HA 4E1VA 5CJPA 3VC1A 2BP5M 5D9SB 4FYIA 5B58T 4FJ6A 4Z3DA 1KCWA 2QL7A 3MLBA 4EHBA 1XGQA 1S9YA 3MV7A 2B77A 2BBSA 4B9ZA 2IPUG 1JH8A 3A06A 1VKXB 5IMLB 1Y8CA 3AB8A 1L0XA 3HVKA 1UACL 3Q6FB 4IIDA 1OJ7A 2Z57A 4GO1A 3DEAA 3V2GA 3WIIH 2GYWA 1HTBA 1M1NB 4RFNC 2FN9A 4UMSA 3J81A 3H0KA 1F4WL 5D86A 2OR3A 2VDLL 2C29D 4QDOA 2QBWA 2O8BB 2B1AH 4IJ3C 1ECJA 4ZVLA 3CS3A 5FR2A 2Y7QB 5E5UB 4B46A 3P0RA 5BV8A 4UTCA 1NCAL 4RTOA 1ZS9A 1V8DA 2VKXA 1TVDA 1X7SA 2YHSA 2IIBA 2ZG1A 4JDUA 2V6MA 2DHDA 4P5EA 3G2HA 2IDZA 3A6PC 1DRVA 3Q8EA 1Y7VA 3MRKA 3ZDXB 2J8OA 4QXOA 1YEKH 3B5GA 1YL6A 1MREL 3GOQA 4JKKA 5D8JL 4UFPA 4X00A 4QF1B 2QTNA 1U8MB 3U1PA 1HWYA 4FFMA 3WYRA 1E94E 4K94H 4X4YA 3C5ZA 3ISYA 3ZHZA 3VI4E 3TUJC 3O2DA 4Q05A 1FNLA 1BQ3A 1A7UA 1ENYA 3DEJA 3P9KA 1NCDL 1Q1AA 3LIUA 2LUOA 2WLYA 2AXGB 2NU8A 3LSYA 3ZE8A 1NNLA 5C4GB 2WZ6A 1VCNA 1ZCAA 2B98A 2BH0A 1F0YA 1PR9A 4ZA2A 3AUWB 2JTDA 2IBTA 3TH5A 5I6PA 2FJFB 1NVFA 3F47A 2J1YA 1W0KA 5L3QB 3ROLA 2GD6A 1NVVR 3SR3A 4D0LB 3AL8B 4B3JA 2FEXA 1Q0HA 1S7SA 2NX5E 5I6XB 3B34A 3HG0A 3H11B 1TX4B 5A2QA 4UE2A 4RZCB 2GJZA 4U7KA 2A84A 1O58A 3R6LA 3NUKA 1N1MA 5TS3A 5CRIA 3JV4B 5GAJA 4LSSH 2WNSA 1PE0A 1LVGA 5KQPA 1CT8B 2ZYSA 4QVGA 3HBGA 3I9FA 3N91A 4JDZB 2C7UA 2KWIA 3H97A 3KKNA 5A2JH 4EEEA 3O2DL 4WN3A 3B1YA 2GPYA 1WW3A 4EEKA 1RWNA 2JKWA 3RWGA 5M04A 3JSSA 1IN7A 3VKFA 5JMOA 4KWUA 1ICTA 2PH1A 4ZW5A 4XMLL 5DC9B 3K1JA 2V3FA 3NH7H 4WU7A 3QA3B 5MERA 2MYUA 1EDBA 2ZXGA 4BU1A 2FIKB 3TW8B 5FBLB 1SBSH 1ZI6A 2RHWA 1HZLA 1GPDG 3F7RA 4EKXA 3BUDA 2QM7A 3I8XA 3U4QA 3U83A 3CIFA 2HKHL 3KLPX 1FWXA 1RBZA 4DKTA 3DARA 3N58A 4A15A 2F59A 2HUEA 3P4NA 4JUDX 4QQ8A 4MZRA 4OZFH 3M5CA 1DO8A 1VCIA 3C16C 3FSZA 1LLAA 1NI4B 2OYKA 1J06A 1X7XB 3CFTA 4FQ5A 1OCCB 4JFEE 1U0OC 1IM8A 1HT2E 2FDBP 3WX0A 4BVBA 2G28A 4X5PA 1ISPA 5KG9A 3GMOB 4K71C 2NSQA 5AJZA 3EYOB 2CJFA 2B94A 3HU3A 3MBWB 3NCEB 4TT8A 3BUYB 5FM4A 1AA6A 3TSWA 3A6CH 5KYYB 4WTZA 1NAMB 1X1DA 5EZYB 1ZEAH 1ZHLA 1MJ7L 4KR3A 3NT0A 1T2NA 2HK9A 2YCLA 4Z7VB 3SJZA 3L41A 2RAVA 2PKQO 1O95C 1W8IA 3I62A 2OMNA 4AZUA 2Y4NA 1F42A 2G82A 1KLGA 2V2XB 2B4YA 1ZU4A 1JPFB 3RVNA 4MIYA 2F53B 4OCYH 3RY4A 1TEGA 4WNCA 3STLB 1VA9A 4RACA 1XZKA 4ZCPA 3MNVB 2AK4E 2X6TA 2WBJB 4KI5E 3DMPA 1E6OL 1QFZA 1SC9A 3CRVA 2ADFA 4OSPA 5H9WA 2QL1A 3QPXH 4AM0B 2HM7A 2IDSA 3AJ8A 4DPMA 4N2IA 5CXSA 3E6AA 3OH8A 4YPVA 3I75B 2IWKA 1Q0PA 3LOPA 3L7OA 2BP8B 1EEZA 3HCEA 1YVDA 3FMGL 3GRGA 2W2LD 4Q1EA 1WULS 4X8LA 3WG9A 4HWOA 2RCSH 1NVTA 3LUGA 1I1YA 2DPYA 3PF2A 4P4RB 2FZ5A 2BEJA 2VZSA 3HJGA 3LBYA 3PKIA 4L3CA 4OAWA 5BOPA 4U3SB 1Y07A 2VN5A 4Z0XA 3ESBA 1Q0XL 4S1QL 1CL7H 1J8HB 3AFGA 1JXKA 4KVCH 4M1CD 5BSUA 3QG1A 2AXNA 3VH4A 4FQIL 4O2RA 1C7ZA 3ZT6A 3IE1A 1T4WA 1UWGH 1O6FA 1HE8A 2JHGA 1ZGGA 3P9IA 1SYVA 3KLOA 4L72A 1OQAA 3DBLB 1ZJYA 4QRRB 2QVBA 5DYIA 2NU7B 2C2OA 1R8JA 1WBJB 5HRCA 3QVKA 3OTIA 2QT6A 1FC0A 4ZVVA 1IHXA 4IXWA 3A25A 3QPAA 3KD2A 4A0QA 3LPNA 2CM6A 1OFGA 4XRRA 2DQKA 1EIBA 5F0MB 2WT4A 5E4TA 1BIIB 5D7HA 2SKCA 1CUUA 4TL4A 1V6AA 5DCCA 2YPLE 1PF7E 3NTOA 1C7EA 3EIUA 2J46A 4C6RA 1MIOA 5AW3A 2CFSA 5HILA 3WFEH 2KZWA 3GM0A 1CGSL 3PJSB 4MPTA 3OHMB 2BFVL 1T1SA 1OM9A 3LNIA 3CIAA 1MH1A 1CP3A 4GD3Q 4WNAA 4W5WA 3WO0A 4Z95H 2ZIZA 3IDGA 3QV2A 1QPPA 3A47A 4BLUA 1F4WH 4UC0A 4M02A 4MD5B 2F8TA 2O3UA 2Q21A 1HZZA 2IK8A 4N8CL 4DQAA 4QBFA 2VRQA 1E0KA 3GXDA 3FJYA 4F3CA 3PIRA 4I3GA 1F2TA 1QYGH 3FB4A 4EVSA 2IAMB 5AJXA 1JG9A 1IQWL 1P6AB 2RG7A 1X3DA 3TD2A 2WVVB 2PLWA 2XBMA 3LN5A 3LRSA 3U37A 4OQ1A 5DO9A 5ENZA 1UDCA 1KTDA 3HE7C 1A9TA 1GTZA 2WZCA 2QPFA 2IOYA 1ZD9A 3PPWA 2DQCL 1R66A 5E94A 1TPZA 3TCLA 4IIJA 4YDRA 4W9RA 1A9EA 1QGED 3LX5A 4JVPA 4MGZR 1O94A 3FHLA 3RC7A 6ABPA 2Y1OA 4UTVA 2G2PA 4YE0A 1NJSA 3ZG6A 2VK8A 4PMFA 1G5RA 2IHJA 1NFKA 3GNLA 3ZWMA 4PF1A 5A2IH 4L02A 3SGDH 4XCNB 5CXXA 4PAOA 3GSQA 2LE0A 3A1FA 4KAFA 4KITB 1Z0UA 1XMXA 2AVFA 2LWIA 3HXKA 4ZVNA 1QNZL 2DPGA 5GZND 1M71A 2HWZL 3N0VA 4LVOC 4KMOA 2FYYA 2CBQA 5FFFA 3B82A 3S3CB 3BPOC 3TV8A 2B4KA 3UHFA 2DQSA 1DAOA 1R9NA 4F91B 1EH5A 1ZAYA 3QUMB 4TTDC 3M2TA 3F7YA 4UNSA 5HM6A 1DAGA 4TSRA 2JIRA 2ACEA 4JFEB 4OVKA 3EFOB 5LDGA 3LZFH 2OLJA 9PCYA 1WA0X 3UMYA 1R4MB 3CBRA 1E3QA 3HU5A 4RPJA 1X1QA 1NIFA 3FMGH 3MX0B 4J28A 2X0NA 4UATA 3K5HA 4YQXL 5C3MA 4UDUA 2GBIA 3OQOA 3VAAA 2NX2A 5CJBA 4Q4IA 3NP7A 2OBBA 3RX7A 4LYEA 3ZCTA 3QH3B 3HNTL 4ZQTA 1W1IA 2PBFA 2V6GA 4OQNA 5JJBA 2HA4A 2BSQA 3LP5A 2ZQYA 4DVRL 4KU1A 3KZOA 4KO8A 2ATPA 2H85A 2Z2YA 5K2MA 4JS7A 1SYSB 4M53A 3ID6C 1MCNA 2MU1A 1JAZA 1XB3A 4P3KA 3WNDA 5C0AE 3DZDA 1JZTA 2C83A 1TCVA 3RVRA 3BTUA 4CLRA 1NBZA 1DVFA 1R3UA 1GCUA 2ZIAA 1JNHA 2A8YA 5IEKA 3RKDD 3VM7A 4TV8B 1LVEA 1BG6A 1IAOA 4GRWE 4K6FA 2OP0A 3GFGA 4CMHB 4XLZA 4Z7NB 1B2LA 3TA4D 4JFFE 3KSMA 2F1BA 1N9ZA 4BQSA 3ZK0A 3S7GA 1BEUB 5KVFL 1SXIA 2OMKA 5J23A 2D5CA 2IYVA 4NPJA 2G5RA 4K9DA 1Z9LA 2RGSA 2KHAA 1MHPL 3WHLA 1WXWA 3S34L 3VV2A 3V1TC 1WCIB 4ZOQI 2NZ8A 3HUDA 4OQDA 4JLWA 4UOJA 1UKSA 1QVRA 2I3GA 3JQAB 1YMMD 5F7FA 1NMBH 4TYNA 4PG4A 4R7NA 3E9NA 4UCFA 4G11A 3UWKA 3VSAA 1NASA 2G5PA 1YXMA 1N4AA 5LBTA 1WS7A 2UZYB 4KROC 5T1DL 2YPKA 1B1CA 5EUKA 5JYMA 4EARA 5B3AA 3R3UA 3PE6A 2QU8A 4Y2XA 5CDYA 5CU5A 3OFNA 4G43A 1X7HA 4IJWA 2CB0A 3WYNA 5KCZA 4Z0BL 3LLVA 4PJGE 4UT6L 4GW3A 1OF2A 5IVKA 2E4TA 1I1HA 1U8AA 4PHCA 3HB3B 3MRXA 1BLNA 2ADMA 2Q1XA 5JXAL 5BSEA 4IS6A 1UT5A 1Q7TA 2WPNA 1FLTX 3WMPA 3GBNH 1IXZA 1KI2A 4MUXA 5C0GB 4O29A 4OAQA 2PO6C 4HJUA 2B2CA 2XSZD 2OCPA 1M05B 2GAZB 5D7LB 3BI9X 3HRHA 4MZ2A 5JFOA 3PABB 2O5ZH 4FP8H 3M70A 4DBZA 4HJTA 3T77A 3HKEA 1N1DA 4IIUA 4HJ0C 4N8VA 2X2UA 1S7VA 1PGJA 4GI9A 3A05A 3OF2A 4XAWL 1P53A 3JVGA 1GL4B 1LYQA 1YRWA 3A37A 1AZBA 1UJ3A 4QDKA 5DJ2B 4FGJA 5GGSB 1ZK1A 4REOA 2H5EA 2GJ9A 4CBPA 4HYTA 1L5FA 3CDZB 4C30A 3SQOL 5AJHA 4HDKB 1A1NB 3RK0A 1G291 1KFKB 1R5VB 4XWYA 1FHNA 2GUOA 1NJ8A 4GOJA 4R1SA 1Q1NA 1IVLA 5L88L 3Q87B 4ZHQB 3G2KA 4FFDA 3AKYA 4AWBA 3UW1A 1UXSA 1DN2A 5KS2A 2IH4A 4KPUA 4YMSA 3SNHA 3LZCA 1XHLA 3JQGB 4HUTA 3T9AA 5BV0A 5JLJA 5I0XA 2Z9CA 3W7VA 4MDJB 3V5NA 1K6IA 5IFAL 1FNDA 1BYOA 2HEGA 5BXFA 5U1PA 7ADHA 3DMMD 2C61A 2OS7A 4LDEB 5KSVB 3P9LA 5T5NG 2FGZA 2D7NA 1DBPA 1SFHA 2QMUA 1OTSD 4BDVB 1NPTO 4OMDA 5SWSB 3LC0A 1OWRM 3DVGA 5BVPH 3UFIA 1VBKA 5FUOL 2WYZA 4UMGA 1X9GA 2QP9X 2Q5HA 1F4PA 2VC2B 1IY2A 4OZ4A 3TBTA 3UYRL 3GZTB 1B0UA 1T8YA 4Q9QH 1PQZA 4MNTA 4TWIA 4PREB 4I55A 3OPZL 4PHTA 4YREA 3IIEA 1ANKA 1E4KC 4L4YA 4WFIA 4BFZA 2DQEH 3FDZA 4JN1H 1TQ8A 2BFBA 2BEWB 3UK1A 4OZIA 3MRMA 2V7QA 3I04M 1H0RA 1OC4A 2PBLA 3VU9A 1WV7T 3ROMA 5C08B 1E4XI 1MAAA 4X7SL 4H0CA 4FQ8A 2FX8H 2XY2A 1SJ9A 1VPDA 4XN2A 2ECKA 2MOKA 4YCAA 2I78A 2W0FB 2XMBA 4PTUA 3Q0IA 3O9MA 3OPNA 4KX9A 4UZGA 3EO0B 1BAFL 1GCGA 3LSOA 3PC8C 5JYEA 2ZXEB 5ESAB 5GRWA 5SV3A 2X1VA 5JD6A 2DCMA 5G02A 3F6LA 4J3SA 4MO9A 4CVZB 3SXUB 4M6NL 4INJA 4UTAA 4I0KA 4X6BA 4P46D 1SK8A 4GG6B 2XIBA 4ZPXA 4JZOA 2EJWA 5FA4A 1YQGA 3AGWA 5IZ7A 3K6OA 4F80A 5BW8A 1Q1ZA 2AXWA 4ARSA 4PC1A 2FRDC 1CGVA 3FTPA 3VGPA 5LR6A 3WDLA 4K2UL 4LQFH 5MN6A 5D7KD 1Y8QB 4Z0PA 4CVUA 1A97A 1YKGA 1N2GA 3PGMA 4KG7A 1H6BA 2BHRA 3EH3B 4L6IA 1G8HA 1INEH 2ICWA 3FONB 4HAVA 4TYPA 5E2TH 5TK4A 1XMEB 3DXAA 1PY0A 4DCOA 1P0FA 4YGXB 4LL9A 1BVKA 4TQ9A 2GG1A 4TM7A 1GYVA 4O58L 3BB4A 1IZ9A 3U7EB 4RJLA 3NA9L 4LLWA 4KXBA 4NGHH 1E6LA 1Y34E 2XYQA 4Y9RA 3O8OA 3U9LA 4CM6A 3IKKA 1RZRA 4R9SA 1QW9A 1U36A 4ZW3A 1OJLA 3JYLA 3PEYA 3ODPA 2NV6A 5LYJB 4BKOA 3SSGA 2OJZL 2Q0HA 1CGYA 1GSKA 4KQKA 4LSQL 4DW2L 4WXYB 3KL2A 4W9LC 4EUNA 4JO2L 2VWGA 2JJSC 3DUUA 5EIVA 2H1RA 2B37A 2X4OB 3GCDA 3D6AA 4LW8A 3GLGE 4X8CA 4DDVA 3R3VA 1EX9A 5DVKA 4IIBA 4F7PA 1F56A 3PCYA 1V7ML 4CIWA 2FR4A 2H4ZA 4QT4A 3OJDB 3OTOB 2XV3A 2RK6A 4YCDA 2QE7A 1MWAB 3CH6A 4LVOA 2J3HA 5IFJA 4GM1A 4MARA 2CJWB 4O2EB 2OQJB 3QEQA 3V9CA 1UXLA 3Q01A 1ZLDA 2O8FB 2R69L 4DK3A 5C0BB 3KOOA 4HGQA 1OP5K 4KREA 4ZPVB 4S24A 1Y4DE 1NLYA 1E1MA 2AGJH 3BWZA 4Q4AA 4AMKH 1BCSA 4RSYA 3KWWB 3FTZA 4PLVA 4NS4A 1JNNH 4XCYA 6PCYA 4EUSA 5FF6B 2VZ9A 4JC8A 4NZMA 5AW8A 1TT5B 2OCCB 3IP7A 1P72A 2PNJA 1ZK3A 2ZE0A 2O2DA 4L4VE 3QX7A 1QH1A 3EXJA 4UQPA 4AT6A 3EDMA 1VJ5A 3HNVH 4IRXA 3PEVA 4BFTA 2WQ6A 5EN2A 3VXUE 3GJ7A 3G85A 2FEAA 3U39A 3ELQA 4XAKE 3WAGA 1N26A 4MKZA 1YRQA 3VRIB 3AFMA 1UINA 3DIFB 1M76A 3ARBC 1K63A 2OCGA 3WGIA 3R4RA 4U02A 4LJAA 3T7DA 5ALIA 4Z4IA 4E42A 3E3OA 1W4LA 1G0NA 1K2DB 4CN9A 1OW0A 4R90L 1NGQH 5CEXB 1X7WA 3MRBB 3B56A 1JZQA 2UVQA 1E5YA 2BC4A 2HKFH 1DOZA 2Q5OA 3PHSA 5DMHA 2UVFA 1R75A 3A6EA 4MCYA 4DFIA 3SYQA 2AKYA 3G8BA 4OQZA 4I77H 2ZYWX 2ZIXA 3WK5A 4Y6RA 4I2XB 3CUKA 4LVNB 2HUHA 4O2EA 3ORYA 3ZKQD 2PL9A 3BF7A 1Y7HA 3G79A 5DGHA 3ZHOA 1KLFB 5JHDB 4Q8BA 3U30B 4N3GA 4JLDA 1RYHA 3ZHQA 3CFCH 4P99A 4AYFA 1JGUH 5E4JA 4GEKA 2F74B 5E4EB 1YN6A 3QI9C 1VB3A 1FC1A 1SOAA 5CM1A 4B2YA 2D5IA 4WKZA 1JLRA 4FZ5A 4PYHA 1FA9A 3I85A 3QZNA 4FXPA 1N7IA 4OJQA 3AL2A 5CIPH 1R10A 3LLSA 1F2XK 1M4KA 2C77A 4ZAVA 1R0YA 3AW5A 1GDTA 3LPGA 2PP7A 3P11H 2XTJC 1EJ8A 1ZN2A 2OC4A 1QP1A 1S5IL 5BVHB 3TPKA 2EVIA 1MG5A 2B69A 4FEEA 2XWCA 3PP4H 3BAFA 3WNQA 1A7QL 3BYZA 2FR8C 4IHJA 5T1LB 4LGCA 4XYGA 3OSKA 1WKBA 1MG0A 3VH8B 4J43A 2GBLA 2A6KB 3U7YH 3LKPA 5AOIA 4RK0A 4NNYA 4Z8XA 5IESH 2EZUA 4WH0A 2VLJA 3P2EA 1TZIA 1ICEA 5C2JB 3HCOA 4K0KB 2Z09A 1OSZA 2GJ6B 3V7NA 1COBA 1NVVQ 2HK7A 2UWEF 5CHEA 1G63A 3ZV5A 3K0HA 5M2QA 3SQNA 3LDFA 4KTGA 1YUKA 3HIZA 5KTOA 1L5HB 4NIYE 2ZCUA 1ZSVA 3HB1A 4CEJA 1DJWA 3SICE 5I4IA 3QIBC 1KYIA 4X91A 5KTPA 5ICFA 3ESYA 1GSHA 2FN8A 1YUHA 1TYDE 2DOKA 2A35A 3DPIA 2JS7A 3GIDA 4PJ6A 4W63A 1A4XA 2WZPA 3Q7EA 3E22B 4AMWA 2O5XH 3P97A 4FFTA 5B55A 2YJTD 5IUCA 4G6ZA 4TN1A 3HG3A 2O4UX 5HHNA 1T29A 2WZBA 1T25A 4AROA 5GS0L 3IU3A 3F84A 1Q3TA 4WBSA 4INAA 3AW8A 3QNZA 2AEFA 3GZKA 4AQYB 2OTWB 4P5SA 3H2JA 1QFHA 2WILA 3UUEA 2I24N 5K0GA 3IILA 4GXRA 2BHTA 3KGTA 1WA1X 1A77A 3EO0A 3T9CA 5HI3D 2EDLA 3MO1B 1WHOA 1KDTA 3GMQA 2FU5C 4IU3A 1IBYA 1PBNA 2QD3A 3HZYB 2NYZA 1T4KA 3U1BA 4Y2LA 3MN1A 3NRJA 3OPYB 1M57B 4KROD 1ZH8A 4PI0A 1J20A 3KQOA 4MPDA 5LBUA 4F2DA 1Y3FE 1CUWA 2P78A 1W2KT 4PJXE 4E0RB 3KJHA 4WUVA 3AHCA 2KJQA 2YHIA 4YVNA 4OLWL 1C50A 5D5HA 1TTCA 3MINB 3GSOA 3JZIA 3WDMA 4DKFL 5I1KL 1KAOA 5F7KC 3V3TA 4DVGA 1DN0B 2GJPA 4DEWA 2GAIA 2Y6VA 1T15A 1P18A 3EGSA 1UBJS 4AIOA 1MCHA 5D7JB 2EE3A 4ZYWA 1RP9A 5C7OO 1RHUA 3AK4A 2X9XA 1EMDA 3D8SA 3FHEA 3MF4A 4DLLA 2Y07H 4QUHA 4M3KB 1KDOA 1FSPA 3EA5A 1VRVA 2QVMA 4PHXA 1HXMA 4B3CA 3TM6A 3WE7A 1AMNA 3NS7A 4UKDA 2WYHA 4OXIA 3PC3A 2VUTA 3VCLA 5I16B 3OR6B 2WB2A 1UZ8A 5JS2A 1F48A 3D6HA 1YPZB 3K31A 1NICA 4GL2A 2ICEC 3APCA 4ALLA 1Q7EA 5JPCA 2PF6A 3IGKA 2QZ9A 3EBAA 1E5DA 5KANG 1M2VB 4IGBA 2AC7A 5IHZB 2IJGX 3N7AA 3BAJA 4S1TA 4KLNA 4KO1S 4KCGA 5EGSA 1Q1PA 3VG9C 4BWYA 1IAVA 5TE7H 2QY6A 4EW1A 3LYHA 2Y66A 5AHXA 3DE5X 4BNJA 2HRPH 3ICPA 3CGGA 1SSLA 1OB5A 1F0LA 4NNPL 4MEAA 1RE1A 1Z45A 2XE4A 1X3SA 1E66A 2GN0A 3TQCA 2X0UA 4KTVE 3DA8A 4BVKA 5I9LA 5GVRA 1X5IA 4YFLI 1K75A 3T0WA 1UOQA 1L9TA 3SI7A 1H3UA 2GAZA 5DA0B 2P8JA 4KQHA 3Q1SL 4M6OH 5IKEA 2Z3FA 4F04A 2BFBB 3D2CA 3CNQS 4LOEA 3R7QA 3GUZA 2F8OA 3DFUA 4LOUD 4LJKA 1T35A 1FGVH 3FT9A 5JCZA 1TCUA 2BSXA 1HL5A 4QRQB 1K86A 2PJDA 4LA4A 3WIHA 4OZ4B 3QXWA 3VNUA 5HP5A 4JCLA 4U6HA 1NYTA 3BJ91 3W77A 5AB1A 4R7XA 4YE4H 3R40A 2C7VA 4YONB 3TIGA 2XXGA 1DGQA 4JGUA 5TJWK 1AGPA 1Z4NA 4RBPK 4ZMLA 5EOCJ 4UXHA 2X6AA 5EIBC 3ESVF 3PWVB 3RVJA 3GFFA 3BUTA 2DMBA 4DL9A 1TJYA 4LTMA 1GGCH 1G9MC 4MULA 4H59A 4I1OA 4JI2B 4GRWH 3RX8A 2QRVB 2ZJOA 3JQGA 1XAKA 4TUJB 1UDWA 4N3AA 4TTQA 4U6QA 4FI7A 2IQ5A 3UZVA 4JOCA 1GRQA 1DP4A 4XWGL 2BKEA 4TL5A 3CFEA 4WA7A 1PFOA 4YZFE 3QMPA 5G2OA 4KZ0A 4PMEA 4HIHA 3VUAA 4R4ND 3DO5A 2CXHA 2H9GB 5LO7A 4AZ0B 5IMKA 2OFXA 2EBWA 4HUUA 1K4DB 5B7FA 3F46A 3IDIB 1JE1A 2QM8A 2I8AA 4YL4A 4RGVA 4ZQGA 5I6DA 1IN5A 5EZJB 4FQCH 2Q2OA 2QK4A 4FD3A 1GTFA 3MVEA 5DWPA 4J5VA 3D1LA 1N3IA 5HMLA 4MHTA 2L0XA 4HAUA 3C1OA 3DUWA 3L9WA 1DWPA 2MIIA 4Z7VF 3N85H 2BP7A 3P9NA 4PJIF 5AALA 1CFVH 1SYSA 4XCFH 2QI9F 4CA4A 4R4NC 1QTNA 3JTTA 4K03A 4I88A 4XN9A 3REWB 2BNRA 2F54A 5HGGS 2WVGA 2G2NA 3BRWD 3VI3F 1ODIA 1UT6A 5B1IA 5HYFA 4DC9A 5K3FB 5DK0A 5C5EA 1OE0A 5JVDB 2VT7A 4LC9A 2B83A 3FFTA 5CJOL 4HZAA 4AV5A 2E7HA 2O0JA 3QU9A 4I3RH 4TLTA 1AZLA 2P67A 4E9SA 1PD6A 2YRZA 1ZQ9A 1Y6MR 2PS3A 1CJCA 4Q4JB 5T3XE 5BN3B 5AYUH 4TS6A 1N5KA 4HWKA 4MVJP 1VEOA 5EC2A 3MV9E 1GQYA 3ETNA 3M46A 1R4MA 3N28A 5A7HA 5FDYA 4QLOA 3M1AA 2PKYX 2FB4L 1RRGA 4TNVF 2VDWA 1HI6A 4D9HA 1AZSC 5F64A 1SHWA 1KCSL 3L5WA 1QKJA 4EUEA 3NG5A 1U81A 3P9CA 2QUAA 4N0YH 3QTLA 3UCFA 3ZK9A 5FO2A 2C5GA 4UDTB 5LZ2A 1PK7A 5C8XA 1M8JA 3CZ9A 3GLSA 4BNWA 4GFXA 5EU4B 2GF9A 3LYRA 4C7OB 2QTAA 2ZZUT 4P23B 4BMOB 2IUYA 4I36A 5CMAB 3OSVA 2X0KA 2PKEA 3U6XA 1PW3A 2QAGB 4G0WA 4LHYA 3RTQD 1CETA 4B8YA 4A1FA 3BP6A 1YNOA 4EXPX 1FYHB 3CN1A 3AJAA 4BLVA 1JOIA 2ZX8A 4XMLH 1M6WA 2BWJA 4AEHL 4GS5A 4Y2RA 4Z78A 2LCIA 3BPCA 5GGTL 1G9MH 3B1UA 4GWLA 2OL4A 3LFHA 5IT2H 5D1QB 1NTRA 4LBEA 1ORDA 4WRLA 2P6NA 3MLUH 1GD1O 2OYLA 1NWHA 2YD7A 4FNTA 1CR1A 3ZDCA 3FUUA 3C60B 3I34X 1KTDB 4PJAB 4XMZA 3KR0A 5FA4B 2WWFA 4PXYA 5JUWA 4BXVA 1ZNYA 2WOBA 5AD0A 2WUWE 3GLIA 5KUKA 4Q9JA 2EWMA 1KMCA 5SZJA 2V54A 3WEXB 1ODCA 4DA7A 1S01A 3A6KA 3A3KA 5DHSA 2QM0A 3TLJA 4P34A 4DILA 5IG7A 2JIPA 1H4SA 1PFYA 2P5UA 5TMPA 1DEKA 1M0TA 1QLHA 2QBYB 3KZNA 5KJCA 1ICIA 1YDEA 1BVNP 4N2OA 4J0CA 9CGTA 3MJSA 3K71B 4E46A 4J8RB 3NJRA 3MV7D 1E9PB 3QEHB 1JHQA 2M9MA 1GVNB 4JDVA 5GRVK 1KYVA 1JYNA 3EAFA 1SBZA 5LNDA 5BNFA 4D9RD 1SVLA 2NNRA 3MBEA 3AMKA 5D71H 2JNWA 3RVKA 1YMVA 1TEZA 1JGLL 1VJSA 4HA1A 2BVQB 4PGEA 4GQPH 3KOYA 2WXJA 4LOKA 1CW2B 1E2KA 2G9NA 2C3OA 3D18A 2WTUA 1GGBH 1S7RA 4O4HF 5IT5A 6PAZA 3GNTA 2YRBA 1L4NA 1U6AL 1QLJA 3OECA 1ID1A 1XTQA 1Z0JA 5DEFA 5AVWB 2ZOKB 1QO3A 1TAHA 2WIJA 2IY8A 1ZLSH 3Q2VA 2FNAA 5DDHB 2C9ZA 3M6UA 5KNDD 3FI9A 2A9NL 3BDVA 3M3DA 2F9BT 2WBXA 2Y1AA 3A14A 1IAII 1DQML 5C0DB 2XGMA 2O6LA 4A10A 4G9FD 4XLLA 4KGLA 3OOJA 1HOEA 4JB2A 3EIFA 5EMLA 3SE3A 5CN2A 5K9OB 2XWZA 4R5TA 4PCKA 3TRDA 4P4RA 4X4XA 4S1RH 2MKLC 1UBCA 5BNZA 4FG4A 3T4AC 3ZTWA 3W4IA 1QMUA 3CNLA 3OKCA 3EOTH 3GRRA 1WA5A 1SUHA 2X0DA 3BD4A 3UBFA 4FYPA 3DSNA 4L0CA 5AM0A 3WTVA 2EDRA 4DUGA 4BMNA 1HZZC 3CZJA 3DSNB 1GA1A 4RZKA 4BQFA 1ND6A 3HG1B 3MLXH 4X20B 4NYMR 3T94A 4Z76A 4R8SA 4ES8A 1J2TA 3DA0A 1G1KA 5EO9A 4E51A 3TSYA 3ZY4A 3SHWA 4FLRA 3RJ5A 4UM5A 1L4UA 5AW5B 4KQ3H 1MW0A 4AGNA 3W3BA 4PJGB 3BSYA 3CVJA 3BGMA 4KZPA 3KKEA 4GKOA 1NLUA 1ZUNB 2XA8H 5KQMA 5IQ9A 1KH1A 5I0ZA 1X7ZA 5AP9A 1BZQK 2ZQZA 5AW3B 2Q29A 5AVZB 1M0EA 3TOZA 3HKEB 1BQHA 1DX9A 1DBAH 5JOFB 1IUZA 2G4VA 3MLYL 5CEZL 1ZX1A 1D3CA 3INRA 1EZZA 4OBWA 1G98A 4P2OD 5DHDA 3OJLA 2C3YA 4UEQA 4IIEA 1GTVA 2Q5BA 3UHJA 5FULA 5K1ZA 5CB8A 1ZJ5A 1NUUA 3VG9B 3GMOA 2F43A 3SO5A 1WF3A 4LY6A 3IP3A 5KQRA 1XCQB 1MW9X 2XI4A 4F9GA 5JWHA 1G8FA 1N5YL 1YB1A 4NDNE 1FL6B 1FVDB 1XKTA 5J9FA 5D84A 5JA9A 1PVOA 1ZGBA 3IODA 4OUDA 4J8RA 3H8NA 3DSFL 3RWHB 4X7MA 2QLMA 4OGKA 4FQ1L 2J6IA 1MY5A 3OEED 4PLNC 4HDRB 1GAFL 4F3RA 1E4JA 2XX1A 3B2PA 3EWIA 3NDPA 4FHZA 4AQDA 1VQ1A 4PGCB 1O57A 3L9BA 3RL2B 4GPTA 3ON5A 3QTTA 1MFBH 1KG0B 2G9HA 3OEHA 3O6KH 1ACYH 3BSHA 3GDBA 3D50A 3EJQA 4IF6A 5CLZA 3A26A 1J21A 1X0XA 5ANRB 4K8RB 2DQ4A 2IUSA 3S1AA 1M6HA 1M7DB 4F33A 5C07A 4KE8A 1O8BA 2QUZA 1J8MF 2A0LD 2FPIA 3O1IC 4G65A 4TLMB 1RZJL 3H4VA 3TVTA 1B8VA 4GM0A 5B37A 5D3MB 1JFSA 4KXNA 2G40A 4DYDA 1CT8A 2DY0A 1T2FA 4K3JH 1QP7A 3C5XA 1NQTA 5IMOB 3AOEC 2F8XC 1WUYA 5FWXA 1R24A 2FQGA 4WLEA 2CE7A 3NORA 3VPAA 3WHKA 4OTZA 2YAMA 3I50H 3ANYB 4UU7A 2EV9A 1HURA 3EOTL 1FNSH 1Q7RA 1T0IA 2TMYA 2V8BA 3QHZL 5JW5A 4OL0A 4PRBB 1CYEA 4Y16B 1MRNA 3FTVA 4DRZA 5L3QA 1XZLA 4G0OA 2NU9B 3LDBB 4DLVA 4OK6A 5AVVA 4TVSA 3UACA 4UPVA 3H17A 2AJZA 5DK3A 4C07A 4TZ6A 1ZJZA 3IVXA 4HF5L 1I4FA 4A5OA 2H0PA 2HPHA 3WZLA 3DYBA 3FUVA 4GZ8A 3QVSA 5FADA 5FHQA 1BAPA 1CC1S 3SODB 1YO4A 1CUJA 5EHNA 2GIXA 1FY2A 4OZHE 4X4YB 2BIOA 2UYGA 3LPDA 3WLMA 2XMGA 5AWNL 4OD1L 3HWWA 4IL5A 2P68A 4WJLA 2NZJA 4DY6A 4OYYA 5I48A 2OYCA 1JTPA 1P6FA 1RERA 5U9CA 4RVCA 5A3RA 1TEVA 1X5ZA 2PT7A 4DDWA 4D3CL 3EIWA 4IK6A 2NQDA 3UYPB 3C3PA 3JQRA 5DVLA 5E8EB 1KIRB 4JPVL 1E2UA 4ZAKB 2Y2YA 1GTSA 4DESA 1OLOA 4XCNA 5FEUA 1CMOA 5FI0B 3BCRA 2XACC 5HUJA 4QGSA 4YMIA 2XNDA 3Q2NA 3BP5B 5HDBF 1OGAB 1ZVKA 2OKMA 2X4QB 1PZSA 1GKYA 1SKAA 5DHYA 4DOMA 5AUOB 1TQBB 2GBFA 4PJIE 5D1XB 4PSAA 3ZDAA 4OI2A 5FUBA 2Y9PB 5K01A 2IGFL 1ZJBA 2ZYAA 3DZGA 3MW8A 3QRGH 4LLUB 3WFHB 2WM0A 3KYOB 4PGJA 3F4LA 3E7FA 1MCQA 1R9FA 4I4CA 1U42A 1MQKL 1B0ZA 5JRJA 2VLRB 4FXTA 2IUEA 1RZKH 2W0LA 4TTGA 3NHPA 4KW7A 1JPNA 4WMLA 2FPGA 3SN6N 4KOCA 4NAUA 1SQ5A 4NM4L 2PU7A 1IMHC 1QIJA 3S8GB 5F9AC 1UL1X 4LF4B 1U8QA 2UYHA 3CJJA 3UTSB 3OJMB 4QE3A 4QWMA 5EOCH 1SVMA 4GAAA 4HLEA 3RWIA 5D1XC 4YMHA 3VOSA 4GKVA 1QKIA 1WZNA 4PPQA 4JJ6A 3NBZC 3BBPA 2UXFA 3AJ7A 4RFSB 3ESQA 2YMPA 3OQ3B 2FHSA 3E2PA 2F58H 3ETGA 2G5BA 2RHJA 2Q45A 2ZBUA 3RHTA 4Q9CA 4PP2B 2J1LA 4KDTA 4DP5X 4LISA 2VQDA 5ANMA 2Q46A 5GWXA 4LNVA 1U3HA 3U26A 1X6LA 2IEPA 1ZT1A 1P8JA 5LQKA 1TSRA 3IHKA 3INYA 3CFKA 5DBFA 3RBAA 3MBWA 3TT3H 2ZRBA 4C0HA 1W8DA 2YW2A 4WIQA 4OFYD 4JFFA 3GP3A 3LY7A 1FYFA 4YRIA 1RK0A 2CLZB 3HTLX 2JAPA 1KIPB 2GY5A 1RAHA 1XDZA 5CLHA 4ZMVA 1JR3E 4XGRA 4R8WH 1TTQB 1VDZA 2Z1PA 4L28A 4ND8A 1JVLA 2GIYA 3QWAA 4TGLA 3QXTA 4M43H 4CSSA 4KZEL 1NVUQ 4Y9CA 2IH1B 1DCFA 4GMTL 3PHAA 2C4FU 4X5QA 2J9RA 3KM1A 1CQIA 3IQIX 4RYLA 4BLPA 5A62A 3TONA 5LJYH 2QENA 4ONFH 3T5DA 1YNKH 3ILQD 4XEHA 2WA2A 1DC4A 4RRPG 1V95A 3IQDB 3FRPG 1UWKA 1P7CA 3RVOA 4OIFA 3JARA 2E0PA 3G9UA 4WY7H 3ND8A 4DP8X 2Z92B 3I1IA 3EBGA 3ZU3A 3NATA 3FCYA 4HU2A 5K59E 1EEQA 3HP7A 3RWGB 3PRKE 4K7PH 3LUJA 3NLLA 1FVFA 4HBZA 3BDBA 3SJUA 3TRHA 2QSVA 3DNKA 1RWVA 4OXQA 2KBFA 1E3TA 4S1SH 1DDHA 5IHLB 2TRHA 2AA3A 2P43B 4HYEA 3N05A 3L1KA 1A3QA 1G2QA 3HH8A 3FYIB 2DJ4A 3W2GA 4H4DA 4X8MA 3ADCA 2D5LA 4PI2A 5JDIC 4GAEA 4LRYA 2YXFA 2JFFA 1JIVA 1LV7A 3MCLL 3VFTA 2YY7A 2FZ3A 5CLQA 2EHDA 5DXAA 4JRXB 5E6RA 1Z5ZA 5LB1A 1WS8A 5EBMA 1UMBA 1NF3A 4JLBA 4EW3A 5LP6A 5IHWA 3U7RA 1M7IB 2H6PB 4HHGA 1BGXH 4DIKA 5THKA 4Y5VC 1IAIL 4EI6B 1NZFA 3N5CA 2YOCA 2WWOA 1KU6A 1NF9A 4FUQA 5C0AA 4EQ3A 1DWOA 1M53A 3GPCA 1M8GA 4CDRA 5FOBB 5KSBE 2C9VA 3P4OA 3VWJD 1WWCA 1HYSD 3KQTA 1FNGB 3EZXA 2F7IA 2QVIA 5E6IA 1Q3KA 1QLRA 1KDIA 1W1UA 2V7WA 5IRCD 4LCYA 3X1FA 4JS0A 1GDHA 1R3IH 3QW9A 1HHGB 1UM8A 3FSRA 1N0XH 1ACMA 3SDCD 3DXAD 3B6JA 1GKKA 3TH2T 1TKWA 1MC1A 4RHFA 1TTUA 4S12A 3QYJA 2O2YA 1X1AA 1XRJA 2PXYA 4J3OD 1XPOA 2AERT 1CXHA 2NXZC 2NZ1A 3MYRA 2XB4A 4YJZL 5FUQA 5KTNA 5HDBB 1SC1A 3QYMA 1JG7A 1Q0TA 4RE5A 3IJHA 3SDXE 2IQ9H 1O6CA 1Q1BA 3FU8A 4IRSD 3WLFA 5SWZA 4DABA 2DWDB 3P52A 3QQ9C 1NPJA 3PGLA 1DVXA 3MJ8A 3ILYA 2PFKA 1G1YA 1RZGA 1OWLA 4EELA 1J05A 1UKYA 3TA3A 4A16A 4QRPD 4GNKB 3BOVA 4A2LA 3NIDF 5E1AB 5C6WH 3F62A 3IT0A 2YAEA 1ACLA 3PRYA 1R8YA 1DZIA 2RKOA 1EAPA 1VIVA 5F1NA 1BFVL 1CS0A 3ZHUA 3NK3A 3IAM1 5B3LA 3IMCA 3K4QA 3VHRA 4NGHL 1GL9B 4XIGS 4KKBC 1GPH1 5A04A 3CNKA 5GJTH 4EJ6A 1I1CA 2XD4A 2BKXA 4MGIR 1USVA 3LS4H 1LDPH 5KEIA 3QJGA 4IV5A 4LC1A 1LTQA 5IF0B 1FN4A 4AN1A 4D96A 4JJ4A 3TKLA 4KE9A 5FBVB 1H3EA 3L0DA 3FDFA 1YEDA 1GSOA 2Q8BH 5CXQA 3PGXA 1XAHA 2Y1ZA 4X0KA 1EK1A 1OPRA 1O96A 4ZQKA 2YAQA 2QDKA 1YHYA 4WKZB 2AXEA 3CVHH 1D9XA 4NULA 4Y1RA 1EEHA 4MW7A 3VFVB 2QX8A 2RIPA 5LMZA 4ABTA 5CEYB 4LDAA 2J3IA 3W8DA 1IAKA 1SBBA 2P8LA 1PZAA 5L4JA 4ZOCA 3PJRA 2JG3A 2J33A 1XGTB 2PGDA 2JKTM 5JPNB 1KZHA 2H4XA 2IGLA 4U1JB 1GZHC 1JQBA 2UZXA 3K8QA 4MD4A 3P71T 3QDAA 2K6GA 2CJUL 5DRWA 1BP3B 3G6JE 1RADA 3GD1C 3WKPA 1YEGL 4FW8A 4UTZA 3CSYB 1QA9B 1Y3IA 4KGVA 3DOCA 3D85A 1MFEH 1FMFA 1SNRA 3WFCH 1XGRA 1UM5L 4MB1A 3SX4A 3MNDA 3B8HA 5C2BH 5FNVB 2BFCB 3Q8XB 4BU0A 4OFZA 1CUFA 3UMCA 3IFPA 2NW2B 4YEFA 3CPSA 4PV8A 4JFDE 4OCYL 4BZ1H 3PVCA 3C3YA 2CVOA 4GI1A 3SC3A 3KLAA 1KJYA 1U8YA 1QWHA 1HESA 1TJ3A 2XFGB 2L7EA 1U91B 1S7XB 5CFAA 4E22A 3GSWA 3MOSA 4ZI2A 1J9GA 2XA8L 3AEQB 3D2LA 4NDMA 3FN0H 4AICA 2GCOB 4M8KA 4I66A 3FNFA 2N46A 1RIVH 3TIFA 2IH8A 4GQ9L 3E6FA 2G0LA 3WDHA 2WI8A 2REQA 4BGIA 3P96A 3N9GH 1ZOOA 3MLXL 5I26A 4WFHE 3LPAA 1DBJH 4WGKA 6NULA 5KYWB 3IVCA 3QUTA 2WTPA 1BXAA 4MMZA 3N76A 1YMMB 1CQXA 1E9QB 2ZKHH 4DCVA 3ILXA 1E9CA 2Z30A 4A0SA 1BM3H 1FORL 3U46B 3SC6A 3C41J 1ZWIB 3FSGD 4MQFA 4UUQA 1G7JB 1NXOA 2HVJB 1KWGA 1SN5A 1TGVA 3KB8A 1DPGA 1HYEA 2IH2A 5AKVA 2HLFD 5LQNA 5DKFA 3VFSB 3FSVA 4ROSA 3KRTA 3E9UA 2DQFB 4F2HA 2EYSB 3CT6A 4JKLA 1T1GA 3S28A 3TIDB 1Q0EA 4E9TA 1Z36A 2CBGA 1ZNXA 2HFFB 1WB5A 1LWOA 2Q87A 5KDOA 2QLBA 1G38A 1DJQA 3EVEA 2HFEB 4L1BA 3ZV4A 4DO5A 2CDCA 2FG7C 2AL7A 1U0GA 4EMTA 1N77A 1H65A 2LCFA 5AW0A 2OMXA 4YP9A 3PHJA 3LRPA 2X5OA 4RH4A 2RHBA 4J16A 3GSNL 3BKJL 4AZ8B 4WFKA 3S4YA 5FV2A 1B8NA 4MV9A 3DLPX 5E2VH 4HX9A 2AXFA 1VHDA 1Z18A 3T9FA 3RREA 1C12A 2P9RA 1G7JA 2B5VA 3R7WA 2NY1C 1H3GA 5SYNA 3CH7A 5ICGA 2ERXA 1FB5A 4LU5L 5ENDA 2YYAA 5GZ6A 5FKAB 2DWPA 1RT9A 3S37X 3WLWD 4OR1A 3EA4A 2WSBA 4A7TA 2B4CH 1RAEA 2EXTA 2PGOA 2Q1SA 1U3TA 2FFHA 4PRNB 4PHHA 4OT1H 2WNIA 1Q9OA 5CZVH 2IH3B 5JR1H 1UFQA 4XPAH 2FOIA 4C6TB 3QC6X 3QLVC 1T0MA 4LSUL 4ONOA 4OY9A 4L85A 1KI6A 1GPJA 2QJWA 3K70B 3LUBA 4N20A 3CN3A 3ZE1E 4QBKA 1VSBA 1NKSA 4H1VA 4RA0C 3O4LE 2VE6B 4P1ZA 4BFWA 1FZJA 2GZAA 5D2LB 4JHAH 3EULA 4WE3A 4LEIA 1DBKL 1MRSA 2WQWA 2DM3A 2PS1A 2XNHA 4Y1AD 4UT7H 5C0RL 4CWAA 2H0AA 3N39C 1XEFA 3G0CA 1J56A 4H3KB 1UH3A 4J0HA 3QISA 4CMKA 4JLRB 4R97B 1TZAA 4KR6A 2IZ1A 4D02A 4DIEA 3F6IA 4TRMA 3HI4A 1TJPB 1BW8A 4FXKB 3R74A 3NIWA 4OJAA 4WI5A 3RTCA 2VSFA 5FCUH 4G8EA 1GGIH 3MA7A 5ENWB 3T4PA 3GSRB 3I72A 2BMDA 2H9YA 3ULAB 3SDCB 1F17A 4R31A 3VPXA 2DVMA 3I3EA 2O61B 2B3DA 5IBPA 1DUVG 1ZD6A 3R1IA 4AIXA 5MENB 1TXGA 2E7BA 2DICA 4BBJA 3EBOA 4Q3CA 2P0YA 3HA3A 4PWYA 4OHMA 1ZVMA 3UZEC 3QIBA 1PD1A 3ARGA 3ZDBA 1LQUA 1JHZA 3EA0A 3IMRA 5IMOA 4YALA 5GS0D 1ZMTA 4QJ3A 5KVFH 1OLZA 4P4SA 5T1KA 4NZDA 1E5ZA 2K7QA 3IO5A 4US2R 3O3DA 1P5ZB 3PE3A 4YUZA 2E4UA 2N42A 1YG9A 5ALDA 2UVPB 1KTRL 3LHIA 5D2NC 1E4YA 4EJ0A 2A7XA 3LZFL 1K66A 1KS9A 5REQB 3EBPA 2K45A 4HATA 5LQRA 1BAGA 3SZGA 2I5PO 1EFTA 3QYAA 1E7SA 1V11B 1PY9A 3VRIA 1YY9D 3HVDA 2VM3A 1JPTL 5LGHH 3HJCA 2HMWA 1I3UA 4TMVA 2FLMA 2O0HA 5I19L 4HB0A 1CFVL 4XCFL 4N9QA 3RKRA 4HG4K 2QPAA 1K7YA 4YO7A 5JNYA 2FPRA 2IGTA 5A6IA 2XNCA 4OM0H 3MUY1 4GE0A 5J13B 1A4BA 3QIUA 3N3EA 4XB3A 2PWGA 2WD8A 5C70A 2YD8A 2AKRB 1FNEB 2R1TA 4FB4A 1RCYA 3JX9A 2CMFA 2GN2A 4G1FA 4C4YA 1R5WA 1ONQA 4RZ2A 5LNK1 3MTRA 2RTTA 1IWOA 2L18A 5TQ2L 2AC4A 3OJ0A 5DULA 4M6OL 1VTKA 3SEPA 1AGCA 2TMGA 1QPXA 5HF5A 4OMUA 3DETD 5DU7A 2CDGB 3HRZC 3WUWA 2C03A 3B9RA 4KBPA 3DDCA 4QI3A 1AP2B 4YC2B 2FLVA 2AQQA 3RS3A 1WXIA 4H2AA 4R4BB 2Q3FA 5CEJA 3GRCA 2VQ1B 3NCJH 3H9HB 1INLA 4XWGA 4WWOA 1DUYB 3IMUA 3A4AA 1T3ZA 2LV8A 2HHHB 4J2TA 2DBVO 4JG5A 4YHOH 2PPVA 1Y48E 1WZMA 4ZX4A 4BRWA 1C7IA 3QHAA 3S6JA 4JVNA 3HN7A 5DRZA 3OKOB 1UDRA 5J4MA 4W9DC 4PG9A 2YWYA 3B6EA 3MQ2A 1L3CA 3IUPA 2CT8A 3HG1A 8PAZA 1KTVA 4XSVA 4LHUA 1KIFA 3PQFA 3B2EA 1W0WA 2QAGC 4Z4GA 4M9CA 1M10A 4O9HH 4OP1A 1MZPA 3CK0L 3O0DA 3EXFB 2H6PA 1COZA 1QP0A 2R6JA 4EJ1C 5EPOA 3SDYL 1I7QB 2N7SA 4HIQA 1RKRA 2AQPA 4LO9A 3ELBA 2ITDB 1IEVA 3OIUA 2YC1B 1L9OA 5FWXB 2EKPA 3IXMA 4IH1A 2EOAA 2XWPA 3MC1A 3MRVA 4XYEA 4NNXB 2ADOA 2HPAA 3CVDA 1JHKH 2C2XA 3Q06A 4PS0A 4J1UA 2W6MA 3ORQA 1XL1A 2F1AA 4ZIRA 1F20A 2X0EA 3JQ7A 4J4PD 1WO8A 1KOGA 4JT8A 3BH8A 1AD0B 4B45A 5GRXG 1T36A 3T6QC 2XZLA 4U5QA 5D1XD 5JNSA 4KLZA 5GS2H 3GKZA 1IEBA 4RSGA 2I34A 3KJGA 3UJAA 4G42A 2KLSA 3BAEL 3EDOA 2APXA 3PQYB 3IP5A 2WG1A 3OFND 4DKJA 5GTDA 1X6VA 1RRPA 4XLTA 1SKQA 5CJQL 2H57A 3RFXA 1QUNB 3TI9A 4ONEA 1V5FA 5HF8A 5ENVA 3H9JA 4LZKA 1A5FL 1EXMA 2BIPA 2Q6WA 2NUPB 3QG7H 4OGFA 3AACA 3QEHA 2QRHA 5IS2A 1US8A 2Y1DA 2IAAC 2OXTA 2XG4B 4XP1H 4FHEA 1ZH0A 2NVUB 3NJ8A 1WKCA 1Z29A 2HB0A 3LNCA 3GUVA 3SG0A 4W9JC 1M2EA 3H55A 5TDOB 1YCGA 2AH5A 3KEFA 3Q7IA 4BH8A 1XLUA 1S89A 3PHOA 2XUWA 1IGTA 3QDMD 4H25B 1WZ2A 1FFAA 1TDJA 1PAZA 4IX1A 3MCG1 1OROA 1QAMA 5F7DA 1E2WA 4NMWA 1VLVA 3KPMA 1E58A 1E6JH 2BHZA 4M9ZA 1RUMH 1ND5A 2A6JB 4U6VL 2WZ5A 1P6XA 1FFRA 1KB5L 1WDKA 1XGKA 3AFLA 4PJIA 1VLQA 3K8YA 1FS6A 4XAQA 4Y9FA 3OY7A 3I5YA 1AGFA 4UMDA 4PV9B 4BZ1A 4PW0A 4JB9L 3WGZA 3L0PA 2W83A 4YNYA 5JW4M 2QEQA 4KN5A 1GTL1 5D6DA 2VHZA 2WKPA 3FJOA 2DFNA 3OQ6A 3ROOB 2HKIA 1T6VN 3OLZA 3FB6B 5E4YA 1AD0A 1XVLA 4JCCA 3E3AA 4OU4A 3WMGA 3VXRD 3EYFA 4BNKA 3N2KA 3DF7A 3DHWC 3DGEC 5GRJH 3MMSA 3WRXC 1SMOA 5AI0A 1BJKA 3H1BA 3NAMA 4ROTA 2E4ZA 1L8AA 1W5FA 3K70D 4AO6A 1IBFA 1XTKA 2HH0L 3UGQA 3KO8A 4WOCA 4JFXB 2NNCA 1YLBB 4MAZA 1JLHA 2IYEA 1NIEA 4IXDA 2K7PA 2ZP0T 3B85A 5D2CA 1PL0A 5F3FA 2PUDA 1K98A 1GT6A 7CGTA 4GEJA 3QIWC 4ZYZA 3N9IA 1DQIA 3EH1A 4ZREA 3OPZH 1LBIA 1YAJA 2P5EA 1WTGT 3UL4A 2W0MA 3LCRA 5D1ZA 3HM9A 2Y24A 2YUTA 1VJ0A 4PD4K 1UG9A 1U3DA 5ESWA 3RY5A 1IO4C 5DJCA 3P0IA 4H1LB 2GPZA 2PTTA 4YSUA 2L42A 1V5JA 5H70A 2GI4A 5B1HA 1WWBX 5E5LA 3V4UH 4L07A 3LQRA 3K5SA 3FWHA 2QYTA 3VW3H 2F5BL 3WJJC 2BMKA 2J5WA 5FNZA 2AV6A 4Q9LA 1Y4AE 2RARA 1T04A 1OAXL 2IDUA 4WERA 2G2RA 2PH3A 3V0FA 1KNQA 1G9HA 1GVIA 3RRJA 2CDFA 1SQFA 5AHRA 1P60A 5B3JF 4R2MA 1BQ4A 3WIEA 1ULTA 1HDXA 2E9BA 4P32A 2JLQA 3UZEA 2FJ0A 1Q83A 2B7DT 4MVJH 1FS4A 1PZGA 3O8LA 1VDMA 3J80A 3B7WA 3NCYS 4R90H 4YAUA 3TPCA 2DF8A 5DO2C 1E9PA 4PJHB 1TM1E 1KU0A 2ZATA 4D9FA 1WSWA 2WC7A 3F3SA 1X7GA 2FPLA 1W72A 4PQRA 1I5OA 3V9AA 3V42A 4BP1A 1ADJA 3ZQKA 3D8MA 3KQMA 4BYGA 1JXJA 4Y2SA 1H8NA 1SJHA 3GMTA 3AHGA 5G4OA 1PUXA 3GEPA 4EFMA 2OWDA 5CFZA 4GR4A 4Z76B 2VLIA 4ZEOA 3HMWL 3LQ2A 3ZIUA 2XGGA 5CFHA 2A0UA 3T2NH 4IBSA 1CRWG 2X1WL 1O0CA 1E27B 1CK4A 3US9A 2ORBH 4CN4A 4O8CA 2HH9A 3BN3B 5AAWA 4TN5A 1FDOA 3RADC 3PWVA 4I0CC 2CR6A 3TBWA 3E3LA 3BXEA 2O9JA 5D70L 3GXTA 4UFNA 3MRRA 1Z08A 2Q41A 2JCXA 2GTHA 3FQYA 1E0SA 5CNJA 2PGJA 3HYTA 1LO3H 2ZTBA 3AWFA 4ILKA 5AKLA 4NCIA 4YXWD 2WN2A 4Y8DC 2LAGB 2GARA 3CVWA 4H35A 3SCMB 2VOEA 4RISH 4IDDA 3UHPA 2RONA 2HU8A 4LYDA 3KB6A 4Z4HA 4ZV9A 5DEFB 4HF7A 5IH7A 1MFMA 3JRWA 1JTOA 4QDJA 3WJJA 5KB3A 5D5PA 3AVVA 3ASNB 4PPYA 2P1DA 5BVJA 5TDPB 2QKIB 4TULH 1OGAD 5JH7A 2HXGA 3EPLA 2KT6A 2PWDA 1HR0B 2QELA 5J3HD 3MBEB 4URKA 5LG1A 1JZEA 4L5FL 621PA 5E51A 3CINA 2VS1A 1SVNA 2CL0X 3SKYA 3WEMA 5KYNA 1UBUS 5TT0A 5KYGA 4L4TE 1NA5A 1RZPA 5JDJA 4N28A 4YLQT 2ZYDA 3F3KA 3WGVB 1E7UA 3GZJA 2HIGA 3AM1A 2B1HH 2BY4A 5A7EA 4MHSA 2PJZA 3AQIA 4N0CD 1EHXA 4Q1BA 4NFBA 3CC8A 3EWNA 4KHZA 4Q18A 3B89A 1QRRA 4YO0A 5JD5A 1G8YA 3OOSA 4RCZA 2QGEA 4RIGA 4EVNB 3VKWA 5ADPH 1GWNA 1EVQA 1Z28A 2VMCA 4APQA 1I8MA 1T36B 2V74B 4UINL 5J57B 1JRHI 2XKJE 3D2BA 3HCBA 2IQAB 3BKYL 1W76A 5EU6E 3A1NA 4C6TA 4IKKA 5KZCB 1C0PA 4M1OA 2WHEA 2O6HA 3IUJA 5JCPA 3RS2A 1GHFL 5IT4A 1VCMA 2O7QA 2YOHA 4UT9A 1WJGA 5CW1A 3IDIA 5GGYA 4JT2A 4ODIA 4NQZA 4IINA 3U7QA 5DQ9A 1J5EB 3S35L 1K9TA 1YH3A 3TNNA 2QFRA 4G97A 4U2GA 3I6IA 1QEWA 4FC3E 1B2RA 3VU1A 3P0YL 4Z9YA 2MSCB 1T2JA 1FDWA 2ZUFA 4WCFC 4IQGA 1KCVH 3T0AA 4QDTA 2VXCA 4Y7DA 1N2RB 3HZVA 3D6TB 4FLMA 4O08A 1U2PA 4YPJA 1SXBA 3KG5A 5SY6A 3WMSA 1AM4D 2OYSA 4RCYA 1IN8A 1GS6X 2ENYA 2J6WA 3TLGB 5AOKA 1RHKA 3HCWA 3QJFB 3EB9A 5F44A 5DRZB 2H9AA 1R3JA 1P6UA 5AW7A 3HJUA 2AS0A 3D7SA 2VATA 4C2TA 3C5JB 3UFXA 2IEYA 2VN6A 4PN3A 2HF7A 3KZ8A 3R23A 1KJWA 5DU2A 2VMDA 5EH1A 4RF3A 4DK6A 4J6IA 1IVYA 3L01A 2DECA 3H42B 4NNJA 2VL4A 4EMSA 3SD5A 3VR2A 5ELLA 3ABGA 4LZNA 5I6MA 4ND1A 1DJOA 5I8EB 5LBSA 2JJWA 3ETJA 2HIHA 4BC0A 3G2JA 4NQDA 2BT4A 5DJYB 5HF6A 3DUFA 2PXYD 4C3ZA 3TLAA 4RA6A 2ORWA 5L7TA 1HG0A 5K0NA 2QAIA 4FFYH 3V1NA 1GCYA 2WUEA 4V0RA 4ZEMA 3MC0A 1Y1SA 4EN3B 2E8YA 3IDXL 5GY7A 2PX3A 5CDTA 5I3CA 1QG6A 1UKEA 1CZRA 1M6YA 1KRWA 4CMCA 5J4LA 1Q0YH 2QQ5A 1USUA 3BWVA 3LIIA 1UA7A 3GEGA 4FJ0A 4CG0A 1KDZA 4KY2A 3OLQA 4XVQA 4CIAA 1HVXA 1JFVA 5JIQA 4X99A 1SBSL 5K8JB 5CWSB 3QKSB 3C7DB 2FR8A 5E2BA 4QM6A 3I9PA 3KPYA 4KRPD 3VX1A 3B83A 5JNYB 4ZHQF 5HYQB 3D31A 3QSKB 5CD5C 3BDYL 3W4JA 4O4IF 4K1LA 2OQIA 1QRNA 4CC4C 3HV2A 1P4BH 1FTGA 4LL4A 1E2BA 4BXOA 1CY2A 4D0DB 1OAYL 4JL2A 3RTGA 4LLDB 1F18A 5A7GA 3V5KB 2WTMA 3KWJA 2FWUA 4Q0MA 1HXMB 4ODWA 3GMRA 1MJFA 1BGXL 1JUFA 4RK5A 3GO4A 4WI7A 1XZBA 1GA2A 4RABA 5HP4A 2YQ2A 2ZYTX 4PHFA 2GK0A 4JP5A 1P7WA 4WSJA 1XCGB 4E3WA 4FNUA 1MFAH 5L4NA 5CF3A 4WAFA 3RI3A 3ZW7A 4JX0A 4I77L 1UDAA 4K8OA 4XE5B 4BZPA 3D4GA 3IGAA 1JZFA 2OWEA 3IAUA 5IBQA 3UOWA 5LQDA 3K6IA 2W00A 4QD3A 1TMKA 4CUJA 1ZJAA 4AY4A 1R0WA 2A1TR 4PO3X 2D1SA 3HL0A 5DK2B 4HDMA 4XMWA 2ENPA 1D9KD 3HOGA 2UZ0A 1I2MA 1FBIH 2NY2C 3UTPD 2BUCA 2P9TA 3FROA 5KNBH 4OGAC 4Q97A 3MRPB 4KI7A 2XOEA 3AT1A 3Q1SH 3DD1A 3ASWA 2XPZA 1W6UA 4EZBA 1EJBA 1GN8A 4CLDA 2WAXA 4WOPA 3OO0A 5J2TF 2R1XA 5EIBD 2QW1A 1YZVA 1LK2A 3IMBA 5F7WC 1G9SA 3A27A 4BSWB 3TI7A 4CLHA 4RY8A 1J70A 3TGWA 4KFUA 3G6AB 4OI4A 3BP4B 5C0CB 4DDUA 3SGJC 5IDQA 4WUKL 4GUPA 3RYIA 1OI2A 5IKPA 5DN9A 4HH0A 2E55A 2NYRA 3ZQUA 1PDWA 4ANWA 1G0YR 4QOIA 5EP4A 4LEXL 1OUMA 1PKXA 1GGEA 2EH7L 1ODTC 3OZAA 2HCZX 2FCAA 4MRAA 2QRLA 5JJLA 2ZWKA 3MV01 5CCKH 3DEKA 2ZOLB 4ZK8A 3LXCA 1P4RA 1TKCA 1I85C 4AT6B 2VDPL 3Q7QA 3URMA 1T0MB 3V8RA 1NMAL 4JITA 4L3VA 3K1AB 2GZHA 1CWVA 1WY7A 5IB3B 3BJLA 5FUCC 3EPRA 3S7TA 3CN4A 2O5CA 3DHJA 1IBGH 2Q2QA 2XHNA 2GZMA 4QPPA 1MI5E 4DWOA 3Q0TA 3VQ2C 3GT4A 4AG4H 2JJQA 1GV0A 3MB8A 2HRCA 3U25A 4XZUB 4I4LA 2PD6A 3LHSA 1O0VA 2ARWA 1NY5A 4GEIA 2OMWA 3V6MA 3QNXB 5IBLC 3SDDD 3E3MA 2CPUA 5CVEA 3WIFB 3T2NL 4H1HA 3S34H 3FUXA 5IJBC 1DQQA 1N5YH 4AJIA 1C9NA 3HBAA 3U48A 1WWKA 4EDHA 3TO4D 1UR5A 5IFJB 2Q0XA 4YHIA 4B0MM 2XTZA 3THMH 3FS9A 3DUSB 5IU6A 2AX3A 4LV6A 2OM6A 2AABL 2YHIB 4PG2A 4WNSA 3O4JA 4GJTB 1TU0A 1RJ9A 2BOBA 4U7WA 1PJ2A 4LPTA 1RI1A 1TPYA 4FQXB 1ZP6A 4PM1A 1AC6A 3HJBA 7TAAA 2XX3A 3QM1A 2ENQA 4UQBA 5AB9A 4Q3OA 3ARDB 3OAZK 1D5MB 4F8OA 1LEKA 1JWUB 3RTQA 2XCSB 4HIIB 4E9WA 1JWUA 2X3BA 3RTQB 2CWDA 1ECLA 1UQTA 4NKIL 3PA8A 1C3OA 4C5AA 2LHAA 3UCEA 4JDTL 1HQ4A 3HFSA 4HQQH 1HDMA 4YRTA 4U0RB 3LXRA 5IHXA 1HDCA 3O0RH 4X42A 1OMOA 4RFNB 2B36A 4FTVB 4P23C 2RB5A 1PIFA 4UNRA 3X11B 1USGA 2YIMA 4G3YL 4NL4H 1NBOA 2EC9T 3GP5A 3C8ZA 1II0A 4HBCH 1C2TA 3ARFD 4WTZG 3QLJA 1Q7CA 4IIQC 1T5LA 4PWFA 2CR0A 2V98A 5DJXB 2GM9A 3GJ6A 2NYYC 2PR7A 1IFHH 2OJEA 2APJA 3BDXA 3VX3A 3QEGH 4X5LA 4NT6A 1MJNA 5E8OA 2YN5A 4II7A 5BMFL 4Y98A 1XRLA 4OAPA 3RU8L 5HVHC 2YV4A 2PVSA 1OGTA 1Z0AA 3PWUB 4JVLA 4ZP1A 1J5OH 2XNSA 1BZ9B 4U2YA 2WQUA 1GZHB 2RKBA 3ZOKA 3NNDA 1C4OA 4PH8A 4B3TB 4NMMA 5C34B 3K2EA 3PUIA 1TU4A 3MFFA 2BGLA 1HMPA 4ZO9A 3VXMD 2OHFA 4FX2A 4AO8A 1Z68A 4JBGA 3GARA 3M4YA 4ODTH 2EH7H 3F7VA 5JPMC 5E5MB 3MXWL 3MLTA 2BFPA 2OXCA 4KIGA 3TWOA 4QGGA 3Q1KA 1Z5HA 1XEXB 1DNPA 3JQQA 1J1OL 4P35A 3QFJD 3PC8A 4M49A 1TJGL 4LHXA 4XXWA 4XN5A 1C3JA 3LKNB 1TTAA 2AQHA 1M5TA 4GRIA 4QWWC 1O6VA 4QAWA 3GUHA 2G5GX 3W6UA 4PWIA 2IVFC 1G21E 2ZKMX 3BD5A 4N7BA 4CIYA 4TVPH 4L78A 4LSWA 2RMKA 4EJSC 1AS3A 4DUZB 2AOVA 1WIUA 4GFTB 2XB9A 4GZ3A 1ZSDA 3FT3B 2B61A 3HGTA 5D7JA 3L0SA 4WFFE 3ZWPA 5DT2A 1SU6A 1J2EA 3EVNA 5K3BA 2FJGA 4F38A 4UT7L 4P5RA 3DPBB 4QOJA 5EPMA 4QXGH 3AG5A 4A5SA 3TCTA 4YHML 5CB0A 1HS6A 2N75A 2YBDA 4DWJA 4MMZC 1A6WL 4NP9A 4I55B 1O7DC 3UMBA 3RT9A 3C15C 1D6VH 4RD0A 2Z65C 3LKSA 3NIFF 2FR4B 1XZCA 3TBYA 5JLZB 4DS3A 4ZFZB 1ZRUA 4GE3A 1EFRA 2C3MA 1ZJJA 1HH6A 4XRCB 3T5WA 5MGNA 2Q07A 4JFYB 2OESA 4YECA 2P4EA 2ZJ5A 4A6YH 2OCJA 3C2AL 4KH1A 3RROA 2EZ4A 5DYGA 5AZ2H 4B41A 5A05A 4HAKA 4TUOA 3FLMA 2P5WD 1OLSA 4F1KA 1OT1A 4B6GA 4B7IA 3AVYA 1BBJA 2IBZX 5JO9A 4L0DA 1I6WA 4MPJA 3GIWA 2B59A 2P8MB 1A66A 4CT5A 1ZR4A 5J47A 2JIXD 2PPCA 5LKAA 1TQCB 2R8BA 4M93B 1V3KA 5KVCA 3AB3A 4GICA 2VJ0A 3PEUA 3KPWA 3W5VA 3DHPA 5EERA 4H8VA 5IWCA 5LVEA 1XSKA 2XT1B 4R9VA 3R7DA 1BOFA 3QWOA 4HP5A 3DBRA 3ZWQA 4TKUB 4QTYA 4JDTH 5FDWB 5H4GA 5BQFA 4B34A 1RCFA 2NT4A 2BHYA 5JCOC 2WF7A 4AL8C 5K9KA 4I2VA 3SIPA 1CYWA 1BIFA 4Q7QA 3TGPA 2ECQA 3DBSA 2HA6A 5I15H 4ZO8A 4PRAB 1TKAA 2J71A 2R8OA 3BILA 5BCAA 4C56D 4MVCA 1U3WA 4F3TA 4JM2D 4GSXA 5IP5A 4RPKA 4WLFA 1WD7A 3HPJB 2JB6B 5HKKD 2A5DA 4JBSA 2HJLB 1QQ5A 4WOBA 3BDAA 1XD2B 2ZR9A 2VNAA 4B60A 3RAJA 2E3VA 2JFBA 2GCIA 5I8ZA 4LFHG 3DUFB 4Q56A 2VZ0A 4PCSA 4KNQA 3SXUA 1N8SA 2V7EA 3OU6A 1Z7EA 4YUAA 4MUEA 2HH0H 3GLFA 4IEFB 3RR2A 3OPYI 3QK7A 4ETNA 2ZUSA 3T7AA 5ESDA 1PKQA 2C5DC 3MWEB 2Y72A 1NCBL 3ELYA 4BWUA 5CB6A 2QJDA 3QLUA 4Z8FH 5KWVA 3LSOB 3V3KA 3UFXB 2YPKB 2J4DA 3NHZA 3C6XA 3LVTA 5FCUL 1JTEA 4PSVA 1NW9B 1NCTA 3HEIB 2QT1A 3R4DA 3PA6A 1S7UA 2NWQA 4GPBA 4G84A 5AKRA 2WTXA 4PQFA 4RDQG 3NJJA 3G5VB 2AEWA 4FS3A 4CF4A 4PJ8A 1FJXA 5JFTA 5DWDA 2J2ZB 5FL3A 3HB3C 4DW2H 4BMVA 1Y6JA 1I33A 2WJJA 3VD3A 1AUXA 4AGMA 4OMCA 5GRYA 4D8XA 1W2HA 3QUZC 1YC5A 2C3GA 3EPHA 3MACL 4RZHA 1S5HB 3DHMA 1CDBA 1M3SA 3U2SB 2FFJA 1RCTE 4BLQA 2KQMA 4FFRA 2HSIA 2DH5A 3T3ME 4BD4A 1NAIA 4AP9A 2GBAA 4HOMA 3FYUB 3LDUA 3DGFC 1RMFL 2VJMB 2BL4A 2EU8A 4O58H 5DHMC 1Z0NA 2OMWB 2ATEA 5DJAB 1OYVA 1WZ1L 1NZJA 5ABAA 1S7QA 2GN6A 1WQ4A 4EI0A 3HUEA 2A4ZA 3CB4A 1B90A 2Y3IA 1JMZA 1WUZA 1I3LA 3Q3VA 5LB2A 2LGNA 2OMUA 4NQEA 4F93B 3PSHA 3ZWOA 3RSFA 2PEZA 4D26A 4AXWA 1IQRA 3W9EB 5KJFA 2WJWA 1CC3A 5KJEA 5BNIA 1WPXA 4CU8A 2H2AA 1CUBA 4WI0B 4OG2A 3W79A 4Z7IA 3UJNA 1I2ZA 1PU2A 2YAHA 4HKZB 4HNRA 4GUOA 3A1UA 4FE9A 4R9NA 3CC5B 1PIWA 5EA2A 2X0RA 1CF8H 2IHNA 1ZLEA 5A6MA 1DBAL 5EWJA 5NULA 1OQOA 2NLOA 3ZEAA 2I32A 3B3BA 4DSTA 1WXDA 5I71B 4C29A 4G9DB 4MRMB 3CE9A 4EKIA 1AQHA 3WGVA 3D4BA 1UM4H 4KZDL 1P1VA 3RAGA 1V4NA 2WPGA 2H1LA 1EVJA 1RULH 2OXGA 5BZDB 1USKA 1QLFB 2ZYGA 2O6FA 4WDIB 1BH2A 2OORA 2E1PA 4RGOH 1QH1B 1OBFO 3U79A 1EQAA 5KNCA 3QFJB 3PD0A 2XTAA 3ROZA 3G23A 3RH0A 1E7VA 5ITBH 3NSXA 1LW7A 1NAMH 5CXUA 4S1VA 3VVBA 2F1HA 4NEHB 3L93A 1OAZL 1X8LA 3CZLA 3ULVF 5AUNB 1QFUL 4HDAA 4HXGA 2B16A 1UTDA 5E4IA 3RFCA 3VYVA 1FBTA 4HWRA 1CUEA 1P5FA 3EISA 3MZTA 1HILA 4XNYH 2GESA 5JZSA 3MLSH 2CJWA 2R87A 1DPFA 2RI0A 4MDIA 5T1JA 4CPDA 3KE8A 4NENB 2C99A 4NO2A 4JL5A 3AMVA 3BXGA 1ECPA 4TXJA 1PLLA 1GZ5A 1N2CA 5AAPA 1K6XA 1AKEA 5FBWB 2KS0A 3GIVB 5ACZB 2ZRJA 3O4FA 2XQFA 4BDVA 5GZOC 1DAIA 2OMVB 3OKDA 4A36A 1TJ4A 1I32A 3X13B 1SA0B 4FS8A 4GP6A 3W9SA 1U31A 4Z0NA 1V3TA 4DHLA 1EBFA 3FSJX 4DPAX 1AGBB 2JKNA 4NXSA 5BQ3A 5DSTA 3RJMA 5LAXB 1YEIH 4MW1A 3FUCA 4IBTA 4M5ZH 2JIBA 4BFKA 4J0IA 4L0QA 3N43B 4JO2H 1NWCA 3DMTC 2GEDA 2WLZA 2NVWA 1L6XA 2XLLA 4NQTA 4FT2A 4H18A 5TPZD 5E6UB 5HKAA 3NETA 3EIOA 2IPUK 3RTBA 4NZZA 5CG1A 4HFWB 4UAOB 2XMZA 2ICCA 5B3NA 3WV4A 5DGXA 1B0GB 3AF2A 1AK9A 1NQXA 3SEFA 1C7QA 1XD0A 3QE2A 3UJJH 4QTUB 5JRZA 3NA9H 5ITFB 3H7BA 4F9LA 3MJ7A 4I0PD 5GGSA 1AOHA 3TQFA