3ZDYB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 110
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdyB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdyB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdyB03
2VDLB 1JEQA 2P28A 1AUQA 3K72A 1JV2B 1BHQ1 1RTKA 1M2OA 3BQNB 1U0OC 4FX5A 1DGQA 1RD4A 1XUOA 1M1XB 1IDOA 1PCXA 3VI4B 3EOBI 2VDKB 3AFCA 5KYXB 2NUPA 3OL2A 5E6RB 4HQFA 4G1EB 3EGXB 1JEYB 4HQLA 2I6QA 2UZYB 4CN8A 3K6SA 2P26A 2XWBF 1M2VA 4MMYA 3ZDXB 3K71A 4WK4B 1LFAA 3EG9B 5LN1A 1UEXC 1XDGA 2X5NA 3TW0A 2IUEA 4WK0B 1PD0A 4G1MB 4O02A 1Q0PA 3E2MA 3EFOB 3HXOA 3NIGB 1ATZA 2VDRB 1T0PA 3HI6A 3OL2B 4F1JA 1QC5B 1U8CA 5KYYA 5E6UB 3AL8B 3NIFB 1FE8A 4UM9B 4O3TB 5HGJA 4HQOA 3V4PB 1YVPA 1PD1A 1M10A 2M32A 2QTVA 5ES4B 3FCSB 1MQAA 3AL8A 2ADFA 4UM9D 3EOAI 4UM8B 3IJEA 4MMXB 5HDBB 1MQ9A 3NIDB 1T6BY 1ZONA 2ODPA 3RAGA 5KYXA 2VDQB 1AO3A 4G1MA 4O02B 5KYWB 2VDMB 5KYNA 2B2XA 4WFQA 1MQ8B 3FCUB 3K72B 1MF7A 1U0NA 2ODQA 3GXBA 4WK2B 1PT6A 4Z7OB 2VDOB 1SHUX 1U8CB 5E6UA 1DZIA 2NUPB 4IXDA 1YUKA 3ZE0B 3M6FA 5KYUB 3PPXA 3T3MB 2VDNB 3EFOA 4Z7QB 4XW2A 1OLZA 4K3JB 1SHTX 3HXQA 1FNSA 1IJKA 1XDDA 4C2AA 4F1KA 3F78A 3PPYA 4PN7A 3OKYB 1M2VB 2NVOA 4MMYB 3K71B 1ZOPA 2XGGA 3EG9A 3TVYA 1IDN1 2I91A 2I6SA 4DMUB 5KYYB 4BJ3A 4IGIA 4A0QA 4M76B 1V7PC 4CNBA 1NA5A 4IHKA 1JV2A 3F74A 1IJBA 3TCXB 4MMZB 4C29A 5KYWA 3V4VB 4Z7NB 2VDPB 1TYEB 1OAKA 3VI3B 4MMXA 4NENB 5E6SB 4JX0A 3ZDYB 1JEYA 1MHPA 2XWJI 3NVQA 1RRKA 3QA3E 5KYUA 2O7NA 1QCYA 4FWWA 3ZE1B 3IBSA 1CQPA 1SHYB 1RS0A 3K6SB 2WINI 3BQMB 1CK4A 3EGDB 1N9ZA 4HQNA 4C2BA 1M1UA 3EH2A 4G1EA 3BN3A 3EGXA 4CN9A 4GZ8A 1QC5A 5BV8A 1AOXA 1L5GA 2ICAA 3EH1A 4WJKB 3FCSA 3ZDZB 3ZE2B 1SQ0A 2NUTB 3Q3GE 1JEQB 3AL9A 1JLMA 2WW8A 3N2NA 3OKWA 4JDUA 3ZQKA 5HJ2A 4MMZA 4O3UB 3PPWA 4HQKA 1L5GB 3T3PB 3PPVA 2NUTA 1SSLA 3TXAA 4NENA 1ZOOA 4NEHB 3IJEB 5E6SA 5E6RA 1BHO1 2VC2B 1N3YA 1M1XA 1YVRA 1MJNA 3EGDA
chains in the Genus database with same CATH superfamily
1CS4C 1T2VA 2BF7A 1AJ7H 1YMMB 2CLEB 5BV7A 4Y2PA 4HFUL 1AXRA 4LZWA 3ZI7A 4YPVA 3OOYA 5JW3L 4OHOA 1DVZA 1WB4A 2H47C 2A3NA 4ZQEA 5F7DA 1HIML 4L8DA 3WLHA 3QKUA 2IYYA 2D5IA 3K0EA 3OAAD 1BZYA 2VF2A 4O02A 3NZSA 2YD5A 1CICA 4KHTL 4NNYA 2Q4EA 3MLBA 1RKQA 3NSJA 5EHNA 3WE6B 1OHHD 1NANI 1QWUA 2X7LB 1VJGA 2KDYA 4NPYA 2C8LA 5HTKA 4GSRA 3B8EA 5A3JA 3OGCB 1Z0ZA 5SV3A 2ZE6A 4OCWH 1Z39A 1F8TL 2JJ8A 4Z0BH 2QZ4A 2WFAA 2WHQA 4KMSA 3P2BA 1ZLUH 2J44A 3E61A 3NGMA 2CKMA 1QE3A 2E89A 3MIZA 4ZVKA 1YRLA 4RMIA 2Q99A 4NRYA 3QUYD 3UUEA 2OSYA 5ID1B 2ZX9A 4N68A 3B8HA 3AB7A 3I02B 2H3XC 4XI5C 1TTGA 2AEPL 3T4YB 2ZJFA 4KXQA 3F2IA 3A7DA 4L22A 1T8UA 4L6CA 2VKQA 1OAYL 3AZPA 4Q4AB 2HCZX 2VGLM 3WA7A 1DCLA 2B1OA 4XO4A 4XYGA 4F3NA 5A6SA 3M33A 2JH2A 2X2FA 2YPVH 3JV4A 1U2QA 1A6TA 3HA0A 3T1VA 4NUPA 1JU9A 3B1KA 5LP6C 5C0IB 3Q2WA 3VXUE 3B70A 5F2EA 1RM3A 1Q0HA 4IIJF 2EYSB 1NDQA 2QL9A 2CBPA 5KS9A 2DWOA 4U2BA 3PDIB 1CGSH 3D51A 1ORQB 3KWJA 4X0KA 2QDVA 2QN9A 4PRID 3AI2A 4X4MA 1IRXA 3OCYA 2Q1XA 1H69A 1NZRA 1AK2A 1QAOA 5AUNB 4Y4KD 3R18A 1P9OA 1E67A 1IBHA 4ZFGH 2O7RA 4MV3A 1G4AE 3GQVA 3NSFA 4IXNA 3L13A 4ETIA 3VXMB 4B31A 3KD4A 3BE8A 3MSCA 1FPTH 2Q8QA 4R7TA 1BGXH 2YQBA 3IHWA 4F5CA 2KI6A 3GJQA 2D54A 2GN2A 4GRWE 4NUQA 4F91B 3AJRA 1VC2A 1Z2NX 4HUMB 1EXWA 2C1ZA 2UXGA 2WLNA 1YEJH 3TEFA 4TRJA 1FZMA 4ZAKB 5EVJA 4QQ8A 5EERA 3F1KA 3HG5A 4KNQA 4R3NA 2ODNA 4L9WA 1E2NA 3GFRA 2IPNA 1XTLA 5DLML 3DMYA 2VLLB 3ROLB 3VRLF 3QDJA 3KVVA 4A7GA 2AUNA 3S2FA 5LA6F 5JMPA 4KUCF 2XBDA 3Q7RA 2JGKA 1WEKA 5C9JA 4FLFA 4LRSB 1IXZA 2I3GA 5GIOE 4Z7AA 4BZ2L 2J0EA 1UM5H 3KU1A 2ADIB 3WJAA 3DLCA 3UJIL 2NR6A 5JPNA 1Q1JL 1LI4A 5C0OE 3BEWB 4DGQA 1JLLA 2V6IA 3GMPA 3P9YA 4MD0A 1PF3A 4OI0A 3HG1A 2Z7WA 2R1WA 3MTGA 4P35A 2HO5A 3M1AA 3M1BB 4NXKA 3T8YA 1INDH 4KROC 3CUTA 3SU8A 5KJ4A 3WIFB 4FFLA 1PN3A 4BE7B 1DDHA 1SC9A 1ZTXH 5D1XE 1FTWA 2GXQA 1ENPA 1JF1B 4EIGB 1GO2A 2AAVA 2R9VA 1ZH4A 1U3TA 3RWBA 4U3CA 2L3BA 4F7EB 1T83A 3FRUA 1VYTA 2JBAA 5ALYA 3MO1B 4CLHA 3KBHE 1NC4B 4ZO8A 2DF3A 1ZM4A 2DQTL 5KVGH 3JQPA 3LRSB 4HKJB 1DO2A 3GEBA 2P6PA 4Z4FA 1FZOA 4H6WA 4KFMA 5KYUB 4MA8H 1NUDA 5JS1A 5BRJA 1GKOA 3FONA 4N0EA 4LHUA 1GGHA 3T5MA 2JMRA 1Z9OA 3T0EC 1HNNA 4YO7A 3IDIA 5D1HA 3CZ9A 5THKA 1DJWA 1A7OL 1P73A 3L95A 1A8PA 1U6KA 3Q5DA 5AM2A 5EHQA 1XQXA 3BWYA 5L3SA 4Q1BA 3QI7A 3TH2T 1XG5A 5BO5A 3QK7A 1P75A 2W6MA 2K8QA 2MCPH 4NIKB 2VR9A 2Z8SA 4DLZA 3VTTA 2QV7A 4JJOA 4Y4HC 4FONA 2WB7A 1TJNA 4OGWA 1K4KA 1SXCA 3G85A 4BV1A 4CT5A 4LGMA 1E4OA 1R6XA 5EHXA 1D5IH 3K4PA 3WHKA 1IM9B 4CMKA 2Y9PB 1J0CA 4YACA 3FB5A 1D2GA 2OC9A 5TFSH 2V2TA 3C09B 5BZDA 3CB2A 1OLXA 2W9DL 1NQWA 4CN6A 1NLMA 2HQSA 4WO4D 3HPLA 4V0QA 1DQSA 4KQMA 5DHRA 4DNFA 3E18A 1TM1E 4BKUA 1R19A 4OEHA 1JXFA 1XZBA 3M4ZA 4POZC 4HIHB 1Z7JA 1DXOA 3IXLA 2WPDD 1BQUA 1HC7A 2B2XH 1ZSHA 3HNPA 3FOBA 2ZSUA 4FR5A 4DUVA 1TF4A 3FR8A 1N5JA 3PC2A 3CZCA 1OGTA 3A28A 1XH3B 1YL6A 3UAJA 2WIKA 1J86A 3O2NA 2NPLX 1WEHA 1YQEA 1YPZF 4UEQA 4YAEA 3RQIA 1S02A 1JMXA 5IF0A 1MDFA 3OKKB 2XN0A 1YPZE 2DQZA 3NOOA 4IP0A 1KJMB 1USWA 3L07A 1BPVA 2Q3CA 2OOKA 4K7PL 1T83C 2GCEA 4LZZA 4DJFC 2XHNA 4UHJA 2I65A 2ZWOA 1E28B 3QJOA 1AX9A 1II4E 1UJ3B 5REQB 3OKFA 4MTCA 4WGWB 3X13B 2CK3A 3DDZX 1LJUA 1CD1B 1R0SA 4ZRMA 4UUPA 1A3RH 2H1OA 4CKCB 2XE8A 2REQA 1KGIA 2XQIA 1U8NB 5IUKC 1YVRA 5CLFA 4LSRL 2FH6A 4NN6C 5DIZA 4LIPD 4OCZA 1G1KA 1GT91 3X2SA 3K9QO 2VUUA 4BXSV 3T7DA 1A69A 4MP3A 1V55B 3N04A 2H0JA 4DLTA 1GYQA 5BQOA 3U4BL 3VU9A 1MF2H 2ARJA 2MCAA 4IBLT 5BW7C 4QREA 4RY9A 1JVBA 5E6ID 2WBXA 3QDMD 1JTEA 3BICA 1PPIA 3ETLA 4Y7DA 3ARDB 3LKQA 2AERT 1OTYA 4NJAL 2OTWA 4AE0A 2A5JA 1J8VA 1O7DC 1Q8MA 3TSOA 4CJXA 3HNTL 3WGOA 5TE7H 1NC1A 1MHEB 1MO5A 3QUSA 3SX0A 2C4NA 3ZLVA 2MQ0A 3N6VA 1B1AA 5EC1B 3O3EB 5IZCC 2P6MA 3G5LA 3KCQA 3RJ5A 1D2MA 4PJHB 1KK0A 5KYWA 4JV5B 1D6EA 3V00A 3EFHA 2AXGA 3RX5A 4WN9A 5B4MC 2YBDA 3Q8LA 4J29A 2AX3A 4D3FA 4DTGL 1CKEA 1PLCA 4D9BA 3L6CA 2VQ1B 3VXQB 1HYBA 4J76A 3ASVA 5BMVB 1KAHA 4KTYA 2EDTA 2IANA 4PYGA 5MI0B 4DA7A 2BVQB 3BMOA 5D1XC 4RVUA 5LKAA 2WJJA 1LL1A 4QJ3B 1A6VL 1BE8A 1CDZA 4ETMA 3U9TA 5EXDA 5DM2A 1F13A 2VERN 3K16A 4RGOL 4XPZA 5E0KB 2OMUB 1VESA 3N3BC 1GVIA 1DAOA 4BKLB 3KLHD 3ROXA 2V7NB 1BGVA 3C8MA 3ULUD 2VDOL 1UOWA 1N9PA 2QVXX 3EYVA 2W48A 2XZDA 3MUNA 2RI1A 1E27A 1EZUA 1AVTA 4JUAA 4XCCL 4OLAA 4P9HH 2FATL 4LWZA 3FI9A 1DBVO 3Q6GL 2YC2C 3OSUA 1MXFA 2ZROA 3EIQA 5I7EA 5KG9B 3SBPA 1I9CA 4GS7B 4MYDA 3F04A 4YV2A 4B6GA 3HVIA 3BESR 4QUBA 4YHNA 1DUYB 1BVRA 4DJMA 5KSAC 3L8DA 3SZKC 1LYQA 1QB8A 1TZAA 4X4YB 2CLCX 2DBZA 4A9AA 3DJSA 4LDZA 1ETB1 5F1KA 2R56L 3ZXYA 3AFIA 4IJWA 1JKMA 5FHBL 4YHPA 3L8MA 1X5YA 1KJ2H 4JXXA 5L2KE 3LRMA 3CZPA 4LCBA 4B5EA 2AXNA 3SQXA 4YP7A 2GT1A 3KTAB 2BE9A 4P46D 5C0AA 1W5AA 4OR1A 1SC3A 2TSYB 2Q5CA 4ZHQB 2VJXA 3LZCA 3TTWA 3H05A 1D6NA 4N7BA 3CLWA 2WHYA 5A2QA 4EI5A 3HUUA 3EYOA 1E2BA 1R0AH 1RWPA 4Z1PA 1NXPA 1YNSA 2B1RA 4XDYA 4OKVB 5HBBA 4B9AA 4IS3A 4I3HA 4J4PA 3SDXE 3JYPA 4IIZA 4HJJL 3QVLA 4H17A 3CZ5A 4ODHH 3TLCA 4QT4A 4M87A 5A6VA 4HISA 2HHCA 1J23A 1RRFA 4HUTA 2Z64C 2LE0A 3ACDA 4XCQA 4OD2B 1CERA 5F3BB 3WY1A 3EHBB 3D81A 3ZL4H 3C6XA 3LUHA 2J2ZB 5GZOD 1A7AA 1ZD4A 4U2DA 5JXEA 1TKCA 4JI4B 4ODTL 1JMKC 3PPXA 1JJ7A 1I8LC 3WKCA 1YNLL 5EUKB 2YRFA 5COQA 1AKVA 3EOAA 3NZ8A 1E1MA 1XA4A 3IJPA 1WDMA 1D6JA 3ZV5A 2QE6A 4P49A 3EARA 3BWSA 2O0KA 3CLSC 3V5NA 3T0XA 4WI9A 3VD3A 1JA9A 4PRIE 1HLGA 2QTNA 3QVGB 2ATCA 3EXHA 3FT4B 4NF2A 3LZQA 1FF5A 2ZSWA 5EO0B 4J16A 1X1BA 1QRNB 4HQRA 3MWEA 3HCFA 4P7KA 1GA6A 4MGEA 1OYWA 1B9KA 2C5DC 4G1UC 4Q16A 1AKEA 1UZ8B 3A6BL 3ER9A 1FH2A 3UG7A 3TCLA 4J1NA 4GUPB 1JGVL 5IVDA 4F60A 3WDSA 1MRFL 1FJ1A 2WP3T 1E89A 1U3UA 4D7PA 1OANA 1Z8NA 2PHZA 2H32H 5B3NA 5AW1A 1CL7L 4Q8BA 3BP7B 2QORA 3WEAA 3P5BA 1TMCB 3DYOA 4YHIA 3FVTA 1Y5NA 4MJ6A 4O2EB 1UJ5A 3GSUA 2MSKA 4J07A 2AVFA 3FRPG 5CHNA 4YJ2F 1QW8A 1N2IA 1D5ZA 3HJ0A 1KT2A 1E6OL 2GFHA 3MV8A 4M1DL 2GCOA 3ZE0F 2NTEA 2VN8A 3KPNB 3GNSA 2GIYA 2ICEB 2Y8EA 5DMHA 1W30A 2QLTA 4MZDA 3TN7A 3UADA 1E30A 1MJGM 2EC9U 2JLYA 1CZRA 5SY6A 2QA5A 3NCWA 1CLCA 4LV8B 1JJBA 5A2IH 4BIKA 1ATIA 5LYYA 4TNGA 4PS0A 3IL2A 3FHTA 4F8LA 1JNNL 4WOBA 1UH4A 4Y7MA 1A1NB 1JFTA 3GJ8A 4HBCH 1HSBB 4DANA 1GR1A 1KXVA 3GJ6A 4PHXA 2B59B 4ZTOH 1N5IA 4IGIA 4FOSA 1WA1X 1Z2EA 2XT1B 3DQZA 4PIMA 4MCJA 4JFAA 4EOWL 4G6ML 5EMLA 1NBQA 1UFVA 7REQB 5TQ0H 3FQ1A 2DQIL 3LPWA 5DD0H 1QCCA 3LU1A 2CFSA 3O2DL 2FSHA 4HULB 2ZRCA 2GAAA 2F7QA 1BKDR 1CUCA 1BA3A 2O1WA 2UVQA 4NBLA 2X4PB 1S2OA 4N2HA 5FF6B 3CPJB 4NBKA 3EJJX 4NYIR 3ARFD 5B3SB 4AJPA 1LCIA 4AV0A 1YZTA 4DJTA 4JT2A 2NZ2A 5B57C 3FMGA 4G1BA 4MAYB 5K3FB 1TOAA 4PJBA 3OKOA 2KPWA 2FSUA 4YPGA 4X71A 2Q1WA 2BP8B 2CGZA 2KLTA 1BX3A 1OWLA 1LQUA 2IOHA 4DZ8B 2VRCA 4PRPE 2XWQA 4N2NA 4UCQA 4W9EC 2NY3C 4N18A 1MLCB 4WTZG 3HJUA 5J0BA 3D2CA 3S36H 5GRZA 3OTQA 3REFA 4XQGA 3TDMA 5FLYA 3O4GA 4DWOA 2PPVA 2AQHA 2O3QA 3VYSB 1WW8A 4FNTA 5EOCH 3SCMC 3HLYA 1NUTA 3FSAA 3ARXA 1V6AA 6FABH 3ZW7A 5M7EA 2A78A 1UWYA 3PEYA 3BVXA 1QKKA 2XZQL 2P4AB 2O8BA 3GCWA 5DK6A 4ZMYA 2HB0A 2BP7B 4YJKA 5B1HA 1BDHA 3P73A 3MMZA 4WZBA 3G49A 3DRTA 4P2RE 4M6WB 4EG6A 1U0BB 5HIAA 5I8ZA 1S89A 2PJRA 2JI1A 2A77L 4BK5A 4J7RA 4XLLA 3QDJD 5LYJA 2GSDA 2QW1A 4D0LB 5IW6B 5K39B 2J1XA 4HD5A 4KXBA 4WV3A 2NYVA 1SVOA 1HE4A 4UV7L 4C4KT 1AS2A 3SHWA 1KMHB 4GWKA 3U0TB 2FSDA 5BRAA 2HT2D 1SURA 2WC1A 4PC1A 4HKTA 2A88A 4IW3B 5AK6A 3ULVL 3VR2D 2WHRA 1XA0A 2J9ZB 1IOVA 3W9DB 1SJVA 2P7TA 1FFCA 2JVJA 4X7SL 5CR1A 2EXXA 3NBUA 1SIUA 1SULA 1DVXA 4GSXA 3PCTA 3VFWA 3LHPH 4AQAB 1Y82A 2AJSH 3SIPA 1L6IA 4ZOQI 1Y1SA 4K40A 3B5IA 2Y69B 4UE2A 4MRMA 3PUWA 2DQCH 1RLJA 2FF7A 3NQ41 5IIEB 3O26A 3JV5A 3PX3A 5JMWA 4QYTA 4TMYA 2JIZA 3MUZ1 3BWCA 5IMLA 3GZ4A 2BIMA 4IHQA 4J7CA 3GGOA 4NU0A 4RD0A 1SXZA 5CVUA 5CCBA 2QPAA 2QT1A 3O90A 2R29H 3FPGA 4Y5VA 3K2EA 2Z0UA 3A1WA 3C41J 3CRQA 5FW8A 4ZMTA 1QLHA 1A2OA 1NOLA 3LO5A 3DHJA 4LLAA 4RQQA 3RVRA 2ZTBA 1EXGA 5C1IA 2FPIB 3E9YA 1FMCA 4EN2A 4MX7B 2SBTA 4WFFE 1I6KA 3MLAA 2UZ1A 1J22A 3T3EA 1CP2A 4LOIA 4RJLA 2J59A 3EJUA 2GBCA 4TSRA 2CL7X 5AKZA 1GAQA 5IEKA 5HYJD 1OTUD 4PO9A 3LIZH 4HDKB 1M5RA 4FYPA 4L3AA 1NUSA 4D82A 3HFML 3WZLA 1JJFA 2G83A 4LARH 5L7YA 3QUYA 4P0TA 3S4SA 1H2WA 1M8GA 4OGLA 3U6XS 2C5BA 1KR2A 4HWKA 4LOEA 3D8UA 2ZSKA 3LQQA 4PSAA 5C0BE 1J99A 5CEZH 1N57A 2XN9E 5FK9A 3WFDH 2BZ7A 2IAMD 1UCBH 2PXYB 2P4SA 1GYPA 1J49A 1PU2A 1A72A 1N3BA 3EXAA 1OFTA 2D7DA 1YC5A 4BXOA 4DK3A 3C3YA 3ERCA 4PYMA 4M1GH 3S27A 4L8SB 2AEIT 3U2SA 3CR3C 3KJ6H 3P11H 3WHE1 2C9SA 2L04A 4M7JH 4CF5A 1P9RA 1LLQA 4MVWA 3P9ZA 5AK3A 4TUYB 2R2BB 1GPMA 5FOSA 3AVWA 4GM1A 5BUGA 1SZCA 2H5LA 4RGNC 1EXUB 4CV0A 3A11A 1U7ZA 4CKBB 5FLKA 2WF5A 2WGNB 4AL8H 3OURA 3BT7A 3FGOA 1N3IA 1MJ8H 4PVCA 3TLAA 2NXZD 1TCRA 1D9KB 3P9KA 1WG3A 3L1JA 1TJ4A 1KS2A 2NY6D 4MMYB 3WMQA 2G9KA 3NCTA 3S5LB 2PRZA 2L69A 4URZR 3TR5A 5C7XH 3LUJA 1A9EB 3SKNA 2ACWA 3QDMA 3MBWB 5MN6A 1ITZA 4FQIL 2VXBA 4RVGA 3BD5A 1W36D 1QFSA 1YZUA 4BFIB 4JNCA 1H8ED 5KVDH 2F19H 2V0GA 3KTOA 4MIKA 4M3JA 4GNKB 3L54A 3DE2X 3KPWA 2Z5VA 1ZMBA 3WV5A 3HE6C 2WW8A 3FPKA 4PZ9A 3LV3B 4EXPX 1S7RB 4HS3B 3PNVA 1KVRA 4Q15A 1JYFA 4ZFFA 3ZH2A 4RF4A 1RWMA 4YV7A 3OMNB 4NRZB 1LSUA 2EZTA 5FUQA 2DMGA 4L37A 4UINL 5EA0H 3F8UB 4EJSB 1R5IB 1EFUA 5EWJA 1T5WB 3VQMA 4E4RA 1W6UA 2Z92B 1UEXC 2GEEA 1AXGA 3E0XA 1GZHC 1SN0A 1BYIA 4PCYA 3IWUA 4HB4A 4M8NE 3IU4L 4LQFL 1I30A 3L02A 1MQ8A 5H16A 5I71C 3LLMA 2C29D 4KI0A 5HOEA 1UANA 3CFYA 2VWHA 3IDQA 2D62A 1I9GA 3UV6A 3G0CA 2YJLA 2VQ3A 3LN5A 1AGRA 5D1XD 3LTVA 3ZOKA 4MFHA 4W9IC 2HN7B 5IBTL 4JRLA 4UCWA 2AABH 2QVBA 3QLJA 1YA5A 3JTMA 4RZ2A 1E0AA 1SHMA 1MQSA 4ZOLB 1L4EA 5IP5A 1N4AA 5I16A 2YD7A 2CV2A 4OCNC 1P2DA 2VWEC 1I2BA 3V5HA 4RTSA 4F6RA 3TTXA 3X2FA 3NAGA 4GMKA 2D6FA 1FYTB 2F90A 5LLSA 4FG6C 3AKYA 2AJZB 1E2UA 1J5OH 4AIEA 3CJJA 3VXNA 3I9LA 4AVKA 5HDOA 1FRNA 1KDTA 3GCDA 1RAIA 4LTDA 2CA4A 5I1LA 3H8WA 3IH5A 1CNFA 3FUJA 1H9BA 3WI9A 3QEMB 2BS9A 3KS0H 2G4EA 5MP6H 3US0A 3ULAB 3IYLW 4TXNA 1O5PA 5C08E 1YEIH 2ZXAA 4IJVA 1WPGA 1ONNA 5E4FA 3V10A 1SELA 2OXEA 3EGVA 3FU7A 1HYEA 4PJXB 4L51A 5BZZA 2AK3A 4GBMA 3FH8A 1RIVL 3D3VD 2W6JA 5EJ2A 5JPMC 2VUTA 3RFTA 3KB1A 4XI9A 3RDPA 5SY9A 5E9DB 2IAMA 3AGVA 4Q4JA 1T04A 3D4ZA 3K1TA 4J8RA 3RSCA 5DZJA 3LM8A 4Q02A 2ADOA 1DVQA 5JY6A 1MJFA 5FV2A 3HE7D 4D4MA 4ZJYA 5DBFA 4GI3A 2C7UA 4H8WH 3HKZA 2YNMC 3DLPX 1INQA 3JQOB 3WSTA 1R17A 5G2NA 1YB1A 2IBSA 1URZA 1DJXA 2X10A 3DXZA 4MRPA 3DBRA 1AGEA 4HT1H 3GIZH 4WY7L 1VKNA 3KNBA 1T26A 5EQTA 2ENUA 5ABPA 2BBWA 4JJFA 3NVQA 3NX4A 3RY5A 3STLB 4MNHA 1CYEA 4IDNA 2QPOA 1ZDMA 3MQIA 1G8HA 2PV7A 1DTUA 2ORYA 2ZGVA 1PYGA 2WEKA 1T4CB 2VUYA 3EEOA 2WD7B 1IWBB 3WEBA 1XH2A 3HKBB 1P4UA 3CFMA 4M7RA 3A5VA 5JLJA 3AU0A 4Z9YA 2DUJA 1AHIA 1P84J 4KWUA 4WN9B 2GRJA 5JASA 1H8HA 3MI6A 2EVJA 4R26L 3GBEA 1AD9B 1CGXA 3EO1B 5HGBB 3SGDI 3VBEA 2C8KA 2Q5FA 3O7WA 4L5FL 2VDWA 1OTXA 1XHEA 1WMAA 3C5ZB 5DHSA 5EXSA 2C9DA 1THMA 2ESRA 3G5UA 3WJ1A 4EYKA 3LKPA 1ULAA 2B99A 4FG4A 4BBWA 3A58B 3DBIA 5HYQB 4PJ7F 1RZKH 1MFAL 4AT6A 3NAMA 3TVMA 3A1UA 3O8OB 2GF2A 5B2EA 2ICWA 3SPCA 3CLVA 3V4RA 4O2CA 4GUQA 3TNLA 3RNKA 2IDZA 3O2JA 4F1KA 4NGHL 1OP4A 1E32A 2VDKL 1OKKD 3WK4A 2R8ZA 4DV0B 4J6FA 4L9DA 2H6OA 1G7PB 1VGKA 2VUOA 3SYCA 4HEPG 3QH4A 1ADQL 2E86A 1E66A 4HRXA 4JJIA 5TPZD 5C31A 4G0XA 5DHQA 5I5EA 4LBEA 5DJCB 1X7WA 1D8AA 2EDXA 2YMLA 4C87A 3W6NA 5C8YA 2H9YA 2XZQH 3OVMA 3PHIA 3EOBA 3DAFA 4FXGB 1UPTA 5K6AA 3KV1A 4A39A 4RRPM 4PB9L 4MVJI 2BZSA 1T1YB 4B0MB 1QIIA 1BJ1H 1UMCA 5C46F 4LGSB 3C6SA 3RE0A 4Y9CA 4JUIA 3E2HC 4JI0B 4TQUS 1S9DA 1J6UA 3HL4A 1YQTA 2FW8A 4UOQA 2XPGB 4LF3A 1DANU 1B8PA 1DBKH 4BLPA 2HJKA 1GTG1 3MA7B 3FTYA 1FX0B 5M29A 3K70C 1FVCB 2HRPL 1XFAA 1HH6B 1NUNB 2YKLH 5K93A 3N5AA 4E9XA 1BO6A 3X1NA 3C7KA 1MFUA 2EE0A 3RWDA 1ZOIA 3F49S 3QXXA 3MRMA 2DKNA 4OLXH 2HU5A 3HEMA 3H3BC 4PRKA 4REQB 4WWKD 1U4NA 1WUHS 4RA6A 1ZL2A 2GD2A 5EUOB 3CLKA 1RZ8B 1ZM9A 1RWQA 2ZONA 4QBFA 4HT1L 2CVHA 4HG4J 1CP3A 3SZ3A 1ZONA 4GZMA 5KUMA 1HZJA 3CRNA 1X7QB 4Q1DA 4IV5A 1CJTC 1GSHA 4FFDA 3LP6A 4CVXB 3KL4A 5CK5A 2XQBH 5KX5B 2PKYX 3VI4A 3MXWL 5C08B 1JZJA 4ZA2A 5F5NA 3A24A 4BH7B 5E8OB 5CT6A 5SWQA 1GPNA 3QKSB 1FVFA 3GGDA 3HB0A 5JD5A 4TUKH 4F6LA 2FPUA 4LPVA 1FNDA 3TUJC 2A9BA 3NEPX 1YRBA 3BP4B 4IRJD 2FGWL 2BSDA 3ONNA 4P2OD 5EBWA 2HIHA 4JY5L 5FLUA 3RJQB 4OFXA 4X9IA 3MMNA 3SD5A 3ZUCA 3QIAA 5GRUL 1X87A 5LXTB 3SDCD 3PIRA 4F3FB 2R7EB 3TKAA 1UEIA 5SX5K 1UA7A 3CH5A 3NLLA 1CJSA 2ORWA 4OK5A 3IALA 1SCIA 1EA5A 4O4LF 5FPQA 4XQCA 5TD4A 4B3SB 5C18A 5IR1A 1VBMA 4R7VA 4HD8A 3UMMA 1LPSA 3L7YA 4BVEA 4MWZA 4NBRA 3GP3A 2DB8A 4ONGL 4RMRA 3PC3A 2AV1A 2Y7QB 4G2AA 5FBQB 3ZWCA 3LDHA 1EFPB 3DUHA 4EMTA 1NE7A 4Y0AA 3MJEA 5T1LA 5CCKL 3IDUA 5EF1A 2PMEA 4HG2A 1UASA 4MSWA 4AG3A 3RJOA 1QVVA 2CLZB 4QY8B 1NFDB 4PWKA 3QJHA 4A3SA 3TJPA 4G89A 4FHFA 2A4EA 5EKSA 1GG9A 1DLHA 4IZOA 4F86A 2H2PD 3G1TA 4XZUA 3RFZB 5JHLA 5EZPA 4NI3A 3TA3D 3TEZA 2QPLA 2V7PA 5IK3A 3AR6A 1E42A 5HBGA 4YXHH 1RC0A 1RQLA 5A7FA 2P5WA 4HQQL 3OESA 3OTWA 4MJ6B 1UODA 1IEVA 5CJQL 1F02I 5I75B 2PD6A 1D5ZB 4B46A 3HPJA 5F9WC 1G5QA 2FUG6 4M9RA 2GCYB 4AJKA 1TKWA 4PJIE 3PC8C 4BYGA 4EW6A 4ELMA 5EO9B 3GVIA 2R4UA 4KVNL 5E2JA 2IZ5A 5F7XA 5DGTA 3OQPA 5L6YH 4OJEH 3OJWA 3W2TA 5EF3A 5ICFA 2WUDA 5ULLA 5ANHA 4DKTA 3CWQA 3I2YX 1U3HA 4IU3B 1X7SA 1G7HA 1M72A 5FYLE 5CDFA 4QZVA 4R1SA 5GOZA 2ZJ3A 4Q7MB 2H54A 2YFYA 4BQOA 1T6XA 1U2HA 2VSOA 3FB4A 4B8ZA 3ELQA 3P54A 4S1OA 4X0EA 3EGSA 1KGCE 3KLOA 4B84A 2WSSD 4B3IA 1AE6H 3W39B 3GNML 4PJDF 4QXUL 4BZ2H 1F6BA 1IC6A 1ZZGA 2OD2A 2YTZA 2LV4A 1OK0A 3SSOA 1IWOA 1OXBB 3E5RA 2Z8WC 3RRQA 5KVDL 4MQUA 5ESAA 1ZOXA 1RPKA 3NTXA 3REWA 4LSSH 4GP9A 4XBPA 4OTXH 2PPCA 3OM3B 1Y5LA 1N4DA 3M6IA 1XWWA 3QDAA 2PO6D 4BVFA 1NCBL 1U04A 5E95B 4G65A 5AJUA 1KYOK 3RG8A 2J57A 3FDFA 3KWFA 2QRUA 1QPKA 4BNGA 1G2QA 6PCYA 4BRWA 1DBQA 2JAPA 3OAYH 3CS3A 3NH6A 1QR2A 2PN5A 2FEJA 5FO9A 3WJLA 1V41E 5EUMA 2EQBA 4XVOA 3N41B 3FCXA 2SICE 4C4OA 4PYHA 2VBIA 2P8PA 1F2UA 2HLAB 3AUWB 2HTLD 2PK3A 3QA3E 3APMA 3EH4B 1M7XA 4NECA 3UQZA 5GGVL 3QEGL 4JUDX 3UG5A 1Q7BA 2BPBA 4FOLA 3TSWA 2XTAA 5BV8A 4EG8A 4WVLA 4N0UB 1R6TA 4WZBB 3K6DA 5BUAA 5EDXA 1U9ZA 1Q3HA 4Q4HB 1MAJA 2QZ5A 2BEJA 3SFVA 4L23A 3F67A 3X1GA 1OX6A 2PLFA 2RHGB 3AOGA 2VPIA 5LNDA 1IAIL 3MJ7A 2DY1A 4Y2YA 3UIZA 1HL5A 5DD1L 1IFHH 4OHPA 5AHKA 4JBLA 1SBCA 1FRVA 1XRJA 1T20A 3AIMA 4YXHL 1EFHA 1GYWA 3VD0A 4CPDA 2M8XA 1VYUA 2AIRA 1NVKA 3DT8A 4KX5A 1GKEA 1MCQA 3FKSA 3LWNA 2TS1A 1QFZA 1YC2A 1HTWA 1IHXA 3QZOA 1GU0A 4LV6A 4HWBL 3G6DH 1M2NA 5D5MB 3DVNB 2EICA 3VXRE 5TK2A 3AR3A 4EKJA 5JDSA 3I5MA 1S7XA 3ZQ6A 4R9HA 1QR6A 4DHEA 1IMHC 3GEIA 3A3NA 2WUWE 5J2UA 3JAMA 1DFBL 4G63A 3FU5A 4PJCF 3G0BA 1GQYA 2LV8A 4PPFA 3OJFA 2QV4A 1CVIA 2DOCA 3QCUL 2V0CA 3TM6A 2EEDA 4BZ1A 3WYCA 1O5TA 1TJIL 1LRKA 4FQ1L 5FEMA 4RQQB 3IM1A 4R4FL 2WICA 1YBAA 1QCYA 3BUTA 1NOJA 5EE0A 6AT1A 1GIGH 4OJNA 5BUSA 4LOUD 3H17A 3K6JA 1XRMA 2Q6OA 3K0YA 2W0LA 1VAHA 5K9KA 4Z4HA 4UVDA 3CVDA 4JO4H 1INEL 1UKAA 4DESA 3ARUA 3QMPA 4DGYH 2MR6A 2ZJAA 4XPIB 3KDSE 3JWNE 1IM5A 4X7TB 3FPSA 4P3XA 3P19A 1HT6A 5F7WC 1Z9SA 5IU6A 4MRBA 3C24A 2GZ1A 4M7ZB 4YAOA 2FJUB 4X7DC 5K6AC 1Q17A 2VEOA 3S4YA 5DRNB 1GSKA 5JZMA 1NZDA 5DYWA 4CU7A 5IFHL 4FFBA 6ADHA 3LC2O 1FNHA 5AVTB 1ZEJA 5EC8A 3T7AA 5K45A 1JWSB 5LBSL 2RH4A 4FOTA 5DJ0A 3O3OB 4E9LA 5LFAA 1FH5H 3NIDB 4IAOA 4XOUA 1NBMA 4OQLA 3H0CA 3R5XA 3BMQB 2YL2A 5DFTA 1NVBA 3RUPA 4XP6H 2O5YH 3DTVB 2FW0A 4B6OA 3WJMA 1AVAA 2E85A 5HJGA 3CSYA 3AGPA 4W5TA 3CXDH 2O2JA 4GECA 4K6MA 2H1LM 3KOMA 1JGEA 1H2HA 4MMXC 5E8EB 1C3JA 3FCBA 2QG9A 4K0OA 3EOZA 2WGXA 1J5CA 4R8LA 1I7RA 2MTPA 3F47A 3ND5A 2EEFA 4FZ8H 3KPMA 5IB4A 1FYWA 2Q0HA 1JX6A 3MGGA 1P4BH 4AJ1A 1X7DA 5DUML 4GI2A 4ZCRA 3X11A 2EWMA 5ANMA 3MLRL 5DFWH 2ZTHA 4QXTA 4WBSA 3U3DA 4Q4AA 4YEDA 4AIRA 4MMZA 3QX8A 3M89A 3ZVKA 3PIDA 4EBFA 5HPOA 5I1GH 4X99A 1A9EA 1B1CA 4HWRA 5SWZA 5FI1B 4JBHA 5HDQH 1FV1A 2ZG3A 1PUXA 4CV1A 5JNWA 5L3RA 4WSJA 1P80A 4M21A 3VKUA 1I33A 2WPDA 4WTXA 5A3QA 3ZW9A 3QFJA 1C8VB 2GEVA 5F5LA 2YV2A 1MCCA 4HH9B 3QPQD 3K09C 1K66A 2R6AA 4AS3A 3KHQA 4WO4A 2JCWA 3BPNB 3SS7X 1JH8A 3GFOA 1M8JA 1F2XK 2QJOA 2J1YA 3IJ8A 2CMDA 4IFBA 1CBUA 4O59O 3DE7X 3GZJA 3VXUD 3TO2B 1E7VA 3SDDB 1GL9B 4Z3DA 2WE7A 4JBSA 1LF5A 3E8MA 1M54A 1K8DA 4MNTA 2ZRIA 4ONOA 1N2CB 3F5DA 2VDOB 1G9SA 1RI3A 3T4PA 2OJZL 2IZZA 3RK0A 1FNSL 3BDXA 2FTAA 3IU4H 2P2NA 4MR9A 2JCCA 3IO3A 3UPDA 4OGZA 4U6NA 1U90A 3TLYA 2XV0A 35C8H 2LTQB 3I3BA 4RPJA 5CGQB 1SXAA 4LKOA 2OHGA 1I5EA 3JY6A 3I9OA 4P9ML 3LIIA 1M5UA 1Y3BE 5KSVB 1BMWA 1MHPH 1FL6A 2VH2A 1WAMA 1H1DA 2Z65C 4BNDB 3RAPR 4MITA 2FZEA 4US2R 1QSED 1SJEB 4LX0A 2PGJA 3EFFA 2FWUA 1TGVA 4HWBA 4N7RA 4QNPE 2IO5A 4NNPH 4R5MA 4CGZA 5T1DH 2G75B 2H3HA 3GKWH 1BE0A 1FGVH 1H66A 3I0MA 1JPGB 5HDWA 3LIUA 2PWZA 2XWZA 2DH3A 3S5YA 3VXNB 4NRXA 1M1YB 3C7AA 5CTJA 1HMYA 3C08H 2H0RA 3NYKA 5HHPB 2W2NA 5E2BA 1E9EA 4D0DB 4MVXA 3R4RA 2G60H 2CXOA 4J7UA 3L3DA 4LSZA 4KC0A 2I1LA 2G3MA 2G04A 5F9OH 4XVRA 3WMXA 4OQQA 1SXBA 1GGBL 1U7UA 4XEUA 5C07B 1AQYA 1WXDA 3E8UH 3GMTA 4JPWH 1JZSA 2VDQB 2FRDA 4OM1L 2XUGA 3KOYA 2JLCA 4P7GA 1JZEA 3HBLA 5IDYA 1TVKA 3MRHA 2B15A 4PJXA 3QC6X 3GRKA 5CLLA 4KIFA 2ZULA 4XTRA 2ITEA 1MFDL 4ER6A 4ZGGA 4AGLA 5HUHA 4PGGA 3CFCL 3FKUS 1HLFA 4A2MA 2XDQA 3H8NA 3T7TA 1UQRA 4MMXA 4PGAA 1NOFA 4E5KA 1M3SA 4XPHL 4M29A 3BAWA 3DO4A 3GFBA 4ARUA 1EQ2A 3B3AA 4RYDA 2F5BH 1B26A 4TVSA 5AW4A 1S6NA 3UJDA 3SE7A 4ZMQA 1RT9A 5HZGA 5IQMA 4EI5D 5TS3A 1K9SA 3QFSA 5EKTA 4B6RA 3GMNB 1E8YA 3SJBA 4JRYA 1R3JB 1R24A 3ZRCC 3QUZB 4EYEA 1EFXB 1VA5A 1OD7A 2YAQA 2YJ5A 3DVLA 5IVIA 1QNFA 3HO8A 4XMLL 3U0WH 1ECLA 4JHWH 5KPJA 4N9GA 4BSWA 2BJMH 4Y4KA 4LMBA 1IBYA 4NPCA 1QG4A 4ODXA 2X6CA 4GI5A 3SJVA 2AMFA 3GRCA 3GLFE 3IHLA 3AVUA 3K35A 2DYPB 3L5WB 1W72L 1HVXA 3VO2A 2W2VA 1PZMA 1A5SB 3HCOA 1Z3CA 4FSXA 3DGDA 3HBPA 1N19A 4Z54A 5JD4A 5H4GA 1TQBB 2IPOA 2MOKA 3NTOA 3DO5A 2QTWB 1FFRA 3GLRA 2GN6A 5J6GA 1EEXB 3C5ZA 5D2NB 3STYA 3HXPA 1KZYC 3K6IA 3LKPB 2DWSA 3UTQB 5C0CA 3DO3A 3E5NA 1W0VA 2VHJA 3FMOB 1ACYH 1N77A 5DSZA 1X9QA 1YA4A 2V9UA 5E2WH 5GZND 5JVDA 1MOSA 4JBXA 5K59F 3Q44A 1MFBL 1CHNA 5JVDF 5TJ9A 3FO1A 1A5TA 2Q1TA 2H2AA 3CU1A 5FKAB 3JQAA 4B44A 4ZS7L 1L0YA 3JZAA 5CMAB 4JL1A 5CJ8A 1E28A 3UYRL 4YWGL 3T1NA 1KAOA 4BQQA 4FMFA 4IH9A 3UOWA 1LTXA 3S70A 4WTWA 5C09D 5AW8A 2UUPA 1BHQ1 4WZBE 4GOJA 2WJ7A 3JAKB 2EDHA 3BC1A 2B1AH 4XWWA 4XXHA 5AJXA 3BSYA 4G8GB 2EOAA 1CGTA 4RFVA 2XBMA 2PW2A 2UYLA 3BXXA 4F93B 4MS3B 1OTTC 2NSXA 3BW9B 4K5OA 2CDFB 4AJNA 3TPKA 1GSAA 4F3RA 4Z4QA 5BNWA 1T6NA 2Q4BA 4IRUB 3VU9B 2R79A 5IGXL 3EDYA 2QADD 4L02A 3EIXA 2PEYA 3IXMA 2ZWAA 1U0EA 1SZJG 1E4YA 2ZUCA 4Z7VA 2NUPB 5AAMC 4DFIA 4H3HB 1WZUA 1GRWA 1M3IA 1W1WA 1BZDA 1MJUL 3FQNA 2V7XA 1JDCA 4KUZH 5DJXB 1MHEA 4E32A 4UQPA 6TAAA 5E6IA 1W85A 2XVGA 1ECFA 2Z2IA 5MEPB 5T8IA 3WL3A 4JFFB 2A94A 4W82A 4XNQA 4YT8A 4KNVA 3H4TA 1E1DA 2EO9A 3WY9A 4GQPH 1FE8H 1JI0A 1T6YA 1P1ZB 3QLVC 2RJMA 1T43A 1J5EB 4H59A 4FJ0A 4KZCA 3MTBA 4S1PA 1XMXA 2X0VA 1BAPA 2A7XA 4EB3A 1CF1A 3BP4A 2BFOA 4X6BB 1DRKA 2FLRT 1L4LA 5TPWH 5CBAB 3CKYA 4NZ8A 3BPCA 2XCUA 1U30A 4ZAFA 4IX9A 4CM6A 5C3TA 3O92A 2Z0BA 5TE9A 4YCAA 1CNMA 5J7CC 4AQDA 3QH3A 3GZTB 1UH3A 1Z68A 4CEHA 3MCUA 4FKEA 4NZ9A 2JLWA 2Z5FA 2FPSA 1NYRA 4D4LA 4PUBL 1VFUA 1HYRC 2MTAA 5ELMA 1JECA 1BCSA 3EYVB 2X9ZA 4Q6IA 4OM0L 1NL0L 1OAXL 5HYJB 3PXGA 1QPBA 1Z7EA 3A14A 1TMKA 3OZGA 4JA2A 43CAA 3PUJA 4QY8A 2F54D 1YS9A 2XZOA 1BN6A 5EIAA 2HKIA 4DM7A 3TWCH 4KOAA 3SQOL 1R50A 5CCEA 3PSAA 3HN3A 1I14A 3AT1A 3BIFA 4N41A 4OBSA 3UT0A 3DPSA 3HCPA 1CR4A 5AO9A 2YV5A 4KIUA 1O58A 5DEGB 3NBXX 4X6DA 3TJRA 3QHZH 1IL1B 1E9SA 5IHXA 4EI2A 4X8OA 4MAUH 5JIQA 3HRZC 1NCWH 4NBTA 3ZCQA 5IB5B 4DHLA 4ZQKA 3AS3A 4LJSA 4J3UA 5L45A 2JCCF 3V55A 4WY2A 2GTZB 1Z5OA 2ZYGA 2ZYDA 1FO0A 2EJVA 3AJ8A 4FDUA 5SZIA 3FYUA 4WNCA 2XKKA 3NV9A 4NCC1 1TO2E 2FR4A 4J90A 1W19A 1RWVA 5FD8A 4OCYL 1OAZL 5ALZA 4H0IA 2OXFA 3GDWA 5IAJA 5DUPH 1N0WA 1CGWA 3S8YA 4XPBL 2ZCKL 2VIIA 5HEKA 1FTGA 3DAHA 2BHLA 4RMTA 3GUVA 2IDTA 4C4TA 4DUPA 1DJOA 1EVLA 3W8DA 1JVOA 5L2KD 1G7QA 2R1ZA 3L7EB 5CEXB 3J7AC 5TRTA 3BFKA 4BH8B 3W39A 4TQEL 1CT9A 4OOEA 3BRDA 4DIEA 4PJIA 3UANA 1I4LD 3JZIA 1A7OH 1YEKL 2KLRA 2BD0A 4NBYB 1T15A 3KH3A 3U26A 2OBXA 4LVEA 2D2VA 2R6FA 1XDWA 3G5YB 3QVOA 4GMDA 4AM0Q 3FJOA 4NC2B 1DZIA 2MKWA 3P4NA 4I4IA 3VFGH 2BSCA 1KDPA 5AW9A 3EYQC 1AGFA 1RDFA 3O8LA 1RZJL 4I2XB 5HVHB 3PENA 3CURA 1XJWA 5I4BA 1OH6A 3TZVB 3OLIA 3UCQA 4Z8FL 1NCBH 3SO3B 2DQSA 5C0JA 5EUKA 3JVUA 4BOYA 1VJ5A 4AS2A 2AD5A 1T2EA 2DQKA 3SHFA 2W9DH 2EVIA 4INZA 2QXTA 1FYFA 2QT0A 2P41A 3HC2A 1MKFA 3DEKA 4X8MA 3MOGA 1RHRA 1Y5RA 4EOWH 3GMPB 1A8SA 5M34A 3EIOA 3CN4A 1ROCA 2HGZA 1M1UA 1H9DA 3S1LA 3OY2A 4GPTA 2WWVD 1LBTA 2G7ZA 4RRPG 4NJEA 5JXGA 3EXHB 4PJEB 4N28A 2F62A 1DS6A 4NQVA 2C1XA 1H5BB 1QRNA 3HUJF 1ABBA 4N2CA 3D39E 3ULSB 3KYNB 3LGAA 4PJFB 3VPFA 1VFMA 3ZHSA 4YRKA 5HNKA 2YUXA 3ZXAC 4ZD3L 4LE1A 1L7BA 2H06A 2DPHA 3R0MA 4J2QA 3U1VA 4D57A 4HF5H 3ZL1A 4L8VA 1KTKE 4U7GA 1ZGLP 4M9CA 3WMWA 3V8EA 3VO8A 5CIPB 5CVDA 43C9B 4L28A 4MR8B 1CR2A 4DSAA 2C7PA 5SX5H 4PWHA 3E22A 3WA6A 3R5FA 4JDZA 1CN4A 1PZHA 2HMSA 3SJZA 4QJ4B 3O2SB 3E1F1 3L93A 4I1YA 3DX3A 5CNKA 1WXXA 2O2HA 4KFCA 1C9NA 4TUJB 3ZCVA 5EOQL 4FYXA 3NW9A 4J2HA 4CC4C 1B6RA 4OHWA 4RO0A 1TJMA 3ARDD 4NMXB 4M9ZA 4G7RB 4GI9A 5I73B 2Q5LA 5FOUA 3PDJA 1JT9A 4YFLI 5AI0A 1F56A 3EDKA 1JDBB 4V0KA 3LN4A 3M83A 3PL6C 4DGIH 3TL6A 4IKPA 2YPLD 1TF2A 5DN9A 2C98A 1Y6RA 1MHCA 1AK1A 5ECGC 2HWKA 3VVMA 2A9PA 3N28A 2J8UF 2HRZA 4ZU3A 2IVFC 1XZAA 4M8IA 4YR7A 3RVOA 1T1ZA 3ZDYF 2IADA 5HGDB 4BKSC 2V65A 1Z6YA 3ZDDA 3BCUA 4JFFE 3QMVA 1U3VA 5AM5A 4CN1A 3HCRA 3W06A 4EN3D 2O6PA 3GLAA 5TE6H 1W6LA 1Q7RA 5LL6P 3FOLA 5DIFA 4G7VH 4D5GA 4XJSA 2AZUA 1G64A 3H2YA 4R71A 3RPBA 3V8NA 5D6DC 1J0BA 4LBYA 1JNLL 5KYXA 4OFDA 5E2WL 5G53C 5LQDA 4NT6B 2RMKA 1T2DA 1VZHA 4QFDA 4NNPA 4JDEB 4M1KA 4KGVA 1U58A 3P40A 4Y9UA 4A2EA 1K4YA 1CU1A 1KYUA 4O2FB 1YJ5A 5F96H 1ZH2A 1U8ZA 4W9GC 3X1FA 3PABA 1TU0A 3KJIA 1DCEA 3IGAA 2C2HA 1E8XA 1M2KA 3QX7A 1BU5A 4HIEA 3GFTA 3MQ4A 4KHTH 3BH9B 2BP7A 2MQ3A 2CEKA 1HZHL 1NWCA 3EMBA 4D8PB 4JJKA 5JIHA 3QE9Y 2ATPB 2ID8A 3L4TA 3RZCA 3MB8A 1HE8A 4NPHA 3U3KA 4YDIL 3CVUA 1R2QA 4XWAA 1KERA 1DFGA 2ST1A 4FXOA 1MFVA 4LNRA 4PIRF 4YGVA 3RHSA 1KTBA 5EC2B 4Y30A 4FD0A 4NNYB 1Y3DE 2VDVE 5BW4A 3D6VA 4FE3A 4QPEA 3O1IC 2EP6A 4TNEA 1WDTA 1TF5A 1N6IA 4PR5A 2IHTA 2H26A 4CN8A 2GH1A 3SBWC 4LSSL 4EF4A 4RM2A 4EKGA 3EJPA 4FQLH 2Q28A 3M4JA 4FFWA 3L6RA 4A6YH 1UXGA 5DURB 2GM9A 1H8NA 2M32A 2CXTA 3CXUA 5A7GA 4MNQB 1XF3B 3MLTB 4B3XA 4HS9A 2J9YB 3Q13A 3UGQA 1ND0B 3I2JA 2PWGA 5EU3A 3RV4A 1W72B 3H7BB 4F12A 1F4AA 3IMBA 1J97A 4Y5VB 2CXPA 2VRKA 2E76C 1WXGA 1EEHA 3C3MA 5DSCA 1A2KC 2P4UA 3LMJL 5F7YC 2Z2KA 1ZA1A 1CIJA 4LYEA 3WFJA 1KN4L 1M66A 5C8JA 4MDFA 1MWAA 4P2YA 1UBJS 1AMYA 4PWZA 4KRMB 1ZGAA 3ROQA 1VPOL 4GXVL 4MARA 1MI5A 2JCCE 2EDBA 5BMVA 2WMDA 3X1BA 4HKZB 3VGAC 3TL5A 3RSLA 3N70A 4JI5B 4WJ5B 1DBJL 3BXOA 4QHNA 2WO2B 1ZTMA 1P5VB 3B2MA 1C7FA 4LC9A 2E9JA 1BLNB 1JPSL 4DTIA 4WFFD 3U5ZB 4BXVA 3CTTA 1JQDA 1OWOA 1OE1A 3T41A 3FTSA 2F54B 1HDMB 2P78A 1TTTA 4K7JA 4K2AA 2WUCL 5DP1A 2Q6IA 1S7UB 5FUZL 5FDYA 5BVHB 5H8DA 2R8PA 1M2VA 3EQ6A 3Q0TA 1CE6B 1ZJJA 4M61B 4F15B 4F37K 3SGKA 2BJHA 4BBZA 2R2CA 4YV1A 4ZEMA 4ZTPH 3Q7EA 1AH2A 1K2DB 4ZCIA 3RA7L 1XX9C 3V5KA 2JAWA 1Y8RA 2DHQA 4NXNB 4OCRL 3IXQA 4AJ0A 1I1FA 2C4TA 2J7PA 5SYAA 5KNLA 2PMKA 4N0PA 3O4OB 2C9RA 4MHOA 3IBOA 4MJ5A 3D34A 3L9RB 1R0CA 3DGEC 4IYKA 2GLTA 1OPXA 3UBXB 2XY2A 1CEEA 4II2A 2OCXA 1T89A 4Y2DB 2ZIAA 1P7YA 1Z5UA 3PUKA 4F2PA 3VOSA 5DMJB 3CEJA 2OZ4H 3F4BA 1IH8A 2BGKA 3DSFL 4CDNA 5CX1A 2J21A 4JVLA 4X6FA 1Q6ZA 3AREB 3IPEA 2VJDA 4KN9S 3ZVMA 4R0VA 3DL7A 3F5WB 4HJJH 2ECPA 4R96A 1SU8A 4NHCH 5AXAA 5DTQA 3GK3A 2WP8J 1KC3A 5KUTA 1A4RA 3KS9A 4AMZA 1NGXA 4MRAA 3MUOA 1OIVA 4XYBA 2DJ5A 2VNIA 1MP0A 1S2MA 1M42A 2FEDD 2O20A 3PWSA 1EVUA 1SCJA 4UAVA 1QFJA 1R66A 1QRSA 2R60A 3KR9A 2Q29A 4EJSA 3IETB 4G1MB 5FL7A 4P6VF 2X2JA 3HI6A 1WWKA 1U9CA 5CINH 4QHLA 3KEGA 4BO7A 2NG1A 4UVEA 1TZGL 4FPXA 5T1DL 3D69B 1CW2B 1QU3A 1ZHOA 3LY5A 4OFWA 3G5VA 3MT9A 4E2YA 5I6XB 1ETZB 3FAZA 2DUMA 2GMWA 1I1AA 2XC8A 3AJAA 2HUEA 13PKA 3AFLA 1MQ8B 1SY6H 3UJ6A 3TQSA 2P28B 2E7LA 1NJ5A 3FDWA 1AJ7L 1OAKL 1KO8A 3U48A 3EDQA 1OW3B 4KVPA 2ISQA 4ZU6X 1MIMH 3H11B 3C60C 1TW2A 1TIBA 4J3OF 2XN1A 5LZ9A 4FILA 3OMWA 2Y07L 2APXA 3VHRA 1BAFL 1PNTA 1TQSA 3MJ9A 4QQRA 4RENA 3TOZA 2AXFA 3NDZE 5HDBF 2JPDA 2YIMA 4BFFA 4ATTA 3VV3A 5JW6A 5C6TH 1Y1LA 4OQNA 4G97A 2IQIA 3IBTA 2QXUA 4AZSA 1CK4A 1DV2A 2SECE 3K0FB 1DAKA 1G6KA 1YEFH 3EASA 1LWNA 4TNFA 2Y2VA 3COJA 3IVMA 4N85A 4GJTB 5CBEA 2O3SA 1REQA 1NJ9B 4GUCA 4FOOA 2AJTA 3KSZO 1YEHL 3IPRA 4YTEA 5KSZA 1E20A 1GZDA 1M2HA 1VMKA 3OUUA 1S0UA 3DZJA 3NPSB 1SUWA 4PFJA 1L5MA 3WIEA 1LK2A 3LVQE 1FNAA 1P4RA 1E6MA 2Y5TA 5ALHA 3TJHD 5F4BA 3J7TA 3MNWA 5GIRA 4CDGA 1XH3A 5AJVB 3U40A 1X9GA 3V4PB 1F11B 4AVHA 3MR9A 4MPDA 3R7AA 2C9UA 3UJAA 4PP2B 1FQJA 3ZU8A 4MVCA 3NBFA 2FEMA 2WTMA 4OU4A 3TBHA 3DV4B 1CNEA 1TTQB 4OY9A 3T2PA 2BVOB 1AT1A 1X9LA 3BQUB 5GZ3A 4HH1A 1NBZA 4LU5H 3B56A 2OXIA 4TS1A 1EGJL 4D56A 1ZM7A 1RXCA 2GZHA 3QULA 3RAJL 2H59A 2ECQA 4PY7A 1WT5C 5DC4B 3V52H 3VGHA 1Z7GA 1J0DA 2JJSC 1HI9A 5IT4A 3E82A 1RC1A 4TWJA 5FF6A 4Q01A 3A4YA 2DEYX 3KPPB 3MCYA 1YLBB 4KQIA 1HE2A 1RRKA 1SJ9A 3G88A 2BP5M 3PYXA 4YBLC 2BNRA 2GB4A 5K3FA 4CUKA 3IS0X 5KWJA 1U1DA 2RK6A 2WLJA 3S37L 2JGFA 4Q9KA 3G2HA 4HG4K 2CUNA 3S3PA 4RNRA 3M2TA 3HMXL 1X7TA 1Z2KA 4IK6A 1LXMA 5IYZF 3VSDA 2FEXA 2Y77A 5D55A 4BO6A 2ARJB 1V35A 4MUAA 3LXMA 4NQEA 4ZNEA 1A98A 3MRXA 3ANYB 4NN5C 3G2OA 3TFKC 3GFVA 4OXRA 3HS0C 1IQPA 1TYJA 1Z6ZA 3P9IA 1AO0A 4FZJA 4Z1MA 4JM4H 4E4YA 3SGEH 1MB4A 5L3ZA 1BJ1J 3GSWA 3DYBA 2OV8A 1PKQE 4U7MA 2BC4B 1DTWB 5GXBB 3LIZL 1SOXA 2P5SA 2FX2A 2YXFA 2VDWB 4FDTA 5AHOA 4M62L 2VF4X 3EXG2 2E1PA 3CUVA 2D9QB 3OX8B 3QP9A 2EXWD 2O7QA 2ZBDA 2EFHB 4EHKA 4O3MA 4N0DA 1D6EB 4LRYA 3MJ9L 1IFRA 3LPGA 4MDJB 1Q84A 1OXYA 3VR0A 4K71B 2HV8A 3WLIA 4B3CA 1CJVC 1M6VB 4ZPVA 3SVZA 1U95B 5JYCA 2IALB 3Q3EA 3O8XA 4PNZA 4DPBX 4PJAF 3BL8A 1PRYA 1UDRA 4HPWA 4L5AA 4L4XA 3NJKA 4JFQB 2UYCA 3RL2A 3JYOA 4QJ3A 2OD7A 1S9YB 1YDWA 4HXGA 4NVRA 2ZIDA 4GMGA 2R69L 3FCSA 2P9CA 4MV1A 3ICQB 3FQWA 1QI4A 5T3ZL 1DWPA 1DL5A 2R2EB 2C3YA 2QRKA 4CXMA 2WLIB 3FGZA 4GXUM 4OFKA 1BHO1 1CS6A 3GZOA 3CWGA 4UNPA 3W11C 3SY6A 1ZNQO 1NJGA 5FWAA 4KFUA 3RUGE 2ZIFA 1NDTA 4KVFA 2B25A 1IL1A 2R2GA 1EGJH 3OL2A 3HA5A 1WBZA 1IC4H 4UV7H 1F4VA 4IHJA 2QMJA 1XH1A 1GHFH 1QLEH 3UTDA 4I14A 3KDPA 1XROA 2JCGA 1FFXB 2R11A 1W72H 3SG0A 2PCPA 3NQIA 2WAYA 4G4JA 1JQEA 2A1WL 3N2JA 4J27A 2WF9A 4CGYA 1W36C 1CJKC 5CCXA 1OGAB 4LOHA 3T7JA 3QMWA 2HLHA 4NQDE 3EFDL 1JBEA 4XUDA 3TK1A 2AZTA 2J4WH 1NINA 4JPIA 3TYFA 4FFZA 1AUOA 4C55A 2Q2NA 4OLJA 3RS4A 1M33A 4ZDKA 4CG1A 4IQHA 2VQ4A 3AUKA 5H37H 5JOPE 1A9BB 1W4CA 5AUMB 5A71A 2AJVL 5E4EC 3DOIA 3EDRA 1J9QA 5E5MB 1NSTA 3SQOA 2F1EA 1DJNA 3IAHA 1FRFS 1YRKA 1QBKC 1V47A 3EC1A 3MV8E 2YLKA 3NIWA 5JUWA 4TTDC 3M4NA 2ICEC 1Z33A 1QSEE 3V4VB 3LUDA 4OG2A 5C0AB 1NJ2A 1U93A 5IFHH 3C6LA 3KDMA 4QXMA 3V8PA 1DEAA 3D6TB 1YO4A 2P9YA 4OLBA 2GUYA 5GGSB 5A04A 4PSKA 2D5LA 4TS3A 5CCKH 3HFRA 1V8OA 4X7RA 1NXOA 4IIVA 3U6XA 4A7TA 2XCTB 5I9QC 3UTTD 1PDWA 5SZKB 3V0HA 1T1EA 2H4YA 3TBYA 3DX7A 4I9GA 3BE5A 3B2DC 3U6RA 2DFNA 4EZBA 2ZYAA 2VP3A 5BORA 1Z4PX 2VTDA 3NCXA 4ALLA 2C96A 3VKHA 2ATAA 3O2DH 1UF9A 5DFVC 4XO8A 3TBSA 3ILYA 2J2ZA 4V33A 3T7KA 1JI1A 2ZS8A 5D2LE 1PIWA 2PYEE 4RKEA 1I4WA 4ZPTA 3EJYD 4XN8A 1HOXA 1X4ZA 4NCBA 1ULBA 2C1OB 3LCMA 4I85A 3GLFA 4MA7H 4QRIA 2ATVA 1KC5L 1QEXA 1J5XA 4G01B 2G0KA 1J0JA 4PYOA 2UKDA 1TJGH 3AETB 1C7SA 4BZQA 3K3QA 4PXAA 4JGNA 3IT1A 2F8LA 3EYUH 4HWUA 4XB6B 1MEEA 2UY6A 4ZMLA 1FMJA 1OB5A 1MBZA 1F5SA 3OVUB 4G56A 2RBEA 1K8IB 4M4RA 3UC2A 3UA4A 3U4EA 3B36A 1JUFA 1WAEA 1GKLA 5AOIA 4ZMAT 4OV6B 2GIMA 3VGFA 5A2FA 1DQQA 4QOSA 4XX1A 3OZRA 4HPXB 1AG9A 4UASA 3GJFB 3KYDA 4B9GA 4MRNA 1EM8A 1JYNA 5F64A 3VXRB 3RWCA 3L7DA 2LU7A 2JCBA 3GBMH 3H6AA 2ZS9A 4YMVA 4DV6B 1S4IA 2ICES 3CO0S 4KAQH 2BW5A 3KLKA 1JGDB 1XMVA 2BLNA 3SPGA 2F6AA 2R29L 2OJZH 1Q9LA 3I9V6 2B78A 2GPAA 2NW3A 4QLAA 1HEZB 5J4MA 4Y4HB 4YDJB 2PSEA 3HHSA 3EGXB 4JLVA 3JWJA 2ZWKA 4ZAKC 3HYSA 1TQVA 3EISA 3VUEA 4HDSB 4B9EA 4DA8A 3E7DA 1U7WA 2FUEA 2ZJBA 1R3IH 4RXUA 9LDBA 1OLUB 2DUNA 3AEYA 3BVVA 5B53A 5DI9A 2VDLL 2DKMA 2CA3A 1TA0A 4KLNA 3PP4L 5IMSA 4NBVA 1LV8A 5G41A 2XMDA 4CHTA 1TJXA 1NEPA 3QI9A 3E3AA 1CUHA 3U44A 2X4QB 1F18A 5CJBA 3O81A 1E3EA 1K2WA 3W57A 3T0WA 3AVXA 2JKYA 4WX2B 4LCWA 1RAAA 4S35A 1YBFA 2PFGA 4LVHB 4TWIA 4WWID 4UMVA 3C08L 2L18A 4AQYB 2R751 3LKBA 1N59B 1WMEA 1M6NA 4AIZA 2YEZB 5FO9B 3KOOA 1F3JA 1K3ZA 2MINA 4I1OA 3LYLA 5LAPA 4TSCH 4HS4A 1Z15A 1P1VA 1F2UB 2VPTA 4GRLD 4DAGL 2GAOA 1VE6A 3CFBB 5D5QA 4N22A 4QHUA 2XWPA 5CB4F 4QRSB 3DDGA 4WLFA 3WFHB 4Z0BL 3VWJD 2CVFA 3CZAA 3IA2A 1M6OB 3AU1A 2V8MA 1KO5A 5HHVH 2XWJB 2XG5A 5DLDA 4YDQA 4RNCA 5A02A 2AI1A 1J1UA 2SCUA 1J2EA 3PHJA 2W8BB 4E3WA 4DFHA 3CLEL 3KXFA 4EIUA 1VPVA 1J4AA 4LSTH 3E3OA 3L3OB 3RQ3A 3E6FB 3HGTA 2QTGA 5EP3A 1PZEA 3MINA 3U1SH 5DASA 3VJRA 1B2LA 2EP8A 1P5JA 1SYSB 1XCJA 1XZPA 4IX1A 5IYZB 4QRAA 2IHVA 4CA4A 3QEQA 2ODPA 4RVSA 2PMDA 1XVTA 4KPEC 2NTSP 1VXRA 1WM1A 2XRYA 2DKUA 4J39A 1X9IA 3WD5H 1SMKA 3LP5A 1PQPA 4GSKA 2FATH 5JO9A 2XXGA 2Q6VA 2ZPAA 4OUUA 1QX1A 2H6UA 1JXKA 4LE2A 1OWMA 3D85A 4KMQA 3S3JA 4RBPK 1DAFA 2B4CL 2QZ9A 3ZWOA 4YBRA 1KXHA 1ZGLA 4YSCA 4BGDA 3WXBA 2DULA 1SQFA 3MFGB 4X6CB 2VLJA 2BZCA 3OGOE 3ADKA 3H7BA 3LQFA 4Y8DC 3ECVA 1L7EA 5F21A 4BQFA 3OF6A 1R0LA 5GGVY 1CF8H 1GXSB 3H65A 3M17B 2F1JA 4ZFGL 5ICYB 3GLGA 4J12A 4MW1A 2IYSA 1WZEA 3TN0D 3M81A 3NM5A 4UTBA 4B40A 3BVWA 2J7KA 5D2LB 1CLVA 3KSBC 4EGQA 3ZMEA 1HDIA 1F3DH 2QRQA 5IW1A 5HHOD 3HKEA 4J3JA 1G8FA 4V1DB 5IT0A 2OB2A 4CMGA 4E14A 4TTRA 1U0SY 2GSIB 3VXSA 2EHJA 1GFZA 3V6MA 3RKDD 2XYRA 1JG9A 3K92A 4RH0A 4KI1A 1SIOA 1YNOA 2WLLB 4G42A 2R25B 2IU6A 3O8OA 2VMFA 5FFNA 2FGWH 2KX7A 3CXDL 2CBTA 2NVUA 2C82A 4YJ2A 1MFBH 1ST2A 1THZA 1MCSA 1Z5YD 2QTVA 4BP9A 2HEIA 4WGFA 2Z93A 3GAMA 1AKTA 5A2JH 1Q57A 2CW5A 2VYFA 1OZAA 3R6DA 3MYRA 5DHDA 5I76A 3OC6A 4D81A 1C1DB 1W0CA 2B6NA 4B4KA 1G0NA 3S8WA 5EWIH 3AW9A 5TXGA 4C4AA 1I9RL 3JRNA 3GXPA 3ZDZE 5HDQL 1ZOPA 2FSPA 4MWGA 4E31A 9MHTA 2N75A 3Q15C 4HGRA 3ESRA 3CZFB 4CQMA 3BZEA 3TF5A 4CVZB 3HB9A 2VHCA 3I28A 4JJ6A 1DQIA 3B4NA 3LWDA 5EQJB 1C5BL 4AMKH 4M6OH 4KXZH 2RHTA 4WPGA 4QVIA 5F98A 1X3LA 4EY7A 2OI9B 1BMQA 4URHA 1XRNA 4K0RA 1GN8A 3MLYH 2HJKB 3P9QA 2PU5A 5DMKA 1W36B 3ET9F 5AKEA 1OP9A 4QJBA 3QI2A 3NACL 1VPLA 1CRQA 3BGVA 1H3NA 3QWAA 1ZWKA 2YVAA 3LKSB 3AFHA 4P0QB 4XIIA 3TO5A 4EKYA 3RWDB 1GDDA 5DS1A 3IEPA 2PO7A 5EMJA 1OALA 3ZKAA 3KOZA 4B0OA 1Z34A 5EYPA 4G6ZA 3ICOA 4LASL 3PQEA 3TQHA 3PGFL 1D5BB 4PJAE 1NT2A 4N2FA 1X7QA 2QQFA 5C7IO 2E7CA 3KPUA 2CWDA 1KDIA 1N6KA 3TA4D 3G0IA 3DMTC 5PGMA 4IZIA 5CW1A 1CR0A 3OU7A 4GE3A 4YRIA 5TJWK 1SY7A 4JQIH 3W2GA 1ACMA 3M7FB 4GW5B 5KAMA 2B2XL 3GM8A 1MF7A 2FW6A 5C07D 2ZSEA 3QBEA 3DHEA 4P23D 1BXGB 4AITA 4KQJA 2B1QA 3BN9D 4U1NA 1N5DA 3HG4A 4UB0H 5EBWB 1ZGHA 3EYAA 4TKUA 4RDQF 1RYZA 1A3CA 1MW8X 3CLRD 5DN6D 3VBCA 3VXTA 3RRFA 3LNHA 5J43A 3AHIA 3UEZA 1OAQH 2PUAA 2QMHA 5D7KD 5KVEH 4BC1A 1L5LA 4OZFG 1B0PA 1U6AL 4Y6GB 2AABL 5KU1A 6YASA 4NRZA 3D39A 4G8BA 2IXQA 3A1CA 1RACA 4WO0A 1P7ZA 2O5ZL 4HBCL 3E2IA 4ETWA 4NN5B 4X54A 1CR1A 4P99A 5LJLA 2OK7A 1WFUA 2FHSA 2QLNA 4EG4A 3TW8A 3PY9A 4Q3EA 5HHMB 4AH2A 2CUTA 4FFVA 4WNAA 4JO1H 1AURA 3IKCA 4R0LB 5J9PB 2R27A 3RVNA 3ACCA 4YHBA 1MDAA 1OOWA 3OKNA 4AX3A 5KOJB 2WB2A 1JEYB 3GPEA 4FRWA 4Q9BA 5DQDH 5KTOA 2A0XA 2E6PA 3JV4B 1YZVA 4QOEA 1NVEA 1NFDE 3SQOH 1WIOA 4QTFA 4RDXA 1YCHA 1UACH 3QEUB 3UAJC 2VZLA 3A9VA 4ND4A 2EW8A 4I1PA 4E9VA 1JJVA 1A66A 1E6UA 4FN5A 2HBZA 4KV7A 1IRAY 3MZ0A 4II7A 1CPUA 1GTVA 4OIMA 4LJ5A 4XBGA 1VRSA 1YUHA 2VLRA 2JGMA 1UVQB 4IUDS 1RJWA 1DIBA 3L0IB 1EP3B 1PBNA 1HHHB 4W7IA 3I3EA 2JWYA 5AK4A 2VHUA 2R8RA 3ODPA 2F5BL 3TURA 2A6JA 3RFRA 3H87A 3TDNA 3FCCA 2FFQA 3I52A 3JWGA 4XSVA 5EHGA 4DV2B 3RT7A 1AF7A 1HT2E 1ZMOA 4UATA 2PMBA 3F6CA 3D4GA 2SKEA 4JR2A 1I8KA 2YFHA 4AL8L 4OGAD 1RU9L 2RGGA 4ID9A 2ADFH 4PP1D 1VCBC 4GLOA 4OQTH 2ILTA 4L9LC 4X5XA 2QQNL 1HKLL 4YRLA 3IA7A 1JTTA 5F1OB 2QN7A 4ZMNA 3VPSA 4YP0A 5F9FA 3L6DA 4NJ9L 4E46A 4MLSA 3UFXB 4LN1A 2HX7A 2KZWA 1B0AA 4KQ4L 3W5BA 3V6ZB 5AI5A 5CB4A 1KIPB 2PGNA 4JDPA 3STHA 3WK6A 2R5NA 3VFGL 2QZJA 5JAHA 2F1AA 2IXFA 2NQ2C 4ZTPL 2AV7B 3WN5B 3MFQA 3FTWA 5I8PA 1H0KA 1JLLB 2EIXA 2WV3A 1U3FA 1U8FO 3FN0H 3S35X 1M7IA 2PX6A 1UDCA 1XWVA 4TUKL 4NKDB 4JBNA 5EBGA 1KLGB 4JO3L 3BGMA 2ADFA 4O0MA 3HP4A 4HN2A 1FOEB 1QMGA 3D1MC 4MQBA 4NLLA 4QXRA 4FFSA 4WBNA 1KDYA 1SIWA 2PTUA 5AAWA 3KNBB 4RMGA 2QR0B 3ULUL 2A1IA 1VB3A 3FNHA 5FO8B 3AY6A 3KW8A 4XVTL 1SF5A 1XVAA 1UZUA 4LSVH 3ELYA 3U2QA 2FSVC 4HDQB 3SXPA 3DJ9A 1JI3A 4AJ2A 4HXEB 2R4TA 2GVDC 4F7EA 1JZHA 4XGNA 2V3EA 4WT7A 3GN1A 1HDYA 2R5FA 1CIUA 4YAQA 1LTHR 3TPCA 1GTRA 1W0VB 5FOTA 3BSZL 4IEFB 3HKBA 5LGKA 3CK0H 4UUNA 5CN1A 1PG2A 2E5EA 2WQUA 2GHWB 3CMMA 3NJJA 1R0KA 3T34A 1NURA 2NVBA 4R01A 2V0AA 3PGLA 4ILKA 3A6DA 1KBVA 4ODWB 3AL9A 1W5FA 4HEMA 4M7OA 2VISA 2HSZA 4HK0A 1WZIA 1J5DA 4LSUL 4TV8A 4ZO4A 5EFIA 2PKRA 3SOBH 4YHZL 2FVNA 2A57A 3FWHA 2XXBA 3T54A 4OBRA 4IWXA 4KU1A 4C4PA 1OD6A 4MGZR 2XTNA 1GRRA 4PJDE 4JFQA 3Q7PA 1HKUA 2IBBA 2VSMB 2X89D 5LKNA 1NCAL 1QR4A 1S9YA 4CC4A 5D5MA 4NUMA 2W0PA 3MJ8A 1YI8A 3LPOA 1PJRA 2NZJA 4Y2NA 2FMHA 1UAAA 1R9FA 3VXOA 2BNUA 2WSKA 5TMEA 1NOKA 4A8JB 1UKTA 2F9BT 4EYSA 3IT2A 3FM9A 3KPSA 4L2IA 3OMAB 1UT8A 4K0KB 2VN5A 1H9VA 4GSDL 4PVMA 4RDCA 3MRDA 4X66B 1EMDA 5BOZG 4OXNA 1PL0A 1YULA 3D18B 4OQ1A 4GYYA 5DJCA 3KDPB 1MHHB 2KMLA 5F93C 2BHTA 1EGAA 3WWPA 3TV3L 4HSGA 1F9EA 3CF0A 3GEDA 4I1UA 1HR0B 3G0DA 3CNEA 4D25A 3JV0A 1H2AS 3MRBB 2ISSD 1OGAA 5GS2H 4QI3A 1NBHA 4M48H 2RIRA 3ZJYA 1VG0B 5E0OA 3U61B 2XZCL 2D2OA 2HPZA 1ENOA 5BNIA 2EH8H 4XPIA 3SGJA 5CXXA 1FX0A 2MIZA 4HUNB 1CETA 1EERB 3AY2A 2X70A 2XUIA 1DFXA 4ISVA 4FL4C 1ORSB 3UCFA 3BQ9A 5IV2B 4TTQA 3PV6A 1KZQA 4PR3A 5KNCD 2DJ4A 3V4VA 2HNAA 2FCBA 5DURD 4Q0MA 5HDLA 4LECA 2BWQA 4GGOA 2UVPB 4IOKA 3C9NB 4JM2B 4TX1A 1BVLA 4HOMA 5LAXA 2X1XR 1RAFA 3EO9L 3TD2A 2BFVH 5JWOA 1VLZA 1HE5A 3D54D 3GLZA 5F7NC 4FQLL 4G0UA 5AZUA 1DNPA 5CFOA 3CTPA 3LNTA 3CSYB 1XCQB 5CA1B 1PL7A 2GJRA 1YKSA 4WWKC 5CFLA 3I50H 4L3CB 4HIPA 5F7DB 3PB3A 3A6FA 3WFBL 1KZ1A 3UPAA 5J3HD 2DLDA 3BXFA 4XOIA 4PIVA 4KUEA 2MYTA 4EZEA 3BS4A 1J7KA 1OF0A 2Z31B 3FOCA 1N1EA 2GBTA 3ZNOA 3DD1A 4MVJE 3ZGXA 1IGTA 1FQOA 1OW0C 4I5FA 4J1QA 1AZZC 4YPFA 3VCLB 3RVKA 4DY6A 3C60A 3RRBA 2VR5A 3CUEF 3NKFA 4JLSA 3TF7C 2O7NA 4CMHA 4L50A 4XB8A 1KH2A 4D8UA 3MRQA 5LUMA 3CEHA 4M1OA 4OVKA 4G5RA 2RHBA 5F2KA 1HWHB 3GFSA 4OBXA 2UY6B 3PHOA 4Z0NA 4HWGA 4X97A 1JPTL 4LEEA 5L0QB 2VK8A 5HUQA 3H42B 5BXFB 1JUFB 1QLRB 3HN6A 3B3IB 4BFTA 1FO0B 4XB7A 2PZBA 2IGLA 2J8HA 5DLLA 2W92A 4XQ0A 5BN4A 1KN2H 1MNUH 1R75A 2Y36L 4TTGA 1O4WA 2QD4A 3LQYA 4BVGA 5LJIA 3PWUB 3SPHA 4GRWF 4HJTA 3TTSA 2O8FA 1QZ3A 1H2FA 2OHXA 1ACXA 4PJAA 2I5PO 1JFSA 4ND8B 1Q22A 3VVBA 2GCYA 2JNZA 1YMQA 3HN2A 5EJIA 3QE4A 1YYLL 3WY4A 2WT8A 4BV8A 4Z7IA 4KTDL 3CSPA 3K0HA 1CZLA 1L9PA 2KQUA 3W1WA 1M7UA 1CCWA 2OSLA 3OR7B 4PJIB 3TNMB 5HYFA 4YAIA 3KKOA 4IIJA 1UPAA 4JELA 4LCIL 3WRYC 3L1OL 2PKEA 2WK1A 3K0BA 3OQ3B 1J7VR 3L2MA 2XOXA 3DTUB 1YRAA 2NW6A 5ITZA 4Q9JA 2WTRB 1LEKB 1L2TA 2VRQA 1PJBA 4IMLA 2Q5OA 4JC8A 4UOW0 1WUIS 4LJRA 4HI0E 5L8JB 2V9ZA 2A9NL 5A2LH 1DAEA 4HIXH 3QA3B 1XA3A 4NDNE 4YHKH 3PQYA 2VBCA 3FBGA 4TRPH 5DR5L 1E1KA 4S1QH 2NXZC 4XMLH 2ID4A 4OHUA 3U44B 1Z3GL 4UARA 5MP6L 3BL5A 4C0SA 4CR6A 1EK3A 5L2JA 1KMCA 2CGYA 1SLWA 5JOQA 5I47A 3JRXA 2R29A 1W9HA 2AMVA 1VERA 4A6DA 2PWDA 1L5SA 3BH4A 4WXEA 4O51A 2X9YA 2N46A 2XE4A 2RGAA 5AB0A 2VDRH 3Q87B 2J43A 3OKEA 3U6KA 1HKFA 4P2OB 2BRRH 1Z6QA 4ORZC 3MV9D 5HS6A 1XTBA 4ZUUA 3WJJC 1T2QL 3NZ8B 3IJRA 4JFDD 3O4FA 3PQ2A 1BHJA 3DZGA 4OB8A 2MHCA 4AE1A 3AL8B 2VYNA 4HH3C 2PQMA 5ADOL 4K6FA 3R06B 1O6ZA 4Q6WA 3SJ7A 4PIPA 3AU1B 1OHQA 2HXYA 2M1XA 2A7BA 3HJBA 1U21A 4DUXA 5IUCA 1U91A 2IYTA 1XGUB 2QW0X 5DJ5A 1Z5PA 3VVLA 1T22A 2ZBRA 5A3IC 1E7QA 3SKMB 5CEZL 3I6GB 4H0NA 4NYMR 4ODTH 5K4GA 4L8FA 3ILSA 5G55A 1U4FA 4HRYA 3BH6A 4N0YL 3SOZA 1ONQA 4AJJA 1X92A 5JNSA 4TL8A 5KMGA 4C29A 4P2QA 4YHIB 3BXEA 3G08B 3X1MA 4TMFA 2B5VA 2KS6A 4MYTA 1IB5A 5CEJA 1NASA 1QX4A 4ODHL 2P3QA 2Q8AH 1GUBA 3O75A 3U30B 2BGMA 2XQ0A 5J11B 5IAEA 2Y25A 1E7MA 3BMXA 3VXME 3L95B 2VDNL 2EE3A 1P5UA 3RWHB 2YWHA 1TGYA 3ZD9A 1FRGH 3QVGA 1KFAL 2ISDA 2PCJA 2ONJA 5C5CA 2JJ1A 5ENWB 1BF2A 5IROA 4BCXA 3GDCA 5GS0D 2QGFA 1T9CA 3DUUA 5ALOA 4X4XA 1QANA 1HSBA 5TQ0A 4YAUA 1K4DB 3ZI0A 4ODBD 1WC7B 1N6OA 4U0RC 4KQ6A 4HT3B 2FPMA 5B3KA 1S2DA 2XVBA 3P9WB 4YRRA 2BGIA 5CMLA 3KQTA 1FE8A 1LF0A 3QRFM 1ZICA 1IGYA 4NP6A 4JFUA 1G3UA 4QGGA 4MJJA 3GHEL 2DWQA 1PL3A 4X5WB 3FLMA 1ZA3B 1GVHA 1ISJA 1SCAA 2WU0A 4H4EA 1C5DA 3U25A 4EIWA 3FTDA 3QORD 3FQTB 3WNMA 3W1VA 1NCUA 3MQ2A 3MS7A 5JOFB 2IHBA 3SE0A 1RH8A 2UZIL 1MUUA 1E2VA 1KVSA 1LTQA 3QYAA 5KQRA 3IJYB 2B0SL 4UOEA 3V9PA 3ONWA 4YPGB 3DOEA 4HBQA 2BSED 2YWZA 2GJPA 6NULA 4QDOA 1C7ZA 4OQ4A 1Q0UA 4I50F 3R6GA 4B6FA 2P6RA 1XU9A 4O5LH 3QIWC 1ISSA 4ND2A 3LZRA 3WYRA 3PFGA 1E6LA 3RROA 1JALA 1MOEA 3CZFA 3ICWA 2A1UA 5GVSA 4UNVA 4EGSA 3D2TA 3E1KA 2RHJA 3ZZUA 4WWPA 1S3GA 3BFXA 3QXJA 4TLMB 2JLUA 2HTLC 1SDAB 1MPXA 2OMZB 4HU2A 1X1EA 1LNSA 2WI8A 3DGFC 2ZF8A 5C08D 4YRFA 2Z6UA 1DL7H 4JOBA 3ZHUA 4DSNA 1QASA 2J5XA 4XFDA 2X09A 3FVWA 3RRYA 1UT9A 2IG2H 3AXLA 5F1NB 4QRRE 1AKJA 1ZRNA 3G2LA 5CBKA 2XVAA 2X9LA 3U39A 3L4XA 2A4KA 1OB2A 1KZHA 3EUUA 2AXJA 4NS1A 5FYKE 1SGKA 4GGMX 4GDFA 1YMHB 2H1IA 2JGIA 4PAOA 3OBAA 4KVZA 4I36A 1MLCA 5AKTA 4XQEA 5E6IB 1NLBH 2E18A 4LDLB 1JILA 4DQ0A 4BHUA 3AG1B 1QG2A 2LGJA 1CU4H 2EEXA 4OM7A 2W0KA 3TOXA 4AAYA 2J6EA 3E3MA 5LGHL 3E03A 4ADSG 5DGHA 4Y1AB 3QDGE 5FBVB 4WEBH 3RNQA 1WX1A 1MWAB 1CQJA 1JA0A 3ESAA 4OZIF 3OZDA 3CH1A 1K5DA 4DNLA 4MRSA 2PL1A 1KDOA 3IDFA 3BJ91 3MJGX 4ENSA 2O72A 2BTEA 2Z31D 4C20A 1GOFA 1TEGA 1Q90A 1ZS9A 4P4KB 3FK3A 5J1SC 2F53E 3INTA 1EFLA 4U3JA 2B36A 5FOBA 2CNWD 3GEFA 4MQXC 4M5YH 4XHJD 4WNSA 5EU4A 3AM8C 4EX7A 3N42F 5CKAA 2FN4A 5EWMA 4C06A 3SC3A 4FULA 4EAEA 4J3OD 2NMSA 1ZJYA 5D96C 2X2EA 5D71L 4HDOB 4J2XA 1ODCA 1WP6A 5AKVA 3U0TA 1KB9J 2EAUA 1KOJA 3FPEA 2VQ1A 3NH7L 4EI9A 5FFLA 4MXQD 3KJEA 1AUPA 5B1EA 3PLYA 1WQVT 2ZDHA 2H0EA 2CHWA 5EZOL 4FMPA 3PDHA 4FEYA 2BVQA 2GJZB 3O5AA 1PQZA 1XZGA 3FWYA 3S9DB 4MVYA 4N2BA 2R9HD 4KKAC 3RGBA 3CNQS 1PSKH 5JJLA 3NC1C 5ERWA 1SEQH 1SCQA 4Y4FD 4QGHA 4XP5L 2OO7A 3DGGA 4Q3BA 4RFEA 3PRYA 3GZKA 2WLHA 1NQXA 2O06A 5IIEA 4FUQA 2V7NA 3N5CA 3FVVA 3FHQA 5AW0A 5I71B 1OM3L 4AECA 3Q88A 4DOMA 3GXNA 3A6BH 5LZ8A 1EGMB 3GLKA 1GTL1 5JHLL 1KE1A 4ZICA 4LZPA 4B53A 1J8HE 3SP1A 1T80A 5HJ3A 1ESZA 3PNSA 3S34H 4MJIB 4R3UC 4EENA 4NCJA 4OHXA 4MX7A 5FFFA 1Y1DA 1UVQA 2ONKA 3OCWA 4AV4A 3KKMA 2X87A 2G3NA 3UZVA 1V25A 1QFWH 4F45A 4TUYA 5G0SA 4TSAL 2VP5A 3L3GA