3ZDZF

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 51
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzF01
3SPVB 4OV5A 1JYNA 1H5BA 1CGWA 3NFPB 3EO0B 3GK8L 2V7HA 1DSFH 3ULUL 3QHFL 2H26A 2FHFA 4NCC1 4PB9L 3QBTB 1J8KA 1KB5B 3QDGD 5EU3A 2NYYC 3O3AA 4KVCL 5F44A 4W4OA 3HZVB 2OK0H 1I4FA 1NUGA 1RU9L 3O2VH 3D0LB 2DQUL 3RVVC 5AZEL 1WV7T 3GKWL 1ZAGA 2CR3A 5AWNH 5B21A 2AQ3A 3BEWB 3U7YH 1WQVT 3MRJB 3L3JB 2PTTA 5IUSA 3HPJB 4NWTH 5MEND 1H3GA 3QT2A 4NNPH 2YXFA 1H3VA 3MLZL 4PP2B 1T0NB 2MCG1 1E4WL 3JWNC 4LLVB 3RJDA 4C83A 1FL6B 5JNYA 2C7UB 4AG4L 1S5IH 3NFSH 1RK0A 4PRHE 3L6FA 3T1FB 3MV7D 4QXGH 4R4BB 3SE4C 1NC2D 4YZFF 1DBKH 3R06A 1WAAA 5LXGL 2E9WA 4NWUH 3BP7B 4FFYL 1A7RH 1QEWA 1T21B 4L3EE 1D5MA 3MCKA 3GBLA 5HHPA 3GO1L 3V4UL 4W4NA 1IARB 5C71A 12E8L 3MOQA 5DJ6A 4MCZB 5I15H 4Y8DC 1CWVA 5IJVB 4I4WA 1FAIH 1BQLH 1UM5L 4P2OB 4AIZB 5L0QC 3BKMH 2BNRA 3RVWC 3WL9A 1PDKA 3D2UB 4AIXA 1Y6MR 1K3ZA 3HMWH 3CVHB 5DURB 5BW7C 3X14B 1NGQH 3BMWA 4NKQB 1JRHH 1JL8A 2Y9RT 5A3IC 2OMBA 5D1XB 2F54D 4XBGB 2L7JA 2FD6H 3KHOA 5FUZL 2VLKB 3N50A 1T20A 1C08B 5D1ZA 5B39G 4F7EB 1KIQB 2DLTA 3K2UH 3AXLB 2FBOJ 1PKQA 1MWAB 2FYYB 3QEUA 1NGWB 3PWJA 5DJZA 2VAAB 4OCYH 5IHUL 3BKYL 2ZNXA 1T03H 3KPQA 1INDL 4XVJL 4B50A 4KY1H 1T1YB 3SY0B 2R4SL 2FX7H 4JCMA 3OB0H 3VI4F 5C08D 2XWJB 1F00I 3G6JA 1NBZB 5DUMH 3GIZL 4TNVF 4FFWC 4LLDA 1MRCL 2BVPA 4P57A 2PR4H 5JOEA 1TVBB 4JFQA 5L0QB 3LH2L 5E08H 1NBVL 5HVHC 3CJJA 3O8XC 1NJ9A 2NNAB 4AH2A 3OR7A 1JNHB 1FVDB 3DUSB 3TZVB 3SDDC 1MEXH 4QO1A 3VMOA 4RDQF 2Z93A 3MGOA 2ED8A 4ODTH 6FABH 2QADC 4GW5B 1I7TB 3RPKA 2PO6A 3MMEA 4NNYA 1XT5A 2VDQL 1ADQH 1SMOA 4JN1L 5E2WH 4I0PD 4HXAL 3NZ8B 3WJJA 1BFOA 1IGTA 4MNQE 3QCUL 4X8JB 5CEYA 2DQFA 5IVXF 3VD4A 5T3XL 2LTQC 4KDWA 4UU9A 2YD6A 4XNMA 1A9EA 3CU7A 4K3EH 3O4LA 4MXVE 4HS3A 3A67L 3PGDB 1KIRA 5GJTH 5IT2H 2CXKA 1HXMA 3GMLB 4HS6B 1ZVHA 2CKBB 3O8XB 5DUPL 2H6PA 3MRIB 4GG8B 1M6OA 1MF2H 4EN3A 5L6YL 3VW3H 4MAUH 3QQ9D 3SDDB 4M8QB 3ZHKA 2GAZB 1WBZA 5IV2B 2CJUH 4HHAB 1JF1A 1WLHA 1KXTB 3VXMB 2AV7A 3DGCR 3HR6A 2AI0L 4JO1H 2KH2B 2AXGB 2NY1C 4JZNB 2H3NA 3AS3A 3I3EA 4XRCA 5B39A 3L3OB 3BH8B 4TNWF 5DHYB 5CUSL 4PJEB 1T7YA 3SGEI 1IMHC 5T5FL 3GSOA 1UCTA 3KXFD 3DHMA 3KLDA 4JHAL 1I8LC 2EYRA 3DO7A 4S0SD 2XFXA 3C87A 5EU5A 1FG2B 1K8DA 3OF6D 4W6XB 4HGWA 4POYA 2ZOLB 1MVUA 1YPZF 3BN9D 3LEYL 2VDPL 1HNGA 4QXUH 3WFCH 2IPUG 4K3HA 3RX5A 5T33H 2YRPA 2DWDA 3BH9A 1ZHKA 4N0FB 4CL7A 4A2MA 1NAKL 3KR3H 1VENA 1KTDA 4A6YH 4YDLC 3RKPA 5J1TC 4KQ4H 3NCBB 5JW4N 4LHQB 1KEMH 4ZOCA 4X9BA 1HYSD 2L0DA 1HHKB 2F58H 3GJFK 1G9ML 5CGMA 4M7LT 3ILPA 2X4SA 5F7HA 4LVEA 3MV8A 2YPLD 1IGIL 3AY4A 5LCVL 2YSSB 3MRGA 4PTUB 1WTGT 1N2RA 3RRQA 1AGFA 3HPLB 4OV6F 1U3HC 2NY1B 4OSUH 2ZCLH 2XRAH 4RMSA 2BSSB 3QFJE 2FX9H 1BIIA 2QR0B 1XFPA 4KHXL 3TT3H 5LJYH 4TVSa 1QYGH 4L9DA 1WSST 4K8RL 4LCUA 4Y19D 4P9HL 4IOIA 1N3NA 3OR6A 1J0JA 1XEDA 4C4KO 4ORZC 2BSTB 4MA3A 5T1MA 5JW5B 1MJ7H 2XY2A 3B2UC 3QUXA 1R5VB 3U9PH 4PYGA 4KRMB 4JM2B 5CWSA 4RBPH 2IPTL 1Q9LA 2C4FT 3S6CA 3C08L 3EFDH 3FQXA 2I5YL 1RZJC 3LKRA 2EE3A 3C8HA 4U31A 4HPYH 4X99A 1G0YR 1U8MA 3TGXA 1CK0L 2EO1A 4NRYB 4U6VH 1Q9KA 3FB8B 1C5DA 4TVPD 1TJGH 3JVGA 4L1HA 1TCRA 2ZJSL 4OLUH 5F3BA 1QBLH 3SGKA 1U3HB 1XF4B 2JE8A 3MA7A 1VPOL 1ONQA 3OX8B 5GPRA 2A6DA 2PYEA 4MD4B 4D3CL 3DPBA 2SEBA 1FVEA 1DR9A 2Z31C 2NZ9D 2YC1A 4NQEA 1UXSB 2WUBL 3JWOL 2GTZB 4KPHH 3D85D 4F3FA 4XAWL 4LLQA 2IH1A 4WFEE 5I8OL 4PJGA 4ODXA 3LKNB 1CF8H 2YMXH 4PBVC 5GGSA 4G7YL 5C0RH 2IAMC 4MJ4A 5GRYA 1VGEH 4IRZL 3ZL4L 5JIHA 3CSYB 4R2GC 2UWEA 3RL2A 5KVGH 4OZIA 2CUIA 4PLOB 1I3RA 3MJ8B 4Y4FC 3X13A 2WLYA 3WLBA 2LAAA 2WBJA 5DGRA 4NO3B 2KZWA 3NCCB 5K59E 4XCEB 1H3XA 25C8L 2VL5B 4ONGL 1KELL 3HB3C 3TIDA 2HTKC 4Y5XC 5FCSH 3MGAA 3O6KL 2HH0L 3SGEH 4PJDA 2AXHA 2FIKA 1YEDB 2OTWA 2E9IA 4OM0H 5BZDA 4OZHB 1LGVA 5C2BL 1WBXA 2Z31B 4P4RA 3QUYA 5INCA 2DQHL 3KJ6H 2EC9U 4U33A 2EIZB 2AV1B 3TJHD 2RIKA 1AXSA 3QQNA 2CDEB 3U2SA 1KN4L 4YXLL 2MPAL 4D0CB 2BNUB 2ADIB 2FJGB 5I9QB 3IDJB 4CDGC 3O45A 4TNVK 3G04B 4D9LH 2BVUA 5SV3A 3B8YA 4Y4FB 4XPBL 5MEOB 4LSUH 2EEDA 1GXEA 5KSBA 2AJZB 4PG2A 1V7MH 1D5IH 1W0VB 5JIKA 4O02L 4GKNA 1FCCA 5HHMD 5JOFA 4BFBD 3FQWB 3S37X 3LN5B 3CZJA 1NFKA 5DEGA 4ZFGH 4YHLH 5IMMA 3WFDH 2CDFA 2OMNA 2WNGA 5BZWB 4N5EC 4KI1A 4JFHE 5DD1L 4PS4L 1IKFH 4GXUN 1ZHNB 3T09A 5HVWA 1UWXK 3PDOB 1IM3B 3VFNA 1QR1B 3GJEA 3BIAX 4PJBA 5E99L 1NLDH 2DD8H 3NPSC 1CLYH 3LKSA 2HWZL 5CJQH 4G6JL 5JA9A 1F3JB 3P4NA 1CFNA 2JIXD 1NDGA 2RFXA 4K3JL 1JHTA 5F89B 3MXWH 4OZGE 5IFHH 3FT2B 5SWZA 1S7UA 2W0KA 1NMAL 1RUKL 2P48B 3VXME 2BOBB 2GYSA 5I74C 5F70A 4AEIH 5HHNB 3SHSA 5C1MB 3TESA 5JOPD 2DQTH 1Q1JL 2XN9D 5FYLD 3WIFA 5HYSG 3STLA 1E6OH 2OJZH 3CAFA 5DJYA 4UB0H 3O2WH 3QYCA 3MFFB 4JKLA 4PJEE 4RIRB 3OSKA 3QCTL 1MELA 5J6HB 1Q38A 3DTXA 3W0WE 3A6BH 1VERA 4M7LH 1OGTB 4JKWA 3K46A 3G5XB 5F9JB 2VDKH 3MR9B 5EULV 2P5EB 3GFUA 4YX2L 1MFCH 1DEEB 3RU8L 1SJXA 1CYGA 4I3RH 5D2NC 4QRUB 1EEYA 5TF1H 1EEQA 1MREH 4UAOB 4DEPC 1DBJH 3P40A 2JJUA 1IBGH 4RRPG 4TNWK 2HLFD 1BGXL 3SKOA 5ECJE 4EDWH 2Z4QA 4JFYB 4TULH 3NPSB 2H9GB 5FOBA 4EXKA 4JAMA 5JORA 1K2DA 5D7IB 3G5ZB 4JPKH 3RUGA 3S35H 1RZ7H 1FLRL 5FM5M 2DBJA 1S7RB 1FPTH 3TCXA 5IMLA 5I74B 4X6CF 5HHVH 2F74A 4FQ1L 5CEXB 3QG6B 4JE4B 3RPIB 5J9PA 1GVIA 1PSKL 1YEEH 2G60L 3ARBD 4Q9RH 1TNNA 1AY1H 1DDHA 3AS2A 3BJLA 1B6UA 3QEQB 1NGPH 1M7XA 4LEOA 4NSKB 1P4LB 3OJ2C 4P2RD 4LFHD 1S78C 5TDOA 1ZSDA 2GSGB 1MCWW 1OCWL 5DQJA 5SWSB 4NQSA 1Q9OA 5D2NB 5F3HA 3T4AB 4LSDA 4PJXB 4DEPB 4KUZH 2AJ3A 3W5MA 2JCCF 1U92A 3SE3A 5I1EH 1EPFA 5D7JB 2D7TH 1QRNA 3T77A 1KLFA 1G0DA 2BFVH 1XGYL 1KC5H 3VXPA 4G6FB 3S36L 1QFPA 1YYMH 4PUBH 5K9JH 5J6GA 1HSBB 3MLTB 3LS4L 4QHMA 3BIBX 3QDMD 4FFZH 2LAGB 4IIQB 2H2PD 4P46B 5H2BB 5MEQB 2G75B 1FL5A 4OF6A 1GIGH 1A6VH 4XI5C 4LAJH 4HUUA 1TZGL 1D5XA 1I1AA 4Z95L 5L7XL 4W70A 3VXSA 4J4PD 3C5SA 5J06A 3B5HA 5CZXC 4I2XB 5HYSA 1A1MB 4U6XB 1FFOB 3ZE0F 1DFBL 4OF0A 3MV9D 4ZODA 4LLWB 1YN6B 4Q97A 3GK8H 1O0VA 5DJ8B 3WHE0 2EKSA 1U3ZA 3ULUH 3QHFH 2GT9A 1TNMA 5KANG 4PB9H 3EYVB 3QG7L 3H8NA 1T4KB 4CADA 1AQKL 3RDTD 1KT2A 1QOKA 4S2SB 1NGYA 4Z7NE 3C5JA 1QO3B 4AENA 4J6RL 4RRPA 1OP3H 2P49B 1Q94B 5AZEH 3GKWH 3V0AC 4HWUA 5E70A 1QG3A 2BHYA 4O4YL 2FL5B 3OXSB 1CE6A 4P23A 5BV7C 3MLZH 1DP0A 4NJAL 4J3TA 4KRPC 5EZLB 1VFBB 3VJ6A 3RWFB 3F6IA 1E4WH 2VLRB 4OZHE 5J56B 5C0CB 4HEPG 1F3DJ 1YEGL 1WEJH 5IVZA 1JUFA 3VXOB 5HI5D 5ACMA 3RVXC 5B8CB 3VXUA 2KZ1B 3RGHA 4RA3A 3P9LA 1MY7A 5C70A 3LDBB 3M17B 1AP2A 4JPIB 4KMTL 3VXNB 5LXGH 1MI5D 1KTRL 1SMAA 2Y5EA 1JGUL 4FFYH 3F7PC 4UNUA 3WFBH 4HWEL 5DRZB 3MTRA 4L4VA 2NXYD 1G7MA 3GO1H 3V4UH 2J1KA 12E8H 3WNKA 1X5IA 2YOCA 3D39A 4HW6A 3F62A 3CK0L 2BOCA 3RA7L 2VDML 5DSCA 1TENA 1BZ9A 4N9GB 4Z78A 1JHKL 2ZUUA 1INQB 1W72A 2IH3A 2H32A 5EBGA 4KRPB 2MKLC 4K94L 2HG5B 4R4FH 1I1YA 1HOCB 4M61A 3BZ4A 4OAWA 3FFCA 1HHJA 3FOMB 5FUZH 1LEGB 1YC8A 1EX0A 2E8ZA 3FN0L 3BQUB 5T1DL 1ZGLB 2R0ZL 5T5NG 4HLZH 5IHUH 3LPWA 3O6FB 3TFKD 4OM1L 1AGDB 1INDH 2BMKB 4XVJH 4U1LA 5DHXB 4AM0A 4AY0A 3CZFB 3QWRD 3DV6A 4WW1A 1QSFD 4N90D 4BZ1L 4NO0A 1XR8B 4X5WA 1X5FA 2DTSA 2YRZA 3KLAB 4HUWA 1MCIA 2FLRT 1HI6B 4Y89A 3K4AA 3GIZH 3EOBB 2M2DA 4OCSH 3X17A 1MRCH 4GAYB 5IB5A 4OD2B 1MRDL 4RWHA 4F7MB 2NY3C 4J8RB 3IDMB 3H3PH 3LH2H 3VI3E 5KVEL 1NBVH 2IAND 3LAFA 1NMCC 4O2FB 3AREA 4OLYL 5HJ3A 3AU1A 2PUQT 2ADGB 4WW2C 3K2MC 1T6WA 5B3JE 1PKOA 4MWFA 2P5EE 5FCUL 1BBDL 1LDPL 3MUGB 5TE6L 4NHUA 2VMFA 4GKOA 1WGOA 3V6FB 1XIWD 5EZOL 3WSQL 3PWNA 1DUZB 2APFA 1IKNC 4Y5VB 3LHPL 4JO3L 4KJWC 4JJHA 2R4RL 3OKMA 2ICWJ 2VDQH 5F7MC 3MRPB 3E6HB 2ZZUT 4UQ2A 4HXAH 2O26U 4NQUA 2ESVB 4Q58C 3V0WL 3OKLB 1ZT7A 1LEIA 5D7IE 4A6YB 4IS6A 5IEHB 4MXWL 5T3XH 2BNQA 2W0PA 3NMEA 1JK8B 1VADB 1F90L 5C0ND 2Y25A 1U93B 1RZIA 3E3QC 4NUGL 4U7KA 4ZTPH 3VD7A 5J12C 4YBLB 4QHNA 5TE7L 5CD5C 3R1GL 2DQIH 1EEZA 2Z92B 1A6ZB 3A67H 4PD4J 1ZLUH 2O5YL 2V2WB 4PV8B 3WNPA 2NY3B 2UYLB 2O5XL 2CLZB 3QDJB 5DUPH 4NGHL 3QEQE 1NMCB 3E8UL 4KJPC 4WW2B 5L6YH 5C92A 1CDBA 4FP8L 3IVKB 2IQAB 3WDHA 5CBEB 2CO6B 2P47B 3BD3A 3LKPB 4EI5D 4NJ9L 5D2NE 4KKCC 4N8VB 1W72L 4PJXE 2XY1A 3VFMA 4PV9A 4G8EA 4Q6IB 2ZUTA 2ZUQC 3V5DB 5HGBA 3BRDA 4L9LC 4YR6A 1MFNA 1H9VA 2AI0H 3WLWD 2J3SA 1CGXA 4FG6C 4LNRA 2FJFB 5CUSH 3VG9C 3A6CL 2GHWB 3DUUA 1IGFH 5T5FH 1BREA 4MDIA 4PG9B 2VZVA 4JHAH 3VCLA 1E27A 2PXYC 2GUOA 4E5XA 1AFVL 3O3EA 3O41A 4D0DB 3EO9L 1JZ8A 3BGMB 3T3PE 3BIKA 4MDJB 5ERWB 5LAXA 2XICA 4MNGB 3LEYH 3T1WA 2VDPH 3S5LG 2EDLA 3GSUA 4KJYA 1B4JL 3VFTB 4NKMA 1UFUA 5IW1B 4LU5L 1LDSA 4I2XE 5MENA 3P77A 5AD0A 2I9TA 3MOAL 5FKAA 4M00A 43C9B 1EXUB 3MNZB 2GJZB 1G9MH 5IFJA 4Q9CA 1L7TL 3KPTA 4QXTA 1KPUA 5BQ7A 2VXSL 1IGIH 5LCVH 4M5ZL 3PE9A 2LV4A 43CAB 1E4KC 1YNKL 4U1NA 4GQPH 3OJDB 4G6AD 5F1KC 1BZ7A 4OF7A 4KK9C 4KHXH 3UBXB 5DT1H 4HK0B 3VG9B 3QIWB 1A6AA 4JZOA 2XI9A 3OKOB 4J1UB 4K8RH 4PJAA 4P9HH 4BYHA 2PXYB 1ULVA 1SYSA 2P8MA 1KJMB 2FSEB 4QRRB 4XVUD 4HXBL 5I1HL 3HRZB 2GK0A 3QZWB 3MNVB 4OD1L 2G9HB 3TJEL 1UVQB 3EHBC 5F9DC 1RUAH 1NBYA 1D5ZA 2WIIB 3EUUA 3WNMA 2XWBB 4MVBC 4IOFC 5IOPB 1M7DA 2ZSWB 3WO4C 3LV3B 5C0CE 3C08H 3IXTA 3H6JA 5EC2A 4U6YA 2XIDA 4JANB 5LG1A 2PW1B 1JGDA 5C09B 2ERJC 2HVJB 1A6WH 2I5YH 4JFDB 5IBTL 3BUYB 1NMBL 2F54A 4IRSC 5DRNB 5HHXL 4NZJA 1JPST 2NY2C 1N6QL 4XPGL 1CK0H 2ID5A 1OF2B 1EZVY 4MAYD 1IC4L 4HUKB 2Z8RA 2ZJSH 5F1IA 2V9RA 2Z0BA 1JHLL 5ANMA 1VPOH 4OFYA 5GZNC 5DK0B 5BOZG 5I1JL 4RMUA 4PGEA 4D3CH 3VWKA 1Q0YL 5EU6D 1A1NA 3BI9X 4KQ3H 4P4KC 1KG0A 1N5AA 1OAYH 1T89A 2B4CC 2FNBA 1U8NA 4YE4L 3JWOH 2WUBH 5C08A 1RULL 1RZKL 3P4OB 2YHGA 5GRVL 4P5TC 4X4MA 5IB4A 5I8OH 1MLBA 5B4MC 1AGEB 4PY8J 3KPNA 4Z77B 1NFDA 4G7YH 2EE9A 5IGXL 5JXED 4XC3L 3VFSB 3ZL4H 5EA0L 3HZKB 1R0AH 2BSRA 4OBRA 4FTVB 2ERJB 5EBWA 2PTVA 4L3CB 3QJHB 3JTTB 2V5SA 2KUTA 5DC9B 2ZUWA 5BRZD 3MRLA 5EDXA 4BKLA 5H94B 3S5LA 1ZHBB 4J23A 3T3ME 4IRSB 4FHBD 2NY2B 2X70B 3Q2CA 5F7WC 25C8H 4ONGH 4D9QE 2A83A 1KELH 4F9LA 3OKEB 3ALWA 1CBVL 4YXKH 1WISA 3O6KH 1ORQA 3ARUA 4JRYB 3HN3A 4J3WA 3P0VL 3VDCA 4I0PA 1T22B 2GY7B 1IZKA 4PBWD 2E7LA 1I7RA 2YK1L 3L1OL 4HQQL 2DAVA 3PUCA 5C2BH 1A4KB 2XQYK 1GHFH 1L9NA 1HCFX 5HYIA 1U8JA 1EO8L 2DQHH 3WXVL 3DIFB 4M1CD 4GOSA 2Y72A 3KPSB 4X4XB 5EPMA 4P5TB 4YHNB 2VXTL 4BQ8A 3FRPG 2KBGA 4HWZA 4G42A 4ZOAA 2QQKL 4JY6A 4YXLH 2MPAH 3UC0L 1GC1H 5J1AB 1TTUA 4J3VA 3EOYG 2J88L 2OYPA 3BFOA 3BE1L 3JBG7 4JM4L 4X9IA 2R39A 2HTLC 1TJHL 5CZVL 2DBLL 3QIBB 1C1EH 1OP5H 3HE6D 5BJTB 2VLME 2CMRH 4MS8C 4XPBH 1EIBA 4K9EL 4MJ2A 3SDYH 4CRPA 4DJMA 4HEME 1FIEA 3LMJL 5FYJE 3RWDA 4TTDC 1IEAB 4E41B 2FR4A 2PYFA 4WU5A 4YHIB 3U0PB 4HAGA 2ESVE 3KJ4B 5J11B 4O02H 4RMRA 3CC5B 1HEZB 4LVNC 1FZMA 1KPVA 3RTQD 4L4TB 1T1XB 1A7OL 2VDNL 5DD1H 3W2DL 3S9DB 4PS4H 3L3KB 3UPRB 3QDJE 4G8IB 4JG0L 2ZUSA 4YEFA 3FKUS 1JWUB 2X89D 5E99H 4WDIB 2HWZH 4ZD3H 4Q9QL 3BEVA 3U6RA 4PIRF 4HUNB 5GS3A 4KC3B 4K3JH 2DJUA 2RCSL 1DVFC 3OAYH 3QXDA 1ND0A 2HFEA 4V1DB 5F7LB 1OGAA 1NMAH 1RJCA 4UQ3B 3DXAB 1XF1A 3GMOB 3WJLA 3P2TA 1L0XA 1QZ1A 4GJTB 3FO1A 1Q1JH 1BOYA 2P5WB 5SX5H 4ISVA 3W39A 1Q9WB 1PD6A 4BUHA 3BWAB 1JP5A 4Z7WB 1KN2L 2XPGB 3QUKA 1NDMB 4RSVA 3ZDZE 2DB8A 3P4LA 1B2WL 4WWKC 4DFHA 2J8HA 1ZE3C 2YPKB 4KKAC 3S96A 4YX2H 5ALBL 2XNAA 1WTLA 3SDXB 3RU8H 1YY9D 3W82A 1AGCB 2VXVL 5J7CC 4LPTA 4MNGE 1PG7L 4Y19A 3EJYC 3RGVA 4Y4KA 2P24A 2FB4L 1BGXH 1J05A 5C0DB 5DK2B 2LQRA 2IBBA 3PQYD 4IDJL 3SDAC 4TUKL 4LSVH 2NPLX 2XZQH 2Y6SD 5JZ7D 4DZBA 4P48A 1FLRH 5AUMB 3FRPA 1A5FH 1X5HA 1S9XA 4M7ZC 4ONFH 1W2KT 5C0AD 3GMNB 3O4OB 1CQYA 5C07A 3H0TA 4XCNA 5IB1B 5T1LD 1G7HB 1PSKH 3ECBB 4GLRI 3PWPA 2G60H 5JPNB 3KPRB 1EK3A 3DWTA 4WHTA 4UIMB 1QLFB 4QOKD 4ZNEA 3RVTC 1DUYA 4UUJB 5C0JB 4QRRE 3O3BA 2I9LB 1OCWH 3LQAH 2JELL 2XACC 4EOWH 4WO4D 1EBPA 3VE0A 3PHOB 1YDPB 4TOYL 4G7VL 1CICC 3QNYB 2AK1L 1ZV5A 1FZJB 1GZQB 3VU2A 4AQOA 3CX5K 3IKCA 1RJZA 3D85A 5EZJB 4X6EA 5EN2B 2BVOA 5T3ZE 1Q72L 3S36H 4DUXA 3SDAB 4HJ0C 4H88L 4JFDE 3DBXB 5IQ9A 3LN4B 3F7RA 3MO1B 3MYJA 3PIQB 1J0HA 1S78D 4M7ZB 1CR9L 3UTTB 1OTUC 3RZWA 4LSRL 4ERSL 5E94A 3R8QA 3EKCA 1GAFL 3GMRA 3B6SB 5E6ZA 3FO9A 4O2CA 3TIEB 3HAEH 4LAQL 2GFBB 4G9DB 4Z95H 5L7XH 1JN6B 3NCEB 4RDQG 4HKBA 2HP4A 2AK4D 1NAMA 3T0BA 3RL1B 3BD4A 1IILE 1DFBH 2VDRL 2Y5TB 4HV8B 4ZPVB 3OKNA 3QUZD 1CICB 3VWJD 5C9KA 3JWDC 1T5XB 1HWHB 2IEPA 4L3EA 4ZDHB 5BMFL 1CXLA 1QHOA 5KSAA 2YD7A 4FTVE 1AQKH 4Z7UB 4P2YA 4ORGA 2DQJL 3HCVB 4U7MA 1GOFA 3QXAA 4PRIB 2NY0C 3C6LC 4UBDC 5HGDA 3VH8G 3SDCB 5B38B 4J6RH 5I8EA 2A74B 1UGNA 5FYKE 3EDJA 3DMMC 3TNMB 3BP5A 4HIXL 4G9FD 4O4YH 3IAPA 3TN0B 3FQUB 4ZPTB 4B7LA 5ESVB 2XKSA 4BQ6A 2N7BA 3MRRA 4NJAH 4JRYE 1KB9J 1WFOA 1P9MC 2VLLB 3KNBA 4NKOB 3I6LD 3R4DA 3AAZA 1D9KC 4KV5E 4M43L 5ICXA 5JW3L 2V7HB 1YEGH 2H26B 2ICES 3KPSE 5F9WC 4HFWA 3ORJA 3X3FL 5EU3B 3S3PA 3O3AB 4XCYA 4KMTH 5JDSA 1I4FB 3ARVA 4B53A 1MCBA 2H1PL 4TN9A 3GIVA 3HKFA 4GT7A 1NCBL 3AM8C 4HWEH 1ETZA 5KJRL 5ILTL 2Q8BL 4W6YB 1FQ9C 4HBQA 2R23A 3C6LB 4E41E 5GS1C 4LCIL 3CK0H 3RA7H 4C83B 5GS2H 2VDMH 5FA4B 1TXKA 3RVXD 1RK0B 4PP1D 5J8OA 1JHKH 1B0GA 2V5TA 4GLRH 1AQDB 4YHYC 2NW3B 3RZCD 4K94H 1MAJA 4JJ5A 4LRIA 1D9KB 1CD0A 4L4TE 4P3DA 5E1AA 1GGBL 1VFMA 2DM2A 2VZ1A 3FN0H 2HT4C 5T1DH 1WC7A 5FYJU 1QSVA 3RWJB 1QEWB 4Y4HC 1D5MB 2B2XL 3MCKB 4OM1H 1YUHA 1EMTL 5HHPB 1TVHA 2K3TA 5DJ6B 4JFZL 2NW2A 1U8QA 2CD0A 4G80A 1NAML 3BSZH 1ORSB 4X7EC 3LZFL 1TITA 2Z8VC 4V1DE 1DJSA 5HBBA 2BNRB 3DXAE 4JRXE 2X6MA 1WZKA 3HG1D 4BSVA 2P5WE 4HK3J 1OAXL 2YR3A 3V4VL 1LO3L 4XGZA 5KVEH 1J8HD 4Z7WE 1T20B 5DJCB 2AVGA 2EYTA 4YHPB 4LHUB 3EDKA 4YHKH 2W07A 3VH8A 2FHBA 1PKQB 1JFQH 3QEUB 3PWJB 5DJZB 4KK8C 5GXBB 4LGPB 5FCUH 5DD6A 2P7TA 4BK5A 3SDXE 3ARFD 1LDPH 3MCG1 5TE6H 3OGCA 5DEFA 5EZOH 2R9HC 5FB8A 3GBNL 1MHPL 3DROA 4JO3H 2QEJA 2R4RH 4PJ7B 4Y4HB 4CMHC 3UTPD 2XYCA 5A40E 4S1SL 3SE9H 1QKZL 4LLDB 5J3HC 4MXWH 5F7FA 4UT6L 1O7VA 4JFQB 4QYOB 1J5OL 3C2AH 1F90H 4NUGH 1MJUL 1NJ9B 4AH2B 4N0YL 3D87B 4OBSA 5CHNA 5TE7H 4ACPA 2VZOA 3R1GH 1YC7A 5DQDL 1EEUA 4X8XA 2YD1A 2O5YH 3QDMA 2O5XH 3VFUA 5FEBA 2Z93B 1EHLL 3MGOB 1J11A 4G8FA 4H1LG 4NGHH 1YEHL 3E8UH 1RIHL 4N8CL 4XMKL 3VFVB 2DLEA 4C59B 2PO6B 4FP8H 4M6NH 3MMEB 4NNYB 1X5XA 1UC6A 2NY5C 4NJ9H 4CVUA 2DDQL 1W72H 3GGWA 1BFOB 2H32H 4J4PA 4YFLF 5DGQA 1XH3A 3MSPA 5CEYB 3MLSH 4C56E 3QFJA 4NN7C 1K5NA 4ODUB 4XNQB 4XNMB 3MV9A 1A9EB 4OUUA 3O4LB 3P9MB 3ZZ1A 2OL3A 4HS3B 5C6TH 3A6CH 3UZEA 2DQEH 4JHWL 1AH1A 1BLNA 1IQDA 1BIHA 2LU7A 4ZXBA 1IL1A 1YMMD 3UTTE 2EDTA 4OGXL 4HFUL 1M6OB 1AFVH 4BQCA 1T0NA 3T0ED 3EO9H 3W9DA 4EN3B 2EXYD 1HDMA 1FL6A 4KKCD 2C7UA 1WBZB 2RAMA 1JF1B 3BDYL 3T1FA 5D4QA 4U3HA 3K74B 2W65B 1BJMA 4BZ2H 4LU5H 2X4OA 1T80A 4R4BA 2NY6B 5DVLA 1K8IA 1MCFA 2YD2A 4HC1L 4AIOA 3MOAH 4P5KA 4FG6D 4GXVL 4LLMA 3REVA 4TPRL 1LD9A 2NTFA 2H3NB 4XRCB 5GGUA 5B39B 3QEHB 4P2CG 1PAMA 4MQTB 3BP7A 4LQ1A 5DC4B 1T21A 2VXSH 4XCFL 3IJYA 3KAAA 4DN4L 4WHCA 1YNKH 3DO7B 2XFXB 5HYJB 5EU5B 4Z7UE 1K8DB 4HGWB 4LSQL 1TCMA 5E8OA 4PRIE 1MVUB 4F58L 5KZCB 1I1CA 1R3IL 3G9AB 1U6AL 3MLVH 4HXBH 4DK3A 3X14A 5ISZB 4OD1H 3BH9B 1IAOA 3TJEH 1CD1A 3CCHA 1BJ1H 2XG5A 4XBGA 1KTDB 2YEZB 4PJEF 2WANA 5ESAB 2F8OA 1QLEL 4HT1H 3ZYZA 5CD3A 1MWAA 4OFDA 4WI5A 4HPOL 1HIMH 3ILPB 1NCWL 5LWYL 3SE4A 5DD0L 3MV8B 5FYKU 1FYTE 3MRGB 5E8EA 1N2RB 1T1YA 1AGFB 3SGKC 5IBTH 3SY0A 2YD4A 5D1QD 5DJ0A 1NMBH 3O6ML 2CIKB 3FB6A 2X5PA 5HHXH 4I18C 5LGHL 1N6QH 4H1LA 3EYFA 2XWJA 1R24A 1IC4H 1EJOL 4FXGB 1MAML 4LCUB 3GZKA 1N3NB 3OR6B 1JHLH 5IESL 4M6AA 4HJJL 5T1MB 4DCQB 2J8UA 5I1JH 2B0SL 3QUXB 3QWRA 1TVBA 1Q0YH 2Y23A 5D72L 4YE4H 5CWSB 3O11A 1Q9LB 1WFNA 2AQ1A 3UJTH 1WZLA 5BW7A 1U58A 5CILL 3DUSA 3GBML 2CXGA 1YEFL 3CFCL 2OL3L 1A22B 3FQXB 5BOPA 4V2CB 3DSFL 4RMTA 3QPQD 5IGXH 5C0BD 2MQ0A 4NC1C 5EA0H 4X99B 1U8MB 5KSUA 5FECA 1ZGLM 2IANA 1Q9KB 4N0UA 3KYOA 1C5DB 3D3VD 4YK4C 3JUZA 1TCRB 2IG2L 2QSTA 3T8XB 5F3BB 4NZDA 1NCUA 4JM2F 2JB5L 2A6DB 4H8WC 3P73A 1FVEB 3UTSB 2Y1VA 1RURL 4NQEB 1CBVH 4OQ1A 4F3FB 4LLQB 2BNRE 4XNUL 4M93C 3P0VH 3V7AE 2IH1B 2C4FU 3T2OA 5HDBE 3HMXA 2YK1H 3L1OH 2DKSA 4ODXB 2P44B 1KBGL 3GMLA 3SJVE 1EO8H 2CKBA 3O8XA 4NQCD 3WXVH 4GG8A 4JFFA 1GGYA 2BCKA 2UWEB 3RL2B 2VXTH 3C60C 4OZIB 5H37G 2QQKH 1I3RB 5IV2A 1PKQE 1KF9B 4S11A 4OZGA 3X13B 1JMZA 3EYUL 3WLBB 2ATPA 2WBJB 4Z0BH 3CVHL 4FMFA 3BE1H 4JM4H 5DFWH 1JBJA 1CL7L 1TJHH 1VEMA 2DBLH 5CZVH 4LLYA 1NBQA 4K9EH 5MP6L 2VDLL 4PJ7E 4R9HA 1OTSD 1HCVA 3ARDD 3BH8A 2OP4L 1J18A 5FAAA 4PJDB 1MWAL 5E9DA 2OTWB 3UAJC 5BZDB 3W0WA 1CQKA 1WBXB 4P4RB 3GI9L 3QUYB 3OAZK 1PYWA 1TPXB 4P59L 1AXSB 2E7HA 3U2SB 1JCKA 1FVCA 2GTWA 1IGCL 1MCDA 2CPCA 3W2DH 1NCAL 2PF6A 4JG0H 4N0FA 3O45B 5DD5H 2HKFL 3C60B 1SJVA 5L2JB 3MBXL 3VGFA 1DN0A 3IDIB 4Q9QH 4OZHF 4WFFD 3BPNB 4DQOL 1HHKA 4FQXC 4CMMA 4PGDA 1TMCB 2DQGH 3GM0A 2RCSH 2PW2B 3HI1B 3K8KA 3PHQA 3VGBA 1AE6L 3IFOA 5KSBB 5K9QG 5FO7A 3N1MC 2YSSA 4PTUA 1T5WA 5JOFB 3HUJF 2IBZY 1ES0A 3QDAA 2QR0A 4KGJA 5DEGB 2VAJA 1QSED 3O4LE 4JZJC 2CDFB 4NM4L 1L7IL 1VFAA 4KDVA 1I8LA 3LB6D 3VRIA 1B2WH 4X6CA 3HI5H 4MCYA 3GJEB 3GSQA 5ALBH 2X1QA 4ODWA 4PJBB 3ET9F 1KCSH 4CN4A 1K4DA 4PFEA 1RK1A 1CFNB 1NDGB 3Q6FA 1PG7H 2MQ3A 1JHTB 5SWZB 5ACLA 1S7UB 3HMXL 1Y18B 4M62H 3CDCA 3N1QC 4IDJH 2BVYA 2CKBL 4TUKH 4FQXB 3WIFB 2VLKD 5TH2B 1L4IA 1T04A 1XCTB 4WWKD 5D5ME 1MNUL 4NFCA 2IALA 1XF4A 4DVRL 3DTXB 4JCLA 1RZGB 4MD4A 3S4SG 4EJ1C 5HYJE 4GBXC 1FFRA 1OT1A 4NC0B 1VHPA 2FDBP 5I1IL 2GTZA 4XPFL 4MAYA 1UA6H 1OSPL 1DN2A 1INEH 3LKNA 1AC0A 4KJQC 4FQLL 2JELH 5ISZE 2NMSA 2Z4QB 1JWSB 3L7EB 4Y1AD 3GMMA 5I71B 4G7VH 5FOBB 2XQYG 4JAMB 5EU6A 2W60A 4JGMA 5E4EC 4ZG1A 1K2DB 2FEEL 2AJYL 4OCLC 3RUGB 4PJHA 3ZTJG 3MJ8A 3UYRL 3WS3A 2BHUA 1WBYB 3QO1B 5SWQA 5KS9B 4GRWH 1J1OL 2F74B 4H88H 1AI1L 5IK3A 5HPMA 3MACL 2Z35B 1DDHB 2DL9A 3ULVC 1CR9H 4ZO8A 4LEOB 4ERSH 1QQDA 5TDOB 4RGOL 1ZSDB 1CXIA 1GAFH 1MIEL 2RBLA 4WJ5B 2YXMA 4XTRC 4LAQH 4NQSB 2Q86B 1NEZG 2JJTC 4AEEA 5C7XL 1U92B 1WK0A 4X6DF 1MIML 2CDEA 4WFHD 3KYKH 1ZA3A 2R2EB 2VDRH 3C09C 4TQEL 3T77B 1UCBL 4U1HA 2IAMA 1N7ML 4KDTC 4KVNH 1EAPA 4NOFA 5J6GB 4QHMB 5BMFH 5BVJA 2C26A 4FFVC 2GIYA 1QFOA 3VD5A 2F19L 1SEBA 3QIUC 4Y4FA 3TVMC 2E7MA 35C8L 3U1SL 3TCLB 4K55A 2DQJH 1RV6X 2AJZA 1FL5B 3ZYIA 4P23C 4KK5C 5CSGA 5MI0C 3WN5A 4HUUB 5CKAA 4Y5XA 4APQC 3RNKA 3QULA 1D5XB 3MGTA 3UTSE 4U49A 2R29L 3HE6A 1NC4A 5TPWH 5KSVA 5HYSB 4K3GA 3JTSB 5SX4I 4RZCA 2D9QB 4F7PA 1UEMA 1DCLA 1SVZA 3OQ3B 2EH8L 4M43H 5JW3H 3BKCL 5TJWK 2G2RB 2EKSB 5DMYA 1IM3A 5DFTA 2GT9B 3IFLH 2WBKA 4ZUUA 3VGHA 1ZKAA 4BUGA 4F2MA 3S4SA 2UWEE 4I3GA 1P6FA 1U8PA 2FO4B 5IVOA 1FV1B 1KT2B 5HPOA 3BO8A 2HT2D 3GRWL 3C5JB 3FT2A 4L8SC 4NC1E 1FBIL 2H1PH 2BOBA 2UVEA 1EFQA 5HHNA 5KJRH 2EYSA 1MCNA 5ILTH 2Q8BH 3EAKA 2J5LC 3K81A 3QUMA 3OBAA 4JO4L 4P23B 1CE6B 4O00A 5MI0B 4QNPE 3MFFA 3VJ6B 4LCIH 3S35X 1KGCE 4PJDE 4KI5C 5J6HA 4APQB 1RZJL 3H42L 1MFEL 1OAUL 3CD4A 3MRKB 4IJ3C 4MHHI 5IVZB 3MR9A 2P5EA 4I3SL 4D8PB 1JUFB 1ZLVH 2AKRB 2IGFL 5FGBC 4NHCL 4EQ2A 3P9LB 1JF6A 3PP3K 3L5XL 4LKCA 3GB7A 5E4IA 1GGBH 1AP2B 4QRPA 3NZHL 4X6BB 1WCBA 1AD0A 2FEDD 1XMWA 4NN6B 3OB8A 2B2XH 1EERB 1EMTH 4HIEA 4L4VB 1G7MB 3ZKNC 3QI9C 1NEZA 4JFZH 1J1PL 4RGNC 4L8SB 4O51A 3CFEA 4JPWL 3D39B 2YN5A 3LZFH 5CEZD 2BOCB 4NQVA 5F7UA 4EI6A 1BZ9B 4Z78B 4TUJA 2IH3B 2H32B 3AREC 5HI3D 2I07A 5IQ7H 1Z9OA 1I1YB 2HT3D 1LO3H 2UUDK 3BZ4B 4M61B 5GGTA 3FFCB 1HHJB 4IRJC 5FM8A 4XX1G 2GSGA 1H8SA 3D18B 4M4RA 4S1RL 5D7KD 1XGPB 3CLEL 4H0HB 2IFFL 5T1LA 4PJBE 2A6KA 3T65A 1L9MA 3DRQA 1M05A 4IMLB 3GBNH 1G7JA 4K71C 4UDTA 4UNTA 4B0MM 5L8LB 1J88A 4NO0B 5SWZE 4X5WB 3U7WL 4HUWB 4O2EB 2DKUA 4HH9A 2I27N 1UENA 4RGNB 1PLGH 3C5ZC 1HK6A 1QKZH 3M1BB 1FLTX 2XV6B 4KROB 4U6HA 2VIRA 3BHBB 3MC0A 3TH2T 4UT6H 1QFHA 5H2BA 1J5OH 4RAVA 1LNUB 1DQML 4LP4A 1MJUH 2DI7A 5HJ3B 3AREB 4GSDL 3AU1B 4OCWH 4NFDA 4OQTL 2UZYB 5DQDH 2Z8WC 2APTA 4F80A 5GS0C 3MZGB 5D93B 1PEWA 4IRJB 1FFQA 4NHUB 1EHLH 4PJ5D 1YEHH 5J13C 5I75B 5SX4H 1RIHH 4N8CH 3BD5A 2BY3A 4XMKH 4P2QD 3H7LA 2AEQL 2EIEA 4MQXC 4B41A 2DDQH 2ADJA 5FO8A 1MCQA 1EO7A 4K71B 1ZT7B 2VLJD 1LEIB 4IS6B 3K4DA 5KS9E 1OB1A 1QO3A 3NA4A 3QUZA 4R4ND 4UOW0 2ARWA 3C5ZB 2EIBA 3BT2L 4QHNB 1EEZB 4JHWH 3ZE2E 3DHJA 4Q0XL 1X4XA 5BS0D 5FM5O 3VFRA 1N4XH 4JO2L 5GRUH 4OGXH 4HMEA 5EZLA 1JV5A 3QJFA 3RWFA 4JQXC 2QKIB 1DL7L 3BDYH 2VZSA 3VFMB 2ZCHL 4HCRA 4PV9B 3DETD 3GHEL 5HGBB 4HC1H 1JF5A 3M17A 1CL7I 4L3AA 4GXVH 4TPRH 3NA9L 4R7DB 4GAFB 3O3DA 5F7KC 5JHLL 4LNRB 3UYPA 4XNXL 3SKNA 3DUUB 4XCFH 3KPLA 3VCLB 1E27B 3JSSA 1HWGB 1KJ2A 2DIAA 1MCPL 4DN4H 2E7BA 5MHSD 1F2QA 2GUOB 3QDGB 4LCWE 3SKMA 3O41B 4LSQH 1CXHA 2ZNWA 2DLFL 3UX9B 4PLNC 4F58H 2CK2A 3BIKB 5LAXB 4HUVA 1K4CB 4E9LA 1VFOA 4QHUA 1F4WL 1R3IH 2X1PA 4KJYB 1LK2A 1U6AH 3ULVE 4LIQE 4NKMB 4LQFL 2DICA 4I48A 2YWYA 5MENB 2FWOA 4AZ8A 1QFUL 2I9TB 5FKAB 1B3JA 1RPQA 3OV6A 3ZDZF 2ZKHL 4FOMA 1MUJA 4DGYL 1OM3L 5F6IC 1ZGLA 5DR5L 2EXWD 5IFJB 4LL9A 3BZDA 4KGLA 4QXTB 2LVCA 4HPOH 5DVKA 4EVNA 1NCWH 5LWYH 3N1FC 5BQ7B 4LPXA 3MV7B 5DD0H 1AGDA 5I16A 5AG8A 2BMKA 5ITFB 4QTIL 3VRLE 2DQCL 2A1WL 5IIEA 1AO7D 1RVFL 3O6MH 4MB5A 2C9AA 4U1NB 1NC2B 3ESUF 5LGHH 5E00B 5AAWA 1DLHB 1R3HA 4XXCC 1A6AB 2R0KL 4EBQL 4D9RD 1D3CA 1EJOH 3MRFA 1MAMH 4ZMAT 5DZOA 4PJAB 1T89C 5C0FA 5IESH 3EOBA 2P8MB 4ZO7A 2BHZA 5EO9B 2X4UB 4HJJH 2GK0B 3CH1A 4OD2A 2JTDA 4F7MA 1F3RB 1NBYB 5D72H 1D5ZB 5F1NA 4WFGD 1M7DB 1JPTL 1T66D 3OPZL 4PJ8C 5CILH 3IXTB 3GBMH 3I50L 1R5IB 5I18H 5EC2B 4U6YB 2OL3H 3LEVL 1JGDB 5FGRA 1NUNB 3JV6B 3S37L 3NABL 3MUGA 1T7XA 4QHLA 4L8DA 1Z9LA 3CSGA 4U2ZA 4W68A 2F54B 3MRHA 4XB7A 3FCTA 2D7OA 5F6IB 1G84A 1O5DT 5E95B 3GHBL 2E27L 2D0GA 1I8IA 4HX1A 4F9LC 2IG2H 3MRPA 5F1IB 3E6HA 4QWWD 3QZWG 5SWSD 2APVA 4ALAH 2ESVA 3IYLW 2C3GA 4L4VE 1T83C 5I73B 3ARFA 4YFEA 2DI8A 2JB5H 2WM0A 3K8MA 3T0AA 4PGEB 5IEHA 1CGVA 1JYVA 2Q7NA 3D39E 1A1NB 1KG0B 3KS0H 5D7JD 3MQIA 5C08B 1X5YA 3IDNA 1EHAA 1QFWL 5IB4B 4HKZA 1MLBB 5EH1A 3OB0K 1U9KA 4PV8A 3KPNB 1FCGA 1H8OA 1KBGH 1NFDB 1QUNA 4J2XA 4Y2OA 4GO6B 5DMGD 2KL6A 2OQJB 4KI5E 5F1OB 1KJ2L 3FFCE 4NBZB 4WW2A 3CNKA 4DOHE 5EBWB 2CK0L 2CKNA 2VNCA 3QQ9C 1A9BA 4R26H 3S5LB 3EYUH 1UM4L 2K9UA 3CVHH 1IKNA 5BV7L 3V5DA 3CFBB 1RUPL 1LO4L 1CL7H 1SJEA 3O9WD 5JW4Q 1N59A 1QVOA 4M5YH 3ZSTA 5CJ5A 3CFDB 5MP6H 2VDLH 1ORQB 2CO7B 2OP4H 3EDDA 4I0PB 4NUJA 1MWAH 2FZ3B 1HQ4B 4UT7L 4LDOB 4PG9A 4RGNE 1I8KA 3V5HA 1NCCL 4G8GA 1U8JB 3FO0L 3T2NL 3H3KA 3S34L 1WICA 1MY5A 4Z76A 2OXHA 1NUDA 2WWMD 4CN6A 3BGMA 4RMQA 4P59H 5CKGA 4H1LH 4HWZB 3L5IA 4MDJA 4G42B 4JY6B 4MNGA 5GHWH 4CVWA 2RGSA 1IGCH 1NCAH 5IW1A 5L8JB 3BN9C 1UM6L 3IT8D 1P6AB 2HKFH 1YMMA 1KCRL 5I19H 3NIDE 3OMZA 4FQCH 1A6TA 3DRTA 2D03L 4DQOH 3UAJD 2GJZA 5CAYB 4WVRA 2VLRD 3WIHH 3AGVA 1AE6H 4WU5B 1BEYL 5C0CD 2F15A 4L9LA 1HYSC 5K93A 1CFBA 1IC7L 4ZAKD 2Q76A 43CAA 1MSPA 2Y06H 2AXJA 3OJDA 1PZ5B 2P46B 1A8JH 1WFTA 3UBXA 1VA9A 3BKJH 4HK0A 5DJDB 1KPVB 4NM4H 1L7IH 5FYJL 1TTFA 4JREC 1JZ3A 2PXYA 4HULB 3HFML 4GRWB 2R0WH 4WI7A 3QZWA 3VA2C 2G9HA 1A1OB 4UDUB 3H7BA 2CRIA 3SOBL 4MA1C 1GGTA 3E1F1 5JHDD 2WAHA 3UTQB 3RAJL 4LF3A 4NKDA 3GDBA 3QXDB 4QY8A 2IBGA 5GIRA 1LILA 2CKBH 5DRNA 3FO1B 2B20A 2X05A 3L3HA 4I9WE 4ISVB 3W39B 2H45A 1HH6A 2Z91A 3IS1X 3BQUD 2P42B 3PWUA 1MNUH 2XWTB 5I1CL 4J3XA 3TH4T 3QUKB 4DVRH 5KVDL 2YPLB 3EOTL 4M6OL 3O6FD 1R3JB 3K7UA 3QDGE 1BWMA 2XKNA 4PJCB 4JREB 5AZ2L 5I1IH 1CGUA 1H3PL 4GQ9L 2YUXA 4XPFH 5AAMA 3P4OA 1OSPH 4Y19B 3RGVB 2NZ9C 3HHRB 2P24B 3HZYB 4C58B 4FQLH 4MA1B 5FXCH 1J05B 2W9DL 4KK6D 3MOBL 5EU4B 5MENE 5K9OA 3M45A 4Z7WF 3HZKA 1G9EA 2R1XB 1CDYA 5HDQL 3VRJA 3E2HB 4FTVA 4LVOC 4U1JA 4DZBB 4TSBL 4L3CA 3QJHA 1RIVL 2OI9C 3UYRH 1IAIL 5H94A 3U9UA 3MV7E 2MCPL 4IRSA 1J1OH 4Y16D 2DLIA 1PY9A 3IJSB 1AI1H 3H0TB 3B4NA 4U0RB 4RBPK 3H9HB 4XCNB 5EWIL 2XTJC 3MACH 4HSQA 2V5YA 3PWPB 5EUKA 3OKEA 3W11D 5HHQA 2HYMA 3ARGD 4WHTB 3D3VA 1DQQB 4XBEL 1DUYB 4S1QL 4F37F 4PTTB 1KJ3H 4RGOH 3EYSL 1MIEH 3O3BB 3FZUD 4P4KA 3VE0B 2VSCA 2WP3T 1V5JA 1PGRB 1JNLL 3KPSA 1CDIA 3HNTL 3MXVL 5C7XH 4P5TA 3IKCB 5D7LD 3NH7L 4FQIL 4MYWB 1MIMH 2APBA 3ULUF 1RJZB 3D85B 4X6EB 4X7TB 3TJHC 3D1MC 4TQEH 5A2IH 5E7BA 1D6EB 1UCBH 4HS8L 1N7MH 1FDLL 4OFPA 1S3KL 1EGJA 5IQ9B 5KVMC 4NQCA 2F54E 4CJ1A 1U8OA 4RISH 1FAKT 3SN6N 3MYJB 2JK5A 4EIGB 35C8H 4OIIH 3U1SH 2X4NB 3UZVB 2ATKA 1OAQL 4MJ6A 4QTHB 1KULA 5E94B 2CGRL 5T3ZL 3GMRB 4FRWA 2FX8L 3FO9B 1HILB 4O2CB 3CXDH 4ODHL 3BISA 2L4OA 3AMLA 1NAMB 1S9WA 1TJIL 5C08E 1DANU 4X4ME 1NFDE 4FFVD 2LVEA 5IB3B 1HZHL 3QIUD 3WXWL 1JWUA 2V7NB 4NBYB 4CBPA 5KSAB 1ITCA 1MLCA 3MRCA 4YGVA 3UYOD 2WMPA 1A7BA 4GW1A 4R8WL 2QSCL 3GRWH 3QXAB 3EJZC 4V1DA 5HGDB 1FBIH 5I8EB 3PP3H 4UQ3A 4JRXA 1C7TA 3GMOA 3BP5B 2MMXA 3OJVC 3RY5A 2DLGA 2MJWA 2P5WA 4JO4H 1Q9WA 3H9ZA 3MRRB 2Y7QA 3BWAA 3QISA 3KNBB 2XPGA 4UI2A 1NDMA 4WEMB 3H42H 3IGAB 3M8OH 5ICXB 1MFEH 1F5WA 1NL0H 1OAUH 1ZEAL 5FYKL 5HHMB 3SBWC 3TNNA 5GGQL 2YPKA 4I3SH 3G5YA 2IGFH 3SDXA 4Y88A 4NHCH 5EUOA 1ZOXA 4HFWB 1QSEA 3D25A 4PBXA 4XCYB 5B38G 3NZHH 3OG6B 3FB5A 1CCZA 2OJEA 5C0DA 3GIVB 5DK2A 1GC1C 5LQBH 2B4CL 2HLFC 1A21A 3P4MA 1A3QA 1VFUA 3QQ4A 5J0BA 1DVFA 2AEIT 2Q7YB 2R23B 2JJSC 4YHOH 1J1PH 2JIXB 4JPWH 2D0FA 5CP3H 1PVHA 2PN5A 5DFVD 2EH7L 3THML 2BJML 3D0VA 4M9OA 4ODSL 5C09D 3QB7C 2VQ1A 4GRLC 1EGJL 4Z8FL 1B0GB 3V95A 4JFDD 5E2TL 3ECBA 2YKLL 4BELD 4M1GL 3PP4H 4UIMA 4JJ5B 1JVKA 1W8NA 2GK2A 2YD5A 5AEAA 4P3DB 5GGVY 5L88L 4Y5YC 1KCUL 4P3WA 2DIBA 3ARBC 2FRGP 4WWKA 5E1AB 5C8JA 1W0YT 4GRWE 1WC7B 3U0TA 1V3JA 3KXFE 2GCYA 4S1RH 4NP4L 3CLEH 2IFFH 3QNYA 4KAQH 1YUHB 3U82B 1FZJA 1TVHB 5I0ZA 4C56A 4G80B 5EN2A 3U7WH 1J0KA 2OXGA 4LNVA 4LASL 4M03A 4Y1AA 1ZHLA 5BVPL 2P1YA 1CGYA 3LN4A 1IC5L 3MO1A 4NQXA 4RA0C 2CLRB 1WAAF 4BSVB 4H26A 4OT1H 2B8OT 3GSWA 4XGZB 2ICWA 2EYTB 1DQMH 2V9QA 1A7PL 2YPLE 1CTOA 4GSDH 4M7JL 5FGSA 3VH8B 1MCCA 3W9EA 4OQTH 3U48A 4G9DA 5ICZA 2P7TB 4W81A 5DTFA 3ARBB 4PJCE 5DVOA 3OGCB 4OFIA 2AJSL 5DEFB 4HZLA 4PJ9D 3QQ3A 3WFHA 1P84K 5FB8B 4NQDA 4YPGB 4J4PC 4HV8A 4ZPVA 4POUB 4Y19E 3SE8L 4P2RB 5IG7A 1CICA 4WUUD 4U1MA 2AEQH 4ZSOA 5KAQF 4ZUVB 4YNYA 4G3YL 2W92A 3DUHA 2BY0A 4ZFOA 2NXZC 3KPOA 1WCQA 4HJGB 4Z7UA 4JDTL 4CN1A 4RFEA 4PRIA 2QTEA 3MRDB 5B38A 3RDTC 5DDHA 2A74A 4NDMB 2BC4A 3BT2H 5CHNB 5E2VL 1X3DA 2WIMA 2HFGH 1QFWI 3TA3C 1AR2A 3QDMB 3LOWA 4Q0XH 4BJLA 1BJ1J 1CFSB 3FQUA 3O0RL 3VFUB 1CLZL 3QIBD 5ESVA 4G8FB 4JO2H 1WZMA 4ZNEE 4TVPE 1NH6A 4NKOA 2VLLA 4MQXD 3G6JF 5IBLD 4LBEB 4KTEH 1NFIA 5CIPA 3U4AA 2X44D 4C55A 4TSCL 1DL7H 3SO3B 3K8LA 2CDGB 2R2BA 3LQAC 3GGWB 3SQBA 1FYTA 2ZCHH 1XH3B 3EJJX 5DZLA 2WQRA 4LLAA 3GHEH 2FJHA 3PV6B 4NRZA 4ZO9A 5HI5C 3QFJB 1K5NB 1UACH 1JNJA 2DYPD 5EFIA 3NA9H 3CPLB 3MRNB 3MV9B 1XGQB 4PRPD 4OUUB 5K9KA 4F37K 4GS7C 4OGYL 5JHLH 2OL3B 5D6CA 4TUOA 4XNXH 3LY6A 5C6PB 1BLNB 1IQDB 1FNEA 1ZXQA 4ZXBB 3U46A 1NGZA 1MCPH 5E8DL 4D0BA 1IL1B 3C6LA 3P11L 1QRKA 3DO3A 5IP4A 4XB8A 2NXYC 3DMMA 5IW3A 3W9DB 2YA2A 1HDMB 2W0FA 3BX7C 1GSMA 5FA4A 3QWOB 3PGCA 3F65A 1F4WH 3PL6D 1AQDA 1HQRB 1UH2A 2NW3A 4NCC2 2X4OB 3FL7A 1L6XA 1P9MA 1ED3A 1K8IB 1D9KA 1OP3K 3AB0C 1QFUH 4P5KB 1TETH 4LLMB 3REVB 2ZKHH 1LD9B 2NTFB 4DGYH 1OM3H 2H8PA 5DR5H 1UB6A 5GGUB 2HJFA 3RWJA 1SEQH 1T1WA 2VC2L 5CP7A 1EDQA 2A6IA 1WIPA 3IJYB 4QTIH 2DQCH 2A1WH 1RVFH 3TFKC 2ILLA 1ACYL 1ORSA 3IDYC 5E8OB 3TP4A 3TC9A 3EFFA 2R0KH 1MI5B 2XQBL 3AM8A 4EBQH 3JUYA 3V6BR 5F7NC 1HXYA 3DYMA 1UEYA 4JFXB 3SJVA 5GS1A 1IAOB 5JMRA 1CD1B 2OR7A 3CCHB 4KU1A 2DS4A 2GJ6D 3U7AA 5DJCA 4YHPA 2EDFA 4LHUA 1JPTH 3OPZH 4J3UA 5CD3B 5TGBA 1WWAX 3QR2A 3I50H 3Q3GB 5HHME 3WS6C 1TVDA 5DYOA 3ULUD 3LEVH 4RFOL 3OXRB 4L5FH 4JFEA 3NABH 1UXWA 1S9YA 5E8EB 5ALCL 3KPRD 5DJ0B 3FB6B 3VFGL 3IXAA 4H1LB 3EYFB 1MFAL 1KTKE 4OZFG 5L2KD 1XIWC 8FABA 1EVUA 4PJ7A 1I9RL 3GHBH 4Y4HA 1QD0A 1R24B 2E27H 3MREA 5D6DC 4RNRB 2MKWA 4J7RA 2XXMB 5D2LA 1FNLA 2Y07L 2X9WA 2J8UB 3N85L 4XP6L 2DL2A 4PJ8D 1NCNA 4QYOA 2ZG2A 2VABA 3FO2A 3JWDL 4I1NB 1Q8MA 3O11B 2X7LA 1U58B 2BRQA 2AABL 3VI4E 3DNKA 5C0NC 1QFWH 1F8TH 4O58L 5JOPE 4OD3L 2XN9E 5FYLE 1XGUA 2K7QA 5DO2D 1RUQH 1CIUA 4YJZL 1KJ2H 3TBVA 4RGMC 5KSUB 5FECB 1D6VL 2ORBL 2WZPD 3VFVA 2IANB 4XMLL 4MQ7B 4MGXA 4N0UB 3KYOB 3V6ZA 1CDUA 5CLWA 1IAII 3JV5A 4YDJA 5F21B 4M3KB 2EDQA 1UM4H 2VUOA 5I1AA 2HFTA 4EI5C 1KPRB 4KKNA 1BOGB 3ROOA 4HBCL 3BRFA 3UROR 1RUPH 1LO4H 4E42B 4ODUA 3P73B 4XNQA 4L8BB 3SEPA 5GRJL 3P9MA 1KYOK 1QPXA 1PG7W 3LCYA 3WLWC 2XA8L 4R90H 4UT7H 1P7QD 3WHXB 2BRRH 3OTTA 3T4YA 2Q3ZA 2EDJA 3U4EA 1NCCH 3FO0H 2VLJA 4UINH 1H3WM 3T2NH 3S34H 5HVHB 1YEKL 2FH6A 2NY4D 5GISH 1YY8B 4JFFB 4KZDL 2BCKB 2VE6A 1TDQA 3UBXI 4PGBB 4CVXA 4WI3A 1LP9A 2HRPL 3L5JA 3SDCD 5I17A 4OZGB 4F15C 2QADB 1HSAA 2GW5A 2W65A 2ATPB 5I76A 1UM6H 5HHOA 4RGMB 5BS0A 2B1HH 3U4BL 1KCRH 4XP1L 3KDMB 4PRAB 4LLYB 4LCCC 1DQLH 5JUEL 4PJGF 2CRZA 4P2RE 3GSVB 1F58L 3DURA 1ZLUK 2D03H 3QEHA 3CX5J 5D5MA 2WP3O 1BEYH 5E9DB 3O3UN 3W0WB 2UWEF 2LTQB 3TT1L 4OZIF 1PBYA 5HYJA 3LKOA 1KLGA 5JW4R 1PYWB 3GSRA 3B3IA 1SQ2N 4BQ9A 1I85C 4G6AC 1QACA 4OZFA 1FVCB 5FYJH 4NM8L 1V7NH 2GTWB 3HFMH 3DOSA 1VDGA 3QDME 5AYQA 1B9ZA 5ISZA 2BP3A 1NCTA 5EC1A 4QNPF 2YEZA 4XVUC 3LKQA 1DN0B 1FO0A 2GJJA 3HC3L 4IHOB 4PJDF 4QRQA 3SOBH 4QCIA 3EGSA 5ESAA 2EIDA 4HWBA 4NO5A 4F15B 3RNQA 4CMMB 1NSNL 4PGDB 3PHQB 3IFOB 1YQVL 1MPAL 1DQJA 5FO7B 4OKVA 3HE7C 4PLJD 3C8KB 1YEJL 4EEEA 4AL8L 1T5WB 2CIKA 5LGJB 1CLOL 1ES0B 5T3XD 3MV9E 1U3YA 4FXGA 4QEGA 5I1CH 1N6UA 1OAKL 1VFAB 3DLQR 4HDIA 1MQ8A 5KVDH 4MAYC 3VRIB 4DCQA 3EOTH 3WCYA 4M6OH 1OTTD 4CW1A 5DRXB 4X6CB 4MCYB 3F8UB 3GSQB 4ODWB 4U4BA 3O2DH 5KSBF 1K4DB 5AZ2H 4GQ9H 1H3PH 4AK1A 4CJ0A 1RK1B 5IROC 3TO4D 3MROB 3Q6FB 3MBEC 3BUTA 1LO5A 2RB8A 3EIFA 3JV4B 1SVCP 1F6AA 4YDLB 1OQXA 2W9DH 3MOBH 5E8PB 3N1PC 3TEUA 2BXZA 3QNZB 3OKYA 4G5ZL 1NPUA 2BK8A 5HDQH 5JXEC 3OAUL 5D1ZD 3H2WA 1T04B 5DJXA 1RIVH 1IE5A 3T8XA 1IAIH 2IALB 4LARH 4I18A 4GAJL 4XXDA 5EWIH 4PRBA 3UTSA 2X1XR 1MFDL 1MI5E 5ENWA 2NY5L 4N5UA 1BAFL 4MAYB 4XBEH 3GSXA 3B9KD 3CLFH 3BDXA 3EYSH 5F6HJ 3GMMB 2WBWB 5HDLA 5IWLC 4MX7B 4N1EA 4XP9L 3HNTH 1T7VA 1II4E 1V05A 2W60B 5EU6B 4B7IA 2EZ0D 4WI8A 3NH7H 4FQIH 4ZTOL 5FA3B 5JXAL 4M1CC 5DF0A 1IJ9A 4PJHB 3G08A 3WS3B 4KUCF 4F7TB 4HS8H 2XTJD 5SWQB 4KFZC 1FN4A 1FDLH 1S3KH 2HVKA 3F7VA 5IK3B 1WFUA 1DLFH 2IMMA 5C6WH 5HPMB 2F53D 1DBML 2D4FA 3WN5C 1FL3B 1FO0L 2K1MA 5A2JH 1GGUA 5JIIA 1EHNA 2PO6D 4HWBL 3STZA 1QQDB 3HE6C 4K8RD 4PGJA 2IBZX 2CGRH 4JLRA 5T3ZH 2FX8H 5IR1A 2J8UE 2ENSA 1QA9B 3GKZA 4AQ1B 3RUGF 4K2UH 4RFNC 4CNIA 4JKPL 4ODHH 3O9WA 1QSFE 4N90E 4KWUA 1E28A 1VGKA 1TJIH 4YDKL 1ZA3B 2C4XA 2E8YA 1E6JL 3H9YA 4U1HB 2IAMB 3RTQC 1EAPB 1HKLL 4R2GB 1HZHH 3V8CA 3WXWH 3C60A 5ESQA 5L2JA 5BVJB 9CGTA 5CLTA 3IDIA 2IANE 1SEBB 4DKEL 4R6UA 4N0UE 4X98B 4EN3D 2VB5A 4ZNCD 1C5CL 4R8WH 5HXMA 2PW2A 2QSCH 3HI1A 1C5BL 3X11A 2E3VA 7FABL 3D69A 2YUWA 2XZCL 1LO0L 4WNQA 3WN5B 4Y5XB 2BSED 3RNKB 2M1KA 3QULB 4FNLH 2NY6D 1N6VA 3MGTB 4YDIL 4Z7VA 1U91A 3HE6B 1NC4B 5KSVB 4X9GA 2VL4A 4RZCB 5FV2A 5ELIA 4F7PB 2QL1A 1U41A 2E6QA 1DSFL 1OP5K 1ZEAH 5FYKH 5GGQH 4ZUUB 4JFFE 4F2MB 4HWNA 3S4SB 3OKDA 4ZFZA 3EJZD 1U8PB 3WYRA 1IEBB 1FNSL 1YY9C 3BO8B 4XWGL 1G9NC 5KZCD 5JQHC 5JQ6L 5E6YA 3KGRA 2F8VA 3VGDA 2DQDL 1Y18A 2A77L 4WTXA 2B4CH 4AT6A 2EYSB 4FQXA 3QA3B 2E5EA 3QUMB 5TH2A 4ZOBA 1XCTA 4DVBA 4LDLB 1ADQA 2Y6SC 2QQNL 3QXVA 5FF6A 5ICYA 5JZ7C 2DM4A 3MLPA 2EH7H 5E9DE 3THMH 2BJMH 2HN7A 1XF3B 3VRLF 5H35A 4ODSH 5I1KL 1D5BB 3MV8D 1RZGA 1EGJH 4Z8FH 4ONOA 3DX7B 4JZJA 2XZZA 5E2TH 2YKLH 4M1GH 4LPUA 1WZ1L 5F93C 4OI9A 3OAYK 3MRMB 5CSZB 4XAKD 5L88H 4LKCB 3GB7B 2J12B 4QRPB 1XGRA 4ZYKA 1G7PA 4RWYH 1WCBB 1AD0B 4H8WL 1JWSA 1XR9B 3L7EA 5SX5K 4NP4H 5F7EL 5JO5A 3N0PB 3FMGL 1PEZA 1C8PA 4WO4C 4HIEB 3DJ9A 4Z0XA 4N0CD 1NEZB 3IFPB 1BVLA 1BQLL 4O51B 3CFEB 4LSTH 1F13A 1WBYA 3QO1A 4GRLD 5DS8A 1T0MB 5KS9A 5FO9A 1UJ3C 4NQVB 3QXTA 4JDVB 4LASH 4XWOD 5EOQL 4EI6B 4IOSD 5CCKL 5BVPH 2BXYA 4CUCA 4TUJB 5EZIL 1IC5H 1T2XA 2Z35A 3PQYB 4Z7QE 4F8QA 1L0QA 4FQJL 3U79A 2I07B 3UJIL 2JB6A 4JY4A 1P1ZA 1JPSL 1X5JA 1JGVL 1A7PH 4WJ5A 4GBXA 4FA8A 4M7JH 2ZPKL 1F3DH 3LPFA 4X6CE 1M1SA 3IFNL 5EIVA 2ED7A 2Q86A 5T1LB 1A0QL 2PYED 4ELMA 4ZFFB 3T65B 2A6KB 3L3IA 5I0DA 3DRQB 1OT2A 2FX7L 2AJSH 4YLQT 1M05B 3RBGA 2R2EA 4NQED 3OHXA 1G7JB 4UDTB 3MJ9A 1GZPA 4OI7A 1RIUL 1IGJA 1UJTA 3D5OF 3I84A 4WO4B 4KI5F 5HY9A 3V2AR 3UTZA 4HH9B 3QUZC 3VWJC 4G3YH 3C8DA 3NCJH 1AXIB 1SY6A 1ZS8A 4U6HB 2VIRB 1S5HA 4BM7A 5E08L 5I66A 4LCWA 4JDTH 3TCLA 1I7ZB 2P4AB 4RAVB 1NGXB 4LVHC 5IB2A 1YJDC 2E7CA 1CVSC 3ULSB 3BPCA 1AKJD 3MYZA 2FO1A 4M8VA 3NAAL 5HVFB 5KTEL 2GSIA 4CKVX 1S8DA 4D94A 4OI8A 3JTSA 4K3DL 3DYPA 4C54A 1ADQL 4KHTL 3IS0X 1V8HA 4HIJA 1LE9B 1CFQA 2OLDA 4DKDC 2G2RA 2JJTA 3ROLB 2NXZD 4HLJA 4TSCH 1GPOL 3H9SD 1JZ7A 3T0XA 1CLCA 2ICEA 3QAZC 3QUYD 2ADJB 5EU6E 5FO8B 1I1FA 1JYWA 1YEIL 3RY4A 4POZD 3NTCL 4MQSB 2AK4B 4HK3N 2FO4A 1FV1A 2DTML 4KDTA 4PJHE 4JPVL 1UH3A 4KVCH 4PYHA 1I8MA 2BDNL 1OB1B 1RU9H 3QUZB 3VWJB 3ZE0E 3TA3D 2DQUH 3DECA 1WWBX 4OGYH 1B4RA 4PPTA 3NIDF 3QIUA 3TVMA 5CJOL 1XGTA 4GMTL 3VFRB 1MVFA 5E8DH 1UZ8A 3P11H 1JV5B 3QJFB 5BRZE 4X4YA 4APQA 2VJXA 4U05A 5I8KL 4AG4H 1BF8A 4R7NB 3MRKA 3C9NA 4D8PA 2AKRA 1T6VN 4PP1C 1Z0MA 4JO1L 4G43A 1MH5B 2HJKA 3RZCC 1ZT4A 4QGTA 4WCYL 4X6BA 4BSWA 1IM9A 1T3FB 3O3DB 3QAZB 2ARJQ 2QV2A 2VC2H 4XT1C 3SKNB 2YN3A 4NOBA 2GI7A 3KPLB 4F33B 1KJ2B 5FUOL 2VZ3A 2CRMA 4L8SA 3SKMB 1FZKA 4LCYA 1ACYH 1UM5H 5CGTA 2XQBH 3MJ9L 3RWCB 3CMOL 4HUVB 4NZTL 2AXFA 4FXKB 4QHUB 4E0RB 1LK2B 5BV7B 5C0GA 5TFSL 4I48B 2C3XA 4PY8I 3ZSSA 3KR3L 1MJJA 5JLZB 5HYQA 1SY6L 2FWOB 1CIDA 4OCXL 3VGEA 4X5XA 1DQTA 1MUJB 5A43C 3D18A 1CFVL 1XGPA 5FGBA 4EVNB 2F5AL 2MQCA 3BKYH 2LFGA 5I16B 3ULVL 4LIQL 4KUCD 3KLHD 4N8PA 5ALCH 1EUTA 5IIEB 2BVTA 4IMLA 2R4SH 1JE6A 5IFAL 3ARFC 3PG2A 1R3HB 3UMTA 4HZAA 1I9RH 2A0LD 3MRFB 3B83A 4O2EA 2VQTA 5EOTA 3QI9A 5EU7C 3TV3L 5IBUG 5C0FB 3M1BA 1E4XL 3CH1B 1EFXA 4I77L 3N85H 3BHBA 4BZYA 4RX4D 5F1NB 1LNUA 3FONA 5ACZA 3PWLB 4XHJD 3LIZL 2GITA 2AABH 2NR6D 4O58H 3QCVL 4ZQKA 3HG1B 3L7FB 4IRJA 4WRLA 4QHLB 4L8DB 5FUCC 5IMKA 4U6TA 3MRHB 4PJAF 1EVTC 3FCTB 3V6OC 1FNAA 3P3YA 1J8HB 1D6VH 2ORBH 4QRPE 4ELKA 2DJSA 1BBJB 2DWEA 4OLUL 1RHHA 1F4XL 1I8IB 4HX1B 4JN1H 1FE8L 2FLBT 3NGBC 3ILQC 3ARFB 1OY3B 3QCUH 4PJIA 4HBCH 2R2CA 1FNGA 3ARRA 2UZXB 1QTYT 4K7PX 1WWCA 4M9PA 4YBQD 1TZHA 3V4PL 1QRND 3RY6C 4WUUA 5GRJH 3KYMA 5GS2D 3C5ZA 3IDNB 4U1IA 3D6GA 5GQBA 1C16A 2CIIB 3MLRL 4HKZB 1M7IA 1A4JB 3PQYE 3N1GC 2DMBA 3CXHK 4YWGL 2HLAA 3S3JA 4P99A 2IADA 2X10A 3VGAC 1YEKH 4N9OB 2F9BT 4MJID 2HRPH 2QKIA 5FKPA 3TH3T 3T0EC 2P43B 4LP5A 2EXYC 4NT6A 1A9BB 3RHWF 1OWWA 3NIGF 4UIKL 1BECA 1I1AD 3U4BH 1JGEA 2N1KA 3N06B 3VXSD 1M71A 1RSFA 4XP1H 1SJEB 5JUEH 1N59B 1QVOB 3NGBB 1F58H 4R7DA 1S7VA 1NFDF 4JQVA 3ZKMD 4GG6A 1RJLA 4NUJB 5DVNA 4NPYA 5E1HB 3TT1H 1I8KB 4XP4L 3V5HB 4G8GB 3WHE1 3QDGA 4Z76B 5J12B 3SGDI 4LPCA 4GXUM 3FQTA 1K4CA 4DK6A 1OLLA 2LU3A 5CFHA 1CG9A 5D71L 4HG4K 1QLRA 1YMMB 1NAKH 4JQXA 3Q5YA 2QJDA 4TYUA 3HC3H 4JFPA 3T0EB 1KNOA 5KG9A 1H3UA 3S88L 4JVPA 1A6TB 3UJJL 4LSUL 1S7WB 2YZ1A 3DRTB 1XF5A 1NSNH 1JIBA 3CFIC 1SHMA 2ZUQB 1P7HL 2MHAA 3GSNB 1MHHB 1YQVH 1MPAH 3MV7A 4L9LB 1L0YA 5ITFA 4DUWA 2QSQA 1YEJH 4PGCA 2Q76B 2HJLA 4AL8H 3VXUD 2AK4E 1NC2A 5E00A 1BD2D 4ZFGL 1DLHA 1K3IA 5D1QC 2ICCA 3ZO0A 5IF0A 1OAKH 5EO9A 2X4UA 1KLUA 3H7BB 1KACB 1NLDL 2DD8L 5CJQL 4GKZB 3LD8C 4U1SB 1AR1D 2IPTH 1A7NL 3MXWL 3UDWC 4LF3B 4HLZG 1R5IA 3HE7D 4NKDB 1G7IA 4QY8B 3TLRA 3JV6A 1P5VA 1X5LA 5EB9A 5ID1B 3QO0B 1UQSA 5GIRB 2FGZA 3L5WB 4G5ZH 4NNXA 5KOMC 4GRWF 3QPQC 3I6LE 3L3HB 3O2WL 4QT5B 4X6FA 1GGCL 1HH6B 2Z91B 4XX1E 3BW9A 3PWUB 5GS0L 3A6BL 1S7XA 2VDKL 4GAJH 4XXCA 3L3GA 1ZVSA 4K07A 3O81A 5D1QB 3NBNA 5LKNA 2XKNB 3MBED 1MFDH 5L2KA 4CU6A 4NO0D 1N8ZA 1BAFH 1IBGL 4XAWH 4YHML 3I6KA 3FAXA 4YQXL 2C1OA 2DJ4A 5HYFA 4OLWL 2OQJA 3LD8B 3PABA 4IRZH 5F7YC 5K9OB 3WO4B 4PJ8A 4KROD 3WNOA 1X5AA 4TSAL 3S35L 1RZ7L 3VRJB 5C3LD 5JXAH 1FPTL 4U1JB 4ODBD 3U9UB 5F88A 3FFDA 4ENEC 4PJFF 1OW0C 3CFBA 5C0BB 4Q9RL 1G0XA 32C2A 5GRVK 1R5WA 5EUKB 4R0LC 3CFDA 5HHQB 3EZJB 3IDUA 3D3VB 3NCMA 2J7LA 1T83A 1C7SA 2HH0H 5E6IC 4FQQB 1QP1A 1I9IL 1U2HA 2FZ3A 1HQ4A 1OTSC 5DJAA 3ARDC 2HMID 1EAJA 3TO2A 4P4KB 4KUZL 2BVQA 2IPKB 4JKPH 4A2LA 3SGDH 4X7FC 1JPGA 2BNQD 3W81A 5ITBL 4YDKH 1KN4H 4EDXB 4IBLT 2EDRA 5K9JL 1P7QA 4GUPB 1JI1A 3HG1E 1HKLH 2WWKT 4Y0GA 4NQCB 2R15A 1U8OB 1J8HE 5JPMA 1KUMA 2JK5B 1LHZA 4DKEH 1DBBL 3INUL 1CDGA 5I1LA 2FBJL 3FN3A 2ATKB 1KCVL 2DRUA 1GIGL 4MJ6B 3GMQB 7FABH 2XZCH 3BVNB 5SV4A 1LO0H 2IQ9L 1PZ5A 2N56A 2GKIA 4YDIH 5DC0A 4UV7L 3CDGA 5DJDA 2F5BL 5EU7E 3ISWA 4MXQD 5IM7B 2ZUXA 1S9WB 5D9SB 3UTPE 4YC2C 4IMKC 1IAKA 2V6HA 1EO5A 2EDXA 3KXFA 2L7UA 1MRFL 3K3QA 1QPPA 1A1OA 4UDUA 2C3VA 1F11A 4QHKI 1X9QA 3LB6C 3OZ9L 4BH7A 3OF6A 4YEEA 5EOCJ 4QRTB 1A3LL 2X4RA 2V2TB 4G6JH 3UTQA 1MLCB 3MRCB 4YGVB 1CDJA 4GW1B 4KKLD 1FNSH 1I9JL 4XWGH 4X9FA 5FUCE 5JQ6H 3P0YL 3TPKA 3BDBA 3RVUD 4P2OC 3V6OE 2DQDH 1RUKH 2A77H 4JRXB 3QRFM 2LU4A 1A6PA 4XPTL 1Z6JT 1JZ2A 2EDKA 5CGYD 2Y7QB 5D1XC 5GGSY 2XWTA 2QQNH 3KPPB 1X6NA 3QCTH 2YPLA 3RHWK 1WEJL 2IMNA 5I1KH 4LVNB 2ZSVB 1F45A 1R3JA 4G8GE 3E3QE 3TNNB 3HR5A 1ZVYA 3G5YB 1WZ1H 4BSJA 3N9GL 4PJCA 4YC2B 5EUOB 1QSEB 1YECL 2VITA 4PRDA 3D25B 4M4PA 1G7LA 1LEKA 3TBYB 3HZYA 3ZE1E 3FB5B 2OJEB 2H2SD 5F9AC 4H8WH 3WFBL 2AP2A 3GMPB 1TIUA 4L29B 5EU4A 1YMME 5F7EH 2PCPA 3FMGH 4H5SB 3P4MB 3T0EE 2R1XA 3QQ4B 4KKBD 1DVFB 3TO4A 1I9EA 2OR9L 4BFIA 5EOQH 3D0VB 1ZWIB 5CCKH 3IJSA 5ETUA 4FQ1H 2VQ1B 3H9HA 5EZIH 3TZVC 4M1DL 5GRXG 4QXWA 4R4FL 4FQJH 3B43A 1DQQA 3UJIH 3RX8A 1JPSH 3IAQA 4WWKB 5C8JB 1JGVH 4PTTA 3U0TB 4YXHL 5I1DA 2GCYB 2ZPKH 3GJFA 4OFYD 3IFNH 2EDEA 1A0QH 5I30L 1FZOA 1R6VA 1GRWA 3IU3A 3VWKD 4HKJA 1DANT 1JTTA 1U2CA 4C56B 6CGTA 1NKRA 1QBBA 1CU4L 4X7TA 4ZUSA 4MD0B 1D6EA 3B9KA 1XGYH 4BK4A 1RIUH 4PLKD 3LN9A 2HKHL 4OCSL 1ZHLB 4Y1AB 2A9NL 3LS4H 4Z18A 5HYEA 4NQXB 3BGAA 4H26B 1E4XI 3H3PL 4WTZG 3GSWB 4KRNA 1N0XL 2X4NA 4H0IA 3FRUA 3QWQB 4QTHA 2ICWB 4OGAD 4Y2DD 5JR1L 2DMCA 1HILA 2NX5D 1TZGH 3W9EB 2F53A 4JHZA 5ICZB 3NAAH 4P0DA 5DTFB 5KTEH 3GUTA 2ZWLT 3I6GA 1B0WA 4HZLB 5DMIL 3QQ3B 4MXVF 3WFHB 2VH5L 4K3DH 1A64A 4NQDB 3NOIA 1M4KA 3ARPA 4KHTH 5IG7B 4P49A 1JTPA 4U1MB 4ZSOB 3WFEL 3KPMB 2YBRA 5ADPL 5IB3A 1GPOH 5LGKA 4YNYB 5EIQA 4F57L 4QKXB 5MEPB 2V7NA 3QG7H 4ZFOB 2MTPA 1YEIH 3KPOB 3L95A 3NTCH 4GAGL 4OF8A 2DTMH 3UCRA 4JPVH 3VXRD 4ZTPL 2BDNH 1JPFA 4RFEB 2DQIL 3HNSL 5DDHB 2BC4B 2HT2C 4NO2A 5C0BE 1UZ6E 4JG1L 5CJOH 3MPCA 3G6AB 4GMTH 3G5VA 4ZUWA 1A47A 3D3VE 3QNXA 4PR5B 5EBMA 4LFHG 1NFIB 5CIPB 5I8KH 3IGAA 4NFBA 4RAUA 5BO1L 3ZDXE 3DX8A 3T0DA 1CT8A 2R2BB 4ESKA 2Q20A 1FYTB 4NZUL 3L3DA 2FJHB 4M48L 1Y0LA 4NRZB 4TVPL 4XBPA 1I75A 5EFIB 4WCYH 5DA4A 5K9KB 1JGUH 1IGFL 2AJUL 5HGAA 2NCMA 5D6CB 3ZKXC 1BX2A 4TUOB 4NQCE 1AD9A 2AAVA 1J0IA 2FEDC 2CUMA 1FNEB 3ARSA 3U46B 4I8DA 1NGZB 2Q7YA 4D0BB 2NY0B 2IC2A 3F7YA 3LRSA 5FUOH 1S7TA 4J12A 2JIXA 5GZOD 2PTUA 2PKDA 2R1YA 3DMMB 2W0FB 5HI4D 3MJ9H 4JM2C 3CMOH 5KW9L 4NZTH 3PGCB 1OGAD 5TFSH 4UV4L 2XN9A 1ED3B 1KENL 4U2YA 1SY6H 5HI3C 2EECA 5KANI 4MJ5A 1YQ2A 4OCXH 4R97C 4WTZA 5C0EA 3C6SA 3IF1B 2HT3C 3SBWA 3KYNA 1VKXA 3V9FA 2H8PB 1EV2E 1UB6B 2ZG1A 4YAQA 1CFVH 2R0ZH 2HJFB 1RQ5A 1X5KA 5F9WB 1T1WB 2F5AH 5CP7B 2A6IB 3ULVH 4LIQH 1VCAA 2R2HA 2J4WL 2QHRL 5DT1L 1LMKA 2AEPL 5IFAH 2KDGA 1UKQA 4BZ1H 3ZKXB 3EFFB 2VXUL 3RGVD 1ZLVK 4Y4KD 5DMJB 4Z7OE 1FNFA 5EIIB 3TV3H 2JJSA 2XOTA 1HXYB 1CFTA 1IFHL 2CLRA 1RUAL 3SJVB 1E4XH 5GS1B 3BZFA 5IHLB 4I77H 4WFFE 1MRDH 4NRXA 1E4JA 3EW3B 4GRLA 5IVXA 1RJYA 4OLYH 3SCMD 4JQIL 3LIZH 2NLJA 5TGBB 3HTLX 4YHYB 3REWA 1EA9C 3ARQA 4XHQA 5DYOB 3QCVH 1A6WL 1RFDL 5C07D 4JFEB 1BBDH 3EDEA 4Y5YA 1UXWB 1S9YB 3ARBA 4R97B 3PWPD 5EUOE 3WSQH 4MNHA 1QSEE 2JF1A 4YPGA 3IXAB 4XH2B 1P2CA 3LHPH 4P2RA 1MCJA 8FABB 1KIPA 4DGIL 3EYOA 1F4XH 3MREB 1FE8H 5TDPB 3X3GL 5A16B 4ZUVA 2YPVL 3VFPB 5D2LB 3V0WH 1X44A 1KJVA 1FC1A 2J6EA 4KQ3L 4HJGA 1OAYL 3ZHDA 4Z6AT 5HD8D 1HKFA 4ONHA 2VABB 3FO2B 4KRLB 5DVMA 2W59A 4NN5C 3V4PH 3MRDA 2AS5M 2X7LB 4NDMA 5K59F 3HAEG 4L1DA 3MLRH 5I1GL 5M95B 3B9DA 4Q6YA 4R4NC 4KTDL 4PY7B 3WDIA 5I9QC 4YWGH 1CFSA 1REIA 1XGUB 1FJ1B 1R0AL 2VLKE 4MA8L 1P53A 3FB7A 5IMOA 4Q74A 3TBVB 1A2YA 3MLUL 5IHBA 4LBEA 3LSOA 3ILQD 1I7UA 2R1WB 2J8UF 3MJGX 3V6ZB 1AKJA 5ADOL 4PRNA 1YPZA 4YDJB 5HGHA 2CDGA 4PRHD 3TPUA 4UIKH 5I1AB 1TZIA 3F5WA 1IQWL 2D31A 5IHZB 3WE6A 4PJ5B 3ROOB 5FYLL 5DHVB 3PV6A 1G7QB 4PGZA 3ZKQD 4YXKL 4CMHB 1UWEL 3DETC 3CPLA 3MRNA 4P2QB 1XGQA 4DKAA 2VN7A 4Y1AE 2BERA 3H9SA 1GHFL 3ZMRA 2IJ0C 3T4YB 4L3ED 1PQZB 2HFFA 3TWCL 4XP4H 3U4EB 1I3VA 4NCDA 2VLJB 4NN5B 5KSAD 3RDTA 5CMAA 2VE6B 3V0VA 3HUJB 1GC1L 2UV3A 3T04D 1LP9B 2C5DC 5INDA 3TA3A 4CVXB 3H3BC 3QWOA 2X2YA 5I17B 1B4JH 5DZNA 3I9GL 1HSAB 1HQRA 3DX6A 5I76B 2EDHA 5HHOB 5D71H 5BS0B 3K1DA 1C1EL 4HH8A 2CMRL 4NQDE 3SDYL 1RZFL 3S88H 3UJJH 3DURB 4ZSOE 1LWRA 5F7DA 1L7TH 4LGSB 5D5MB 2WINB 3RWEA 1G6RB 2EXWC 4M5ZH 4NN7B 3AC0A 5E24E 2VYRE 4WFHE 1OSZA 2WLZA 3LKOB 1KLGB 3ALXA 1XZ0A 3GSRB 4OZGF 4LMQE 3RWIA 3B3IB 1MI5A 2WWKO 5HGGS 4OZFB 3VFOA 1H0DA 5A2LH