3ZE0A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 100
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze0A00
4MMZA 1JV2A 2VC2A 3VI3A 3FCSA 3NIDA 3IJEA 4MMYA 3T3PA 3VI4A 4Z7OA 5E6RA 2VDMA 3NIGA 2VDOA 2VDRA 4O02A 2VDLA 1M1XA 3K72A 1L5GA 3V4PA 2VDPA 4WK0A 1U8CA 5FFGA 5E6UA 4IRZA 3V4VA 3ZDZA 3ZE2A 4UM9A 1TYEA 4MMXA 2VDNA 4WJKA 3NIFA 4Z7QA 4WK2A 5HDBA 3FCUA 3ZDXA 4G1MA 2VDQA 3K71A 3K6SA 3ZE1A 4Z7NA 4NENA 4WK4A 4UM8A 4G1EA 2VDKA 5E6SA 3ZDYA 5FFOA 3ZE0A 3T3MA
chains in the Genus database with same CATH superfamily
3BG0A 4AX4A 2AGLA 3ODTA 4J77A 2YNPA 5CYKB 4J0WA 4ERQA 5THAA 2UZYB 3C9CA 4J79A 4Z7OA 4G56B 3SVWD 2YMUA 3I7PA 3EI4B 3W15A 4G55A 4L3HD 3MKSB 4ZN4A 4NC4A 2QXVA 4QRJA 3GREA 3I7LA 3SLED 3OL2A 3L4MD 4BL0A 3I8CA 2AGYA 5EMLB 3BG1A 5HE1B 4A09A 3DXKC 5HYNB 3V4VA 3UKUC 1FWXA 4ES0A 4PBZA 1E5TA 2IAAA 3I7HA 2JKXA 4TZ4A 1ERJA 2I0SA 1VE6A 3EI3A 4CI8A 4QT8A 2P9LC 3O4HA 1C9LA 3F3FA 4GGAA 3I7OA 4JSVC 3JZNA 2QZPA 4A0BB 4JD2C 4Z7NA 2I0TA 4PBYA 2AGWA 3I89A 1UOOA 4D0KA 2AH1A 5IJ8E 4GMBA 4E54B 2J56H 4J8BA 5HE3B 2VDRA 4JXMA 1XHMA 3K72A 4E5ZA 3AL8B 5FFGA 4D6VA 1TYEA 1C9IA 2GC4A 4AEZA 2XL2A 2QR5A 1BPOA 3OTTA 2I0RA 3SWSD 5I5MA 3UVMA 1K32A 5I5IA 4YVDA 1PI6A 3T3MA 5GMKn 3DSMA 3RRMC 4QL1A 3IJEA 2H47A 5FXYA 5EMJB 5H1MA 3SN6B 4CC9A 4BUJC 4QQEA 4PC0A 4ZOZA 3U4YA 3I7KA 4IA9A 1A0RB 4GM3A 1YR2A 4MK0B 1GXRA 3C5MA 1NEXB 3KRWB 4A2MA 1GOHA 2VDNA 3OL2B 3QHYB 2HU7A 4PXWA 4WJKA 2OVQB 3O4JA 5HDBA 3ZDXA 1JJUB 5FKRA 4A09B 3N0EA 4WK4A 4XYIA 4J73A 2AQ5A 3PXWD 3EU7A 1OMWB 4X61B 2J57G 3MKQA 2IWKA 3EI3B 5EMKB 4DNWA 4CZVA 2QC5A 3OKTA 3PVUB 2VDPA 4HDJA 4K3ID 1UTCA 4PSXB 3EWEA 4GQ2P 2AGZA 2H9LA 2VZ3A 3EMHA 1TBGA 1GOGA 3JPXA 4H5IA 4J78A 3OKWA 5H14A 3EI2A 4XYHA 2VDKA 5C9ZB 5H17A 1H2XA 3IURA 5FFOA 4GQBB 3ZDYA 4CY3A 4J87A 2P9KC 4A11A 4ZOYA 2XU7A 3IUMA 3UVNA 3CFSB 3GD1I 3F3GA 3PSLA 5GXHA 4J81A 1T2XA 2XDWA 2BKLA 5FKTA 3JROA 5CXBB 4WK0A 5E6UA 4FHLA 1B9XA 3C99A 4OWRA 3V5WB 4ESGA 4NBMA 5EM2A 2AGXA 4O2WA 4ERYA 2BCJB 4X60B 1PBYB 4BH6A 3QI0A 3RN1D 2HU5A 3A0FA 4UM8A 3HFQA 2GC7A 3MUOA 1SQJA 2I3SA 3OF7A 4O3TB 1PGUA 5CXCA 5M5TA 3V7DB 3SJLD 4CI3A 5GSAA 2HKRA 2VZ1A 3EQ8A 3EQ9A 3KCIA 1JTDB 3UR4A 2IUVA 4RE5A 4ZOXA 1E8MA 4JSPC 3JZHA 2IUPA 1H2ZA 2YBAA 5FA5B 3MZKA 2YB8B 2H9PA 1PEVA 5I5JA 3ZE1A 5GXIA 1N6DA 4I79A 2PBIB 3UVLA 2TRCB 3SFZA 4AN0A 3CIKB 2H14A 5C2VB 1U2VC 1QFMA 2VDMA 4JT5C 1VE7A 5SXMA 1M1XA 1JOFA 4JSXC 4O45A 1VZ3A 4L9OA 2BBKH 5IT9g 3GFCA 2EICA 5IGOA 5FKQA 4MMXA 2B5NA 2EIBA 4GM8A 4WK2A 2CO0C 3SBPA 1E8NA 1O6GA 4FA1D 3K6SA 3IIWA 2Z2NA 4NSXA 4BP8A 4A11B 4O3UB 5TF2A 5IJ7E 2VC2A 3J81g 1K8KC 3NIDA 4A0AA 5CYKA 3IVMA 1YFQA 1RI6A 2OK4A 5TEEA 3IKOA 1GOFA 4ERZA 3EI4A 4RE6A 1Q47A 2W18A 3OKYA 1N6FA 5EM2B 3FRXA 3DXMC 4CY1A 2P9UC 4N14A 3K27A 3PVWB 3FCUA 4U7AA 3VA6A 4JHNA 3EG6A 3JB9L 3BWSA 3DDUA 3DWLC 1GP2B 3O4IA 2B5MA 4UI9R 3PXTD 5TDHB 3AFCA 1TYQC 4J82A 5K1CC 3EI1A 3T3PA 1I2MB 3VI4A 2H9MA 4Y5RD 4A7JA 3NIGA 5M5UA 3I2NA 4BCCA 3RN0D 2P9NC 5FLXg 2P9SC 4FA5D 3IIYA 2H6NA 3ORVD 3IJ1A 2GNQA 1GOTB 1MDAH 4IRZA 1GG2B 3K26A 5C2WB 5B4WA 3NIFA 2VDQA 2CE9A 4A0BA 5TEFA 3UVKA 1OLZA 4X63B 4Z8LA 3O4GA 5M5SA 3C75H 3NVQA 1N6EA 4FWWA 2G99A 4MMZA 2XL3A 4O9DA 4A08A 1L0QA 4GQ1A 4CY5A 4DNVA 4JSNC 3KRXB 4E5ZB 5K19A 3AL8A 2CE8A 2HU8A 2XZGA 1JMZB 1SHYB 5AFU3 2H6QA 3PXSD 3MZLA 2Z2OA 4AN1A 3SBRA 3AH8B 5EAMA 2H3XA 2OVPB 3PSCB 1JMXB 4IMMA 5M5VA 4FB1D 2MTAH 4A2LA 4A0AB 2EBSA 2IUQA 2OK6A 2YNNA 3F3PA 3SBQA 4X3EA 4KFMB 5E6RA 5KDOB 5EARA 4CI1A 4AOWA 2IWFA 4J84A 4CZXA 1QNIA 1U4CA 1U8CA 3OKYB 4LG9A 2B4EA 2CO0A 2PM7B 3AL9A 4AMZA 4R7AB 4GGDA 1P22A 4D9SA 2PM9A 3EQ7A 2XYIA 3DM0A 2AH0A 3B7FA 1B9YA 5FKSA 2UZXB 4G1EA 4XEIC 5E6SA 3L4OD 2OIZA 4FA9D 3EI1B 2I3TA 1MG3A 2EIDA 4ZOVA 5AJAA 3J80g 3ULEC 2VDLA 1S4UX 3OW8A 1SQ9A 3IUJA 3ZE2A 3RFGA 1O6FA 2HESX 1UOPA 5EMMB 3RFHA 3RMZD 5C92A 5C86A 3MVDK 5IGQA 4G1MA 3IULA 1QFSA 4DNUA 3EI2B 4BP9A 3JRPA 4PNKB 5M61A 3ZE0A 3FGBA 4AMYA 4CZYA 4EWRA 4A08B 3VI3A 2J55H 1VYHC 3JZGA 4JHPC 3I8EA 2VDOA 4CY2A 3ZWLB 4FAVD 2G9AA 5A2Qg 3IJ0A 4LG8A 1L5GA 5CXBA 2CN3A 4K3JB 1VZ2A 4OZUA 3SHFA 3SXTD 1K3IA 2HJ4A 3I7NA 3IUQA 1XIPA 2B5LA 2P9IC 2IURA 3UKRC 2HYEA 1H2YA 1H2WA 4CI2A 1XKSA 1NR0A 3SMRA 2HXCA 5HE0B 2HKMA 4GM9A 4L1MA 3NVXA 3VH0A 3V9FA 2YNOA 2H6KA 2Z2PA 5CXCB 1JV2A 4BCBA 4BCDA 3FCSA 4MMYA 3N0DA 2O9KA 2EIEA 4L1QD 2H13A 5FQDA 3RLMD 5JWZA 2H68A 2HJBA 4QAMA 2H9NA 4PSWB 5IC7A 4J8GA 1R5MA 4J0XA 2Q7QA 4UM9A 2OVRB 3IUNA 3E0CA 4GZ8A 3MMYA 2PM9B 3P4FA 4GGCA 4Y7RA 4JT6C 4NENA 4J86A 3CFVA 3PE7A 3IJCA 4L3GD 3UVOA 5HQGA 5M5RA 3RSEC 1MG2A 5EALA 2XE4A 4O1QD 3FM0A 4LGNA 4NAAA 2OJYA 4E54A 4O02A 3SCYA 2CN2A 3V4PA 3VGZA 5EAPA 3ZDZA 3MUNA 5HE2B 3MXXA 4U1EI 5AMSA 4FA4D 3JAMg 2P9PC 4Z7QA 1A12A 4FAND 2WQ8A 3NVNA 1UOQA 3K71A 2PM6B 4H5JA 3GC3B 2CNXA
chains in the Genus database with same CATH topology
4MMZA 1JV2A 2VC2A 3VI3A 3FCSA 3NIDA 3IJEA 4MMYA 3T3PA 3VI4A 4Z7OA 5E6RA 2VDMA 3NIGA 2VDOA 2VDRA 4O02A 2VDLA 1M1XA 3K72A 1L5GA 3V4PA 2VDPA 4WK0A 1U8CA 5FFGA 5E6UA 4IRZA 3V4VA 3ZDZA 3ZE2A 4UM9A 1TYEA 4MMXA 2VDNA 4WJKA 3NIFA 4Z7QA 4WK2A 5HDBA 3FCUA 3ZDXA 4G1MA 2VDQA 3K71A 3K6SA 3ZE1A 4Z7NA 4NENA 4WK4A 4UM8A 4G1EA 2VDKA 5E6SA 3ZDYA 5FFOA 3ZE0A 3T3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMZ A;  1JV2 A;  2VC2 A;  3VI3 A;  3FCS A;  3NID A;  3IJE A;  4MMY A;  3T3P A;  3VI4 A;  4Z7O A;  5E6R A;  2VDM A;  3NIG A;  2VDO A;  2VDR A;  4O02 A;  2VDL A;  1M1X A;  3K72 A;  1L5G A;  3V4P A;  2VDP A;  4WK0 A;  1U8C A;  5FFG A;  5E6U A;  4IRZ A;  3V4V A;  3ZDZ A;  3ZE2 A;  4UM9 A;  1TYE A;  4MMX A;  2VDN A;  4WJK A;  3NIF A;  4Z7Q A;  4WK2 A;  5HDB A;  3FCU A;  3ZDX A;  4G1M A;  2VDQ A;  3K71 A;  3K6S A;  3ZE1 A;  4Z7N A;  4NEN A;  4WK4 A;  4UM8 A;  4G1E A;  2VDK A;  5E6S A;  3ZDY A;  5FFO A;  3ZE0 A;  3T3M A; 
#chains in the Genus database with same CATH topology
 3BG0 A;  4AX4 A;  2AGL A;  3ODT A;  4J77 A;  2YNP A;  5CYK B;  4J0W A;  4ERQ A;  5THA A;  2UZY B;  3C9C A;  4J79 A;  4Z7O A;  4G56 B;  3SVW D;  2YMU A;  3I7P A;  3EI4 B;  3W15 A;  4G55 A;  4L3H D;  3MKS B;  4ZN4 A;  4NC4 A;  2QXV A;  4QRJ A;  3GRE A;  3I7L A;  3SLE D;  3OL2 A;  3L4M D;  4BL0 A;  3I8C A;  2AGY A;  5EML B;  3BG1 A;  5HE1 B;  4A09 A;  3DXK C;  5HYN B;  3V4V A;  3UKU C;  1FWX A;  4ES0 A;  4PBZ A;  1E5T A;  2IAA A;  3I7H A;  2JKX A;  4TZ4 A;  1ERJ A;  2I0S A;  1VE6 A;  3EI3 A;  4CI8 A;  4QT8 A;  2P9L C;  3O4H A;  1C9L A;  3F3F A;  4GGA A;  3I7O A;  4JSV C;  3JZN A;  2QZP A;  4A0B B;  4JD2 C;  4Z7N A;  2I0T A;  4PBY A;  2AGW A;  3I89 A;  1UOO A;  4D0K A;  2AH1 A;  5IJ8 E;  4GMB A;  4E54 B;  2J56 H;  4J8B A;  5HE3 B;  2VDR A;  4JXM A;  1XHM A;  3K72 A;  4E5Z A;  3AL8 B;  5FFG A;  4D6V A;  1TYE A;  1C9I A;  2GC4 A;  4AEZ A;  2XL2 A;  2QR5 A;  1BPO A;  3OTT A;  2I0R A;  3SWS D;  5I5M A;  3UVM A;  1K32 A;  5I5I A;  4YVD A;  1PI6 A;  3T3M A;  5GMK n;  3DSM A;  3RRM C;  4QL1 A;  3IJE A;  2H47 A;  5FXY A;  5EMJ B;  5H1M A;  3SN6 B;  4CC9 A;  4BUJ C;  4QQE A;  4PC0 A;  4ZOZ A;  3U4Y A;  3I7K A;  4IA9 A;  1A0R B;  4GM3 A;  1YR2 A;  4MK0 B;  1GXR A;  3C5M A;  1NEX B;  3KRW B;  4A2M A;  1GOH A;  2VDN A;  3OL2 B;  3QHY B;  2HU7 A;  4PXW A;  4WJK A;  2OVQ B;  3O4J A;  5HDB A;  3ZDX A;  1JJU B;  5FKR A;  4A09 B;  3N0E A;  4WK4 A;  4XYI A;  4J73 A;  2AQ5 A;  3PXW D;  3EU7 A;  1OMW B;  4X61 B;  2J57 G;  3MKQ A;  2IWK A;  3EI3 B;  5EMK B;  4DNW A;  4CZV A;  2QC5 A;  3OKT A;  3PVU B;  2VDP A;  4HDJ A;  4K3I D;  1UTC A;  4PSX B;  3EWE A;  4GQ2 P;  2AGZ A;  2H9L A;  2VZ3 A;  3EMH A;  1TBG A;  1GOG A;  3JPX A;  4H5I A;  4J78 A;  3OKW A;  5H14 A;  3EI2 A;  4XYH A;  2VDK A;  5C9Z B;  5H17 A;  1H2X A;  3IUR A;  5FFO A;  4GQB B;  3ZDY A;  4CY3 A;  4J87 A;  2P9K C;  4A11 A;  4ZOY A;  2XU7 A;  3IUM A;  3UVN A;  3CFS B;  3GD1 I;  3F3G A;  3PSL A;  5GXH A;  4J81 A;  1T2X A;  2XDW A;  2BKL A;  5FKT A;  3JRO A;  5CXB B;  4WK0 A;  5E6U A;  4FHL A;  1B9X A;  3C99 A;  4OWR A;  3V5W B;  4ESG A;  4NBM A;  5EM2 A;  2AGX A;  4O2W A;  4ERY A;  2BCJ B;  4X60 B;  1PBY B;  4BH6 A;  3QI0 A;  3RN1 D;  2HU5 A;  3A0F A;  4UM8 A;  3HFQ A;  2GC7 A;  3MUO A;  1SQJ A;  2I3S A;  3OF7 A;  4O3T B;  1PGU A;  5CXC A;  5M5T A;  3V7D B;  3SJL D;  4CI3 A;  5GSA A;  2HKR A;  2VZ1 A;  3EQ8 A;  3EQ9 A;  3KCI A;  1JTD B;  3UR4 A;  2IUV A;  4RE5 A;  4ZOX A;  1E8M A;  4JSP C;  3JZH A;  2IUP A;  1H2Z A;  2YBA A;  5FA5 B;  3MZK A;  2YB8 B;  2H9P A;  1PEV A;  5I5J A;  3ZE1 A;  5GXI A;  1N6D A;  4I79 A;  2PBI B;  3UVL A;  2TRC B;  3SFZ A;  4AN0 A;  3CIK B;  2H14 A;  5C2V B;  1U2V C;  1QFM A;  2VDM A;  4JT5 C;  1VE7 A;  5SXM A;  1M1X A;  1JOF A;  4JSX C;  4O45 A;  1VZ3 A;  4L9O A;  2BBK H;  5IT9 g;  3GFC A;  2EIC A;  5IGO A;  5FKQ A;  4MMX A;  2B5N A;  2EIB A;  4GM8 A;  4WK2 A;  2CO0 C;  3SBP A;  1E8N A;  1O6G A;  4FA1 D;  3K6S A;  3IIW A;  2Z2N A;  4NSX A;  4BP8 A;  4A11 B;  4O3U B;  5TF2 A;  5IJ7 E;  2VC2 A;  3J81 g;  1K8K C;  3NID A;  4A0A A;  5CYK A;  3IVM A;  1YFQ A;  1RI6 A;  2OK4 A;  5TEE A;  3IKO A;  1GOF A;  4ERZ A;  3EI4 A;  4RE6 A;  1Q47 A;  2W18 A;  3OKY A;  1N6F A;  5EM2 B;  3FRX A;  3DXM C;  4CY1 A;  2P9U C;  4N14 A;  3K27 A;  3PVW B;  3FCU A;  4U7A A;  3VA6 A;  4JHN A;  3EG6 A;  3JB9 L;  3BWS A;  3DDU A;  3DWL C;  1GP2 B;  3O4I A;  2B5M A;  4UI9 R;  3PXT D;  5TDH B;  3AFC A;  1TYQ C;  4J82 A;  5K1C C;  3EI1 A;  3T3P A;  1I2M B;  3VI4 A;  2H9M A;  4Y5R D;  4A7J A;  3NIG A;  5M5U A;  3I2N A;  4BCC A;  3RN0 D;  2P9N C;  5FLX g;  2P9S C;  4FA5 D;  3IIY A;  2H6N A;  3ORV D;  3IJ1 A;  2GNQ A;  1GOT B;  1MDA H;  4IRZ A;  1GG2 B;  3K26 A;  5C2W B;  5B4W A;  3NIF A;  2VDQ A;  2CE9 A;  4A0B A;  5TEF A;  3UVK A;  1OLZ A;  4X63 B;  4Z8L A;  3O4G A;  5M5S A;  3C75 H;  3NVQ A;  1N6E A;  4FWW A;  2G99 A;  4MMZ A;  2XL3 A;  4O9D A;  4A08 A;  1L0Q A;  4GQ1 A;  4CY5 A;  4DNV A;  4JSN C;  3KRX B;  4E5Z B;  5K19 A;  3AL8 A;  2CE8 A;  2HU8 A;  2XZG A;  1JMZ B;  1SHY B;  5AFU 3;  2H6Q A;  3PXS D;  3MZL A;  2Z2O A;  4AN1 A;  3SBR A;  3AH8 B;  5EAM A;  2H3X A;  2OVP B;  3PSC B;  1JMX B;  4IMM A;  5M5V A;  4FB1 D;  2MTA H;  4A2L A;  4A0A B;  2EBS A;  2IUQ A;  2OK6 A;  2YNN A;  3F3P A;  3SBQ A;  4X3E A;  4KFM B;  5E6R A;  5KDO B;  5EAR A;  4CI1 A;  4AOW A;  2IWF A;  4J84 A;  4CZX A;  1QNI A;  1U4C A;  1U8C A;  3OKY B;  4LG9 A;  2B4E A;  2CO0 A;  2PM7 B;  3AL9 A;  4AMZ A;  4R7A B;  4GGD A;  1P22 A;  4D9S A;  2PM9 A;  3EQ7 A;  2XYI A;  3DM0 A;  2AH0 A;  3B7F A;  1B9Y A;  5FKS A;  2UZX B;  4G1E A;  4XEI C;  5E6S A;  3L4O D;  2OIZ A;  4FA9 D;  3EI1 B;  2I3T A;  1MG3 A;  2EID A;  4ZOV A;  5AJA A;  3J80 g;  3ULE C;  2VDL A;  1S4U X;  3OW8 A;  1SQ9 A;  3IUJ A;  3ZE2 A;  3RFG A;  1O6F A;  2HES X;  1UOP A;  5EMM B;  3RFH A;  3RMZ D;  5C92 A;  5C86 A;  3MVD K;  5IGQ A;  4G1M A;  3IUL A;  1QFS A;  4DNU A;  3EI2 B;  4BP9 A;  3JRP A;  4PNK B;  5M61 A;  3ZE0 A;  3FGB A;  4AMY A;  4CZY A;  4EWR A;  4A08 B;  3VI3 A;  2J55 H;  1VYH C;  3JZG A;  4JHP C;  3I8E A;  2VDO A;  4CY2 A;  3ZWL B;  4FAV D;  2G9A A;  5A2Q g;  3IJ0 A;  4LG8 A;  1L5G A;  5CXB A;  2CN3 A;  4K3J B;  1VZ2 A;  4OZU A;  3SHF A;  3SXT D;  1K3I A;  2HJ4 A;  3I7N A;  3IUQ A;  1XIP A;  2B5L A;  2P9I C;  2IUR A;  3UKR C;  2HYE A;  1H2Y A;  1H2W A;  4CI2 A;  1XKS A;  1NR0 A;  3SMR A;  2HXC A;  5HE0 B;  2HKM A;  4GM9 A;  4L1M A;  3NVX A;  3VH0 A;  3V9F A;  2YNO A;  2H6K A;  2Z2P A;  5CXC B;  1JV2 A;  4BCB A;  4BCD A;  3FCS A;  4MMY A;  3N0D A;  2O9K A;  2EIE A;  4L1Q D;  2H13 A;  5FQD A;  3RLM D;  5JWZ A;  2H68 A;  2HJB A;  4QAM A;  2H9N A;  4PSW B;  5IC7 A;  4J8G A;  1R5M A;  4J0X A;  2Q7Q A;  4UM9 A;  2OVR B;  3IUN A;  3E0C A;  4GZ8 A;  3MMY A;  2PM9 B;  3P4F A;  4GGC A;  4Y7R A;  4JT6 C;  4NEN A;  4J86 A;  3CFV A;  3PE7 A;  3IJC A;  4L3G D;  3UVO A;  5HQG A;  5M5R A;  3RSE C;  1MG2 A;  5EAL A;  2XE4 A;  4O1Q D;  3FM0 A;  4LGN A;  4NAA A;  2OJY A;  4E54 A;  4O02 A;  3SCY A;  2CN2 A;  3V4P A;  3VGZ A;  5EAP A;  3ZDZ A;  3MUN A;  5HE2 B;  3MXX A;  4U1E I;  5AMS A;  4FA4 D;  3JAM g;  2P9P C;  4Z7Q A;  1A12 A;  4FAN D;  2WQ8 A;  3NVN A;  1UOQ A;  3K71 A;  2PM6 B;  4H5J A;  3GC3 B;  2CNX A; 
#chains in the Genus database with same CATH homology
 4MMZ A;  1JV2 A;  2VC2 A;  3VI3 A;  3FCS A;  3NID A;  3IJE A;  4MMY A;  3T3P A;  3VI4 A;  4Z7O A;  5E6R A;  2VDM A;  3NIG A;  2VDO A;  2VDR A;  4O02 A;  2VDL A;  1M1X A;  3K72 A;  1L5G A;  3V4P A;  2VDP A;  4WK0 A;  1U8C A;  5FFG A;  5E6U A;  4IRZ A;  3V4V A;  3ZDZ A;  3ZE2 A;  4UM9 A;  1TYE A;  4MMX A;  2VDN A;  4WJK A;  3NIF A;  4Z7Q A;  4WK2 A;  5HDB A;  3FCU A;  3ZDX A;  4G1M A;  2VDQ A;  3K71 A;  3K6S A;  3ZE1 A;  4Z7N A;  4NEN A;  4WK4 A;  4UM8 A;  4G1E A;  2VDK A;  5E6S A;  3ZDY A;  5FFO A;  3ZE0 A;  3T3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...