3ZE0A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 100
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze0A00
2VDOA 5E6RA 3T3PA 4Z7NA 3K71A 5FFGA 1L5GA 4MMYA 4WK2A 5E6SA 3ZE0A 4MMZA 3VI4A 3NIFA 3NIDA 4UM8A 3VI3A 2VC2A 4WJKA 3NIGA 3FCSA 3ZDZA 1U8CA 5E6UA 4WK0A 4Z7QA 2VDLA 4G1MA 4Z7OA 3V4PA 4NENA 3ZDXA 4UM9A 3FCUA 3ZDYA 2VDPA 4O02A 2VDKA 5FFOA 1JV2A 3K72A 2VDRA 3T3MA 3ZE2A 4WK4A 4MMXA 3IJEA 2VDNA 4G1EA 5HDBA 2VDQA 1M1XA 3V4VA 4IRZA 2VDMA 1TYEA 3ZE1A 3K6SA
chains in the Genus database with same CATH superfamily
4A08A 1GOTB 2YNOA 3BWSA 5H17A 1E8NA 3KRXB 3RSEC 3UVOA 4A09A 3PVUB 4FA9D 2H9MA 3DDUA 4GMBA 4XYIA 3JPXA 1GOHA 1UOOA 5EMJB 2OK4A 1JV2A 4ERYA 5I5IA 2XDWA 3VGZA 5IGQA 4J84A 4J79A 5HDBA 2TRCB 5EM2B 1QFMA 3ZE1A 4FAND 4X61B 2GNQA 4GM9A 2VZ1A 2HXCA 4PNKB 2XU7A 4BCBA 3EMHA 5GXHA 4JT5C 3BG0A 4CI1A 2O9KA 5EMKB 2H6KA 4BP8A 3P4FA 3EI3B 4X63B 4A2MA 4BCDA 3OKYA 3SHFA 4ES0A 3EI1B 2VDRA 2PBIB 2P9LC 1FWXA 3RN0D 2J56H 3C9CA 1GXRA 3K6SA 5A2Qg 3EI2B 1YFQA 2P9IC 2PM9B 3OF7A 5FKTA 3AFCA 4JSPC 3SCYA 4O45A 1GOGA 4A08B 2HJBA 4J87A 3I7NA 4G56B 2AGYA 3V4PA 1E5TA 3L4OD 4ZOYA 2XYIA 1TBGA 4K3JB 2J55H 4GGDA 5FLXg 3K72A 4GGAA 1K3IA 2H14A 5M5UA 4AX4A 3UR4A 2HJ4A 5IJ8E 3UKUC 2XL3A 4ZOVA 4Z8LA 2EIBA 4U7AA 4JSVC 4J0WA 5GSAA 4ZOXA 3JRPA 2CE9A 2H9NA 4LG9A 4A2LA 1L0QA 1MG2A 2HYEA 5HYNB 3SVWD 2G99A 3SXTD 2B5NA 5H1MA 3MXXA 3IVMA 4DNVA 5FFOA 2QZPA 1SQJA 1H2ZA 4CY1A 4PSXB 4D9SA 3EQ9A 1H2WA 4AEZA 4J77A 1A0RB 4PSWB 4L1QD 4Z7NA 4ERQA 1ERJA 4CY5A 4E54A 1B9YA 2JKXA 3UVMA 4WJKA 3IUMA 3F3PA 1T2XA 1R5MA 3C5MA 3V5WB 4BUJC 3PSCB 4NENA 4O02A 5H14A 2CNXA 4GQBB 4A7JA 4WK4A 5TDHB 3NVNA 2AH1A 2B5LA 2CE8A 4D6VA 2HKRA 2H6QA 5HE3B 5EARA 4CY2A 3VH0A 3C75H 3IIYA 2EIDA 2HESX 4QQEA 4LG8A 4JD2C 2H9PA 1H2XA 3DXMC 2AGWA 1P22A 5GXIA 1SQ9A 3MUNA 3IJEA 3K27A 4ESGA 2VDMA 3V7DB 5C2VB 1MDAH 4L1MA 5M5VA 4QAMA 5C2WB 3RLMD 1L5GA 1PEVA 1C9LA 3DXKC 2H47A 1K8KC 1QNIA 3NIDA 1K32A 3B7FA 3OKWA 3NIGA 3EWEA 2VZ3A 3IUNA 4QT8A 4IA9A 5HE2B 3I7LA 3PVWB 3SWSD 2YB8B 4E54B 2H6NA 3AL8A 3GREA 4UM9A 4E5ZA 2EICA 5IJ7E 2IURA 3K26A 4UI9R 4GZ8A 3UVLA 4FB1D 4CI3A 3CFVA 3EG6A 4FA5D 3GC3B 2J57G 4Z7QA 2I0RA 2YNNA 1OMWB 1GP2B 4A0BA 5FA5B 5CYKA 4AOWA 4PBYA 2H13A 5AMSA 2GC4A 3IIWA 3RFHA 3I7HA 3NIFA 3KRWB 2BBKH 3IULA 3JAMg 2P9UC 5JWZA 2HU5A 3ZDZA 4J8BA 4NBMA 3PE7A 2AGXA 3J81g 4GM3A 4YVDA 1SHYB 5K19A 3OW8A 1VE7A 1QFSA 4O3UB 4G1EA 4X60B 1M1XA 4GGCA 4QL1A 4BP9A 1TYEA 4CZYA 4XEIC 2Z2PA 3EU7A 3N0DA 4OZUA 4GM8A 1A12A 5EMMB 5FQDA 3E0CA 4WK2A 3V9FA 1PBYB 4A0AA 1XKSA 3EQ8A 3VI3A 4A11A 5EAPA 5EALA 5M61A 1OLZA 5M5SA 1U2VC 2VDLA 3FCUA 1E8MA 3SJLD 2H3XA 2IWFA 3VA6A 2HU7A 3PSLA 3T3MA 2P9PC 2GC7A 3FGBA 2P9SC 5C9ZB 4ERZA 3AL8B 4E5ZB 3W15A 3A0FA 3ZWLB 4O2WA 3DM0A 3K71A 5TEEA 3SFZA 4TZ4A 3ORVD 5FFGA 4CC9A 3FRXA 4MMYA 3F3GA 3HFQA 4MMZA 1JTDB 3IURA 4CI8A 4UM8A 2CN3A 3O4JA 3AH8B 4A0BB 2QC5A 5CYKB 5SXMA 2P9KC 3N0EA 4DNWA 2YMUA 3JZHA 3I8EA 3JZGA 4J86A 4BH6A 4EWRA 3MUOA 1GOFA 3BG1A 3PXSD 5CXBB 4JSXC 5EMLB 4AN0A 4BL0A 1S4UX 4I79A 2OVQB 4ZN4A 5IT9g 5TEFA 1N6DA 4J78A 3T3PA 1O6FA 2OIZA 2OVRB 2H68A 4JSNC 4K3ID 4J81A 2AGZA 2CN2A 3O4IA 3MKQA 2CO0A 4J82A 4NSXA 3NVXA 4R7AB 1I2MB 4Z7OA 3KCIA 4HDJA 3PXTD 4A0AB 5GMKn 2W18A 4A11B 3ODTA 4J73A 5EAMA 5CXCA 1BPOA 3ZDXA 5HE1B 2IAAA 5HE0B 3MVDK 5TF2A 5FXYA 5K1CC 3EQ7A 2XZGA 3O4HA 1YR2A 1NEXB 1XIPA 3AL9A 1UOPA 3FM0A 3VI4A 3JB9L 4JHNA 3FCSA 4ZOZA 2OJYA 3IKOA 1U8CA 1JMXB 3MZKA 3I7PA 3UKRC 3ZDYA 3OL2A 4XYHA 3C99A 3ZE2A 2QXVA 5I5JA 3I7OA 1C9IA 2UZYB 3UVKA 4L9OA 3PXWD 1MG3A 4J0XA 4O3TB 5IGOA 5M5RA 5AFU3 5C92A 3I89A 3SLED 5C86A 3MKSB 3JZNA 5E6SA 3GFCA 4O1QD 4JHPC 4AMZA 3DSMA 5M5TA 5KDOB 2IUQA 2OK6A 1XHMA 2IWKA 1Q47A 5E6UA 5CXBA 4WK0A 2MTAH 2AH0A 4G1MA 4CY3A 2HKMA 1VZ3A 4N14A 2PM7B 3MMYA 2OVPB 2VDPA 4DNUA 4FA4D 4Y5RD 3QHYB 4AMYA 3I7KA 4MMXA 5I5MA 2VDQA 2BKLA 3UVNA 1N6FA 2IUPA 4O9DA 4IRZA 2H9LA 4PBZA 2B5MA 1TYQC 3I2NA 4NAAA 3JROA 3IJCA 2AGLA 3O4GA 3RRMC 1U4CA 2Z2NA 3IUQA 5CXCB 1VZ2A 2P9NC 4AN1A 3EI4A 4GQ1A 3U4YA 4OWRA 1B9XA 2WQ8A 4J8GA 2UZXB 5THAA 2Z2OA 1JOFA 5FKQA 4A09B 3OTTA 1GG2B 1H2YA 3DWLC 2VDKA 4IMMA 4U1EI 2YNPA 2IUVA 3SBQA 1NR0A 1JMZB 2VDNA 4MK0B 3V4VA 3J80g 1PI6A 3OL2B 2VDOA 3IJ0A 5E6RA 3OKTA 4FAVD 5B4WA 3IJ1A 4D0KA 3ZE0A 1O6GA 2CO0C 3F3FA 4JT6C 4FA1D 2VC2A 1RI6A 4H5JA 1JJUB 5IC7A 2HU8A 5AJAA 4RE5A 4LGNA 4CZVA 2I0SA 1VYHC 3L4MD 5EM2A 4H5IA 4NC4A 3SN6B 4JXMA 2PM6B 2EIEA 1PGUA 3MZLA 4PXWA 4RE6A 3SBPA 3ULEC 3OKYB 4KFMB 2G9AA 1N6EA 4X3EA 2XL2A 4QRJA 4PC0A 2YBAA 3IUJA 3CFSB 3CIKB 3EI3A 3RFGA 3SBRA 2I3TA 2AQ5A 4Y7RA 2QR5A 1UTCA 4L3HD 5FKSA 3EI1A 4BCCA 2B4EA 4G55A 4L3GD 5HQGA 3SMRA 5FKRA 4CZXA 3NVQA 2I0TA 3QI0A 3RN1D 1UOQA 2BCJB 2EBSA 2I3SA 3EI2A 3EI4B 3RMZD 2PM9A 4CI2A 2Q7QA 4GQ2P 3GD1I 2XE4A 1VE6A 4FHLA 3I8CA 4FWWA
chains in the Genus database with same CATH topology
2VDOA 5E6RA 3T3PA 4Z7NA 3K71A 5FFGA 1L5GA 4MMYA 4WK2A 5E6SA 3ZE0A 4MMZA 3VI4A 3NIFA 3NIDA 4UM8A 3VI3A 2VC2A 4WJKA 3NIGA 3FCSA 3ZDZA 1U8CA 5E6UA 4WK0A 4Z7QA 2VDLA 4G1MA 4Z7OA 3V4PA 4NENA 3ZDXA 4UM9A 3FCUA 3ZDYA 2VDPA 4O02A 2VDKA 5FFOA 1JV2A 3K72A 2VDRA 3T3MA 3ZE2A 4WK4A 4MMXA 3IJEA 2VDNA 4G1EA 5HDBA 2VDQA 1M1XA 3V4VA 4IRZA 2VDMA 1TYEA 3ZE1A 3K6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDO A;  5E6R A;  3T3P A;  4Z7N A;  3K71 A;  5FFG A;  1L5G A;  4MMY A;  4WK2 A;  5E6S A;  3ZE0 A;  4MMZ A;  3VI4 A;  3NIF A;  3NID A;  4UM8 A;  3VI3 A;  2VC2 A;  4WJK A;  3NIG A;  3FCS A;  3ZDZ A;  1U8C A;  5E6U A;  4WK0 A;  4Z7Q A;  2VDL A;  4G1M A;  4Z7O A;  3V4P A;  4NEN A;  3ZDX A;  4UM9 A;  3FCU A;  3ZDY A;  2VDP A;  4O02 A;  2VDK A;  5FFO A;  1JV2 A;  3K72 A;  2VDR A;  3T3M A;  3ZE2 A;  4WK4 A;  4MMX A;  3IJE A;  2VDN A;  4G1E A;  5HDB A;  2VDQ A;  1M1X A;  3V4V A;  4IRZ A;  2VDM A;  1TYE A;  3ZE1 A;  3K6S A; 
#chains in the Genus database with same CATH topology
 4A08 A;  1GOT B;  2YNO A;  3BWS A;  5H17 A;  1E8N A;  3KRX B;  3RSE C;  3UVO A;  4A09 A;  3PVU B;  4FA9 D;  2H9M A;  3DDU A;  4GMB A;  4XYI A;  3JPX A;  1GOH A;  1UOO A;  5EMJ B;  2OK4 A;  1JV2 A;  4ERY A;  5I5I A;  2XDW A;  3VGZ A;  5IGQ A;  4J84 A;  4J79 A;  5HDB A;  2TRC B;  5EM2 B;  1QFM A;  3ZE1 A;  4FAN D;  4X61 B;  2GNQ A;  4GM9 A;  2VZ1 A;  2HXC A;  4PNK B;  2XU7 A;  4BCB A;  3EMH A;  5GXH A;  4JT5 C;  3BG0 A;  4CI1 A;  2O9K A;  5EMK B;  2H6K A;  4BP8 A;  3P4F A;  3EI3 B;  4X63 B;  4A2M A;  4BCD A;  3OKY A;  3SHF A;  4ES0 A;  3EI1 B;  2VDR A;  2PBI B;  2P9L C;  1FWX A;  3RN0 D;  2J56 H;  3C9C A;  1GXR A;  3K6S A;  5A2Q g;  3EI2 B;  1YFQ A;  2P9I C;  2PM9 B;  3OF7 A;  5FKT A;  3AFC A;  4JSP C;  3SCY A;  4O45 A;  1GOG A;  4A08 B;  2HJB A;  4J87 A;  3I7N A;  4G56 B;  2AGY A;  3V4P A;  1E5T A;  3L4O D;  4ZOY A;  2XYI A;  1TBG A;  4K3J B;  2J55 H;  4GGD A;  5FLX g;  3K72 A;  4GGA A;  1K3I A;  2H14 A;  5M5U A;  4AX4 A;  3UR4 A;  2HJ4 A;  5IJ8 E;  3UKU C;  2XL3 A;  4ZOV A;  4Z8L A;  2EIB A;  4U7A A;  4JSV C;  4J0W A;  5GSA A;  4ZOX A;  3JRP A;  2CE9 A;  2H9N A;  4LG9 A;  4A2L A;  1L0Q A;  1MG2 A;  2HYE A;  5HYN B;  3SVW D;  2G99 A;  3SXT D;  2B5N A;  5H1M A;  3MXX A;  3IVM A;  4DNV A;  5FFO A;  2QZP A;  1SQJ A;  1H2Z A;  4CY1 A;  4PSX B;  4D9S A;  3EQ9 A;  1H2W A;  4AEZ A;  4J77 A;  1A0R B;  4PSW B;  4L1Q D;  4Z7N A;  4ERQ A;  1ERJ A;  4CY5 A;  4E54 A;  1B9Y A;  2JKX A;  3UVM A;  4WJK A;  3IUM A;  3F3P A;  1T2X A;  1R5M A;  3C5M A;  3V5W B;  4BUJ C;  3PSC B;  4NEN A;  4O02 A;  5H14 A;  2CNX A;  4GQB B;  4A7J A;  4WK4 A;  5TDH B;  3NVN A;  2AH1 A;  2B5L A;  2CE8 A;  4D6V A;  2HKR A;  2H6Q A;  5HE3 B;  5EAR A;  4CY2 A;  3VH0 A;  3C75 H;  3IIY A;  2EID A;  2HES X;  4QQE A;  4LG8 A;  4JD2 C;  2H9P A;  1H2X A;  3DXM C;  2AGW A;  1P22 A;  5GXI A;  1SQ9 A;  3MUN A;  3IJE A;  3K27 A;  4ESG A;  2VDM A;  3V7D B;  5C2V B;  1MDA H;  4L1M A;  5M5V A;  4QAM A;  5C2W B;  3RLM D;  1L5G A;  1PEV A;  1C9L A;  3DXK C;  2H47 A;  1K8K C;  1QNI A;  3NID A;  1K32 A;  3B7F A;  3OKW A;  3NIG A;  3EWE A;  2VZ3 A;  3IUN A;  4QT8 A;  4IA9 A;  5HE2 B;  3I7L A;  3PVW B;  3SWS D;  2YB8 B;  4E54 B;  2H6N A;  3AL8 A;  3GRE A;  4UM9 A;  4E5Z A;  2EIC A;  5IJ7 E;  2IUR A;  3K26 A;  4UI9 R;  4GZ8 A;  3UVL A;  4FB1 D;  4CI3 A;  3CFV A;  3EG6 A;  4FA5 D;  3GC3 B;  2J57 G;  4Z7Q A;  2I0R A;  2YNN A;  1OMW B;  1GP2 B;  4A0B A;  5FA5 B;  5CYK A;  4AOW A;  4PBY A;  2H13 A;  5AMS A;  2GC4 A;  3IIW A;  3RFH A;  3I7H A;  3NIF A;  3KRW B;  2BBK H;  3IUL A;  3JAM g;  2P9U C;  5JWZ A;  2HU5 A;  3ZDZ A;  4J8B A;  4NBM A;  3PE7 A;  2AGX A;  3J81 g;  4GM3 A;  4YVD A;  1SHY B;  5K19 A;  3OW8 A;  1VE7 A;  1QFS A;  4O3U B;  4G1E A;  4X60 B;  1M1X A;  4GGC A;  4QL1 A;  4BP9 A;  1TYE A;  4CZY A;  4XEI C;  2Z2P A;  3EU7 A;  3N0D A;  4OZU A;  4GM8 A;  1A12 A;  5EMM B;  5FQD A;  3E0C A;  4WK2 A;  3V9F A;  1PBY B;  4A0A A;  1XKS A;  3EQ8 A;  3VI3 A;  4A11 A;  5EAP A;  5EAL A;  5M61 A;  1OLZ A;  5M5S A;  1U2V C;  2VDL A;  3FCU A;  1E8M A;  3SJL D;  2H3X A;  2IWF A;  3VA6 A;  2HU7 A;  3PSL A;  3T3M A;  2P9P C;  2GC7 A;  3FGB A;  2P9S C;  5C9Z B;  4ERZ A;  3AL8 B;  4E5Z B;  3W15 A;  3A0F A;  3ZWL B;  4O2W A;  3DM0 A;  3K71 A;  5TEE A;  3SFZ A;  4TZ4 A;  3ORV D;  5FFG A;  4CC9 A;  3FRX A;  4MMY A;  3F3G A;  3HFQ A;  4MMZ A;  1JTD B;  3IUR A;  4CI8 A;  4UM8 A;  2CN3 A;  3O4J A;  3AH8 B;  4A0B B;  2QC5 A;  5CYK B;  5SXM A;  2P9K C;  3N0E A;  4DNW A;  2YMU A;  3JZH A;  3I8E A;  3JZG A;  4J86 A;  4BH6 A;  4EWR A;  3MUO A;  1GOF A;  3BG1 A;  3PXS D;  5CXB B;  4JSX C;  5EML B;  4AN0 A;  4BL0 A;  1S4U X;  4I79 A;  2OVQ B;  4ZN4 A;  5IT9 g;  5TEF A;  1N6D A;  4J78 A;  3T3P A;  1O6F A;  2OIZ A;  2OVR B;  2H68 A;  4JSN C;  4K3I D;  4J81 A;  2AGZ A;  2CN2 A;  3O4I A;  3MKQ A;  2CO0 A;  4J82 A;  4NSX A;  3NVX A;  4R7A B;  1I2M B;  4Z7O A;  3KCI A;  4HDJ A;  3PXT D;  4A0A B;  5GMK n;  2W18 A;  4A11 B;  3ODT A;  4J73 A;  5EAM A;  5CXC A;  1BPO A;  3ZDX A;  5HE1 B;  2IAA A;  5HE0 B;  3MVD K;  5TF2 A;  5FXY A;  5K1C C;  3EQ7 A;  2XZG A;  3O4H A;  1YR2 A;  1NEX B;  1XIP A;  3AL9 A;  1UOP A;  3FM0 A;  3VI4 A;  3JB9 L;  4JHN A;  3FCS A;  4ZOZ A;  2OJY A;  3IKO A;  1U8C A;  1JMX B;  3MZK A;  3I7P A;  3UKR C;  3ZDY A;  3OL2 A;  4XYH A;  3C99 A;  3ZE2 A;  2QXV A;  5I5J A;  3I7O A;  1C9I A;  2UZY B;  3UVK A;  4L9O A;  3PXW D;  1MG3 A;  4J0X A;  4O3T B;  5IGO A;  5M5R A;  5AFU 3;  5C92 A;  3I89 A;  3SLE D;  5C86 A;  3MKS B;  3JZN A;  5E6S A;  3GFC A;  4O1Q D;  4JHP C;  4AMZ A;  3DSM A;  5M5T A;  5KDO B;  2IUQ A;  2OK6 A;  1XHM A;  2IWK A;  1Q47 A;  5E6U A;  5CXB A;  4WK0 A;  2MTA H;  2AH0 A;  4G1M A;  4CY3 A;  2HKM A;  1VZ3 A;  4N14 A;  2PM7 B;  3MMY A;  2OVP B;  2VDP A;  4DNU A;  4FA4 D;  4Y5R D;  3QHY B;  4AMY A;  3I7K A;  4MMX A;  5I5M A;  2VDQ A;  2BKL A;  3UVN A;  1N6F A;  2IUP A;  4O9D A;  4IRZ A;  2H9L A;  4PBZ A;  2B5M A;  1TYQ C;  3I2N A;  4NAA A;  3JRO A;  3IJC A;  2AGL A;  3O4G A;  3RRM C;  1U4C A;  2Z2N A;  3IUQ A;  5CXC B;  1VZ2 A;  2P9N C;  4AN1 A;  3EI4 A;  4GQ1 A;  3U4Y A;  4OWR A;  1B9X A;  2WQ8 A;  4J8G A;  2UZX B;  5THA A;  2Z2O A;  1JOF A;  5FKQ A;  4A09 B;  3OTT A;  1GG2 B;  1H2Y A;  3DWL C;  2VDK A;  4IMM A;  4U1E I;  2YNP A;  2IUV A;  3SBQ A;  1NR0 A;  1JMZ B;  2VDN A;  4MK0 B;  3V4V A;  3J80 g;  1PI6 A;  3OL2 B;  2VDO A;  3IJ0 A;  5E6R A;  3OKT A;  4FAV D;  5B4W A;  3IJ1 A;  4D0K A;  3ZE0 A;  1O6G A;  2CO0 C;  3F3F A;  4JT6 C;  4FA1 D;  2VC2 A;  1RI6 A;  4H5J A;  1JJU B;  5IC7 A;  2HU8 A;  5AJA A;  4RE5 A;  4LGN A;  4CZV A;  2I0S A;  1VYH C;  3L4M D;  5EM2 A;  4H5I A;  4NC4 A;  3SN6 B;  4JXM A;  2PM6 B;  2EIE A;  1PGU A;  3MZL A;  4PXW A;  4RE6 A;  3SBP A;  3ULE C;  3OKY B;  4KFM B;  2G9A A;  1N6E A;  4X3E A;  2XL2 A;  4QRJ A;  4PC0 A;  2YBA A;  3IUJ A;  3CFS B;  3CIK B;  3EI3 A;  3RFG A;  3SBR A;  2I3T A;  2AQ5 A;  4Y7R A;  2QR5 A;  1UTC A;  4L3H D;  5FKS A;  3EI1 A;  4BCC A;  2B4E A;  4G55 A;  4L3G D;  5HQG A;  3SMR A;  5FKR A;  4CZX A;  3NVQ A;  2I0T A;  3QI0 A;  3RN1 D;  1UOQ A;  2BCJ B;  2EBS A;  2I3S A;  3EI2 A;  3EI4 B;  3RMZ D;  2PM9 A;  4CI2 A;  2Q7Q A;  4GQ2 P;  3GD1 I;  2XE4 A;  1VE6 A;  4FHL A;  3I8C A;  4FWW A; 
#chains in the Genus database with same CATH homology
 2VDO A;  5E6R A;  3T3P A;  4Z7N A;  3K71 A;  5FFG A;  1L5G A;  4MMY A;  4WK2 A;  5E6S A;  3ZE0 A;  4MMZ A;  3VI4 A;  3NIF A;  3NID A;  4UM8 A;  3VI3 A;  2VC2 A;  4WJK A;  3NIG A;  3FCS A;  3ZDZ A;  1U8C A;  5E6U A;  4WK0 A;  4Z7Q A;  2VDL A;  4G1M A;  4Z7O A;  3V4P A;  4NEN A;  3ZDX A;  4UM9 A;  3FCU A;  3ZDY A;  2VDP A;  4O02 A;  2VDK A;  5FFO A;  1JV2 A;  3K72 A;  2VDR A;  3T3M A;  3ZE2 A;  4WK4 A;  4MMX A;  3IJE A;  2VDN A;  4G1E A;  5HDB A;  2VDQ A;  1M1X A;  3V4V A;  4IRZ A;  2VDM A;  1TYE A;  3ZE1 A;  3K6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...