3ZE0B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
465
Chain Sequence
PNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 107
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze0B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze0B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze0B03
2B2XA 3ZDZB 1MHPA 4HQNA 1PT6A 4BJ3A 4F1KA 3ZQKA 1ZOOA 4O02B 4CN8A 1U0NA 1TYEB 4G1MA 1BHQ1 3K71A 1QC5A 1MF7A 1ZONA 2XWBF 3PPWA 3HXOA 3NIFB 3OKWA 1MQAA 3EGDB 3EH2A 1U8CA 4O3UB 2QTVA 2VDQB 2NVOA 1AOXA 1M2OA 4HQFA 3IJEB 5LN1A 3TXAA 2O7NA 1QCYA 1PD1A 3PPYA 4WK2B 3FCSA 1FNSA 1JV2B 2M32A 2X5NA 1IJKA 3AL8A 3ZE2B 3NVQA 4CNBA 3ZDYB 3EGDA 4WJKB 3ZE1B 3EG9B 1BHO1 3AL9A 3NIGB 3F74A 4F1JA 1OLZA 1L5GB 4M76B 2I6SA 3K6SB 1RD4A 2WINI 2NUTB 3N2NA 2VDNB 2NUPB 2XGGA 1JV2A 3EGXB 5BV8A 1JLMA 1UEXC 1ZOPA 3OKYB 1PCXA 5E6SA 5KYWB 1L5GA 4Z7QB 2VDKB 4A0QA 5KYYB 2NUTA 1V7PC 3BQNB 3EOBI 5HGJA 2NUPA 3EH1A 3EFOB 4HQKA 4O3TB 2ODQA 1FE8A 2IUEA 4O02A 3ZDXB 1M1XB 1U0OC 3EGXA 1ATZA 2VC2B 4DMUB 1SHTX 1T0PA 4JX0A 4IHKA 5KYXB 3PPVA 5KYWA 3RAGA 3TCXB 3Q3GE 3K72B 1AUQA 1JEQB 1YVPA 3IJEA 1SQ0A 3EFOA 4MMZB 2XWJI 1N9ZA 2VDOB 1M1XA 1DZIA 1N3YA 4WFQA 4IGIA 1YUKA 1M10A 1SSLA 1M1UA 1Q0PA 2ODPA 3M6FA 3ZE0B 4NEHB 2P28A 3IBSA 3EG9A 5E6UB 1JEQA 5ES4B 1CQPA 1PD0A 1MQ8B 1CK4A 4CN9A 4PN7A 3K6SA 1RS0A 3OL2B 2P26A 4UM9B 2VDMB 3V4PB 4Z7NB 3QA3E 3TVYA 4MMXB 3NIDB 1IJBA 4G1EB 4C29A 3GXBA 3T3PB 5HJ2A 3K71B 4C2BA 5KYUB 5E6RB 3VI4B 4HQLA 4XW2A 3TW0A 4GZ8A 3VI3B 3V4VB 4IXDA 1NA5A 4Z7OB 1XUOA 2I91A 1U8CB 4MMYB 5KYYA 3OL2A 1SHUX 3E2MA 3EOAI 4WK4B 1JEYB 1M2VB 4UM9D 1RTKA 4MMXA 2ADFA 3F78A 4FX5A 1MJNA 2I6QA 1IDOA 4G1EA 2VDLB 3FCSB 2UZYB 5KYUA 5E6RA 2VDRB 4NENB 1SHYB 4WK0B 2WW8A 1DGQA 3PPXA 5KYXA 3AL8B 1RRKA 3T3MB 2VDPB 1IDN1 4MMYA 1XDGA 3K72A 3BQMB 3HXQA 4FWWA 1OAKA 4HQOA 3AFCA 4C2AA 1M2VA 1JEYA 1T6BY 5HDBB 4MMZA 1YVRA 3HI6A 5KYNA 3BN3A 3FCUB 4NENA 1AO3A 4G1MB 1QC5B 5E6SB 5E6UA 1MQ9A 4JDUA 1LFAA 4K3JB 1XDDA 4UM8B 2ICAA
chains in the Genus database with same CATH superfamily
1VIMA 1UBHS 2R5NA 5SZJA 2H6PA 5AWNL 4AK1A 3PR3A 4DLWA 1L9PA 5LZ7A 1MWOA 3SJBA 3HMXL 1G6KA 1NF2A 4KXWA 3AU0A 4PRIA 1E3FA 2HWYA 4N8CL 1YD7A 2XRFA 1IGJA 3OGOE 1DN0B 3V6OC 2OEPA 3UN1A 5EWLB 4UUOA 2AT1A 1GUDA 4B35A 2DKNA 5E1AA 5SZHB 4PWHA 4AS1A 1OCOB 3GBVA 2ZRHA 2FCAA 4X60A 4FJ6A 4NHOA 3KYAA 1H15A 4Z7UB 1Q0YH 3CUVA 5JIQA 1NFDB 1DAOA 2OZ4L 3LY9A 4KMRA 4UMSA 1DCEA 4FDMA 4OCWL 4RPKA 1DBRA 5K2OA 4IJ3B 1X5YA 1XLTA 1G6HA 1G0YR 1CGYA 3OLQA 4Y5VA 4ZI7F 4JZNB 1YK0A 1GV1A 2CXUA 2VM3A 3SKVA 4B9CA 2FR4A 2WUVA 4FDTA 1F2DA 4E46A 1LK7A 3KSRA 3ULUE 5LMZA 5TPZA 4Q9CA 3FB6A 3QBTB 3A24A 3MA7B 1V6CA 4WZZA 3M6XA 2QL1A 4AZ3B 1CXFA 2WQUA 5KJ4A 4UBIA 3IULA 3F7LA 3PX3A 1PZCA 2WFAA 3CE9A 4F72A 5TARA 1Q0UA 5NLLA 1OIOA 1CDIA 3FHAA 3AHCA 3LDUA 2J4WH 1DBML 4KO1S 1JHKH 3V4PA 2C4VA 1X1TA 4HRYA 4N0EA 2D0DA 1V5WA 4JZOB 3JZIA 2OTWA 2NR6D 4CAGA 4FOPA 3ZCPA 3ZCXA 1FJGB 4S1SH 1T2VA 1G9XA 3GIDA 5JI3E 2O7NA 1IC0A 1FIGL 1I4WA 4NXNB 4FA6A 3ZV5A 4CSSA 3WO0A 4H8VA 4IFTA 4XR4A 3IWUA 3HYLA 3TLGA 4P2QD 1U7HA 1V1JA 3N44B 2CE2X 3WFBL 3U7AA 2VH1A 5KQLA 1HWHB 4O02A 2LDBA 2L4OA 3NFYA 4E0BA 3B6JA 3ARVA 1W72H 2VXVL 2E4WA 1GKLA 1LXMA 3EC1A 2QVYX 4HPWA 4M48L 3IJRA 1Q16A 1FLRL 4HUNB 1SFRA 4NRXB 3M6FA 1W0WA 2CE6A 1S9VB 3E1GA 2DQ6A 3ZKQD 3ULUF 4IGEA 1E3SA 4KXCA 4IY1A 4FT2A 3BHJA 3SLKA 1QBLL 3OKEB 4FK8A 2R0LL 1BE1A 3VV2A 1MNUH 5KSUB 2VI5A 4KOCA 4H20L 4D3CL 3GLHB 4V1DA 4X63A 4PJIF 5E6IA 3JVGA 3BIKB 1XMWA 1ABEA 1CB4A 2PCFA 1FN4B 2V0NA 1B2WH 4ZAGA 2A83A 1T6BY 1KPVA 4BTEA 4YRNA 1N6NA 2QHLA 3WQBA 1GS6X 1U0BB 4J29A 4PJBF 3FHOA 2DY0A 3E38A 3RZCA 4URFA 2PO6D 3GL9A 4PWZA 2CJWB 3O73A 3WFJA 1TQDA 2R1VA 1KTDA 2IYAA 3H0TB 4EHBA 4GPIB 2CSPA 3KLNA 2X9GA 4HJJL 3ICVA 3PJDA 2FOIA 4TRNA 2QY6A 3CMOH 4YDZA 4ONOA 5BW5A 3P94A 4WHTB 2W70A 3VFMA 4DQKA 2P4EA 1R5VA 4UTBL 1C9YA 5KBLA 4LKOA 3Q7RA 3VYVA 5JG7A 1R3IH 4JI6B 1GU7A 3L1UA 3ALPA 1I94B 4M5YH 3FUHA 1N2RB 3DMTA 5BRPA 2BCMA 2WY2D 3A6JA 3H4MA 2XTAA 5BN3A 1DDOA 3JTMA 2HFKA 4D9KA 4H0FA 4NN7B 4MO2A 5I76A 3B85A 2F53E 3BJEA 4BYGA 5DLQC 4BNJA 1OHHD 1SVZA 4XB8A 1IGFL 2YR3A 2YKLH 5I5GA 4HDSA 3DDNA 4CKEB 3BIWA 3DX3A 2WJPA 3N3AC 1F3OA 3AU1B 1GYAA 4WBXC 4EG5A 2H00A 1GTL1 2FATH 3VWJB 2YMXH 2WHPB 4RIGA 4NNXB 4O4JB 4OH7A 5JVDF 1W5FA 3WMFA 3ARGA 5A2GA 3PV0A 1W88A 4UKDA 2O5EA 3H3XA 2XWXA 4N2CA 1F4XL 2Z65C 4GQQA 1GXSB 1UJMA 2YPVH 5K9KA 3L1OL 3QQNA 5C4MA 2R1XB 4ZMXA 2DQEH 1KB5L 2WSPA 4G5GA 4UTOA 1ZTMA 3KPSD 5LJIA 1KK1A 2VDJA 3FH5A 2E7ZA 4JFUA 1AGCB 1I8IA 5AVRA 3MBEB 3JQ8B 5ESVB 3BMCB 3V8EA 4F3RA 2P2LA 2I2BA 4PLCA 2X87A 5AOJA 2PD4A 2WKQA 5BSGA 4I2NA 5CD3A 4L02A 5JI2E 3CDGA 4JDPA 4DO6A 1SJMA 4C83A 2GZSA 2CMKA 4EZKA 1IH8A 5FH9A 2J67A 3N8DA 4FMKA 4NC2B 4HQ6A 2V97A 1OM3L 5EN4A 1U3VA 3JVUA 4MOWA 4E32A 3FDIA 1LHZA 3E3QE 3NH7H 2I32A 3GD7A 3C5WP 1IJEA 1C1XA 4CLOB 4NO2A 2XYQA 2XOXA 5DJYA 2MDTA 4NKMA 5KHLB 5EBWB 2BNQD 2EINB 2VUOA 1Z34A 5J63A 4MKTA 2OX5A 1XR9A 4PRDB 1YEIH 2Z2ZA 3SDXB 5T67A 2QROA 3SD7A 4HKBA 1U7TA 2BMEA 2KMLA 1YIDA 1SPDA 4LVEA 3V8PA 1SG9A 32C2B 1SCQA 3VFRA 5FF6A 3QO1A 4D4GA 4NXMB 4HCFA 3B48A 1M34B 2R23A 1WQ4A 3CURA 2Y72A 3GFOA 3GUYA 5J4LA 1RJLA 2DJUA 4FKKA 3DTXA 3BQUD 4OX9Y 1TLMA 3U1SH 3T5PA 1CUCA 1UXWB 2NNFA 4ND2A 1RBYA 2JCCB 4QQNA 4HUWA 4MULA 2XQBH 2FB9A 4RL6A 4ZA2A 3MR9B 5EOCJ 3PR1A 4R4NC 3SDYL 3ZXYA 2NNLD 1M7IB 1QFUH 2W6ID 3LN5B 1EHCA 4MV3A 2VRKA 421PA 2GSIB 4HF5L 4DP8X 1HXKA 5TSDA 2XZDA 3BTOA 1NBCA 3TN0C 3MCG1 2GJ4A 3A8TA 1IHDA 5IDWA 1E4XH 1EBFA 3WEOA 4Y67A 4CVZA 5DJ2B 3BAXA 4C3ZA 3DMRA 1EHLL 1PR2A 3ZK7A 4F11A 1BAWA 2X9ZA 3WLWC 4U6TA 3M9XA 4PW9A 5I5EA 1T2XA 4GMTL 3MHPA 3SSGA 2WLKA 1GM5A 3CZKA 2QYOA 5FYJU 5HK9A 5IBTL 3RRFA 5T7BA 1UZ6F 1G6RA 3KBHE 4MW5A 1VKXA 3KAKA 3R7SA 5KAPA 5F1OB 5EA0H 2IVFC 4DNOA 1KV3A 3N0AA 4X0KB 3T7IA 2EFHB 4GXVH 2YJ3A 3V5DB 2IALB 4OJFL 3UWMA 2K7FA 1M1ZA 3CN0A 1NUQA 4MASA 3T5TA 2D7CA 4W5NA 2CHNA 2ZRMA 3OC6A 2E4XA 2UWEE 4DETA 4E36A 5DMGD 4B0MB 3RNKA 3PHBE 2V7HA 1FS5A 3VU9B 5DGIA 1OD7A 4QD2E 4HD8A 2X0IA 3EBGA 2V4UA 2EIMB 1YS4A 2IJ0C 1KJ8A 3IU4L 2R29A 3FAWA 4J7AA 5CA0A 4UDNA 1KQFA 4KH1A 2BY1A 4PGBB 4ONFL 1CQJA 2GBAA 3DDWA 1S3SA 3ZY7A 3GEMA 4QPNA 1P0CA 1FVCA 5I6XC 3DXAB 2RCYA 3ZL2A 4K28A 1A66A 2PKCA 2NY1D 1INDH 3HE6B 1QBBA 3LC7O 2ZX8A 4D5GA 1TPZA 4WA7A 4NBTA 2QT0A 1EFXD 2KUTA 2HDOA 5SZKB 1GC1H 5LBVA 4NUGH 4XR8C 4LSRL 1URZA 4OJEH 3KD3A 3KUCA 4JS0A 3ARFC 3UGXA 3L3OB 3QQ9C 2IG2L 4YR7A 2GHIA 3LQMA 4QMEA 4YGVA 5E5LA 3IILA 2AABH 3L95A 4XOEA 1IAOA 3L13A 5BQ7A 4X95A 1P9MA 4KROD 1MF2L 3IVMA 4WFHD 1R64A 4BO3A 3DEFA 3QU7A 2XUPA 4LOVA 1EE1A 2HFTA 4IS6A 2XODA 5CJXA 5L7XH 5JQHC 3SCMA 4GOKA 2DQUL 3A04A 1X92A 4PUBH 2H31A 4RJLA 1XZJA 4GECA 3GI9H 1A8JH 3O4LD 2DD8H 5E2UL 5T5FH 5C0ND 5DJZA 3BH6A 2WNKA 2VAAB 1T10A 1RQPA 1SVUA 3NBXX 2BNUB 1P4HA 3IRCA 3OAUH 1INEL 1OSPH 3ZXIA 4I36A 3ZDDA 2YC4C 4AM0A 2G4GA 4IRJB 2LKCA 4ZI5A 1Z8FA 4HUXA 3HHRB 5MHSD 4KRPB 4YRKA 4INOA 2B0CA 5E8NA 5FHRA 1D5MB 1UXSA 3NBAA 4WW2C 5C0AD 5AKVA 2Q4OA 4O4IA 1S7WB 3I9GH 4LPUA 1QO9A 1VJGA 4FZVA 5D2NA 4MV5A 1HT1E 2FD6L 2YDYA 1RJZB 4K6KA 4OEHA 4EITA 2XRYA 3NA4A 4XVSL 3DX9A 3OO0A 1EK1A 4HXYA 2X1LA 2VRCD 1MCDA 2R83A 1KI1A 1E6CA 1U6IA 3E3OA 5JCJD 1I6WA 1YRLA 4J8RB 2ZJ7A 3ZDXF 1GTMA 2NQ8A 4MWZA 3LZNA 2EZ0C 4H1LA 1RQ5A 2A6KA 3IV6A 3T12A 3REOA 1N6QH 1G5AA 2HRZA 2F58H 2IS2A 2QYTA 3TUJC 3W05A 3W5IA 1DEXA 2H92A 4L4TB 3SVTA 4OHRA 4KI5C 2OWDA 2XIIA 4IDHA 4M6OH 1ORIA 1JZ6A 4LHJB 4HKTA 4OCYH 1HVXA 2QRQA 3T6KA 1QTNA 2OCBA 4KMTH 1FFGA 5KNDA 1Q0YL 5TDOB 5JW4R 2R8ZA 3USES 3IS0X 4JP1A 2ZVDA 3GV0A 2PYED 4QRTB 3GLDA 1B2RA 2FX8L 5EMHA 1FNEB 5A5FA 3RVWD 1U11A 5DT2A 4X45A 4G1EA 3SE3A 3AUYA 4QXQA 1XCJA 3CIFA 2L18A 5C7OO 4WGFA 3FMVA 3QDGE 4NQVB 1E4EB 5KC8A 3PIQB 1V3LA 5DMXA 5ELXA 5I9IA 3MWYW 4JRXB 3TAHA 3WA6A 2PG3A 3T5WA 5C8YA 1G6Q1 4AD8A 2DPLA 4OLVH 4ALJA 2BHTA 5L9DH 5LD2B 3OD5A 4F9FA 4NPJA 4OZIE 1E5LA 1T5HX 2HXSA 3NEAA 4XC1H 3X14B 3BD4A 2J4WL 4TM9A 4YFDB 3EG9B 1JHKL 3OIWA 5D1HA 1PZNA 3PQ5A 2IANA 4TKZA 2Y3IA 2ICES 3FNFA 1TD1A 4LBZA 4S1SL 1A25A 4P2AA 5B1DA 5BXYA 3W4JA 5HZMA 4IH4A 4P3CL 4W9IC 3U7WH 2NQCA 1CUDA 5ESDA 2ROQA 4N9GB 1KY5A 1HX7A 9MHTA 4YSSA 4W6YB 2PJUA 1A1SA 1CD1A 5GJBA 1NR1A 3EYUH 3QJFB 4EVSA 3M82A 1NXTA 5EKTA 5D6OA 3UUFA 4DN6A 1KI2A 2L69A 4BP9A 1THTA 4TL8A 3NGLA 2R27A 4KPYA 2J5LB 3KQTA 1PTJA 4O2AF 1P73A 4F45A 1W72L 5DM70 1UJ5A 3A6KA 4E2YA 3E2IA 2VHXA 1G20E 3CN1A 3DBXB 4BX2A 3NJHA 5D71H 5A9SB 1MH1A 4US1R 1NJ1A 5IG2A 1RXYA 4ER0A 3B8YA 4N0YH 4ZMZA 3H2QA 3H1TA 4HMDA 4R1QA 3KUUA 1MNUL 5E9JA 2P8MB 3UADA 3VXUA 2G30A 4NBUA 3FHTA 3MRBB 2ZCHH 1WUZA 3M1AA 3MINA 1H85A 4BXSV 1B2WL 3FQWB 1Q3HA 5DYFA 2PGXA 3S5UA 2YMQA 1ZV5A 4MVWA 4FHDA 4CKZA 5TQ0B 3B1UA 4B3TB 4X0EA 3NATA 4W1QA 4MAYD 4GBXB 2QP9X 1UL1X 3NEOA 1N2EA 3K2MC 1XTBA 5EEHA 4J1QA 2ASEA 3ORHA 1MREH 2ZP9A 3PHHA 2R2CA 4WHMA 2F9FA 2YNMA 3ZCTA 1CW2B 2DQJH 1ZEMA 5E2BA 1WCBB 3CMOL 4UAOC 1WEKA 3GC6A 1H6DA 4EGSA 4OZHA 1F0KA 3FHLA 3RTCA 3W0WE 2XCQA 4QFBA 4KUZH 4M5YL 1IBBA 4FA7B 1MV5A 1Q9LA 4LEBA 4IJWA 5E4EB 1SDDA 1WGOA 3VFSA 3OZRA 2JFNA 2HMIC 1J2YA 3EVBA 3FZEA 2O8EA 1HMYA 5ICZA 4MA3A 3PGA1 4LPVA 3TINA 3CNOA 5F3RA 1BJ1J 1RH8A 1D03A 2QLVB 3SZKC 1S89A 2HWXA 3DR3A 5EJIA 3O11B 4ERNA 5HF9A 4D3ZA 1BQ3A 4UQBA 2DFTA 3RUPA 1PJ8A 1H4VB 3OXRA 1L5SA 3BHMA 4G6ZA 2FATL 1S8NA 2YMXL 3ZKMD 4R4BA 2CJSA 1SVOA 2PRIA 3P9MB 4UXIA 2G5PA 2O06A 4ZU3A 5BVPH 2DQHH 1N1DA 4ZUVA 3QQXA 1C4WA 4ZT4A 2R4RH 2YPVL 1QP4A 5D7JB 5ENWA 2B8OT 2CYAA 4F1KA 1EEQA 4G1MA 1BG6A 3P2MA 5TX7A 4E5XA 3HKCA 3DX7B 2O5NA 1GCGA 3O4RA 2R1TA 1LEKB 3TBYA 4MXQD 2PYDA 1XVTA 4DEPB 3LSOA 2EE3A 5CM9C 2EUXA 2NYUA 1NEZB 4MJ2A 3DKIA 1I8LC 3T7KA 3WDKA 2EWMA 2XTMA 1LBQA 1ZW1A 3LLMA 3QSGA 5KSAD 2YOGA 1X5XA 2H2AA 2H8PA 3Q2WA 3ORFA 5I28A 3FU5A 1QBMH 2Q9AA 1R4XA 4HAWA 1F13A 2NYKA 2WFMA 3FO1B 3KAQA 3LXRA 4JB8A 4YMUA 4JR0A 5LQUA 1CF8H 2ZT7A 3NH7L 3ZE0B 5F6HI 1HO3A 2XN9D 2HAEA 1MDTA 3L9RA 2YV5A 3VR6A 5I1GH 5CDSA 1GSAA 3MLWH 2IDUA 1SCKA 4Z76B 4HUQB 5C0OE 4Q4JA 1K6QH 1Y9AA 2FHCA 1FVFA 5L4NA 3RV3A 3CJRA 4M0FA 4BVFA 4ZOCA 2FTAA 1AKUA 2RAVA 3T4EA 4N4AA 1B2YA 2ZWLT 2SODB 3VFVA 3KU1A 4UUMA 1PUIA 3WNQA 3MWDB 2FZ5A 4AXXA 3WHXA 1FVOA 5AJUA 3U1SL 5FOTA 4XPIB 2D2VA 2L7EA 1HE8B 4S2EA 4ODSH 3JYHA 4NQED 3ZN6A 2GY7B 5IASA 3F5WB 1JEEA 2ENSA 2HRLA 2IDTA 1EM6A 4P58A 2XQBL 3LUGA 3DKVA 3PKIA 1EJ8A 3D6JA 1V3JA 1A04A 2DYPD 5AOLA 3DGGB 1LF0A 5HP4A 1EFLA 2VS1A 1X8LA 4UT6L 3T0WA 3QLJA 1T3SA 2HLDD 4G5XA 2ERJC 5AKZA 4MW2A 1QZ1A 5KYWB 1E4XL 1WBJB 1XGTA 2VLJE 1EERB 5ALFA 5C32A 4OI4A 3FDWA 1ODJA 2EEPA 4HIIA 3HE7C 3HPLA 3OJFA 1RK1A 2ZIFA 2VQTA 3L6RA 3O74A 2EIZA 3TBHA 1JZEA 3IQXA 4HAVA 3CFBA 1P6FA 4LBYA 2QVXX 5KSVB 3NIDB 4EZLA 1AF4A 1YZHA 3HLYA 5EA0L 1AUXA 1ZK5A 5I75C 4GXVL 4BO6A 3VFWA 3P2IA 2G07A 4XN4A 1NGQH 1PEZA 3PNOA 3PWKA 3H84A 1INQB 3QDAA 3OHXB 2LP4Y 4CUCA 1Y6ZA 3KSAC 2V3WA 1G1CA 1RXIA 4FFMA 4EY7A 1HFKA 1HOXA 3EUFA 5ADOH 1L7BA 4NQCD 5IESH 5T8KC 4CDNA 3RVSA 5FF9A 1AHNA 2VJ0A 2XA3A 5JTTA 3U4KA 2RB5A 4FTVE 1FUUA 4XNDA 5DTEA 1P9NA 1VERA 1AR1D 1WPXA 1NCBH 2P2CA 4LYEA 1XTVA 1HH9A 3ETJA 3EJRA 2Q5EA 2G4EA 4ZT5A 3CSTA 3CO0S 2AG0A 4KZCA 4H18A 2BHFA 2UUAB 4UOW1 3LBYA 5AVTA 1OP4A 3SKXA 3F7TA 4GMSL 4JQXA 1H6BA 5KVVA 4MRBA 1G64A 1S5HB 3O3EB 1P7VA 3TW4A 1U8QA 3ZQ6A 4XJXA 3RVKA 1R8YA 1PJ2A 1S3GA 1INDL 3A25A 3WADA 4AQYB 4ICIA 4K94H 5FUQA 4MGZR 3CUWA 5IW1A 5B6PA 3QDJE 1GC1L 4IQHA 3DVNA 2JGIA 4NUGL 3MNWB 2ZSVA 3OJXA 3HAEG 1XV8A 3FL7A 3FUVA 5EFIA 4WQOA 3SZOA 5DHTA 4AEFA 1HXMA 3ZBQA 3QEKA 1OW0A 1OI3A 1WVZA 4F5CE 4EHAA 1OZTG 4KR2A 4R5TA 3IE0A 3RT1A 5ERWB 4N49A 2HJLA 2OQVA 1JV5B 1N2GA 4OKIA 4P4KB 5L7XL 2OQ2A 3OZAA 1A3ZA 3II3A 4YBZA 1LSJA 3HJ0A 3W2DH 3IDSA 4PUBL 1FU7A 3O3DB 1NBVH 3KBFA 1R3KB 2I03A 2F7QA 4NK5A 4QT5B 2DD8L 3GOQA 4A66A 5T5FL 3LG2A 5C0IB 3KT6A 3WNZA 4PVMA 3RDPA 3NX4A 4HATA 4G5FA 3OPUA 3GSXA 3SGKA 5FKPA 4ATNA 3M7IA 1XVVA 4YK4B 2WLLA 4HG4K 4YBRA 1JDNA 3ROOA 5EPEA 2Z6QA 2VLRB 2KDYA 3LKVA 2ZJ4A 3CFMA 1N6PA 3SQBA 3E9YA 2KDGA 4X8JA 1J09A 3KNBA 4ZJ9A 1E1KA 4RSRA 4B3SB 2EC9U 4M76B 3TFKC 3I9GL 3B7WA 3UT5B 2PWHA 2EP6A 2FECI 1L4YA 4RWZA 3H9SB 5KBNC 1QG6A 2QHXA 2AJZA 1CUSA 3G5YA 4M2LA 2R0WH 2J9RA 2MT9A 2H2DA 1BEXA 1LP9E 3A2LA 2EVWX 4AO8A 1S7XB 5T57A 1AHPA 5IT4A 4GRLD 4LLMB 1YRKA 3TD2A 4GWLA 1IE5A 3F7VB 4EDXA 2K8QA 3ETHA 5FWRA 2J33A 2WBKA 1ZIDA 3MILA 3U4EB 5LB2A 2PPEA 4HV8A 3ENKA 4QVIA 2F58L 4F4HA 3LKNA 1ONQA 4JVMA 5E0QA 4QVKA 3ULVF 4RCZA 5EH1A 3DDFA 2C58A 4D4MA 1Z35A 3F3KA 3DJTA 4G8GA 1A9PA 1PNOA 1SQSA 4OCYL 5ITFA 3NP9A 1DXQA 4KMTL 4CLDA 3KQNA 1ICEA 1DQRA 4MQ7B 4XHJC 4Y4FB 1QPBA 1MABA 4BGVA 3T38A 1S8DA 4I77H 4I18A 4KQXA 3HEIB 5CT5A 5I7UA 2VBIA 4EY6A 1I6LA 5JWRA 3K6OA 1YMVA 5AVQA 1RZ7H 2J8HA 4G82A 2ZXDA 4JQVA 3QUTA 5F1PA 4XB7A 3AFIA 3VYRB 5C0EB 5TD4A 4N5NA 3ZO9A 1Z9OA 5CEFA 3NQIA 1OXYA 2PTHA 1EEYA 3RWMB 3L4KA 1W93A 4E5MA 2PKDA 1TG8A 4U2KA 4BO2A 1GOHA 3OC5A 4L9LC 4EELA 3L45A 1BTOA 2PT6A 3DYBA 4A7UA 3N06B 5G0SA 4EUPG 5DUBA 3DETC 3E6HA 3NOVA 3S37L 1RLMA 4U1HA 1ETA1 1U0HC 1T4KB 2YK1H 4HWSA 3R74A 3NBZC 4G0YA 2F6RA 3KJZA 1M6OA 2J09A 15C8H 3JT2A 3OLCX 1N0XL 3NG5A 2WDPA 2XZAH 1V8HA 3FOBA 4DR4B 5F9WC 1VEOA 1U0RA 3FB5A 2FJPA 3C6MA 3UXFA 4MQXC 3PKZA 4A2QA 5EB9A 2YD4A 3U7WL 3EISA 4IXTA 1BOGA 1JWSA 1DBIA 5KNCA 2DQCH 2F8LA 4PGHA 3EFHA 4ZFFB 2CRIA 1AGBB 3GJ3A 5GZ1A 4BKTC 4FXKA 5K3DA 2Z5LA 3EYUL 3VGHA 4BOYA 4YQFA 4WAUA 3DCIA 5HIJA 1L4LA 4D9IA 4BFNA 4ZI7A 1B0RB 3IGFA 1W16A 5ALRA 1MOEA 2CALA 5DFTA 4BX3A 4H0HB 3AB0C 4JDZB 3UWKA 4OJDH 2WZPA 4DXAA 1A3LH 4HBCH 1NKOA 3F8UB 3THYA 2NNAB 1AQ8A 4EX6A 1SRQA 4OA5A 1JG2A 2HF2A 3RG1C 5GZNA 2XB6A 1VA5A 5J6GB 2XKKA 2FR8C 4CCYA 3W9YA 4FMDB 2YUVA 3SMQA 1RPQA 2AMYA 4GNKA 2CNNA 2A4CA 1TZGH 4JFPB 3O8QA 3W4KA 2X7HA 1YZNA 4JFQA 2CK3A 2YS6A 2JCBA 1GGNA 3PEWA 3M2TA 1XIWA 1XCQA 1BN6A 1W0YT 1L9XA 1KOLA 3C5JB 1HBJA 3V1TC 5GAJA 2NW2A 4J28A 1PMYA 5BZZA 1CO1A 2IX9A 4JAMB 3DTUB 4V1DE 3AL0C 4ZVQA 2IXQA 2NUPA 2AZ4A 3UO1H 5EPMB 3KR1A 3D25B 1LVHA 1LNUA 5ICMA 4MJ5A 1ZMOA 3GS7A 2BMFA 4GUDA 2BMAA 4QNPF 1CDCA 2WIBA 4DEYA 1CFTB 2DQJL 1GZ5A 3SOPA 2EZUA 5L8KB 4R84A 5IF0A 3QKSA 2DECA 1P4LB 3TEWA 4OQYA 2FEOA 3IEAA 4KUZL 3URKA 1QIMA 5DOVA 1EHKB 1W59A 1EHYA 1F0NA 5E4OA 3WLFA 1AQNA 8ABPA 5HJ7A 3FQRB 3ML8A 1RYYA 3S3PA 4XBPB 2BF7A 3D6NB 3WB1A 4UE2A 4Y4KA 2HPOA 4C7OB 3NK3A 1ZLEA 5JAIA 3K15A 4PJIA 3B9AA 5JEDA 4X4YB 3CPJB 4PAOA 4C01A 3WQRA 5IQ9A 3BE6A 4ELMF 4UAJA 1UMDA 2WIIB 1WBBA 1W80A 5B55A 1G9SA 1QC5A 3UHOA 1Y6FA 1MJ5A 4UEOA 3U0TA 4PZ0A 3UP1A 1WBDA 5BVPL 3SDAA 1H2YA 4PJBA 4LE1A 4LJYA 1H66A 5DM60 3O8XA 2R4RL 3P54A 4JREC 4CRPA 3NSJA 1KSHA 4KWUA 3W5SA 4OLHA 1U3DA 4FQPA 3MWLA 5HXAA 1YCDA 4MPTA 3TB6A 5FNZA 5T5NF 4F27A 1KIRA 4PSUA 3VAAA 2Q0HA 3SJVB 4JFEB 1DKRA 2GHWB 3Q88A 4EXPX 1OPGH 3G13A 4DPCX 2G0AA 3H3FA 4LWQA 5CAEA 2I65A 2WKSA 1EA7A 3N2GA 4QLRA 3ISYA 3VUAA 1JA9A 3OLVA 1KK3A 5JISA 3DEJA 3B6KA 3W8NA 1YBVA 2EC8A 2AN4A 5EIXA 1XK7A 2CXRA 2GASA 5DSCA 2BE9A 5C52B 5E2VH 1PDKB 1PGRB 3PQYB 5AVWA 2VT7A 3J8F7 1CF8L 1OCWL 3BLKA 3AR4A 2HMTA 3V4ZA 3E9DA 2XQYK 2QUZA 3K6FA 4CKYA 4OLUH 3LPCA 4OO3A 3BMQA 5I1GL 5JVDA 1BBJA 3LDAA 3MLWL 2C9XA 5DC0A 1TO2E 1K6QL 3CVBA 2WTAA 4J9UE 3S70A 3IDGB 1Q4NX 5T1JA 1RKRA 4KUCF 1VIAA 3E4CA 4DFHA 2V6GA 1P2FA 3GK8H 3L1FA 3IIEA 2W5UA 3E9RA 3OR6B 5DJ6B 4LLAA 1OTYA 4LV5B 1K7EB 2AI2A 3I0NA 4QTTB 1MZYA 5GRJH 4M36A 2LAGB 4HNRA 4LE0A 4OCZA 4DMLA 3WBFA 1GR7A 3TBKA 3HFSA 2BSRA 5LSAA 4YO8A 3QORD 5AUOB 3ULAB 5GGRA 1JH9A 5HEKA 4DV4B 2UZ4A 3F7YB 2QMUA 2ARJB 2OCJA 5ALPA 3RX9A 1QSEB 5AVOA 3QEBZ 1OSZA 4HXAH 5FUCE 4Q52A 4HUTA 3ZL4H 3C5CA 3U2SA 1DQSA 4GUOA 4FSXA 4JBGA 2IIBA 3OQIB 3WBDA 2HDWA 2J31A 4H7EA 4F8JA 1TEFA 1E2KA 2TSYB 4YXFA 1JF1A 2YH2A 4AW9A 3W7VA 1VTKA 1K4CB 3B2UD 2J59A 2OPHA 4WECA 3HBJA 3SZMA 5BUSA 2DH2A 2HU5A 4LCWD 1UM8A 8PAZA 4XNZC 4D1YA 4R7LA 1IC4H 5K5YA 3KLQA 3R1IA 4DW2H 2H7VA 3T4PA 5CB0A 2WVGA 4QOKB 4L78A 4RJIA 3E9ZA 2UVQA 1Q83A 1Q0EA 1L9TA 4MJXA 2KQMA 1M7UA 1Z5YD 4Y16A 3KXFE 3I5AA 2BGJA 4EVIA 3CG4A 4MDRA 1MB3A 3ZQKA 1QHQA 1QYGL 1P7KB 3FD8A 3SJAA 1PT9A 2EKBA 2WFLA 4ZTEA 2HC9A 3OOYA 4HUVB 5FBLB 1YEDB 5ADOL 5IESL 3BUPA 4L1BA 1SKYE 3PE4A 1KPHA 4CEHA 3O6VA 1IFRA 1XALA 5F1NA 2VXOA 2VBFA 5HGBA 1SVSA 1P9OA 1V3UA 1EIZA 1NC2D 3KV3O 1Y34E 4I1NB 1QUNA 3TVMB 3L9EA 2C92A 1S2IA 1NCBL 5IZ4A 1UKSA 4UIMB 3UZQA 4M8QA 1QTRA 3N2NA 3SS9X 2IAMD 1AD0B 5K6AA 2BONA 3MN8A 4JANA 2OGTA 2AXQA 1BM3H 3QIUB 3QJHA 4MD5B 5C3LD 5FAXA 3C6LC 2N0SA 1PLBA 4ZCPA 2IW3A 2MU1A 3LH2H 1Y80A 4AMKH 2NZ9D 4EI2A 2DBLH 2V0GA 1BVNT 2ZGVA 1NSYA 1D7AA 2AC0A 3O1LA 3ZBTA 2RK3A 4K94L 3STHA 1HX0A 5ALKA 5TE6H 1VJTA 2E74C 4H77A 4YMSA 1AQLA 2VDMH 5DEFA 1QX1A 3OGCB 4OBWA 3UB4A 2FJUB 3I42A 1LO5A 3RDTB 1AZBA 3VZSA 4UAHA 4L73A 4WJ5B 3DDGA 5I1LA 2ADFA 3CSFA 4OHUA 4B43A 5MEPA 2BKUA 2WXMA 2WNSA 3ZW8A 5I0VA 1PEKE 3VNSA 5EYPA 5CVDA 4BQIA 2JVIA 5E3JA 2B9VA 4GVLA 4YBLC 3K6IA 1Z56C 2NSLA 5GQSA 4LHUB 4JB9H 3BICA 2HX1A 4LJ5A 5DK2B 1HKUA 4L9WA 3W9DB 3VX1A 3OJCA 4IIBA 1TZ2A 2AYZA 2X58A 1DNPA 4NPCA 3ZNNA 4EYOA 1ZK0A 3TZHA 4WE3A 2JAOA 2RC5A 2E2WA 4XCNA 4FYIA 4RPJA 1UDBA 4NBZB 1UP4A 1PLJA 3FUNA 5JNSA 1PS8A 1GGMA 1N8NA 3QBDA 2D0FA 1L4BA 5AFSA 4L75A 3BXHA 3QX8A 2W22A 3HJNA 2C5GA 4G4GA 1SCNE 3TZVC 4UJ3A 4ANWA 2JAXA 4KQ3H 4X99A 4XM1A 5L7TA 5C0JA 4QGBA 4D9LH 2BVEA 1M4KA 1MFEH 4GINA 4GGPA 3RTGA 2Q0ZX 5J1AA 5GY7A 2R0WL 3F9IA 3KAJA 3K5IA 3GCXA 4LZAA 3ASOB 3PPEA 1YZKA 1X7QA 3QWIA 2AQHA 1YT5A 3WFEL 2IH5A 1IM9B 5D2NE 5LQDA 1QYCA 1BGVA 4EN3A 1ZLDA 3V2IA 4UEJA 2XIJA 5DD6A 3LOQA 3NRFA 3UMYA 3UMFA 3QI9B 4HWZB 3S48A 3H4IA 5A2LH 1YMMB 2Z9TA 1UK9A 1VL5A 1Z8NA 1IQDB 2VA8A 4DSZA 2DKOA 1OGAD 1QUPA 4OJKA 2REQB 3JYOA 1JQEA 4JUCA 3REVB 1NMSA 3FZUC 2IGFH 4OYYA 1P2CB 4ND7A 1YC7A 4ZGBA 1RBQA 1EFTA 2O1WA 1JEDA 3P0FA 1FRVA 4FQIH 1RZ7L 4LHQB 5KQPA 3AL3A 4HT1H 1AN9A 2I0FA 1YRWA 5GWXA 3ZVRA 2XQVA 3RFRA 2PRJA 2VK2A 3G89A 3OCUA 2GBGA 1K9SA 3VJKA 5F1SA 3WK9A 4INAA 4AH2A 4YHNB 3JATA 2VYCA 4ZQGA 4WV1A 4CKQA 4DAEA 2EBUA 1RPKA 5COBA 2GN6A 1BCIA 3OO1A 3UUEA 1JXKA 2WQZA 3ECWA 1SMAA 1HLFA 1NWPA 2YK1L 2FZKA 4KO2S 1CIDA 2DHCA 1KF9B 2YW2A 3EPHA 4RFSA 4UCFA 3NRJA 3AKYA 5EO9A 5FYJL 1ZPUA 2XZAL 3MREB 1SHMA 1A8QA 3K8ZA 3FZQA 3GJFA 3KPYA 4KFRA 3KUDA 2H1WA 3MOAH 2IPUG 1WAAA 2GBPA 3CZ5A 2QKIA 5H37H 4HS3B 3KYCB 2GVDC 2LNDA 3OAYH 3VZPA 4NPYB 4NYIR 1T2FA 4XVJH 3ARBA 2GIYA 3CZEA 2FPGB 5LNK1 4I48B 2DQCL 2ZRAA 2IANE 5E7IA 4XNYH 2IYSA 5A7EA 1GLNA 3HU5A 1NINA 4GAAA 1WP9A 3ZEIA 3IAAA 4BZWA 2RR3A 2J0QA 3AF6A 5AI6A 3SQXA 1SXJB 3ROLB 4Q1CA 4PZLA 4DTCA 4DSAA 2IMMA 4BFRA 1A3LL 4HBCL 2FMKA 4XVHA 2B4CL 3DWIA 1B0UA 3CTTA 4G0OA 5TE9A 5I5JA 3VUFA 1PD1A 5DHQA 5FYKE 2JKVA 5EMNA 1XMIA 1DE4B 2HN7B 3SR3A 1LEGA 3BLPX 3LPPA 2JNZA 1QOQB 1OB1B 3R0NA 3D6MA 3Q8WA 3HLAB 1T8RA 3PWPA 5F21B 3L8ZA 2YXWA 3U44B 4M1GH 4WEBH 2IYWA 1CFVH 3H4HA 4U7SA 2D5BA 2AMFA 2Q76A 1TZGL 4BEIA 4D6YA 1I3GH 3VI4E 1Y8RA 5IHZA 4E0RA 1Y9EA 2BGRA 3MJ4A 3HUDA 3FBQA 3UMJA 5AW3A 2ZUFA 1ZLWH 5K0NA 1I1YB 3UV3A 2CPCA 3VXUE 1Z32X 2OVFA 2ODPA 1MCSA 3GN1A 3KVNA 5H81A 4YJFB 1Y0LB 4ME6A 4J3SA 3HMXH 3OKFA 5D1XD 3UO1L 5K20A 4GR5A 2OJZH 2BGWA 1MDFA 4NZFA 4UBLA 5JPMB 3IVXA 1S6NA 2JEYA 4QNNA 3O6FA 1NBZB 4YXKL 2DRIA 1GMEA 2DDQL 3ARWA 1W52X 3JAWB 5HJGA 2V7NB 4O0MA 4QATA 4FE3A 1JEYA 3OZLA 3NUZA 3NNSA 2R2BB 4E14A 5JWHA 2PZGA 1FYFA 3MFFA 5B2ZA 5CD5C 3EUAA 1DSWA 3LPNA 1N5DA 3E3MA 3N8KA 3IN2A 5DHVA 1X5FA 1FS4A 4L0MA 4OZHE 1RRMA 2JC3A 3V9AA 4OQNA 4D9CA 3HA0A 2ZG1A 1CUVA 2FJHB 3C5HA 5TQVA 4EPWA 2PQMA 2N42A 3FSRA 4XUDA 2AK2A 4RPCA 1J9TA 4A26A 3H3KA 4CMEA 5ECWA 3U46A 4OHFA 2BGGA 4DSTA 1E1MA 1T36A 2WTRB 1V47A 2OD9A 4D8WA 1MN4A 2W6ZA 2CR3A 3LKSA 5EXXA 4BLVA 5L51A 4MCAA 4MWBA 1PR3A 1TU0A 3GBMH 1L4FA 2YWFA 3K5HA 1K9TA 1U8KA 1ZQ9A 4C6TB 5FHAL 3KYDB 1ADYA 4G0UA 3BRQA 1A6UL 2M6LA 4MUFA 4B4WA 4FTWA 3ORQA 3GLKA 5DVKA 1OPGL 1A88A 3EIFA 4C4KO 1WZCA 1QZXA 3KE0A 4DV3B 1K6IA 1QOKA 4UQOA 3HVUA 4TGLA 2KHZA 3PPSA 1PV2A 3BH8B 4Z7OB 2G9ZA 2QD5A 1IC5H 3BWAB 1EWTA 3F65A 4MSUA 1TZOA 3NHZA 2ODBA 4PANA 3AH8A 3MLAA 4CG0A 5EDSA 5EO1B 2J6IA 2XD4A 5E2VL 3D48R 1C5BL 2C2HA 2Q7YA 4XGRA 2DQMA 3FWZA 4Y8VA 4C54A 4U6SA 3THWA 3MJVA 2PXYD 3WY1A 3DNFA 4YXLH 4OLUL 3M45A 3BIFA 4N7MA 4XGZA 4XCVA 3C9NA 4AJOA 1L1RA 3QWHA 1ZI8A 2CXSA 3TNMB 1VZ2A 3TQQA 3IAS1 5CIPA 4PX3A 3M5CA 4MGIR 2IOMA 3GK8L 3WBBA 4ZVNA 4G1CA 1YDWA 1KIQB 1T6VN 4ETWA 1U3ZA 3DHJA 2FWSA 4D3CH 5FXCH 3RVUD 2Y1OA 4M86A 3HCVA 3CFEA 5GRJL 5H8DA 1UFRA 3KSDO 4JBYA 3GMMA 5HHPB 5G55A 5FUVA 4YCSA 4KO5A 3IUNA 5AVVA 4RGYA 5AJHA 5CB8A 5LQCA 4P5KA 4R7VA 1RM3A 3DFKA 3QKWA 4HXAL 4YUAA 4Y6RA 5GGUB 4LIQE 3D4GA 3ZL4L 2QZ4A 5K1VA 2ONZA 5IJKA 1WX1A 3SDDB 4HJJH 5GZOD 1DUSA 2X6RA 4WI9A 3B78A 5BOZG 5CUSH 2H0QA 4X6EB 1HL7A 2XETA 5CFQA 4MJHA 3VH8G 4NQUA 2RQ8A 4RHUA 1G0NA 4YSTA 4WO4D 1RJ9A 2F3QA 4JD5A 3QFJD 3AM8C 16PKA 1TJ4A 2R2EB 2AX3A 1OY3B 4KX8A 3K53A 2J7KA 5IMBA 3GEHA 3TIVA 1IWOA 3FX2A 3FUXA 4CMJA 1U1DA 3OKAA 8ADHA 4HUUB 3WKQA 1IAIM 3K71A 5BPFA 1T0PB 3U3DA 2Z31B 2J3KA 4Y4HA 4CMGA 3KYMB 4IKEA 1Q0LA 1CEYA 4BQNA 5HI4D 2DICA 3SBEA 1U0LA 3RTAA 1F4XH 3G17A 4PS1A 4F6LA 4HX1B 4TS3A 3L1OH 4AYWA 1ES9A 2ESVB 3WYNA 1H0SA 1KB5H 3C16C 4HVCA 1F41A 4ZMAT 1T8YA 4PV9A 3CVCA 1T4WA 2XW6A 3L8CA 5K0FA 1TVCA 2FVYA 1PZ5A 5D96B 4EI5D 4W4NA 3N42B 3G2OA 1ZSNA 2ZU0C 4DCVA 3CMCO 4MA7H 1YN6B 4K6GA 3NSXA 3NV7A 3C4VA 1X42A 2HRDA 1BM3L 3Q87B 1AMNA 3DHUA 5DF0A 1DIGA 1Q94A 3MRRB 1ZM3A 1RPAA 2NQTA 3GLFB 3PQEA 1FI8C 2I9TB 2J2ZA 2I6UA 3LH2L 1S9WA 1QO3A 3UPDA 4Z4FA 2EIBA 4AMKL 3KYOA 2DBLL 4YMVA 1ED3A 4NH4A 5HYSB 4CI9A 3U0PA 3K09C 3I2YX 1D4AA 4BQQA 4I87A 2P44B 5TE6L 3MV9B 3B6SA 1DTWB 1I1AC 1OOAA 2FK7A 1H3NA 3LKZA 2XTJA 2PTTA 2VDML 1MDBA 2NY6C 5BXFA 1BH6A 2HIMA 1ACZA 3ZHZA 3DKKA 5C1BA 2J6EL 5GGSB 1JZGA 2CNDA 2DZDA 4BGDA 3U16A 2YTZA 3T04D 3QLVC 4GG6B 2HKHH 1PVDA 4PAWA 1JL8A 2X4SA 2XMDA 2YHSA 3CC8A 4CM6A 4WK6A 4S1QH 3KHQA 1SCIA 1WBZA 1OKKD 3BIBX 1DDGA 1AG6A 4GW1A 3TNJA 2VN4A 2EL9A 1ZM7A 3QPVA 2E4AA 4AGMA 3UJBA 4ZK8A 3NH6A 3C6BA 1XTKA 1N2CB 1LMKA 3CW9A 3GB7B 1S2GA 1YAJA 3HQ4O 4ZAYA 1WS8A 4PPGA 4BWYA 1SWWA 5FTJA 4YECA 1RWXA 4CEJA 5AKSA 2WT4A 2XCOA 5HI3C 1L7XA 4EY4A 1OHQA 3AKDA 4MWFB 1DG9A 5G2OA 1GQFA 2VE6A 3QNXB 2RQEA 3IMRA 1SB9A 4I5FA 1FCGA 4ESOA 5F3HB 2BZ0A 2OL4A 1AKVA 1BQRA 1IGIH 4J0CA 2P26A 4KQ3L 3CHRA 1Z28A 4R2WA 3HEBA 3SDCC 4AY3A 3VPBA 1HHJB 1KDPA 1N36B 1MFEL 3ESOA 3UTTD 3IUEA 3G82C 5D7LA 5BW4A 4QRSA 2JH8A 3SGLA 4KZDL 4IS2A 3V7WA 5BV2P 1Z6JT 3IXTB 4FG0A 2Z4SA 4LCVA 5ALOA 1YL6A 3SEQA 3MZTA 2VLLA 1OAKA 4PNHA 1BQKA 4F6RA 4J91A 4TXMA 5FYDA 5IAJA 5K3FB 4IIQC 1B6UA 2ZRGA 1E2PA 5LBIA 1P2BA 3S7ZA 3S4SA 1HDXA 3S2IA 2JHFA 1KJ2A 2GTIA 1KS2A 5J43A 5C97A 2ZU6A 4NI3A 5D72H 2VF8A 3C3DA 2Q07A 1P5UC 3A05A 4FZRA 2AN9A 2GFHA 4DNXA 4XWWA 4CKWA 1XCPA 4JEGB 5L3SA 2IGFL 1R0XA 1G6OA 3F5MA 4G8GE 3KFVA 3N6VA 3BESR 4K9OA 4XR9A 1C0EA 3X2EA 3YASA 5E95A 2D5LA 1XU4A 1LBHA 3FPLA 4GBMA 4FQIL 4JKPH 4HT1L 3N1UA 1KZ9A 1WH0A 3CGGA 1XZWA 1D1TA 1SGWA 1V05A 4NFLA 1GZDA 4MUMA 4YWHA 2VNSA 1Q1GA 3WMRA 4P32A 4B3EA 2JIQA 2Z91A 4OQPA 2BKAA 1DAPA 3AP1A 5CJ2A 1Z6QA 2OV8A 3P1JA 1MQ8B 1T91A 4YHHB 4LCIH 2XB4A 1RZFH 3CD4A 3DBIA 2Y4SA 2BT4A 1NOLA 1NQ5A 2W88A 4ZDHA 3LV8A 3KPNB 1VL8A 2JI4A 5DEJA 3MXOA 2FPPA 3LPDA 4RMIA 1BX2B 3RK1A 4Z1OA 1M6VB 2P8LB 2OUKA 1SULA 5HHOB 1RZUA 4RJ2A 1Y3AA 4QQKA 3MOAL 3I4FA 5DW0A 5I7VA 3EIOA 2UZPA 1JVSA 3UHFA 3WKPA 4PGMA 3FSAA 1MF2H 4XVJL 2X70A 3ZS8A 3AROA 4K3DH 2JAPA 2OTUA 3H04A 1DEDA 3DMNA 4FXLA 5FO8A 1F4PA 1YKSA 2WJVA 5CLIA 2DQUH 4B41A 2P6RA 1IJKA 5AW7B 2I7CA 3QMPA 2QVMA 4MRPA 1R24B 4PJFF 2IU0A 3O75A 3QYFA 4MZ3A 4XWGA 2V9UA 2ITDB 4EO7A 4IUCS 3RE0A 1PWYE 2HHHB 4FYXA 3VXSD 1JVKA 5CN3A 3GEDA 3W3AA 4AENA 5C6WH 3WDMA 4JX0A 2EQ5A 2KBEA 2I7SA 4KIWA 5I30H 2WLZA 4M1GL 3PFFA 4WEBL 3TA3C 2XWJI 1L9QA 4JE0A 2J3LA 5HWSA 4KCGA 4ES8A 4K9JA 3LFUA 4GKZB 1KTVA 3Q40A 4DZBB 1A4JA 4F8NA 2R6JA 3BD7A 2N75A 1W46A 4XVSH 5E4YA 4PGZA 3I6YA 2ZIUB 4Z9YA 1JPEA 2AD5A 3VW3H 4OQXA 3E9CA 1IC1A 1E2JA 4WTOA 5JJLA 4IRZH 1PX3A 3DZIA 3KAPA 3PNQA 1XRQA 2WAYA 4TRRA 2OJZL 3MLYH 5T1LA 1IHPA 3RVLA 2AP2A 4AY5A 5DM2A 2WKGA 2PUFA 4JI0B 3VSAA 1KMHA 4I50F 1YSCA 2YXEA 2DMKA 1CF9A 4CLHA 3LRPA 5I1AB 4BCDA 3IAQA 1QFPA 2EIDA 3F5QA 4KTYA 1XTMA 3Q2IA 3V6LA 4U0RB 5F7MC 1OMOA 4JQSA 3FQTB 1QGZA 3V52H 2Y69B 2ZLBA 1JFSA 2PK3A 2V6BA 3GFTA 3U3OA 2LLGA 1IMOA 1IEAA 3Q6IA 2ZDGA 2FX8H 5CDHA 5E7QA 3OX1A 4KGLA 3KL0A 2CZNA 2PGNA 3RWFB 4CQMA 2A74B 4WKZB 1R6DA 2IUYA 5H0IA 3ZY5A 1CUHA 4U1JB 2LU7A 3HGTA 2VUTA 3QXSA 1LJUA 1SKUA 1EH5A 4BNYA 2VZEA 2WJYA 3LUAA 2B3RA 2J9YB 2DULA 1XF5A 2XUDA 3JAMA 1I7ZB 3FBKA 2GCEA 3WYRA 1UJCA 4B60A 4NC0B 4HMEA 1GKOA 3AZPA 2BSBA 3Q72A 3SOZA 4PJIE 1AZCA 1QAWA 4MR7B 4L5FH 3GBML 3WLBA 3EVGA 2DWDB 4XP6H 2WNHA 4QHLB 1V5IA 5CH5A 3CO5A 1N5AA 3H6HA 4AC4A 4PJBE 4LSMA 2Q6WA 3V0JA 3KEDA 4H60A 3B13B 1IBZA 3MPCA 3FN3A 3NJXA 3ZYIA 2DWPA 2VDRB 5DXJA 1CY0A 3P2BA 3RKPA 1ABFA 2Z4TA 3EEBA 5CX1A 2X53A 3H18A 3QIVA 5AKRA 1AVAA 4P3CH 3W2FA 2OTPA 3PUHA 2QGFA 1UJ3C 1IC5L 4ELKB 1DAMA 1JB9A 2ZCVA 3UZVB 2VABB 2OW6A 2EYQA 3KDMB 4IMKC 4HSCX 3TLCA 3I1FA 2XMCA 1TJHH 4AW4A 4U1IB 5AVZB 1INLA 5EF2A 1I31A 5DJCA 3FUJA 4PWEA 2C34A 4U6XA 5D00A 2Y9PB 2GJ6B 2A92A 3WJMA 5PCYA 1FNHA 2EG9A 3AL8A 1K3TA 5KYTA 1E99A 3E7PA 3L0OA 4YXLL 2WJ5A 2JH9A 2J8UB 3WYCA 3LRMA 4ELMA 2ZBRA 2PBZA 1VE5A 1K1EA 2Y76A 5K8IA 3A27A 1PZEA 3ET5A 2C82A 2ZRBA 4P4LA 5CN1A 2DW5A 2JD2A 4EPVA 4I1UA 3AXIA 5HDOA 3FHQA 1KGIA 3WHIA 1DUIA 4R16A 4UUAA 4IBWA 5JXWA 5LLDA 3E82A 4IG4A 2I2CA 2ADOA 3QPBA 4OXYA 4QBIA 1XDUA 3B51X 3B82A 3IMWA 1COWD 3KSUA 4M6AA 3M6WA 5C4IA 1KGJA 1JNNH 1H5QA 2O8FB 3OOJA 4KR6A 2A7BA 3VVWA 5SWSD 3FOLA 3CLUC 1NKTA 3H8SA 5CZXD 1K5GA 1MEJA 4XZ4A 1F51E 2OMYA 1DO6A 3JQ9A 1SXGA 1CE6A 4EUFA 4UQ2A 1KK0A 4XTRC 1GNQA 3DCNA 1SHZA 3RC3A 2VXSH 5DURB 1BRTA 3QJ5A 2JKXA 1E3DA 2PCPA 3O0RL 1KTRL 4ZYKA 2P9CA 3BBPA 3PRHA 5CUSL 1S3FA 1LGVA 4RF4A 4O51B 3VC2A 5JYMA 4B09A 3V4FA 4IOIB 3H5RA 5IJZA 2RJOA 4J0FA 2IAAC 3W57A 4G5OA 1QVWA 2YFQA 4NN5C 3FSOA 4E9YA 2RGXA 1MDAA 3RS0A 2R7MA 4DQ0A 1DJSA 1CR1A 5B39B 2HVKA 4NK4A 2BW5A 3GMRA 1KRHA 1KJVB 2ZPTX 4LEOB 2DHEA 3AWIA 1RPZA 4A16A 4IIHA 4NQDD 4LP4A 2OXHB 3OMLA 3HCAA 5E5RB 1QNIA 2JB6A 3RF7A 2WO3B 3CDFA 4MKFA 2V0AA 2DPGA 1RJCA 1ICIA 3KLAB 3O4IA 3PGXA 1NASA 3KLHD 4DDHA 4GEIA 2OO7A 4UYQA 1TI7A 3R6DA 1CS4C 4ETQA 1FYWA 5J8OA 3L7OA 1O6ZA 1SUIA 4X64B 3JPYA 3U3JA 5EZJB 2PPAA 3OTIA 5DNYB 3IVKB 4BN4A 1AX9A 3VR4D 1Z18A 3FN4A 4IU2A 3DPUA 4MA7L 5EZQA 1BKYA 4D0BA 5J9PA 4BLQA 2KKQA 2XKJE 3H1BA 5COAA 3CVHH 3LRSB 5KYUA 3AHGA 3OQPA 3IDIA 5IBQA 4U1SB 1X7XA 3OKNA 3TIDA 4WHDA 2FFRA 3HZ3A 5I7AA 1E4JA 4YHYC 3H5LA 1J2RA 3KZ8A 4QYTA 1OOWA 3D2TA 3V1UA 1LBEA 3IC5A 1ENOA 3O31A 2BMDA 1EDDA 1FU4A 4KQGA 5IJDC 3UV6A 3FSZA 4QJIA 3QBEA 2W58A 1PQYA 3IKTA 1GQRA 4HEQA 2EIXA 2XKNB 3ZU3A 4PWFA 2D2EA 3UTQB 4JLVA 1OCCB 5FS5A 4IGKA 4RSGA 1UZ6E 5AVKA 5FBKA 4WEUD 4FFVD 4I8DA 3DROA 5D7IB 2HKHL 4I6GA 3W04A 5FWQA 1YJDH 4AZ8B 2DKUA 2F55A 1AZTA 2GM4A 4S1QL 2QR3A 4CI0B 3D6GA 4PG2A 1GNSA 2I78A 2QT6A 1DKUA 1XCXA 4ABVA 4HDNB 3ZOKA 4WJG3 4JM2D 4ZYYA 1O7VA 4B6GA 3V4UH 4YMGA 3T5MA 2ZYIA 3MMNA 1I7UA 4ETYA 2GESA 3RYHB 3BGMA 2BFEA 1PYGA 2HWKA 3MBKA 1AACA 3RY6A 1E5QA 2EXWD 3RNLA 2ZTVA 3ILXA 1XF9A 1B8OA 3K2QA 1YZQA 3TQCA 2DI7A 7GPBA 1RMFH 2VP3A 3T1YB 4UT6H 1HTYA 1M71A 3LO5A 2ZSFA 3TVTA 1F3LA 2EWVA 2ZOKA 1IGIL 2DPYA 2C7OA 2NY4C 4F7EB 1KXQE 5IJVA 3LUFA 3J07A 4NG4A 4DLSA 4DA6A 2E18A 3MJCA 3WNIA 4GW4A 2SNIE 4XPHH 1RYNA 2JFVA 3JQBC 4YXWD 1VPWA 4K9DA 1QHHB 4LCYA 4J16A 1OF2A 2CF5A 4HY3A 4AUNA 4NYMQ 1SXCA 3UK0A 4P82A 5FLXA 5AUPB 3VG9B 2XHNA 2E75C 4Y0VA 3ZY3A 1DLHA 2PR7A 3A1DA 1BOOA 4DB2A 3GEBA 3OOHA 1OZHA 2P2YA 3V2AR 5D7KE 2JKWA 3VUEA 1BMZA 3QGVA 4DMCA 1SOXA 5D72L 2WHRA 5C08D 2CMHA 4HLJA 2XKBA 1TTPB 1KBBA 3L3IA 3L4WA 5A6LA 4D74A 2FKNA 2JBAB 3LHKA 1W47A 2ALJA 5FL3A 1BQ4A 4II2A 4PLOB 3WKNA 3ND9A 1NQXA 3FRPG 4P5TB 4CTJA 5JNUA 1SO8A 1X0XA 4BJHB 3LNDA 7REQB 4HK4A 1JHMA 1AO7E 3BBLA 1KC3A 4PSVA 4JKPL 3FMGA 2B0SH 2DCMA 5HJ5A 2LABA 4YPGB 3BA1A 3DE3X 5ESRA 4FUTA 1V7MH 4HZAA 3P19A 4QEKA 2B2CA 5CB4B 5EORH 4GMSH 1ZH8A 4UT7H 3U7QA 2BLNA 4DAOA 4NWIA 4LCIL 2DWSA 2Q2OA 2AXEA 1A2YB 1RZFL 2JJSA 4WJLA 4XNAA 1POXA 3AFGA 2PT5A 1J9RA 2JFOA 3UH0A 3V95A 3H7IA 1SU4A 1M2WA 5BOPA 1DZ0A 1G19A 1NJ9A 3IP3A 3WLIA 2RH8A 2OZLB 4JFXB 4R3NA 2XYHA 3WGVB 4X65B 1RYDA 4IP0A 1E1LA 4IDAA 2KLTA 1CJKC 25C8H 1IC7H 3ZDXE 2P9JA 4WNAB 1OK0A 4N2IA 4GYBA 3V55A 4HO1X 3WKBA 5IXJA 2WMPA 2R6HA 4K3DL 2HFEA 3WGOA 1C7QA 2GY5A 1KAHA 2VTFA 2CB9A 2DSTA 2YJZA 3PRJA 2CLIB 1Y1SA 3HG2A 3GM8A 2VNAA 3QNUA 1ESOA 5JC8A 2VYFA 1PZXA 5LQJA 1M1XB 2R1ZA 1UWXK 1B1AA 3W2HA 3K7UA 3HSYA 3DMMC 4ZS6C 4X6DB 2OV0A 1JI2A 2P9HA 2HLAA 2N1BA 4F24A 4F15C 3COWA 4LKXA 2MFNA 3K0AA 1BQHB 1JD9A 3VD0A 3IXAB 1B42A 4TTGA 3NGMA 3IDMB 3RHTA 1SJEB 2FFQA 1D5XB 3NPZB 3AXTA 1OL0A 4PHZA 4YSUA 4L6IA 5K7SA 2E4FA 4I9FA 5I30L 2BSDA 3DUUA 1WVGA 1K6XA 3Q85A 5FCSH 5DS8A 4HJSA 1ZLYA 3T4YA 4OM7A 2KLBA 3JVFC 5FWDA 1I3LA 4D4LA 3HI6H 3PWPE 2Q1WA 1SEBA 4CVXA 3ZRCC 3PP3K 1MCZA 4UVEA 5TC4A 2ZWZA 3TAXA 5KINB 4Y9RA 5J13B 2XV0A 3VW3L 5D93B 2JIXD 3S36X 2QLFA 1B6SA 5DRWB 2PKQP 1LA2A 3ASWA 4IRZL 3COJA 3BYTA 4J3XA 4UZEA 5D5QA 3MLYL 5DQ9B 3RRJA 1EXUB 5IT0A 3B2DC 3VQLA 4OMFG 1EEZB 3ZHOA 2YQ5A 2HJFB 5JCPA 2O30A 4F9PC 6CGTA 4ETMA 2PW1B 4PBRA 3QR2A 4YFEA 1S8FA 1KK2A 2EYSA 4TL6A 1N8ZB 1WAAF 2GARA 3K6SB 1YZTA 2NSDA 4KXNA 4JKNA 5A5DA 2RCNA 3KO8A 3QIBC 1X14A 4GZ5A 1TJYA 4DQUA 3DX2A 3UBXA 1C7EA 5DWVA 5I16B 5EXSA 3V52L 4ZUSA 3UGJA 2ZFUA 3KBBA 1NI4A 3R77A 2I4TA 3D09A 3BEDA 1Y5LA 1VFNA 3KOOA 5AR1A 5DXFA 2O72A 5JPIA 1UKYA 3BHIA 2QX7A 3TO4D 1D0VA 4DP9X 4LCCC 3O92A 1KTJA 1T24A 3Q43A 3U81A 1WY7A 2LVEA 1DRVA 5E51A 1N4XH 4MMXB 1Q77A 4GZMA 2OMUA 3WXVL 1HILA 1JMXA 4QICA 3SEFA 3GCZA 1T3FB 4FLHA 1E9PA 3IT8D 2KSQA 5TE7H 4L5FL 4XX1A 1ORRA 3S37H 1VI6A 2E4ZA 3T5DA 4WW0A 3V1LA 3GRGA 3MROA 1VC2A 3C8UA 4XP6L 5HI5C 3MUOA 4AMWA 1X7HA 1SMOA 4UTAH 4Q4HB 4GSYA 1N0XH 3S3DB 3HN2A 4FQXC 4NYLA 1E9VA 1FMTA 3KYKH 4MINA 5E03A 5AVYA 3RTQB 1JXJA 5FO9A 5KVFE 1J0XO 1HSBA 3FRIA 2DC1A 4NUQA 5B22A 1SEPA 2PV7A 2PFKA 3RSZA 3NPSB 2DB3A 2ZT9C 2Q99A 4CIDA 2C4TA 4M93C 1U9YA 5GGTH 1MLCA 4MA8H 1UG9A 1DANT 2C3VA 1ND5A 3HDGA 5J2TA 1DXHA 2CO7A 3L06A 3GJ0A 3W1WA 5F5LA 1JHRA 1MW8X 1N5MA 4DOHE 5FOUA 5D1NA 4F1JA 1TJHL 3IF1A 3STVA 4L2IB 5BO1H 4XQEA 2Y0DA 1TB4A 3JAKA 3SE0A 1EXDA 3GJ7A 3Q8FA 3R3ZA 1U3HC 4F1ZA 4H26B 4RKWA 5DWPA 4D7BA 5B1JA 1NZJA 1XI2A 2O50A 2R8RA 4X5WB 5CLJA 4E11A 3W5DA 2AFRA 3BKCH 1DN0A 4DGSA 3QFDB 4EG1A 4D7PA 2RAFA 1NF8A 3TWCH 1SUDA 4RGND 5A06A 3VR4H 2P2GA 5JPCA 1JE1A 4DSNA 1O97D 5LAXB 3RGVA 1K98A 4H1VA 2B83A 4Z7UA 2YD9A 2R8BA 5AOVA 5D1QD 1UPUA 4KPUB 3I5YA 2E3VA 1H94A 4V1CB 4CR8A 3A3YB 3DIVA 3SY0B 5JA9A 1JNNL 3AQ4A 3L79A 4FQ2H 3PUIA 1NIPA 1EUUA 2Y71A 3SBDA 3K4QA 4L27A 4P2RA 3PZRA 2WP3T 2GUGA 1ZINA 1MEEA 3DLTA 4NL4H 3RUDA 2WJGA 3TSYA 4LISA 1FL3B 1JYXA 2VP5A 3MA7A 2YZ2A 1BU5A 2B1GA 4LL4A 2VXSL 3FUFA 2B4RO 1B74A 2E0PA 2ZSUA 2GI7A 3EO0B 1KS9A 2LVCA 3KBEA 4HIEB 2UY7B 1BJ8A 4NKOA 1QGAA 5FYJD 1ZR2A 3BPNB 1N33B 4KXMA 2QJWA 2XDHA 5DJ8A 2A7QA 4I4NA 4XVUA 4RM2A 2AQ2A 1XMOB 3FN0H 2RH0A 1I7PA 2DKFA 3EQZA 3SWWA 5BQ5A 3HR5A 1CS0A 2XQFA 3GFRA 4PG8A 3L1GA 4NZRH 2OQJA 3ZJVA 2IS4A 1B4LA 1NNEA 3RWOA 1DQKA 3FPAA 4JPVL 1TC1A 1DTSA 1OVGA 1XSKA 3NONA 3OJDA 4R96B 4DKDC 2H1IA 5AOMA 3GLRA 1W2KT 1JA1A 3TIEB 3FI9A 3NRBA 1DV1A 1FYTB 4LSWA 4FXGC 1AE1A 4ZI2A 3VWKB 1I7RB 1UBMS 1SOUA 1JU9A 5C0RH 2AD1A 3PWTA 3GRCA 3JT0A 4OGXL 3ZU8A 2P78A 1XF4A 3BDBA 1QW9A 3RSHA 2AGVA 5TDPB 2B5IC 1MJFA 1V4NA 3M6VA 2N3JA 1WBXA 1BA2A 1REQB 5LA6F 2ZWOA 4I5EA 3GGGA 2XVBA 5F0PB 2ZKHH 2RK4A 4IVPA 4MK4A 1EGJA 1OZAA 4PONA 1KIFA 1P84J 4R1NA 1S9VA 4E5DA 2BM8A 4EKYA 4LNRB 2DG2A 3CVHL 4N0UA 3E3AA 4BMOB 4JFDE 2DM4A 4W9ZA 1VL2A 3OKEA 2I29A 1ZSVA 3UJNA 4UVDA 5C3UA 3SHSA 4OFWA 4DDTA 3IPXA 1MUUA 3KXKA 1Y3BE 1OP3K 4EENA 4OXIA 2V2WA 4FMPA 1FN4A 1BHO1 3DMHA 1KTIA 4NBXB 3RVMA 4WKBA 4PLHA 2X2HA 5BVHB 4J49A 1OCWH 2IDMA 2IV7A 4ZCQA 1HL3A 4R01A 1UH3A 2Q2WA 2V03A 1A7OH 4WZAA 1AI1H 1HDGO 5HDQA 2YVUA 3W56A 2DUJA 4XIGS 3JQ7B 4K5PA 2XTJE 1YJ8A 3H0TA 5IAAA 1R17A 3SSMA 4MRRA 1YJDL 4B8ZA 3QYCA 3FCYA 1R9FA 1YI8A 1NNLA 2DJIA 3TSAA 4WHTA 1GRVA 4MA0A 1LPNA 4BNFA 3L7DA 5LPNA 2FT8A 1N2RA 4TMWA 1F0PA 3V4UL 4FI7A 3GSNA 3ZC3A 3B38A 2ZJFA 3FWPA 3SQNA 3DEZA 3AEYA 2DP4E 4CV3A 3CWCA 4NJ9H 1CUOA 5CR9A 1J1IA 1NANH 4LRNL 4CKEA 3O9WB 2Y6SD 4GZLA 3W81A 4PSRA 3AU1A 5L2KA 2ORIA 1RMFL 3F04A 4HYQA 3R7AA 5KAQF 3IJ5A 4B1FA 1T9GS 4NNXA 4DC0A 3DX8A 3A4LA 3CLTC 1HK7A 4MB3A 3DLAA 5JQGF 5EXEA 4ZAKC 4E42A 3TYGH 4CW1A 2C9AA 1ZVYA 1YQUA 3RJOA 2E76C 5JR3A 3BI9X 4XPHL 2R1XA 4FCAA 3ZE1E 3HBLA 7YASA 5JDCC 3ICOA 2B35A 4XMKL 4P2QB 4Y6GB 4N6QA 2EQAA 2IIJA 1ZOSA 1Z9BA 4PB9H 5IGXH 1T0HB 5D7LE 4NDMB 1VLLA 2VP9A 2JB9A 2ZAHA 4M29A 1NQWA 3KDPB 4HXFB 1X7GA 4WI0B 4FZ8H 1SUPA 3GMLB 4DLYA 1FMLA 4LFAB 4CNIA 4CJ1A 4QJ3B 4QF1B 1QYGH 4J8PA 1ZUD1 4XPGH 3RYFA 1GVIA 4JFFB 2WOYA 3F1LA 1MHEA 3E8XA 1OC2A 1VCOA 3ZHXA 4DHEA 1T1IA 3NTUA 2F61A 3QXWA 2E21A 4WWOA 1ZD9A 3HW7A 4UU9B 4KR0A 3E5NA 2B0SL 5EBWA 5JH7B 4KGJA 4IX9A 2PO6B 3C3XA 4DF3A 1V7ML 2V7PA 3SDXA 2IBZY 5EORL 3TJHD 2NPFA 4YALA 2P65A 1IIIA 5AYTA 3A1TA 4UT7L 32C2A 1XYGA 4NDAA 3GEGA 1FZMB 5HJDA 3OPYB 1M34A 1BFOA 1I85C 2BY4A 3RIFK 2ZSIA 5AQ0A 4BO4A 5AKYA 1EE9A 3BMNA 3ZE1F 2HKIA 4GH7B 3U5TA 3W8FA 1YQ2A 2JCCA 2OQRA 4DHWA 1UBTS 2G0LA 4GEKA 4F58H 2AXJA 1NQVA 1C5CL 3SYOA 1XH0A 1BWRA 4C5CA 1IKOP 3MR9A 2G63A 3SY6A 1RWPA 1YZ3A 3I3EA 2QTZA 3AHIA 1M7IA 25C8L 1IC7L 4HS6A 4QHSA 1ZJZA 4WHYH 2APWA 4XCCH 2PZAA 4AUJA 3BIJA 3T6VA 4QL3A 3ULVE 1AIZA 2FEWB 4JJ8A 5DHPA 1MG0A 1F8UA 5DN6D 4Y98A 3ANNA 4N0RA 2JHGA 3A6GA 1JIVA 4G65A 4XWOA 5DJ2A 2NY0B 5F9JB 4NKRA 2X6UA 3B2XA 2DL9A 5FM5M 2GTZB 4L8VA 3HY3A 1ULVA 4ZMSA 3T65B 3L54A 3KPSB 4HGNA 1ZK9A 1NMXA 1E2VA 2DOKA 5FYLE 2P7TB 4NO5B 2AFVA 1D7DA 1HU8A 3ILEA 4KK6D 3ODGA 4L8BA 3ZTWA 3S96A 1KO7A 4FLSA 2Y1LA 2FWMX 1ILUA 1MCIA 5F23A 4DP4X 4X0KA 5DZNA 2VJCA 4LHWA 1JZ2A 4OFYD 1OPOA 3PFCA 1DJIA 5KYNA 3VYWA 4TTSA 3PNPA 5AKXA 2VZOA 4R2HA 2PWZA 4QGSA 1H65A 2QXUA 3MJ9A 4FYYA 2HZ7A 4W82A 4B4KA 1OLSA 3HI6L 4MVBD 4PX9A 4TKMA 4Y0AA 4FD3A 2Q3JA 4A8PA 1WW8A 3FQXB 4H3VA 4U7FA 4JUSA 4U6YB 1JNJA 5LUMA 5K0CA 4YJGB 1FFPB 4QC2A 4TTRA 3WFEH 5IQOA 4DV0B 2P5ED 3FNEA 3B9KD 1T2NA 4ANXA 3QEJA 4F2FA 2X28A 2KWIA 3B5GA 1R6BX 3GY0A 4KTTE 3D4OA 1DO0A 2I6FA 2R60A 1WV7T 4D8YA 2BNQB 5ICXB 1XGRB 5FQNA 2BFGA 4NAHA 5CCJA 5EXPA 1M7BA 2J6BA 2C3GA 4PRIE 1H8OA 1GZ4A 5ER9A 4PJFA 2IY8A 1BFUA 4K15A 1PBTA 1XLWA 3HE6A 4XDYA 2H1LM 1JTTA 4ROTA 2R47A 1EAPA 4NX0A 2NY5H 5HUHA 3EMBA 2C2GA 3FYDA 2GA9A 2FEPA 4HJXA 1GTRA 1SCUA 2HRCA 4UARA 2Q86A 3CZLA 4FKBA 1EFKA 2GZ2A 3K9WA 1N4XL 2EFDB 2G8LA 4NECA 4XZUB 3PSHA 3Q11A 3KM1A 1L4EA 1C8KA 2J1KA 2AEQH 3FTNA 3T5AA 1JIKA 4D3DA 3TFBA 3ZKND 1NAMH 4WWNA 4QDUA 4YZWA 4HDMA 4U0QB 2VDUE 1YNTB 5TE7L 3CQFA 2JELH 1GSOA 4IOLA 4FS3A 1SQFA 3KVRA 2QN3A 4M0DA 5GSVB 2XAUA 1X7SA 4UTAL 1EP2B 1T0JB 4Y9TA 2J6CA 3TLJA 5FYJH 3V0EA 4I50A 3PLAE 3KYKL 2VAAA 3VFTB 4H2DA 4X8GA 2IIVA 3H9BA 1GSHA 2D7DA 2ENWA 4J7XA 5HQ3A 1EA5A 3P3YA 1UADA 5DGCA 4QNPE 1FDWA 1UODA 3N2ZB 1Q1BA 5GJCA 4X7CC 3CBJB 5E2JA 2X9YA 5GGTL 2J5RA 5INTA 4MA8L 2CIKB 1BH2A 5FM4A 4BQBA 3PEFA 2GEEA 4YP6A 1O9WA 4JFAA 1JLLB 5KAMA 4RMQA 5CGYC 4TMKA 3NWJA 4DR1B 5BO1L 2EHDA 5D7SH 1UZGA 1A8SA 4PJ9A 2WTOA 1BMGA 1JZQA 1FSSA 4QG3A 5CLZA 1RXEA 4J0JA 3DV0A 4GPZA 1B88A 1UC4B 3DEIA 1NVMB 2AJ8A 5JY1A 1N92A 3EOTH 1WHSB 2B4CH 4M7RA 4G86A 3PAZA 2AQ3A 5BWLA 1F4VA 1UANA 1QUFA 1E4KC 1H5BB 4QXUH 1QRNA 3ARXA 1UAAA 3BKCL 3TVDA 1HYQA 3TWCL 3NCWA 1X5IA 1QKJA 5ALUA 3EHBC 4ELME 3HJBA 4CDGA 3GJEB 4K6HA 1Z9PA 4MLZA 2QPAA 1IK4A 2ID7A 2MCMA 3DHMA 3TD6A 1N7JA 4HEA6 5B3AA 1ZD6A 2AUTA 3MLPA 1WS6A 1H9AA 3B8SA 2NY1B 1X1QA 5HRCA 4ODUB 4A03A 4U5QA 2J1WA 1II0A 1FNEA 4PLTA 3WIIH 3EJSA 4FQ2L 3S8GB 5JSHA 5BV7C 1ID5I 1IAKA 4P38A 2Y25A 2GK4A 2J12B 3C1AA 1QEWB 1C9NA 3W5NA 2BEWA 3LQFA 4YDQA 4RY8A 4BU1A 3PIQA 4YXKH 5LB1A 4K8RH 2X10A 1VZIA 2DDQH 3IBOA 3K3QA 4KROB 3T4AC 2CZGA 3N3BC 3EBHA 2IDQA 1P1HA 4QYSA 4DEUA 1U0GA 1TMQA 1T7XA 5GRWA 1QCCA 4EL0A 1WT5A 3AY4A 3W5MA 1UFKA 1LC0A 3FU9A 1JR3D 3MC0A 1YDGA 4U1GB 4U7GA 3N9GH 1WEHA 1KEWA 3KFLA 1X1AA 2IODA 3FN0L 3X3FL 3TR5A 2G72A 2GBLC 3EG9A 3ZDAA 3O4LB 3EF4A 5F3BA 2FBOJ 3QIWD 1QJCA 4NZRL 3N41F 3KM0A 1QGUB 2GK3A 2O20A 2HNKA 1XNRB 4TNFA 3CCCA 1IVLA 1H1DA 3P0YH 1AGNA 4PWKA 4E70A 1J0DA 1GDTA 3IA2A 3IFSA 4N9GA 1BFVH 3CNNA 4FM9A 5G0UA 3V8NA 1WQ3A 1RE0A 5BNFA 2WQ6A 2X9VA 4KSYA 5C0RL 3UG5A 2XPZA 2NX5D 3BZ4B 1OXTA 3RVQA 2PA3A 2JASA 1VKJA 3QDMD 4BKLB 5FHAH 3SIPA 1A6UH 2Y77A 1QLRA 3FFDB 4U8HA 3EB9A 4QECA 2JV6A 2HTEA 4F7DA 2ZKHL 3F83A 4LGPB 3JW8A 5DW3A 1KOJA 5EEVA 3OTWA 4FNAA 1U90A 3IAXA 2Z35A 2I9PA 1KH1A 4G9DB 1XN4A 4OBXA 3DHPA 4OKSA 5G4OA 1O89A 3IP8A 5A2QA 3S8YA 4MDIA 3EDEA 4G5RA 5KHOC 2ISQA 4R31A 4Y2DA 3OJLA 1C5BH 4FD2A 3V8OA 1FYDA 2V7VA 3ANYB 5DK4A 1D3CA 2PYEB 2W2LD 1PR6A 3ICWA 4CQLB 4XKJA 5TQ0A 2DQTH 4Z5RB 1RCFA 1C29B 1A7OL 4GBXA 5AP9A 1AI1L 4GSDH 1PJRA 3R9XA 3PICA 2JJUA 3Q6MA 1M6NA 5LIRA 1RS0A 1Z5VA 3G2LA 5AYQA 2P1RA 1TX4B 4WL0A 3EDOA 1E18A 2BHZA 2X4RB 2Q8NA 1SD2A 1KCSH 1WCBA 4NOLA 4XIJA 4EBFA 4HJEA 4TLAA 1QMUA 2EGUA 4U6NA 3H11B 2Z1DA 2Z83A 1ZD8A 5IFAH 4GOJA 2AUNA 2A3RA 3EF1A 3RS5A 4XMWA 2HSWA 5BORA 4N6RA 1G7MB 1IQPA 3B52X 1U33A 3H17A 1C0KA 4RA9B 3QA3B 3TB4A 1KO4A 1MJ7H 3L43A 2WM0A 4OI8A 2ZJ8A 4NJ9L 4FNOA 5KJ7E 2RHTA 3UBTA 1UIRA 4DT1B 5JIHA 5KTKA 2GILA 4E3WA 3SYMA 4L4SA 3AT9A 2VR3A 1N2OA 4LRIA 1DTEA 3BM5A 5A0FA 1YHZA 4GXRA 3NHSA 3A4EA 1HE3A 1Y1KE 3TYGL 3R5SA 3AUUA 3RI5F 1ICTA 3PQ4A 2ZB8A 3WC4A 1ODUA 2Q3FA 3EFFB 4TSFD 5JASA 4YR6B 5HGDA 3RWJA 4QVGA 1ZE3H 721PA 1V7PC 1HZZC 2GR9A 2ZSKA 1WMEA 5E6YA 2AH5A 3U9LA 4Y2TA 2CB0A 5SYMA 4F38A 1ZK2A 4J3TA 2J8ZA 3X2SA 3RIKA 5TF0A 4PB9L 2PVPA 3DX7A 1QFZA 4J6FA 5IGXL 2WQ8A 1WXHA 1WE5A 2ZZNA 1B3JA 2JRCA 1YCSA 1LEKA 2D1FA 4P31A 4B5LA 1JEQA 4FZ8L 2XWQA 1NEZA 1YQ9A 5T1MB 2FIKB 1CTNA 3QUML 3R5TA 1XB6A 4KXUA 3JV4A 3UGQA 1WU7A 2QX6A 3UDWA 5FM8A 1NGZB 1RI8A 2H3KA 4PVLA 4UOEA 3U7JA 1WD9A 3ETEA 4K5LA 5EP1A 4XPGL 2AL7A 4RHTA 1G5IA 1J90A 3OJEA 5FI1B 3BILA 4HWRA 3W79A 3ZQJA 1AY1L 2O7VA 1TMOA 2X77A 4RD0A 2X2UA 3FO1A 4D8PB 3PNVA 2AFHA 5GSRA 3BIXA 4QAQA 4M6NH 4N8UA 4H7IA 2HX8A 4BMCA 3KPWA 3FUCA 4H1HA 3IDNA 2IH3B 4C0SA 4Z76A 5TGBA 2R7LA 3K31A 4MAYB 3G7NA 3R06A 4E94A 3GSRB 3BHBA 2N47A 4NYJR 4JM4L 4YSRA 1M54A 1BDBA 2A5LA 2E9JA 4HLEA 4PCLA 4GXUM 3KD4A 5C7ZA 1RPJA 3PRYA 1XD0A 4KKVA 1IWBB 1V3MA 5IV2A 3H9HB 2C2XA 3KLMX 4PXYA 1XO1A 3HA7A 2XB8A 4F58L 2J6EH 2CXOA 5I01A 3P9WB 1U0QA 2VUUA 3DGGA 3KJ4B 4WKNA 4JKYA 3UT0A 3NJ4A 5I1HH 5IC5A 2CNZA 2HOQA 4XCCL 4II7A 4QHMB 2R9VA 4N0FB 2C03A 4PXAA 4UQDA 1SK9A 3GVPA 4LHSA 4GOND 3UFXB 2BJVA 2J55A 4ZVOA 1RHMA 4P8QA 1PT8A 2DMRA 4UU1A 4R0VA 2WWMD 3OZXA 3QT2A 2C4NA 3MYJB 3V4VA 4EA6A 4C2AA 2Z6UA 3AB3A 1IAVA 1GRCA 4RVBA 2K6GA 3WK7A 3DD1A 2OBYA 1W6LA 3SLRA 2ADYA 1J8SA 5KSVA 1XB3A 3EJYC 1T0NB 1J9SA 3IJSB 3NJJA 3K46A 5GS0C 1NBOA 3VDNB 3FB1A 3KCWA 1L0BA 1CRZA 2C84A 3V0HA 2J9FA 3ZUCA 4DIKA 2XVLA 1FJ1A 3IP6A 4B5EA 4M1KA 3MQ4A 3LD8C 1JT2A 3PLRA 3CZMA 4OCMC 1U58A 5GMOA 1OB0A 5KSAB 2FSSA 2ZT6A 4ER6A 5IVPA 4B87A 4KZDH 3T0DA 2V45A 3QYPA 3HWWA 4EB6B 4POOA 5KU1A 3E1SA 1WY5A 5CXSA 2W07B 2Z5GA 1N18A 4MA5A 2XN9B 4KAJA 2VMJA 2B1JA 3K72B 4N2KA 2O5RA 3HY4A 3GFSA 5D2CA 3ZKXC 4EEXA 2AG8A 4PJ8D 4UPEA 3DYOA 4TV9B 2A5GA 3L4VA 2TMDA 5JYBA 3PD0A 2J5XA 2PRSA 5IVDA 2QD3A 3LS4H 5K33A 4O6VA 1S5HA 2DLIA 3T77B 4FCHA 4IHAA 4UM5A 1HXYB 2NP6A 3L16A 4Y6PA 4DUZB 4CGTA 5MEND 1BKDR 1T1YA 1P81A 4DYDA 4RPGA 3I6LE 4P93A 3ZU4A 1C7TA 5K9JH 1ZK3A 1TL7C 4HDOB 2NY5L 1A1NA 4BFSA 2ZWAA 1X80B 4E41B 3Q5YA 1CERA 3B12A 3PT5A 4NQEB 4EFLA 3C5EA 5I1EL 4WT7A 4L5BA 1E67A 4KPHH 1Q0TA 2DYPB 4QTUB 4LTNA 4FMFA 4MLDA 3MHZA 4CTKA 5ERWA 1MGOA 2AEQL 1C4KA 1PQWA 2G4VA 4KJZA 3VACA 3SN6N 1TM2A 1NAML 4BQPA 3KX2A 1ZUIA 4BKRA 1AXGA 1A5BB 3KTAA 1R9JA 1XZQA 4Y7CA 5I15H 2JELL 1EGVB 3NIBA 2DV6A 1YACA 3ER9A 1DFXA 3NQKA 3K70C 1R3KA 3EEOA 3VZQA 4N3UA 4A3SA 5I8PA 5L7WA 4CFSA 5C0IA 2IDFA 4R6UA 5M7QA 2BW0A 2X40A 2BUCA 4FVTA 2R0KH 4XX1E 3IMVA 5GIOE 1SHTX 3D4IA 3EQ2A 4YX9A 2Z0UA 3UAYA 4ZVVA 2B21A 4BJLA 1XRLA 2C4FU 5HHNB 1YA8A 2ZUSA 4IICA 3ZCVA 1RAMA 3PUVA 1R4AA 2NZJA 2QN9A 3V6FA 1P77A 3JD3A 3F3HA 5CYFA 3SSAA 4LHVA 1CVSC 5CLXA 1SLVA 1VI2A 1NIAA 5D7SL 3UH8A 2CJYA 2Q8PA 5JW5B 4Q15A 4NQCB 1S7XA 3TX4A 3EOTL 2HT3D 4N65A 4FMVA 1TQUA 1I8AA 4MA1B 3OKLA 4LLMA 2CHGA 1MAVA 1AR1B 1HHKB 2Z8RA 2F3TA 3K1AB 4QXUL 4AJKA 3RFZC 2C4WA 3P3RA 3KKOA 3N7TA 3U4EA 1OM9A 2CHZA 5E6SB 1ERNA 1A4IA 2JL1A 4O9HH 1HEIA 2CW5A 3T1NA 4H44C 3MTQA 2AMJA 3G5UA 5BNXD 5TMPA 3IJ9A 4G6AC 4Y9BA 1GTFA 4PFEA 1Q1ZA 3CEJA 1HH4A 4JQIH 1H9BA 5A3ID 3IQDB 3GYGA 2GKOA 1QCYA 4NU6A 4UU0A 4N5DA 3RTDA 4MQ7A 1HSOA 3TW6A 1TTBA 1A9EB 2AQNA 4BGLA 3L3KB 4OXQA