3ZE0B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
465
Chain Sequence
PNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 107
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze0B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze0B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze0B03
2NVOA 1OLZA 1BHO1 1V7PC 1ZOPA 5KYNA 1XDGA 1QC5A 3F78A 4JDUA 1T0PA 1RS0A 3BN3A 4WK4B 1QC5B 3GXBA 1M2VB 1JEQB 1UEXC 3RAGA 4XW2A 3AL8A 1U8CA 1T6BY 5HDBB 3ZE0B 3IJEB 3ZQKA 4WFQA 3Q3GE 1U8CB 3AL8B 3V4PB 1IDOA 1MQ8B 3EH1A 3E2MA 2X5NA 3K72A 3ZDZB 4MMYB 3ZE1B 3OKWA 1IJKA 1CK4A 1MQAA 1FNSA 1PT6A 3BQNB 2VDKB 2NUPA 5KYYB 5KYUB 1MQ9A 3OL2B 1U0OC 4F1KA 1MHPA 4FWWA 1XUOA 4CNBA 4G1EA 1PD1A 3OL2A 3BQMB 3M6FA 5BV8A 3F74A 4GZ8A 1PCXA 4BJ3A 1M2OA 4G1EB 1M10A 5KYWB 5KYUA 1DGQA 4Z7NB 1TYEB 3FCUB 1LFAA 1M2VA 1JEQA 2I6SA 1N9ZA 4HQKA 3EOBI 4UM9B 3AL9A 1IJBA 2VDNB 4NENB 4C2BA 3EG9A 1IDN1 3EFOB 1DZIA 4MMZA 3EG9B 1SHYB 4Z7OB 3EFOA 4MMYA 5ES4B 1ZONA 1FE8A 5KYXB 2NUPB 4MMZB 3VI4B 5KYYA 5HGJA 2XGGA 5E6RB 1SHUX 1YVPA 4O02B 1SHTX 2VC2B 1RD4A 1CQPA 1MJNA 3PPXA 3NVQA 3PPWA 5E6RA 4O02A 4M76B 1AO3A 1AUQA 5E6UB 1BHQ1 1U0NA 1JEYA 3ZDXB 4NEHB 5KYWA 1M1XB 3HXOA 4HQLA 1MF7A 4FX5A 3K71A 1JEYB 4A0QA 3IBSA 2VDQB 3T3MB 3K71B 3FCSB 3TVYA 4NENA 4C29A 3K6SA 4CN9A 1SSLA 4PN7A 4UM8B 4IXDA 3ZE2B 3K6SB 4JX0A 3ZDYB 2NUTA 4F1JA 4WK0B 2VDMB 1RTKA 5KYXA 1RRKA 1QCYA 1ZOOA 3TW0A 3NIDB 3VI3B 3NIGB 2NUTB 4WK2B 2VDOB 3PPYA 2I91A 1JV2B 3T3PB 3HI6A 4IHKA 4IGIA 2UZYB 1XDDA 3AFCA 1N3YA 1JV2A 4MMXA 3OKYB 5E6UA 4HQNA 4HQFA 1M1XA 2P26A 2B2XA 3V4VB 4MMXB 2M32A 4UM9D 4O3TB 4K3JB 4G1MB 1SQ0A 3EGDA 3PPVA 4O3UB 4CN8A 2I6QA 3FCSA 5LN1A 2QTVA 1ATZA 2VDLB 2XWJI 1OAKA 4Z7QB 3NIFB 2ADFA 3EH2A 4C2AA 4HQOA 3QA3E 4WJKB 2VDRB 1YVRA 1L5GA 1JLMA 2VDPB 3EGXA 5HJ2A 5E6SB 3TXAA 2O7NA 1L5GB 3N2NA 3EGXB 3IJEA 1YUKA 2ODPA 1NA5A 2XWBF 1PD0A 5E6SA 2P28A 2ODQA 3EOAI 3HXQA 2WINI 3K72B 2WW8A 3EGDB 1AOXA 4G1MA 1M1UA 2ICAA 4DMUB 3TCXB 1Q0PA 2IUEA
chains in the Genus database with same CATH superfamily
1VL8A 3BBPA 2ZBGA 2X8JB 1AFVL 1U3HD 1YQEA 5LCVA 5ALJA 1QLJA 3W1ZA 4LE2A 1IHXA 4IJVA 3NYIA 4S1PA 2ID8A 3W39B 2ICEB 3QWRD 2OBFA 3USES 1NBYB 4H7PA 1LDSA 2GABA 3MLZH 3TQSA 4E5DA 3I0NA 3X1MA 2LLGA 5K4HA 1KTLB 4IKKA 4Z7NB 2CLSA 4ILKA 1KC3A 5EVCA 3DB1A 4MV8A 4ETYA 2ZIXA 3BD5A 3LKVA 1MKFA 4M0FA 3L9YA 5HGHA 2ZKXA 4HIEB 3LHSA 5AVYA 1IGTB 1M0EA 5U1PA 1IBBA 4J7XA 2J88H 5A3SA 1QLRA 3HPJA 4P23C 2YN0A 3JZFA 3F4KA 3J7AC 4LHZA 4CFZA 5DHUA 1Q84A 1DKNA 1NPUA 2A4EA 1WC7B 4OUDB 3WLWD 2XHNA 4R9VA 1HWGB 2BNRB 1GXSA 3TQOA 2XI9A 1NUGA 2ZXEB 1ABFA 1WW2A 4G8EA 4CCSA 2NSYA 1ZLVK 4KJPD 2D00A 4LNRB 4OGFA 3MV9A 1XCQA 4YUXA 3H0TA 4QEDA 13PKA 3HMKA 2NY1C 1XCJA 1L5YA 2H2HA 2QVZX 2AI2A 4BECA 1P5VA 5UKDA 3O6LL 4YT2A 3L7CA 3K5WA 3A3YB 4QPCA 3KYOB 1G38A 2X3AA 1V95A 3KLAA 1A6UH 3BKWA 2X8JA 4B73A 1KF9B 2BZ0A 1BZ8A 3HC3L 821PA 3NCFB 3ZI7A 1TEGA 2YWBA 3P4UA 3RV4A 1SZJG 4MRSA 2OO5C 3L05A 3OFSA 1AU9A 2X7XA 3HN5A 2O06A 3DETC 4NP4L 4M61B 3TNMB 3SC2A 1Q0XH 1ERNA 2NY3B 3QW2A 1E69A 2CO3A 3WP1B 1I1HA 1Y7TA 4R0NA 3UUGA 3JVFC 4IRZH 3IQIX 4GEKA 5D7SH 4NYJQ 4N86A 4B3SB 3JW8A 1CRQA 2J3SA 1GZ6A 1UBGA 2BZSA 2X3UA 5F3FA 4ENED 5GVRA 1KT2B 2P68A 4PG2C 4PG9A 2JFPA 2VN7A 4NV0A 4J3BA 2W0PA 4JZNA 1D7CA 4EW2A 5DC4B 3UMTA 1TK2A 4Z7NE 2FXVA 4QJ3B 4OFYD 2DPXA 3KD4A 3DV0A 4PZZA 5F2KA 3T5CA 1XGYL 3BZFA 3VPAA 4BQEA 1ZTXE 1QFZA 2QUJA 2V8OA 1OBOA 5DTFB 3SR0A 5E6UA 3O47A 4IOJA 2Y6SD 4GMKA 2O61B 4JLBA 3EA5A 2RARA 2IAND 2Q6LA 1XEFA 3W4KA 4CKCA 1EK5A 2X1XR 1Q92A 1SMKA 4B76A 1L8OA 1JMXA 3F6RA 2EIDA 1CJBA 3S2ZA 3UM9A 3JQFA 4IWXA 1NJFA 5JCJA 4P59L 1G7PA 3LN5B 1ZOXA 3REQA 3VSDA 3SY8A 3WL8A 1YJ8A 2GLUA 3TWYA 2OW6A 2IHBA 4JG0L 2D9CA 4JL5A 3WXWH 4G97A 4XUCA 2LABA 1BXVA 4OQMA 4L07A 1LCIA 1EEYB 2WJYA 5GZOA 4PS7A 5CW2A 4PSVA 5IFKA 1ZKMA 4NPHA 4MV9A 3TL3A 3TO4A 5EU6A 3BH9A 2PMEA 4WNJA 1W4ZA 5KOYA 1SUFA 4FMCB 4Y9UA 2XYRA 4M8LA 1EWHA 4Z3JA 4NXKA 4K7PX 1W36C 1VPEA 3RHTA 3RFTA 1DPFA 5C0OE 1GUAA 3OBBA 2IGTA 3AUUA 3ITNA 4XMZA 3T3MB 3DVFA 5EZOL 2J8UA 1EH9A 2BELA 3MLXH 1JFQH 1SEBB 1OI7A 3MYJB 3AY7A 3ZWKA 2Q5LA 4CM5A 4G0VA 3K9HA 4IJQA 5D6CB 4LOUD 2V74B 4ZMBA 4LCBA 5AK4A 3V0FA 1AO0A 3C85A 2B1AH 2P11A 4Z77B 1ZXQA 4GXNA 3ABQB 3IAXA 3BPNC 3P20A 2GT1A 5EEGA 1QQ5A 4G5SA 2O2IA 3IUMA 4EHBA 2GO1A 3I9MA 2XWRA 1R66A 2CHDA 4Y2DB 4N0YL 4CF5A 1OAYL 4JX8A 2W58A 3WL3A 4CMBA 2B94A 3WKPA 2BGLA 2ZB8A 4ZV4A 5HJBA 3NPSB 4UHCA 1L0BA 3RBSA 4R4ND 3AAZA 2V17L 3ARFC 4EO9A 2WZ6A 1I3OA 2Y1AA 3AZQA 3H2PA 1SQSA 4PY8J 4WZBA 2CO6A 4NN7B 3PWVA 2IHZA 5BOSB 2ZI7A 4WXPA 1Q90A 1RZQA 4L73A 4J4PA 2CJPA 4OHKA 5MEQA 2PO6D 2OHVA 4YL4A 2BCEA 4AGQA 2IBGA 3PPEA 5F7MC 4F97A 1ZK9A 4J39A 1X70A 3RG1C 1ZVYA 3A8TA 2J6WA 4L85A 1DTSA 5A7BA 5DJ0A 4GRLC 3EC1A 4AO8A 1X9RA 4EUPA 4PJ5D 1U2QA 5L3VA 1OCRB 5A3IC 5IFHL 3LFUA 4MWEA 2IDKA 1BE1A 1R6AA 5JQWA 5HGJA 5CP7A 1S8NA 4I4NA 5EDSA 1M7IB 2ZUQB 4RPCA 3SE8L 4CM1A 4JB3A 2F48A 1BMDA 4FLEA 1BIHA 3CC5B 3B34A 4Z95L 4JFEA 3MYJA 3ZY6A 3WV4A 1J06A 5DD1L 2QYHA 4OFPA 1MCPH 5L51A 1Q3KA 3A04A 3EEFA 2JJSC 4R5XA 1KO7A 5TGTA 3AKZA 3RRXA 3CKLA 2C9CA 4PSCA 1PEDA 2Y0BA 3L4VA 2G0TA 4RL4A 1LEGA 4DMGA 3OCXA 1WZAA 5DUPH 2XUIA 5C0DA 1KMNA 3KTAA 3WXBA 4F58L 3SBDA 2NT1A 4TXMA 2AVGA 2GI7A 3WFCL 4OHYA 5ESXA 4MHOA 1DT5A 1HZJA 4Y2DA 5JNLA 3QIUB 4CQNA 3QJQB 2IBBA 3ZTTA 4LHUG 5LMUB 1U8KA 3TJPA 3MB5A 2FTKE 4FCCA 1OREA 1IAOB 4NQVA 1U3GA 4TNEA 1NXSA 2F3SA 4UE6A 4FZJA 5BOSA 1PTJA 4MDRA 1PS8A 2FJHA 3WMFA 1A4XA 4D9MA 3BZEB 5ESQA 4YASA 1GGFA 1SVBA 3CZFA 4CILA 1KCKA 3K72A 4EZIA 4L9WA 4R51A 2AJUL 2PL5A 3UC5A 3M89A 3DBHB 3GIWA 3L6FB 2J20A 2BR3A 1K2WA 3N8GA 5DT9A 4XCFL 3PAYA 2B14A 2FF5A 3VFUB 1XK7A 2BJHA 1G5GA 1FNGA 4AENA 4TRRA 1P29A 5KO2A 4Z7VF 1CY0A 2VXTL 3DPSA 1W4RA 4BH8B 3BGMB 5DP1A 3QFSA 3SDXF 1O7DE 1AM4D 4X97A 3HRZB 1B8UA 4HYQA 2W6CX 4O4HA 1BX3A 4I9NA 4JPVL 1BD2E 3S5LG 4Q4EA 4UCXA 5GS1C 4HR7A 4LMPA 4NOBA 4G5FA 3LEVL 1MWAH 4GI7A 4UEQA 4H6XA 4DHWA 1AC0A 1N64L 2IH3B 2Y7SA 2R00A 4ZTUB 4ZO4A 1K8DA 3KR2A 2K4AA 1YPZF 1AS8A 1ORVA 3WIEA 4KGJA 5KZCD 5FAAA 2TECE 4MMXA 3DBXB 3L3IB 4XPFH 4C04A 4L4VE 4DTGH 2FDCA 1G6KA 2OI9B 4AUUA 5KVGH 3TO2B 2PL9A 4RZKA 3HBZA 1GITA 5EZYF 1A9SA 1V11B 2VTDA 1L9NA 3RRJA 3PCYA 1DCLA 3KV3O 4MYUA 4LOLA 3GSQB 3M9LA 3A2LA 1JB1A 4IRXA 2LFGA 3RIYA 4GXVL 4LFHG 1KI3A 2IELA 1IEQA 5CT9A 3MBXL 2VMFA 5KZCB 5KTMA 4TRPL 1K3ZA 3AYZB 2IPLA 3CK0H 4H5SB 1EUQA 1JQ3A 3OZKA 3VFMA 2XE6A 1BZDA 1AO7E 1PR6A 3OEHA 1XZFA 3VGHA 3IXQA 3LHIA 3EDEA 1EBUA 1DKMA 2UWEE 2BVEA 3CPSA 3RHFA 5LZ9A 1FNGB 2BY2A 2PQ6A 3CWGA 5KVEH 4P3KA 2JK0A 2FEDD 2IUFA 3ULUF 4DLLA 2BFOA 4YP9A 2H3EA 2A38A 1AXTL 2QMKA 3FTFA 3BHMA 3KXFD 5FGCB 3M6UA 5A1TA 5HKOA 3BUIA 4W7HA 4NZUL 4EF4A 3ANNA 5IKMA 3N39C 4IPTA 1JTTA 3FM9A 4ZYZA 3KSZO 3VGJA 2V9ZA 1WVGA 4UZSA 1PGOA 3Q9LA 4PFJA 5I0ZA 4PRDA 3Q1SL 4JP5A 2V33A 1H0RA 2E85A 2A5LA 5FLYA 3UC0L 3LCJA 3U44B 3EGVA 3BFWA 2WNSA 3KW7A 2WFAA 4WXRA 5K0SA 1E7RA 1IGYB 1D5BB 4P5TD 5FYJD 3TZEA 4NO3A 2OV1A 3O3AA 1L6IA 4H31A 5BSTA 3OKKA 4UQ2A 1XGKA 3ULUL 5E6SB 4PQXA 3O2SB 4X6UA 1A82A 3IHWA 5E1HB 1KK2A 5D1ZA 5BPHA 2YAEA 5IVXB 2V0GA 2XUAA 3FNFA 4JFTA 3V6ZA 1GG5A 2A4KA 1KU6A 2O5XL 1SBCA 3HCFA 1E9PA 1UXWB 4J16C 1E7VA 3I5XA 1BVLB 1I2CA 4K1XA 4WOCA 1H2HA 5LPNA 3T1OA 1JHMA 2C34A 2DQCL 4OLYL 4F33A 5K01A 4Y4HD 5HYJB 4UOEA 3ORFA 1XR9B 3HKDB 4OGZA 2WKWA 1WF6A 2JJVA 4F5DA 2XBDA 1TFRA 4P53A 4PP1D 2YK1H 2FQYA 3A6FA 2I2WA 1YDPB 1ES0B 4HUKB 5IMSA 1H2AS 1HQDA 1DO5A 3H4IA 1MIOA 3AUAA 1U3JA 3RWOA 3VJLA 4JSRA 3ZXUB 5INDB 4DNOA 4YSRA 3F00A 2HL6A 5C9JA 1SKMA 1CJMA 3UAJA 3UJJH 2BEWB 4QRDA 1LMKA 3NSDA 4YAUA 2NRDA 3MK31 3GFPA 2BHUA 3ECWA 3ILYA 4LHWA 2Q7NA 3NHJA 4UD6A 1NOLA 1SQ5A 3OESA 4AQEB 4FBLA 2PG3A 2GJKA 4HQ0A 1TETL 2VSMB 3L1UA 1ITCA 4OAOA 5K3EA 1RI1A 4DCPA 2HQ1A 4CMMB 2OQIA 4CM6A 5TQJA 1A7JA 3MODH 4FHEA 4BMZA 2Q7YA 1H6TA 4BV9A 3VXUD 3W9BA 2UXVA 5EF2A 1UWEH 4JFOB 4MD4B 5B7PA 1GGVA 4TMPA 3NDZE 2WKQA 4UHJA 2NAFA 5HKAA 1UBTS 4FE3A 1Z2PX 4Y2OA 2XUKA 3M1IA 1W8OA 2ZJSL 1QLEL 4PGDA 3DJZA 4J1NA 3NCYP 3BUDA 1TYDE 1RUMH 2Y07H 2EDKA 4ZI8A 3SOBH 2A8YA 3IHTA 2ORBL 1CF8H 3TMYA 5J59A 5A3QA 2WSKA 3P1JA 3U83A 1I1RA 4UWQB 1A97A 2A5GA 3SJAA 4R1MA 2D3WA 1JIJA 3CVUA 1OC4A 4HIQA 4X8CA 3ZCTA 4KJYB 5I1KL 4R1QA 3FT1A 4LCCB 4LLDA 4HV4A 4B3JA 2HPAA 1KBGL 1JIBA 5GGRA 1MOZA 4W9MC 2FIRT 3D39A 1LSSA 1WWKA 3IA2A 4IGAA 1C9NA 1QASA 2AQ2A 2O5ZH 1HJCA 2B8OT 4K87A 3G8DA 4HKBB 3WIFA 3GRVA 4WWKA 3K9FC 2C7VA 4BRSA 2P5TB 5FTKA 3K6NA 1M8JA 1EMTH 2GJJA 2WMPA 3F01A 4YUYA 5D72L 3BZ5A 3HG1B 2CHUA 3U4DA 4WCVA 1JK8B 2Z9TA 4DGIL 5B1BB 4LWPA 5DT1H 3K53A 4EX6A 3IIJA 3RU3A 1IPEA 4U00A 4TTDC 1R4MB 1CFVL 4TTTS 2J56A 1ZGHA 3QUZC 4AWXA 1T0PA 4C56B 4LQFL 2FW0A 1RD6A 4WENB 1UP6A 2FV8A 4TZKA 4OLAA 5CJJA 3U17A 1BG6A 4YRZA 1R10A 2BTEA 4KV7A 4PJFE 1XLTA 1GSIA 3DVNB 4RQTA 4AIIA 1X0XA 2GZ1A 3GMMA 2IZ6A 5JSKA 1J87A 1E4KA 4Q1VA 2RGEA 2G9HA 1CFMA 4XNQB 2C2WA 4DP6X 4X7FC 1ZOLA 3R3JA 2J6CA 2D0OB 5BSUA 2HWXA 1SBQA 1HOCB 5HVNA 3OG4B 3U79A 3V5NA 2ADJA 2B1QA 2EZTA 4FMDF 4MA4A 3GMNA 1MNUL 1NZFA 1JLKA 2ZRIA 4F7MB 5EHNA 5JMOC 3MTBA 1FVCB 1UPXA 1KGYE 1ZK5A 3BYZA 4KK8D 1CDHA 1EANA 1P7PA 1ZR2A 1W93A 1XSOA 4XIGS 2V7HA 4KRNA 3F46A 4QBKA 2JJTC 2OBYA 2DKMA 2DS4A 4BV3A 3ZHZA 4WCYL 1SXZA 3P4YA 3F6EX 2EE2A 2CXKA 1RXYA 5ICCA 1P5JA 1ELOA 1B4TA 1I85A 5H3HA 3BH7A 4XPFL 5ICZA 5DFAA 4TVOA 1LK7A 1MAMH 4M8SA 3B3IB 4PBVC 3A1SA 5FO2A 4K9SA 4FZRA 1WBJB 1P0CA 3RK4A 2MOVA 1W0VA 2G75B 3HC4L 2CXQA 1T9GS 2PKQP 1ZUNB 3ANMA 5FXMA 5I8ZA 3FH0A 3B1VA 2O30A 1FNSA 4DLZA 5TGBA 2PS9A 3ARBA 3RV3A 5B6IA 4G1EA 2PN5A 2AJDA 5AVJA 4GZ8A 3GP8A 4CA4A 4AT1A 4OCXH 3UCRA 3V48A 3QE5A 5KSBB 1W2WB 3JTTB 2JGLA 1URPA 3FPEA 5IOPA 2XV0A 1BAWA 5DO8A 4N5EC 3F12A 1NNLA 1IN1A 2OLKA 3ULVC 3V7FA 3SJVA 4JHAL 4EMUA 1NLUA 1IY8A 1KOLA 2V5YA 2HXYA 1Y8ZA 2W90A 1X7DA 2H1LM 2UWEB 4RVSA 1M9NA 2HY7A 3SX2A 4FYQA 3NEOA 4XMXA 3GUZA 3DRQB 4IRSA 4DZBB 1BF2A 4L4TE 4MH0R 4UINL 4F5EA 4OLXL 3Q7IA 1M3IA 1WITA 4KGVA 3JZDA 3T4AC 4LF3B 1DJPA 3R5JA 4LF7B 5AOKA 3NA9H 2WAQA 3W5VA 3DOHA 1HINH 1FH2A 3BLKA 3NNSA 3C6LA 1EWVA 3BD8A 2I33A 1ADQL 2HF9A 4PJBB 4Z8YA 3RS4A 5BRJA 4I18A 3LZFL 5HGGS 5FADA 5CAYB 3IDAA 3I6LD 3SKOB 4OCWH 5HRUA 4DSTA 1U6AL 3I1YA 4F4FA 1KCVH 2OCJA 1U11A 2V2WA 4Z95H 4G9EA 2X09A 5T4EA 4BN0A 1CYWA 1Q50A 1PJ2A 4DDMA 3TG8A 1XCGB 4WU5A 1A6ZA 1FUNA 1HEZA 3C5ZB 1WBXA 5GISL 1U92B 2WU3A 3GRGA 3BWYA 2Z43A 3NDJA 4AW4A 1IN6A 4FCTA 3OFVA 4E36A 1PW7A 5EMLA 1BD2B 3GJXC 4JS0A 2F61A 1QFXA 4I4TA 3EPKA 4PWHA 1BPLB 1DL7H 3TAXA 4HCFA 1RZIB 3IO3A 4K07A 3L0BA 1A2YB 1CR1A 1G5PA 2ZCHL 2F3RA 4Q2ZB 1R5VB 3W9SA 3LFHA 3C5SA 4YGXB 5GONB 1U7DA 4OL0A 3H9HA 3AREC 1PJCA 3JVVA 2MQGA 4NYLA 4IHJA 1D9KD 1Q74A 1W5FA 3W1VA 4LXXA 2YPVA 3PS6A 1QCYA 2OWDA 2R0LH 7CGTA 3OIFA 3T7AA 5DHVA 3OQVA 1F6DA 2A9QA 5HF6A 2Q9AA 5EZ6B 4B6FA 5IHZA 3HRHA 1VSUA 5GJBA 2ZSEA 3EXIB 4J1UB 1JIKA 2NYZA 2R9VA 5JVDA 3PLAE 3OLZA 4KREA 3L8MA 1Y5NA 1T91A 2QXUA 1SKBA 5DRNB 2HREA 1BBDL 2MMXA 3LKRA 4X5LA 3UBFA 3MTGA 3WNJA 5FJJA 4K3JH 1Q0RA 3L3DB 1W5EA 3S28A 2V5UA 3LEVH 1RYEA 2IH9A 1VHJA 3M17B 1AZSC 2ZRMA 5G0TA 3AMVA 2JA1A 3ILSA 3S8FB 1NAIA 2DKNA 4RDHA 1G7TA 4Y19E 3RSHA 1VL0A 3OBIA 1QQAA 3BRFA 4BFIA 4LLYA 4JAMA 4F4IA 4I36A 5BRZA 4BELD 3GLUA 1T2QH 2VA8A 2XA8H 1HCFX 4LPKA 4ZXPA 4PG2A 4GMTL 2XE8A 2B1RA 3CW9A 3MRFB 4UM5A 1KA9H 3TECE 1IKNC 1HQYE 2FDRA 4E9VA 3AG6A 2RH4A 3WFZA 1A8HA 1BQRA 4KNUA 4JHLA 5DGCA 4FMPA 4BS9A 3NJXA 4W9DC 4KKCD 4QXWA 1BBJB 3BDAA 1EUCA 1T1EA 1MLCB 3O4FA 1K6QL 1C4XA 4I3GA 5L0QB 1V8PA 2A58A 1PYOA 2N47A 4RETA 1GZDA 4IGIA 3K4ZA 1P7ZA 1ODKA 2PFSA 1QGED 1U8LB 3IJSA 4AL4A 1A6VH 4NUGH 1CY6A 2BVQA 1P44A 3RH0A 4QDZA 2NZ2A 4CC1A 5A9SA 3QPQC 2OAP1 4Y5VC 4M9XA 2W59A 1Y3HA 3T6ZA 1TT5B 5KNDH 3DX1A 2WLKA 1CUIA 2NXYB 3VE0B 4LOVA 1TM4E 1OASA 1IC4H 3RUGA 2ADYA 1R88A 1YJCA 5DEFA 1U3CA 4WI1A 2QTVB 4HISA 3VNYA 1IZYA 2QSZA 3FB7A 4HUNB 4DJMA 1X1RA 1U1FA 3UXFA 3LHDA 2OBXA 1GPAA 8FABB 2II6A 3EZXA 3IODA 2BM1A 1ZTXL 1Q9KA 2JI8A 3T3PF 3Q3JB 5DFVD 4Z0TA 2E4YA 1IU9A 1MFVA 2GKOA 1II8B 4R8WL 5JCOC 4INOA 3S88H 2D1SA 3OJLA 4JLAA 1Z36A 5FM4A 2XOTA 3OAZH 4MA7H 4K3UA 2I1QA 3FTZA 4KTYA 1SUPA 4DDWA 3ERCA 3T0WA 3RFXA 3F3HA 1IJFA 3TM4A 3WB9A 5K8VA 3CEAA 3JD0A 4BH7A 3CVXA 2VYND 2FPPB 4OFIA 3RWEB 1Q20A 4IGEA 3VI3F 2OSWA 4QHNA 4RMUA 6TAAA 4RESA 3T06B 1X5GA 2R62A 4DY6A 3Q2VA 2HFJA 1S7UA 3KXKA 4EJ6A 5ALPA 4PVCA 5F3BB 2DWQA 1ISMA 3S8GB 5CYGA 4N41A 1D2GA 2Z30A 1T1ZB 5AIAA 1NV8A 3MILA 3K30A 1ZA2A 2AI0L 4W99A 3BDBA 3C98A 3OIGA 5IVDA 2G25A 3WZMA 3GB9A 2EH7L 5CXXA 2B98A 2DQKA 1DBAH 5HZGA 1ASPA 5A7FA 2PYFA 4BVFA 4RS4A 3L7FB 2Y1VA 1KEGH 1P7HL 1P4IL 3BJZA 1V71A 2Y68A 4FHFA 2D2EA 2KL6A 5J2UA 4IGBA 1LLCA 4YXLH 3D8MA 1ZU5A 3TZVB 4UIMB 4MGXA 4LZLA 4XGKA 1HX0A 3HO6A 4MVJP 4L8DA 2VLKD 1K88A 1NUNB 1JPEA 4NFLA 4OQTL 2FX2A 5ICGA 4LRUA 3MJGX 5E00A 3GJ6A 2ERJB 5DMGD 3MLYL 2CZQA 3TCLB 3NP7A 1OK0A 5IV2B 4OXRA 3WYAA 1CBUA 2C1PB 1MTOA 4MA8H 1PWXA 4JJ8A 4HK0A 5DJAB 3O8LA 1D1TA 5TS2A 4B97A 4HS4A 2DBQA 3KLNA 3OPXA 1U93A 2VH5L 1JZSA 4HH3C 2PYEB 1A77A 1WFMA 3QJYA 4WFED 4WO4C 4LSRH 4PR5B 4PRHB 1XLTC 1EQAA 4X7MA 4AVHA 3UBXA 2I4IA 4U3XA 4ZW8A 1Y3IA 1FXWF 2EDQA 4LRXA 1ZC4A 4B6OA 4HGKC 1ZLEA 4OH7A 5DTEA 1YMME 2X4IA 3IS0X 1YY8B 1EM8B 4M4RA 3F7NA 2NU8B 2WTXA 2BOCB 1KR5A 3ZWAA 1KI2A 2AF4C 4P4NA 1NCCL 1AKJB 5G0VA 3FQTB 1PJQA 1Z0NA 4KC0A 4NN6C 1OAKA 4RV5A 5DMIL 3K80A 4DW2H 5HGBB 3N6XA 1OV4A 3BL6A 2DEXX 3CFNA 1ITBB 4PMFA 4AULA 3A70A 3O3DA 4AXXA 2F53A 2C9AA 2QR5A 5LLTA 1FK8A 1FTGA 3DA0A 4XAKD 4GOMD 2LW3A 4KRXA 1JYWA 2A6IA 1Q94A 2MJWA 1NINA 1BE8A 2ZVJA 3D6UA 5KTOA 3S3TA 3B2MA 1P2DA 3ZTJG 5DNEA 5BYBA 4Y1SA 4ELKB 5GRYA 3V2AR 3H9BA 1HCZA 3BWCA 1NV9A 1TQBC 3P0VH 4TSCH 5CR1A 4DRZA 3NM6B 4B9PA 1EM6A 3RJOA 2GD1O 4FYHA 4MIYA 2NXZB 4GSLA 5HI3C 4MQMA 4RMGA 4ZAZA 4LEOA 3TTWA 4AYFA 4BFWA 5CVTA 4A1OA 1LRLA 3IXAB 3REGA 5C1MB 2UYGA 1ONQA 5CX1A 3PJNA 2ZD0A 1UBSB 1AK1A 3SXUB 4MS8C 1Q4NX 1JTOA 4PAWA 2YN2A 4L6CA 2Q1YA 2O8BB 3GGSA 1L5RA 4BLTA 1O5DT 2Z4QB 3WR5A 3QDJA 2JIPA 3MV9B 3I9V1 4N18A 3OKYB 4Z3OA 4NDMA 1TM5E 3L46A 1Q15A 3HR8A 2FLBT 5K9OA 2QVXX 3FONB 3RDPA 2NVUB 1BC5A 2G0LA 3RKUA 2P52A 4M38A 1XF5A 5E2VH 3FRJA 2JB6B 2NUAA 2TMYA 2JJ8A 2ZJ2A 2E49A 2ZUWA 3IJEA 4LBZA 2PWPA 1WH0A 4XMKH 4R3SA 4ZUSB 3H3KA 2EERA 3GVXA 4OKSA 2HHCA 5TX7A 3OR6B 3HKEA 3RG2A 1YR3A 1TJMA 1MFBH 4FJYA 1J00A 2OFFA 4K9QA 1J9TA 2K7ZA 4HOMA 5CCEA 3P2EA 4C3VA 5H94A 3P9QA 3KYKL 5C4MA 1RQ7A 1QEWA 4UTAH 1N5OX 3L1JA 4QIHA 3W3ZB 4AJPA 3KTDA 4R90L 3CXHJ 3K15A 2HEGA 5EHZA 4M93B 5HDWA 3V0IA 4X54A 2O54A 5TGZA 2D1RA 3IALA 3PR3A 3WEXA 4YCLA 3HS8A 3NAQA 2GFBA 4H7JA 5ITSA 2JH2A 5FWQA 1TEXA 3SDAC 1IHDA 1MBZA 2Q8BL 3L01A 1ADQA 5CFAA 3LQAH 2F0CA 4FFMA 5DCCA 4CJ1A 5DF0A 4O4JA 3RU2A 5CJQH 5D6OA 3P4MA 1JJ7A 1RJFA 1Q9WA 3DK0A 4LIQH 5KKNB 2D0PB 3Q1EA 1M34E 4CW7A 2PR4H 2D3JA 2VQDA 5IOKA 1KDVA 2OQRA 2C7BA 2NW3B 1YDWA 1YZ3A 3JS5A 1I9CA 5E3IA 1JSZA 4KTDL 1DVFD 2RC6A 2V65A 3W6ZA 5KBLA 3TW8A 2WW8A 4LJLA 3I2FA 4BKOA 1R5BA 3QAZB 4HOZA 3QPKA 3BGSA 5IGXL 5DWPA 1XNQB 3WELA 3Q7RA 2PTUA 2XFXB 3GBPA 2CZNA 3WTTA 2EIZB 1CVIA 4RL6A 1IN5A 1RU9H 1KC5H 1NVDA 4LLAA 5DHYA 5DN6D 3UJCA 2QVFB 4WBNF 2ZSKA 2WWVD 3KEDA 3AONB 5JW4R 3G5ZB 4C0KA 5KTRA 5C07E 4HLZH 3TR5A 3OZ9H 3BOSA 4OJFH 5GJSH 3IFNL 4ELMA 5KBMA 1Q1ZA 5CZVL 1IILE 4PB9L 3VXSB 2XKSA 5IMMB 3HDQA 3FVRA 1QMUA 3TQRA 1NCGA 4Q3LA 4L5FH 5D7IB 2JLSA 3NN8A 3CLEH 5T1DH 4KMRA 5FHBH 2NZJA 1SOXA 4BO2A 1E1CB 2PM8A 2WUBL 2VPXA 2OC9A 4DA0A 4HWUA 4UAOB 2X38A 2LTQB 3VU9B 3C6QA 4JGUA 4AC9A 3OKMB 3MS2A 3FULA 1JZQA 1O08A 4LTMA 2CXNA 4UARA 5I5EA 4Q0MA 1U28A 1RXWA 2VNKA 1BLNA 3UH1A 2HEIA 4PONA 4TN9A 4KYTA 4Q7MB 1N6IA 3N85H 1L1RA 4Z4EA 4QGFA 4KU1A 3ZCVA 1NBOA 3TLRA 1SR8A 2WOJA 5F2EA 2QYSA 4KGDA 1T9CA 1Y9AA 3TEZA 4RF5A 4YOKA 2DJSA 5EC2A 3SQBA 1Z2NX 2Y4NA 1P53A 1TVBB 4FA8A 1IE5A 1YJBA 2FUG6 4E46A 4XN7A 4DZ8B 4BCCA 3SB3A 4URVR 4JLKA 5CM8B 3TS1A 4QVIA 3GLFB 1XSJA 3T0IA 3IMBA 4OOEA 2PUWA 4Q4CA 2QL5A 4JUCA 2J0UA 5HR5A 1JYXA 4F92B 1C41A 1QHNA 4W5HA 3RSZA 2UYQA 4GR5A 4S10A 3H87A 4KX5A 4V1CB 5LNGA 1P33A 4U6HA 4MQEA 3B3AA 2QX7A 3ABLB 2L19A 4QT5A 3R9WA 3QXDA 1TE2A 3P0YH 1EUDA 3B83A 1F2VA 3AT0A 1IJEA 3QVOA 3N3BC 4PJ5B 4EOWH 4BFSA 3SK0A 1KYZA 1OAQH 2R1TA 3RNQA 1H3XA 1IAKB 4HETA 4Y2YA 2A73B 2ZDHA 1SEBA 2BNUB 3H5IA 1UC9A 3NVAA 4X64B 1N12A 4PRAB 5GIOE 3I9AA 4YY3B 1ULSA 1UODA 1B9ZA 1GDDA 4CLXA 3VTAA 1EEHA 5DYTA 1W5TA 3HEBA 4HOYA 4ZV9A 4ZHQB 2LLLA 4D9EA 4KFTA 3FOLA 3UTOA 1NFIA 1N6HA 4WJKB 1RXCA 2ATPB 2TSYB 4B4VA 4YJ3B 2Y69B 5IZCA 4MA1B 4ISVB 3R1IA 4IRMA 3VXNA 1XALA 1I6WA 4Y4KB 5EB9A 4GJTB 3OKOB 1UM9A 5L2KE 1ZM2A 2YC4C 2G4EA 4G7QB 1CDEA 4BX2A 4MHHG 1R8XA 3RC3A 4X99B 3TEJA 3HCAA 2EBHX 1OLUB 4RFVA 4XRRA 4E6EA 4FTDA 2EL9A 2IPTL 2IYNA 1EHKB 3F67A 2YPVH 4RVCA 3OFND 3A9SA 2NV6A 2CNZA 4E0RB 3SKMB 1NM5C 3P2OA 4PRPA 3NYKA 2ZUXA 1Q2UA 1A2YA 2XXFA 2MDTA 1W1UA 2FE4A 1BAGA 1ET8A 4GBXB 2K6ZA 1QFMA 1MOEA 3ANSA 3NUQA 4H7EA 5KJFA 4O4HF 3L6BA 2FUCA 2CF5A 3WYCA 3OE4A 3CIOA 3RWHA 3PXJA 3TGWA 1NSFA 4YSDA 2D4DA 5FLUA 1U5CA 4Q6IA 1PJAA 3V7YA 1WQ3A 3DO8A 4FK8A 3BPLC 2PIDA 1JEYB 5KAQF 2B25A 1FDIA 5MENE 4E6PA 4BQ6A 1WZKA 4ZT7A 1BCRB 1JLSA 2IYSA 4J03A 4Y7OC 3BGIA 1TZBA 3RWFB 3GZ4A 4KZEH 3WS7A 4RGBA 4WO4A 4H25B 4OXKA 5ECGA 1T5XA 5JXEC 1FQ9C 3X11B 2JS7A 1DU4A 2HXAA 5C8XA 3I58A 1A1OB 1PGQA 1TUIA 5FBRB 4YP5A 5LR6A 2J71A 1YJDL 1RBZA 4CIXA 3M7IA 1XR3A 1BXRA 3FN0H 2QRVB 4YRDA 1J0YA 3UK6A 3DBOB 2X7JA 4IJUA 3VTTA 2ZSWB 5LUBA 3W1WA 1FFAA 1BFVL 1IT9H 2WQAA 2XCSB 2Y24A 3FPGA 3HG7A 3V52L 1ZOPA 1ZLWK 3PGFL 4DETA 1XF2B 2NSMA 2V0AA 2BP8A 2QMHA 4M6WA 2ZUUA 3RVVD 3PNVA 3K0AA 2C7UA 1YS9A 1T80A 3GLHE 1JGIA 3GJ8A 4FYJA 2AI0H 1BKYA 3SYLA 2B4AA 2Q4BA 2H5JA 3HZMA 4MZ2A 5KW9H 2ZP0T 4KPYA 2HWYA 3QG7L 5HNKA 4UAGA 1SHWA 2X8AA 4NNYB 5ICEA 5I0VA 4WY5A 4DTCA 4XR9A 2C1OA 4BEJA 3UEZA 1ULBA 4LP5A 4RRPM 1XZCA 4RENA 4D2IA 5IS2A 2ZTBA 2CD0A 5IJVA 1LBSA 1CUJA 3PXBA 1S2LA 2GEBA 3U2SB 2E55A 4M0UA 5FOQA 3MELA 2YD5A 1DC6A 2FD6L 1YZQA 4DAEA 1QRNE 3H42B 3VXTA 2QDKA 3GLRA 1OZ0A 4KIJA 1LWOA 3GOHA 3KQSA 3QRBA 1A7NL 4PRYA 2JGJA 3KTFA 4YREA 5I7AA 5F9OL 1KF0A 1FV1A 1UT1A 3HG1D 2Z93B 2O61A 3U3ZA 2QTVA 1NXOA 1JZIA 1QLFA 1E3WB 2WWMC 4EI9A 1VGKA 1MCWM 4YIQA 1IEWA 4AJOA 4TM9A 1PAMA 4XB3A 4ODHH 3LP6A 2BFVH 5CD3A 1V9CA 3P11L 1FNCA 3F3SA 3GMTA 3GJFB 1IUKA 5F88A 5LWYH 1WSST 2DRUA 3N43B 1SU6A 3QUMA 1WZUA 3LK6A 4R1OA 4GPAA 3VZCA 4IBYA 4O0MA 1BDIA 1YN7B 1HDEA 2GN6A 3DSNA 1XF2A 4Q7JB 4KVAA 1TFPA 3DJYA 3I9NA 3LUFA 5DBIA 4CUJA 3UG5A 4M60A 4J9UE 4JDTL 1EWQA 5KS9F 3VR6D 1ZLVH 4PJIA 1BS1A 2VDKH 2EKZA 4CMIB 3V79C 3C5HA 1X5XA 3COYA 3DJSA 1E8YA 2PX6A 3T34A 5JRJA 4D25A 1NJ1A 4UE3S 3OLVA 3S35X 1ACLA 3VC1A 3U1VA 5L40A 1A8JH 3CQFA 1QBML 2BMFA 1IKOP 5D70H 3OP1A 4AIRA 4CNIA 3BD9A 3WIBA 1HDGO 3TQCA 1NBWB 1TTAA 2V7QA 3BQUB 3PIIA 4PAOA 3TFKC 3VXSD 1ND5A 4NIMA 3C5JA 4WESA 4BP1A 2ZCKL 5MERB 1C3OA 3TMKA 4LJYA 1FNSH 3A26A 2I60H 2XOKA 1AGYA 1W4BA 2E9GA 5D6CA 1M6EX 1H2BA 2C9VA 1SU7A 4ABUA 1K5GA 3O81A 5I9MA 2YWGA 1SWVA 5E7QA 2J9XB 5A2GA 4H40A 3TBWA 3L3HA 4B96A 4MCAA 3V3KA 3L6UA 2H8PA 4NN7C 3W5JA 3Q6FB 3PF8A 5LP6F 3ARSA 1I2BA 2JIOA 3IE0A 4OM1H 1HTBA 5EUKA 2XAUA 2B3RA 3GEMA 3MGOB 1HHGA 3NI2A 5JJLA 3B12A 2WT9A 4L7VA 3NDIA 4F4DA 4HEHA 1K9SA 1Z4QA 5A06A 4BQNA 3ZZQA 1BCSB 3RYFA 4I1SA 3EVCA 2AJYL 5K3SA 3BFVA 2VJDA 4DERA 2OM5A 5ISZB 1U4FA 5C7ZA 2H7CA 3SOBL 3QZOA 5E7FA 1HGXA 3L5XH 4G9FE 1CI3M 5TF1H 1NONA 3PNRB 1PLCA 1RZVA 2NY0C 3UBXB 2X53A 1KO4A 3IP7A 1DFIA 3EOBI 4MWTA 4HLZG 2W4IA 3VJKA 2E5LB 2RR3A 2IX9A 3KKOA 4J1TA 2PETA 1UJ3C 2YH2A 1IRXA 3A0UA 3D1JA 3PXDA 2P8LA 4PRNA 5GRZA 1BDMA 3W0LB 1TU2A 2O1SA 1AS6A 2CCLA 5GS0C 3TIIA 3HBNA 3NH9A 4QLWA 3F7RA 4DHEA 3MFYA 1AGNA 2BD0A 4KK5C 4YRJA 3NHRA 4AEFA 4DK6A 2YRFA 2HR1A 1WXFA 4XNXL 2NQ8A 3THYA 3QIBA 4MVJH 4B2YA 3KC2A 3DMNA 2CJWA 5KAPA 4PGJA 3N40P 1MHCA 4DR2B 3QLJA 4EG5A 4AW7A 1Q22A 3O1IC 1O0BA 4OGLA 5DQ9A 3QMPA 3QKRA 3HR5A 4MAZA 4JB8A 3DX7B 4YVFA 2VDRL 3KK0A 3JZ7A 1LP9F 3SIWA 1CDZA 2GZRA 4O4IA 3UENA 4UOW1 5D5QA 2RHRA 3PL6D 5LD2C 4MAYA 3NCTA 4LXFA 4D6YA 2H57A 2WKPA 4TSBL 4ZDWA 5IJAA 3B9RA 4Y9BA 3DD5A 4N26A 5B1DA 4FE7A 4JO3L 3BZEA 2VLLA 3ATDA 3BWXA 1XPJA 1QRDA 3LY8A 4WBSA 4BVHA 1K72A 4PS3A 3PRZA 5TJ9A 4DMMA 2DAVA 4RD0A 4M8UA 3CF4G 4CGUB 5GS1B 4W81A 4G8IA 3CSUA 2FJUA 4CC0A 2AEPH 3LPGA 4DIFA 3STWA 1JWSA 5SWQB 5JHDE 1QIKA 1JU3A 4Z7OE 2ZX8A 4IIHA 3DONA 4KX3A 2MCPL 4E70A 2EE0A 2ZYWX 1CJVC 1I4DD 1X5YA 5FOVA 1K5WA 5IBUG 1ZLSH 2WHRA 5KVCA 4EZJA 5FIEA 3I39X 4YLGA 5A2JH 1UXIA 2X3BA 5D5ME 1T1WA 2K4WA 1LD9B 5E1IA 5FEBA 1SPBS 5D8DA 3SPJA 1D0VA 4ICIA 1YF3A 4HX5A 2H8GA 2XC8A 5K9QG 2WLIA 4GH5A 3FCSA 3RWCB 3GGDA 1J09A 1HT2E 1HH6A 4IGKA 4V1DA 1XZHA 4IRUB 1NFDB 4FDUA 1J07A 3J27A 5EMMA 1JUDA 1KZ1A 2ZI9A 4NZFA 4DQLA 3X3GH 3E03A 5A2IH 4JGJA 3HDGA 1L4IA 1F3OA 4FXLA 3ZU3A 3VFVB 2WUBH 3AETB 4EYEA 2ZVDA 2OR9H 4G2TA 3B6MA 4PHTA 3TVDA 4MQ5A 2CNDA 2C7PA 4F8NA 5C9ZA 2P9JA 3EYUH 1VBFA 5DUMH 4I9GA 5F1PA 5EOVA 2YXBA 4P46A 5IZCC 4EO5A 2XCOA 3VM7A 1VRVA 4QRAA 5JAMA 1H3WM 1T1XA 3L92A 4ZYKA 3E80A 3AF6A 4QHMA 5HJ3A 1M56B 1E99A 3NAZA 4TTAA 3EDOA 5DYNA 4JFWA 2G5BB 1MC4A 2XVYA 4N5HX 1PJ4A 1MCBA 3S3BB 4Y0NA 4PVNA 1AR2A 4EIBA 3TLCA 4A2WA 3K0EA 1INQB 1EX7A 3DWGA 1CQJA 4LVUA 5LQAA 2QTAA 5IVHA 2B1GA 1EVJA 2AN4A 5F70A 3IV6A 4HG4J 1ASQA 4CGYA 1WDLA 4ZS6C 1E61A 2FYTA 3SG0A 4R9UC 4L2YA 3BB4A 2COKA 1KFAL 4E41A 3SE9H 2YAFA 3RWIB 4Y2QA 3OU6A 4ZCPA 4DXAA 5JZVA 5I4KA 5LN1A 2XLCA 4NOKA 2A59A 2Q4DA 2ZIFA 5LNEA 3PNLA 5D3KA 4RSMA 4NZDA 4NO3B 3GFBA 1UZNA 1Z0SA 4HSQA 1XZLA 2P48B 3N2NA 1SC6A 4ER5A 4HUMB 2WUCL 5GAJA 1EHLL 5IBLD 4UZFA 3LXXA 1Y6KR 3KHOA 2PSSA 4IVPA 3KD3A 4ZUUA 2OI9C 3HWSA 5BQPA 4YPGB 3F6PA 3NCHA 1AQIA 3LQQA 2FW1A 5GS2H 1N5LA 3L43A 1B76A 4MJIB 2AVFA 3LZLA 1T89A 1XQWA 4YJGA 4M1WA 4TOYH 2FW8A 1JXOA 3W2EA 3BD3A 4WGKA 2YRLA 3P1VA 4JZOB 1MLBB 2JA2A 3B3FA 3QX9A 1J0DA 1P2FA 5MN5A 3NHMA 3T7DA 2XUOA 4I1UA 4ALNA 3D3VD 2WVVB 4TMFA 2XZAL 2OUKA 4EABA 4MR7A 2BKEA 2GYSA 4GG8A 3WNOA 3O4IA 3T08A 5HVHB 2P5ED 2RI1A 4G0MA 1IH8A 2M6SA 6ADHA 4HZLB 1C12B 1AGPA 4FG6D 4I14A 2AERT 5KEZA 1U6KA 2GUOB 3MV7E 2POQX 3ULUH 3OM0A 2DMBA 1CYEA 3KWTA 4GZMA 1TX4B 1L5MA 4PPNA 1BJRE 3KS9A 1JHQA 3OCJA 3RAJA 1U8PA 4TNGA 2H1SA 4U05A 4PZYA 4OHUA 1D6MA 4E5NA 1BVKB 1XI2A 1HNZB 3IA7A 3KL4A 3WIUA 3KS0H 3K16A 4FS3A 5E6IB 3E5HA 1P9RA 3OJMB 5KS9E 3T9BA 3QNYA 4WW1B 1TPXB 4IL5A 2E1PA 2QUHA 2ZYSA 2G71A 4I5FA 3HS0A 2J1YA 4W5OA 4I18B 5ALDA 3DOFA 1VKJA 2WINI 4B32A 3LX6A 5IB1A 3ASNB 4OLVH 5DS1A 4BEBA 2FSHA 2I55A 5CUSL 4QGBA 1MFCH 5TS3A 3QQ3B 5H35A 3G2QA 1GKUB 3GZQA 4P23D 1OQAA 4XPIA 3KYOA 1FZQA 2OKCA 3FO1A 2I2DA 3GS7A 3EUAA 3R06A 3ABMB 2UUCB 1JNNH 4QTIH 3HZVB 4Y1GA 4BLRA 4CLEA 3BKML 4NZ9A 1R6TA 5FYLL 3D05A 4PJEA 2BM3A 4D96A 1MC5A 1SXBA 4ILEA 1N3IA 3I64A 3THMH 4GPEA 1JNYA 4GMXA 2IVFC 3WO0A 3DVGB 1I6KA 4EPVA 3CO5A 4J0DA 2QRQA 2CR6A 2YEVB 5CVVA 4PY8I 5T8IA 4FXGC 5IBRA 2PKCA 4A6YB 1R34A 1NURA 3EEOA 4U6TA 3N86A 3PD0A 2XCMC 3P3UA 1L5ZA 3U5TA 2VQTA 3I1FA 1JHKH 4MB1A 3RT9A 1WO2A 2A9MH 2NXZC 5F6HJ 4WNSA 1EDHA 1HLPA 4AMUA 3N0XA 4FUQA 3RVSA 1G9TA 1UBLS 1WXDA 3D0QA 4L8LA 3WIFB 4FFBB 3WEMA 2Y05A 5ABAA 4ODVL 3JWOH 1XOIA 2K6GA 4KIWA 3BE4A 3BSSA 4YDRA 5JG7A 4K88A 2VDPB 3O75A 2O2XA 1NU8A 5CIPH 1PLJA 4BNHA 2BBTA 3HSSA 3EOAI 3N8DA 4TN1A 4WZ6A 2KZ1B 3U40A 4TMKA 4LC0A 2FMHA 3LB6C 4GMSH 5DO2D 2QM3A 4B53A 2J9FB 3IT1A 3M6VA 3VV3A 4F7TB 5J06A 1WW3A 1GM5A 2FSIA 1BJTA 3LVFO 1B15A 2ZPAA 3HR4A 1JG9A 5KTNA 1V16A 3IDGA 2G9RA 5C0JA 4P2OB 1DE4B 2ZONA 5KN5B 1LEHA 3AUSA 3DOSB 1LNSA 2XBUA 3MG9A 4BATA 5D8JL 2FSFA 5JQGA 4A9AA 2YBRB 2FEAA 5KSAD 5BZWA 5FPKA 2QR2A 1CQPA 4GRWF 1RJYB 4Y6SA 1REIA 4P22A 3GFUA 4GRWE 5ES3A 4X6XA 2GC7C 4ZMXA 1S7UB 4B74A 1C1YA 3ILPA 3ZX5A 2KLBA 1MCFA 3O94A 1OLLA 4NI3A 4PLNC 5DA0B 1YKGA 1NVAA 2WBLC 3PTLA 4QPJC 4BU0A 2XGMA 4L1DA 3L3OC 5FO1A 1C7JA 2BOVA 1CC3A 4D26A 4FQLL 3SPVB 3SMVA 1DQDL 1C8VB 2H3KA 4CU8A 3QCUH 4Q7KA 4QSHA 2HDWA 1J2JA 3GKWL 2J6IA 1BE0A 4CF6A 2JF0A 2A9RA 5KQMA 2QGFA 4G1MA 3BSYA 3EVEA 3BGFC 2E6PA 1X8XA 5JXGA 4B17A 2ESVB 1UXOA 3OHXB 4KBGA 4Q3EA 4DNFA 1J4AA 2VZ8A 4U7KA 1XEUA 2HH0L 4NM4L 2BFGA 2BL4A 5CLGA 5A2CA 2INGX 1R50A 2NO1A 1U3ZA 2WD0A 3C3WA 1RCUA 2VQ4A 3B1JA 4L22A 2DF3A 1QP4A 1PZGA 3RJ9A 3O82A 4CODB 2PLAA 1R3IL 1NC2D 3NZHH 3C09C 3T1NA 3ZHSA 3SJVB 2OD7A 3PF2A 3BH8A 3LHKA 2Q1XA 3WGZA 3WICA 1ZHNB 3C2SA 4WTZA 3TS8A 3CZLA 4XB7A 5TPWB 3TV3H 3TRKA 4Y19B 3OZWA 5BRPA 4PJXA 3U4EA 5FHAL 3MJSA 2UVFA 2A4MA 2QLLA 2Y1LA 2ATEA 4RK4A 1MJHA 4YQYA 3G04A 1ZN9A 3KLAB 4LCYB 4X80L 4CKXA 1ZD3A 3KLHC 3L77A 2NX5E 3KDAA 2Z7ZA 5T5FA 2QGNA 4P31A 3KKZA 1E6CA 2IBTA 3NDPA 5FOXA 5GY7A 3J81k 5D3MA 3ABZA 3RTGA 1WBYA 1GTZA 5LSAA 3IEKA 2P7TB 1ZPDA 3RPEA 3EYQD 2MOQA 1E3TA 4ER0A 2O8DB 5DP2A 3KNBA 2X23A 1JFFB 1MY5A 4XVUA 3QEGH 1MB4A 4HRAA 1WZ1H 4AS3A 1P1BA 3LQFA 5AI5A 3TAUA 1FH5L 1MCSA 5E6ID 5DJYA 3I9IA 4BASA 2B4TO 3J8F7 4UM9A 2BH9A 1IL0A 3HUEA 2QGCA 4PXYA 1OPRA 1YFZA 3PFKA 5E1OA 4RMHA 4CDNA 2EYRB 3WIHA 2BX5A 5IABA 2VJYA 4RPLA 4EQ3A 1EFRD 3D0VB 2YD9A 5IC4A 1KELH 2L18A 1HDMA 4JH0A 4PBSA 3ICQB 3L7KA 2CDEB 1GLVA 4I2XE 2Z31D 4D3CH 3B6JA 3NFSL 3O3UN 1Z88A 4MQLA 4M98A 1SXSA 2M8XA 4O1HA 4U7JA 3IMUA 2SHKA 1RPTA 4EUSA 3OD5A 3KD2A 5HYVA 3ZWPA 4AQOA 2RGWA 2O8CA 4XP9L 1NE7A 3GD5A 3LPWA 1XNGA 4UT9A 3O11B 2ZG1A 4FADA 3DKPA 3TD6A 3C3EA 4TLBA 4LOEA 2XY2A 1TO4A 4PIRF 1NW3A 1SZPA 1Q57A 4ZV7A 3SYCA 3D30A 4QRRB 2IWEA 1GJRA 4IBVA 4WY7H 3UCQA 1C5BH 4BFXA 4KLRA 1SU8A 4PZ0A 3MGOA 2VAPA 5E4JA 5J12B 1XGTA 1JALA 3EQZA 1CJKC 1COBA 3IFPB 4RDCA 4IW3B 5G4MA 1JLMA 3HVDA 4KJWD 3NYQA 3KBOA 2HCRA 4F27A 1RJLA 4MA3A 1YR1A 1GH7A 2Y1YA 5WRFA 4JI3B 3ZH2A 2YYAA 4GO1A 4JVOA 5JCXA 1EUYA 1RBMA 3FLMA 2ZSHA 3APMA 1DTEA 3TQFA 5I30H 2BKAA 3QUBA 1PJWA 3AINA 2SEBA 1BA2A 2BT4A 4IDCA 5CB6A 4INJA 4Y7CA 4A27A 4YVUA 1V1RB 2NUBA 3B6ZA 5LJYH 4GKJB 1UWFA 1U0OC 3IUQA 3L4UA 3I72A 2VDLL 1V3JA 1P7KB 4PRBA 4PLKC 2I34A 3GLDA 4G4SO 1MAWA 4LSQL 1CUWA 4R0LC 2QNBA 2ZZKA 3RSGA 3FQYA 2PT9A 2DQMA 3SDDB 2YZ1A 3THOA 3BZUA 1F4VA 2B1OA 5DRWB 3TT1L 1EFXD 3EULA 2BHZA 1SXCA 4IHJF 3CZRA 4MS8D 2Y9PB 1ONQB 2B3IA 3ISJA 3OIYA 4PNEA 2H9AA 5TD4A 4IJMA 1GSMA 1Z5VA 4GMTH 2UZPA 4JM0A 1SCNE 2XPCA 1E9VA 5LXVA 4TVPL 1B6DA 1JQBA 3TOZA 5CCGE 4NQDE 1C1XA 4NZMA 4UMVA 1S8AA 3O8CA 1NXVA 5HD8C 1NTOA 3O4VA 4NDMB 4I4IA 2W0MA 1L3NA 1HNXB 3ETSA 1KIRA 4G8GA 3K74B 3O2NA 2NVUA 4Y1RB 2N1MA 1AJEA 5AYTA 4TPRL 4UVIA 4NBVA 1ZANL 1TA9A 1ORSA 2GJSA 2BSSA 1LE9B 1XMXA 3L7JA 1T9KA 2P9QA 4H7HA 3ZIAD 3QSKB 2ZIDA 3HLAA 5DXWA 2IBZY 5M7EA 1LK3H 4HAWA 2Y7NA 1CT8B 1KZ9A 1E5CA 1Z3CA 3TYFB 3SGDH 2CD7A 3FWPA 4EUPB 1JZGA 4OJCA 4WI7A 2OMZA 4LK3A 3AS3A 2NY4D 4BFUA 3V4PB 3ZIMA 5D1XD 1DUYB 4RMNA 2BMAA 2P24B 5DGQA 3BRSA 4DQVA 5ELIA 1DIAA 4GNKB 2XDWA 1NQ5A 1ESMA 3MMSA 2K8QA 4PJDE 1UKEA 2VG8A 1IMHC 1W0VB 3N5KA 5DTRA 1DFGA 3CIFA 2XADA 2IG2L 1QO0A 2RJNA 3ARWA 4K2UL 3WL9B 2WXKA 4YGVA 3VQMA 3LX8A 4EUFA 1XFAA 1OL0A 4JM2F 4Y1EA 4G43A 1LRJA 2R56H 1ONOA 3BFXA 3VNAA 1TYRA 1YJDC 5IULC 2NNAB 3RFZA 2REBA 5IX8A 4F6LA 1YEJH 4N2CA 4FFVC 5FFNA 4GEGA 1EK1A 5AUNB 3CXDH 1N1EA 3GMIA 1WX1A 1QD0A 2HT2C 3VPHA 3UA4A 2J07A 2NYAA 2BI7A 4PJEF 3ZE0E 1RY7B 4TROA 2LTQC 3PVCA 5DNWA 4DDTA 3D9AH 2XTAA 3FZEA 5CB4A 3IFLL 1DVXA 1T4CB 5HZHA 4XP5L 4GBMA 3M5PA 2ECPA 4P5PA 3FUKA 2BGNA 3IQDB 1W8IA 3B9KB 1V8ZA 2K7PA 3UAFA 1DQDH 4WBNB 3EDFA 5F89B 5I5IA 4ERNA 1U0EA 3H04A 1G5RA 4H20L 1N7IA 4KO4S 3ZDXE 1ISSA 2D06A 4LSDA 2IU4A 3KTOA 1NPYA 3BQNB 3GGCA 4KTVE 2C59A 2XCLA 2QDXA 4QOGA 3KLBA 5I8KL 3E8VA 1HOTA 3BX7C 1YRHA 4R81A 1VCAA 1T5TA 4L3OA 4KNVA 5L7TA 2ZWPA 2C5DC 3LAFA 4MW7A 1OFGA 4DH2A 2IZOA 1A7OL 5F44A 1CLCA 4BN4A 1TJIH 4JOBA 4JZNB 3VXUE 1YNSA 3D6MA 1E1CA 4JP2A 4MEBA 1BHQ1 3KWLA 4ADGA 1CXFA 3TDMA 3H3FA 3IDJB 3W37A 1MJ8H 5BPPA 1OGPA 1X19A 4P2BA 2P2GA 5D7LA 4LF5B 1F8XA 3GT4A 4P08A 3RODA 1J20A 2B4RO 1ZMOA 5JD5A 5B4UA 3BUBA 4RZ3A 5IVXF 1F5SA 4KH0A 2H4WA 1A9OA 5J1SB 4FFYA 3DGGA 1TECE 3LOWA 1IQWL 5EIQA 2XMBA 4LEBA 3G5WA 1XA3A 4ZUUB 3SQOL 3F90A 2QSCH 4EW1A 2WDZA 1F4YL 2OV8A 2FCBA 2VT0A 1E9FA 4H5SA 4M9OA 3BA6A 2PRZA 4JGNA 4MAYC 3MAWA 3K5SA 3RS8A 2VERA 1VHTA 1X15A 3PAVA 1XZPA 3PI6A 3II1A 1YB6A 3DIVA 1P4JA 4F3TA 1KXJA 2YIHA 1Z5HA 3FOBA 4AE1A 3RNLA 1KB3A 5BOZG 4HWBL 2WXRA 4LSSL 4G5XA 1VYHA 3IBYA 4B3CA 2F59A 1UWXK 4E08A 3MR9A 3GO1L 1JFLA 2B4KA 3E18A 3OB0K 1RRPA 4R96A 3VM5A 3MBEB 5MEND 4XOEA 4J1SA 4HVLA 5K3FA 3UUEA 1T4MA 5FCDA 1G8MA 1UVQB 4JFDD 3G2MA 3E2IA 2GXAA 2JIBA 3A6EA 2Q1TA 1TIBA 2P47B 2O93L 1KJVB 1UZLA 5CEZH 1GG2A 4Z9BA 3MRGB 3G5XA 1V2GA 1QHXA 5D7LB 5JAPA 5F2FA 1SB9A 3SN6A 3OQPA 5TARA 4UNIA 1U2YA 3R4RA 1CB4A 4NI5A 5T5FH 2ZYGA 3H9UA 5A0TA 2EDDA 5U4XA 1DBSA 1J5OH 5JXAH 3DEIA 4IHAA 1NATA 2YJ6A 4XI5C 2CLRA 2D31B 3FNKA 3C7CB 2YUVA 3OJXA 4GX5A 1XRLA 3IGFA 4DQOL 2RGBA 5EMNA 5JH7B 5AICA 1PLGL 2J1WA 5JZSA 1QKKA 1DPGA 3C1UA 5EJ5A 4Q9QH 3E15A 3ORSA 4JK3A 3V52H 3OKOA 3TCXA 3L7EB 5AQ0A 4OGYL 2OPHA 2XIQA 3WNZA 4XXCC 2ICWI 1DCTA 1HSBB 2ZRPA 5LGKA 1DX6A 1N18A 2IIBA 5FBZA 3DAFA 4IM8A 4Y2DC 3RP1A 1MW3A 5E0OA 2VDPL 1JS4A 1X7GA 2VP4A 5CJ2A 1B2WL 3LA8A 1XKTA 1I3GL 4R7LA 1XWVA 1FP4B 3O4OC 3NJLA 1RLJA 1EHXA 1LK2A 3L0YA 3JXEA 1VYTA 1XDZA 3KZMA 2PXHA 1UT6A 3UMCA 4WV1A 1SHUX 3IUPA 2BHLA 2W6OA 4OZHF 1GYUA 5I74B 4FYMA 1EZSA 5EJ9A 2UZIR 3WL6A 2C3OA 2NSLA 4DLNA 4A6YL 3EGSA 3VXTB 2FA9A 4U63A 4EGFA 3KPRA 5I9NA 3TIDA 4MOWA 1OE3A 1J7VR 4BO4A 4CUZA 4BWGA 1CY4A 1RZ8B 3B2VH 1G3QA 4UOZA 2OAEA 2X2OA 3V6OA 1CUOA 3N0PB 2QQGA 1N67A 3LQAL 1ZGGA 4PTZA 2BHNA 5F3BA 2WV9A 1GG9A 3EYFB 3QLUA 5FWXB 3BFKA 4EVIA 3U3OA 2OZKA 5D1XC 2WO3B 1PT7A 4K3JL 4MMXC 1Q6YA 4IFEA 1DHKA 1II0A 1DC3A 2WJ4A 4FMKA 1LI4A 2X41A 2YVLA 1DO0A 2JATA 2KBFA 3WGQA 5IWLA 4X00A 4M6WB 2WJWA 3B7SA 3GLGB 2BP0B 4NBSA 1MP0A 3D25B 1DVQA 4FZ5A 2DCUA 3UGQA 5L7XH 1Q0ZA 4C6HA 4ELMB 1JJIA 5K3CA 2NY2B 4MKMA 2PU5A 4XYMA 4F86A 4G83A 3QULB 1GTMA 1QWOA 4HIPA 4NPYB 2JCSA 2XDYA 2VXCA 2AHRA 1PG7W 1X80B 4G37A 5LDDC 5EGNA 3D6HA 4P7BA 2JD2A 2IYZA 2P65A 2X2UA 4RD3A 5DMHA 3GEPA 4KTDH 4JFDB 2IH3A 1FLAA 3HFSA 1R1DA 4EXKA 3K5PA 3O5AA 4YAGA 4FXOA 3DYBA 1HMPA 4R0LA 1CTNA 3SJVD 1HHHA 3UDWC 1QIGA 2WZDA 1WUJS 4F15B 1T6BX 4AYSA 1JHTA 4P9ML 5JDIA 4XH9B 3I8OA 1HL5A 3RI5F 4OI1A 2K3TA 3DCYA 1NXQA 5DM60 1R4MA 3T5DA 5EHFA 1ZOIA 3EJYD 5CKGA 3M3HA 1EX1A 3HS0C 1OX5A 2DICA 2WZ5A 2IUSA 1ZK0A 5JPCA 1BSIA 1F5NA 4CTOA 3MQFA 2Q9OA 5T7BA 1I6LA 1FL6B 1W96A 1QPXA 3JATB 3KVDD 3MVEA 1I9JL 3ADPA 4MDIA 3JASB 3C6MA 1E1YA 2A0FA 5AVZA 4Z7WA 4TSAH 2ZF9A 3TF4A 5KSUB 2N4IA 1ECFA 3P9WB 2R29L 3DPBB 1AXIB 1BX2A 2CWDA 5HS4A 1N9GA 3FKJA 2IGFH 4LQLA 4RFNC 2ZRLA 2PMZA 2HHLA 2NNWB 1R0SA 1AUXA 5FEMA 5D4QA 4U1LB 1XPOA 4TNFA 2NN3C 4IMPA 2PW2B 4O2LA 2BNQD 4S1VA 1QIHA 2DX7A 3GVHA 3VFWB 3ZT6A 2A77H 4Y19A 5CP3A 4Z2AA 1QPZA 3ZKND 2JFOA 1HO3A 2GD0A 4A92A 4AVJA 1Y3BE 2F43B 1HWYA 2GBTA 4O02B 2YXMA 4ZI7F 2VQ6A 1GPUA 1V55B 2YY5A 3L4SO 3AI1A 3RLSA 1ETZB 5JV5A 2HUPA 2X77A 2AJVH 3PJEA 1VBMA 4XNXH 2CMKA 4OH2A 2A86A 4G07A 4QTZA 4NVRA 2AE2A 1HL4A 3TD2A 2CO7B 2E5FA 5B1AB 3HZ3A 2CMDA 2EGHA 2Q0QA 2GEVA 2XWCA 3KEFA 2A9BA 4PGCA 3F9CA 1A8SA 2QRLA 5CBPA 5KS9A 2VDRH 2N1BA 3FUEA 2Z4QA 5BRQA 1YCSA 4RIEA 2B20A 2Q5CA 1B14A 3AL0C 4Y6OA 2EYRA 4YTEA 4OL9A 3WAGA 4OZIB 4V1DE 4DVRL 2VR7A 4TTDD 2VT6A 1WABA 1ZZEA 2OQJB 4H27A 3ATAA 1W2KT 1FSGA 2GBGA 1B3IA 3EDRA 1HYQA 1NRWA 3NRPA 5A5VA 5GZ1A 1EVLA 2YA2A 5GZOC 5CM9C 1UG9A 1EO5A 5CJOL 4XLLA 3I2CH 2QR0B 1JHXA 3BPLB 1NUQA 4P83A 4JM4L 8FABA 4YHHB 1UUNA 2Y1WA 2D4AA 3NAAL 2SODB 1XQ1A 1Z33A 1A9BB 1WAEA 1MIOB 4ZOBA 3WIHL 1OPXA 3VGGA 4JFXB 4NZPA 2ZSBA 1FC0A 2VTEA 4KI5C 2F90A 3T3EA 3MNWA 1NGSA 3R2JA 3ETGA 2CBQA 1K0UA 5C9JB 4BB9A 3WNNA 2AR0A 2HJFB 4UQAA 2IYEA 2NPOA 2RCNA 3HN3A 1RAFA 1USIA 3GUCA 1W88A 1RUAH 1BZEA 1TQTA 5F6IC 5KQLA 4X6LA 3R4CA 3FT3B 4OGAD 5F9WC 1ZI9A 2AMGA 2BLLA 1B00A 3SP1A 1P0FA 1PWZA 4REMA 2MYPA 5LGHL 1YS4A 3DSFH 4K3DL 2I4NA 4GBJA 2AYZA 5MGBA 4N8UA 3CZ4A 1F8TL 2RK3A 1FDTA 1W73A 4KTEL 3FCGA 1ZWKA 3DZFA 5A4JA 4LHYA 3ARFA 3TGPA 3IVCA 5KVGE 3B1FA 5BVJB 1HSOA 3F47A 3LPPA 4K7FB 5IAOA 2WN2A 3ZCQA 2IP4A 5JDJA 4IFTA 2WXGA 1MG5A 4RKFA 1MA0A 5LGJA 3SLRA 3HKCA 4AQYB 1XA4A 3A4YA 4GX2A 1S1CA 4L9RA 3AIIA 3F2LA 5I75C 3TZVA 3F74A 3BWDD 5E8NA 1A5FH 4JC0A 2V97A 4L3CB 2MCFA 5EZ5A 4MV0A 1BXXA 1CDJA 2CFOA 3WMPA 1F9AA 1SKUA 2AQIA 2B9EA 3GBSA 4ZX5A 5FEUA 1E7MA 2Z91A 4EOGA 1K8RA 5JY6A 1E9QA 3CQPA 3EAQA 4I4LA 4XN8A 4MLPA 4EUNA 3T4EA 2H0PA 4D9NA 3BCRA 1JIQA 5CA1A 3PDHA 2A92A 4A4DA 1KIRB 1N2RA 3UGUA 5TQ2L 5HI5D 4KKAD 1X1AA 1KFAH 4HNVA 2P5EB 4A2QA 2X5OA 2GXQA 4NBWA 5FKAB 2VKWA 2RHJA 2AKAB 5ID0A 3HABA 1MFEL 1LDYA 2ILVA 4CN4A 4E2WA 1HH6B 4W70A 3NC0C 2EIMB 4X7RA 3GPSA 3GBMH 2D03L 2CA3A 1CGSH 1GU7A 3L79A 4XFDA 2V58A 1YVDA 3F5MA 4K23L 2IUYA 3WS3A 2C07A 2L7EA 3K2QA 1NOFA 5L6LB 5I66B 5JZBA 3L3OB 3HYNA 2IC5A 1YQXA 5LP6A 2XIIA 1O9HA 3VHLB 2HFGH 4LRSB 1RWMA 1RUKH 4BCZA 4EI2A 5JIKA 2DF8A 3WRWA 4PWEA 2W0SA 1NYLA 3ZIUA 1NJ8A 1J8YF 2RB8A 2P6NA 1YCHA 3EO1A 5KX5B 4AY0A 4J2OA 2QVKA 1XPUA 1ZUWA 5I1HL 2IUUA 3R3SA 2HWZL 2O6DA 3H9SE 1AGCA 1Z7BA 5IHWA 1NFKA 1Z4MA 1AV7A 1W44A 3P0YL 5EP2A 2CLVA 2F3TA 1EBAA 2YKLH 5HHOD 3JAWA 2JCCF 4PGGA 5G0SA 1NCAL 3B5EA 4WESB 1SOQA 1JECA 4H1TA 5KOHB 4CSPA 3PCRB 1C8QA 3DMMC 2JJUA 3T3OA 4MUHA 2Q5HA 3K35A 2DWXA 2ZANA 3LUKA 4Y4FD 1EIWA 5AW0B 2H7XA 3TBWB 4KKVA 4I50F 1BYUA 5EQDA 4F57H 1E2UA 1NWHA 4BHTA 3V7MA 1S2EA 3N50A 1FXWA 4NMXB 3WENA 2JLPA 4HXFB 5IB4B 3DBVO 5ARDA 4LSUH 1QUEA 4G8GE 1W94A 3V7WA 4PE5B 4Y1AE 1WPQA 2P4UA 5EORH 4ANXA 5EE3A 5AZ2H 3KPSE 3KPRE 4WFIA 4QRHA 3D02A 1JL8A 2XSZA 3QH4A 1ZINA 4HCRL 1UKCA 4OPMA 4X9YA 4X7BA 1ZT4B 3LDUA 4X5XB 3IJEB 2Y2UA 5F7KC 5AM4A 4EARA 3Q2NA 3VA2C 1SDYA 2BK8A 4U1HA 2J72A 2GRUA 1UM9B 3NC1C 1S8DA 4X1KA 3RTDA 2E47A 3LD9A 5L3ZA 2R29H 3NFPB 1DVTA 3IDJA 5FHBL 1L6RA 2AUNA 2NY6C 2WF5A 5AAPA 3FMIA 1J7KA 1EFHA 4HNHA 4QUBA 2BJVA 4BKLB 1IHUA 4KROB 1YVUA 2F9MA 4KXZH 1QDUA 2ALWA 1LPAB 2A1UA 3ZG6A 1JJFA 5BSWA 3QVTA 1OTUD 1SSLA 3V33A 5C5EA 4LOJA 1DC7A 4ODUB 3ZL4L 2H5IA 3SF8A 1RVFL 4QQFA 3TP4A 1OCOB 3TBFA 4Q6IB 3EVNA 3UTSD 3AUFA 1O6SB 3IHKA 621PA 2R6FA 1PNCA 4BMXA 4NMMA 2AEEA 1NG9A 4BWTA 3CRQA 1KXQE 3CLWA 1E5TA 3QXHA 4GOOD 1G1AA 3L5HA 3MZTA 3EEBA 3RTCA 3HKBA 2HKHL 2JJYA 1I7PA 3I5AA 4GKSA 4M7ZB 3JV5A 4O51A 1CZLA 4F3RA 4NQUA 3FUCA 5BUGA 5EP3A 1ZLUH 5DMGC 5F1IA 3EX7C 3HLYA 4M1TA 1EK2A 3VC2A 1NULA 3OWEA 4NV1A 2QSJA 3WWEA 4I4TF 1WZLA 3TW8B 2VAWA 2Q76B 1KLFA 2A7QA 4BZZA 1PNVA 2IDMA 3M4JA 2ALAA 3DZDA 4GP8B 3MTJA 4DG5A 3KVYA 2ETWA 4L1HA 3LUPA 5BN4B 2J9RA 3IEIA 5HILA 2PS0A 2O5ZL 1H9DA 2BEVB 2HU8A 1QU3A 4GQBA 3W39A 2ED9A 5CGYD 2PTTA 3H4MA 1XWWA 3T77A 4N5NA 2BHSA 3QZLA 2ZKYA 4J4TA 2KMLA 4KNWA 3MRHA 2H11A 3GIZL 3EOYG 5C0BE 3BUSA 4U2FA 2EDEA 3T1WA 1CE1L 1Q1PA 3UAJC 3SBEA 1FDWA 2FQGA 2GAZB 5E7IA 4PICA 4GGMX 3FHAA 2VK4A 4DKEL 3H2WA 4OAQA 3FDJA 3NIDB 3KLQA 1Y8QB 1KRWA 2DI7A 5EZJB 4IM7A 5A4FS 1T1WB 4DQUA 3HPJB 3G0DA 4BGUA 3GXIA 1R3UA 2J7KA 5K93A 4KHZA 4GI8A 1Y33E 4S0SD 3IVGA 5C71A 5HWSA 3U56A 1OTTD 2Q7XA 4R7NA 1YUKA 4LZAA 3L16A 1PR1A 3NFYA 1BQHA 5DC0A 1T8WA 3ZE2F 1JAEA 4BKUA 2BSRB 1SG6A 4A10A 1P9MC 1QOKA 1WMSA 1WMAA 1XYGA 1E5XA 4XVHA 3LNHA 2YW2A 4Z53A 4JKOA 1U58B 5AVQB 3R6WA 4JDTH 2ZCKH 5DM1A 3HBAA 3ZCSA 5AOVA 1U7OA 3GJ3A 1EAQA 3T0ED 1MCKA 4JFFA 3BGFB 1YN7A 5AB0A 3DO6A 1DINA 1UURA 1SYSB 3NATA 3DGCR 3EYUL 4PFEA 5C08A 4XUDA 1BWQA 3FPBA 1FCGA 2G5BA 2Q3ZA 1EB9A 4UNSA 3VG9B 2GZMA 2QD2A 1S2OA 5IDYA 4AX8A 2G3ZA 2H2SD 1G6OA 4D98A 3UGKA 2ZS8A 1R3HA 5F9DC 3ZNOA 3KYCA 3UBGA 2EVIA 3I12A 3RX5A 4AWJC 4NWTH 3U39A 1CPYA 5IKCB 2C82A 3STZA 3VNSA 4YHBA 5EWLA 4HDSB 3CE1A 1QHGA 1WXHA 4KXYA 5LQCA 4O8ZA 4BMNA 4M8VA 4N5LA 3WXMA 4DSOA 3DM9B 4HEJA 3SZ6A 1Q1NA 4K8RD 2P9CA 2VN4A 2J2ZB 1MWOA 3GM0A 1E4YA 2VCYA 4HG2A 2GJRA 4LIPD 4KCGA 4DPMA 1DKUA 4R7DB 3TJHD 3AKDA 2WNKA 5A2QA 4G0XA 4MRCA 5EXEA 4GAJH 1LNQA 4HDMB 1NSYA 1JH9A 3RE0A 2ICEC 4R41A 5CVDA 1DKPA 2IYYA 1NGXA 3EO9L 4RFLA 4ZHQA 4EAEA 2W42A 2BSTA 4KZDH 2WQZA 3BO8B 3OZXA 1Z68A 5LU8A 5CXPA 2O5YL 1Y1DA 3V0EA 1SCKA 2GTWB 3TLAA 4H18A 3VXNB 3PNOA 1D2NA 2C57A 3BXGA 2WPDD 4GSKA 9MHTA 1M7GA 1FNHA 4NABA 1E58A 5BRNA 4IY1A 2ZE0A 4ZMZA 4MNQD 1MDTA 5EBLA 1SYSA 4LLWB 4FOMA 4YDVB 2EQAA 3QG7H 2P8MB 5C3MA 1LFAA 5C0BA 3S5LA 2AV1A 3KPOA 3FCCA 4JCMA 4S35A 2X0EA 4G42A 2VATA 3KOWA 5B4MD 3G8AA 2CE6A 4YRQA 1YPZB 5AXBA 2E3VA 1WRBA 5DC2A 1EEYA 3EJYC 1WVIA 1JYVA 1PFQA 1I4OA 3P4MB 4F06A 4OLFA 4AL8H 2XCIA 2ZS9A 1KSHA 1IY2A 2XXAA 3ZTJH 3K6SA 2GB4A 4FMBB 2AJLI 3UL4A 3U5ZB 1UMKA 4FP8L 3UTPE 1QTRA 4OHBA 5EF0A 4ELMF 1Q12A 1A1MA 3IIMA 4J27A 2EE6A 3U4MA 3ML8A 3HW7A 4P2RB 4AGLA 3JALB 2FUTA 4ABVA 1M7DA 4OKNA 2JB9A 6FABL 2UZ0A 4M36A 2VH1A 2VNAA 2JIXD 1R27A 5I1LA 4GKZA 3T8YA 1QR4A 4NQXB 1BX2B 4NRXA 4RGNC 4Y9GA 3FDFA 1S7VA 1JZ5A 3DJTA 3UCEA 3RKDC 3EPHA 4L4TA 5ICSA 1D7OA 4BLWA 4RTKA 4EBBA 2O2CA 3IV7A 2VH2A 2WZCA 3M6WA 4OA5A 4CMEC 1ABBA 1SF5A 1ZRSA 2PA3A 4MKFA 2HLDA 5D96B 5DD5H 3V0JA 2C3YA 3KBEA 3W5NA 3I1JA 4IX9A 5JDSB 3NHUA 1JG2A 5JHDA 1H22A 4LDRA 3S5LB 3QUZB 4I08A 3RU9A 3GSWB 1E9CA 3ROFA 2V2XA 1SZDA 2PH3A 4X9HA 1AIPA 3AVPA 2GY7B 1AJ7L 4KE8A 5GGTL 1FE8A 1QO7A 1SCAA 1YFKA 2LKDA 4OV6F 5INTA 3L17A 4IDPA 3SBXA 3QRLA 4NCC2 1BLNB 9LDTA 1ZMTA 4H0IA 5F7FA 3ULUC 4O5LH 2XXAB 3L5IA 3JWPA 2HMAA 4XWKA 3W5BA 4WKBA 4NBYB 3VI3B 4OHPA 1D5IL 5IMLA 1DIOB 3TR6A 1B6UA 1NGYA 3PWPA 4JEUA 2F58L 2PO5A 3FAKA 5AZUA 1I3LA 1KP3A 5AHOA 3FSVA 2DWTA 5I19L 4ZAKD 4Z7WF 3ESBA 3SHSA 3ZD8A 1NJ2A 4WTQA 5T6BA 3WRXC 3TF7C 5DLMH 5KU7A 3JYBA 5D1XA 4YC2C 2CNLA 2X5XA 3NBQA 3VU3A 3G7TA 4ZCRA 2VUTA 1MHTA 2WTAA 3U62A 4H7DA 1ZJWA 4PYRA 3BHIA 4TNVF 1B73A 2TRHA 1T4WA 2XVLA 1WDWB 4CBPA 3MYZA 1EI9A 2G63A 4WXMA 2FX9L 1P6AB 3DC2A 1N1MA 1FHNA 4UDXX 4P49A 3FO9A 5EMHA 3KDMA 1JG6A 1XWFA 3BJ91 1U99A 1YUMA 3VFNA 3L6OO 1BMFA 4IJ3B 5T1JA 1KDRA 1IB0A 3HAEB 2OQVA 4D97A 4PRPD 4B0MB 2XYQA 1WXQA 2PPFA 3VO0A 1FP6A 2X6VA 5J58A 1R12A 1RIVL 1H9VA 1CL7L 4LJ5A 2GSGB 1UWGL 2I7TA 2MTAA 1U9JA 1LO2L 3OZCA 2WUEA 3JV6B 4YMIA 4G43B 1EO8L 2CMFA 5IT5A 4X20B 3CFIC 1R64A 2FLRT 3MXWL 1A9XB 2APSA 3B9EA 4L4UA 1HZHH 3HN6A 5F12A 5EIBC 5CDFA 1RLOA 4EI7A 4TUJB 4GOKA 4FKMA 5LJIA 2W9LA 2E82A 5HYJD 3TBSB 1D9KB 1JKJB 3FF1A 5K9OB 4NQCE 3W5IA 1E1RA 4KO8A 1D9ZA 3I5MA 3TASA 2C5GA 2JB6A 3U6RB 3C48A 3H8SA 4HSGA 4Z86A 4ZJPA 2QOEA 5EESA 4ZZIA 1NF9A 4MUBA 3HVJA 2DDQH 5LBSL 4JRYA 2CJUL 1IIIA 4N0CC 5EO0B 4H1UA 2EADA 1N2JA 3HCBA 1IL1B 1A98A 4E0RA 3MV9D 1A8PA 5AVTA 1G5FA 2PRSA 2C26A 2CHNA 4PBXA 1ISRA 1KCWA 3BDYL 3JPYA 5AVKA 3P0RA 3UMVA 2UUOA 4X8HA 4DCOA 4CBVA 2A9JA 2NSDA 4OP1A 2FZCA 1QK5A 2ZM5A 2UYCA 4HWGA 1GTL1 1H3EA 4Z76B 3K0YA 4LTNA 5TDNA 3US9A 2PUTA 1I0ZA 2O5EA 4LWQA 3Q10A 5KTYA 2RGCA 3ZY5A 3VPXA 4Y0GA 4U0RB 4BVJA 1TADA 1W85A 4ENRA 4LSUL 5JS6A 1J18A 1E4XI 2F1HA 2FBOJ 2X6RA 3QV2A 1JZ7A 4JO1H 4FB4A 3PZRA 2OVFA 2W2KA 4PWGA 1F20A 3HWWA 4IKLA 1K89A 4JPQA 5T3YA 2G06A 3TJMA 3E5NA 1UGNA 4PRNB 2DLFL 3BA1A 3CCHB 4J3XA 1PFYA 4AUJA 1N5KA 3PJRA 4YP1A 4HXEB 3AR7A 1WJGA 1NPTO 4BA8A 4FWTA 2AX3A 2V5SA 3V42A 3T0EE 5IRCD 2J3LA 2HA3A 2YAHA 3QZPA 2HSGA 5I8PA 2A9VA 4HB3A 2Y1FA 2X4UA 2CDFA 2OHJA 2JW5A 5TMDA 5KOJB 1G4AE 4M0LA 3GDBA 4N03A 3W79A 1CS6A 2FWLB 1JUFA 5E5UB 2CEAA 3QP3A 2CBGA 4J0HA 4ZAKB 1U28C 3QU5A 2WFZA 3EIUA 1L7XA 2ZUBA 3V6MA 1Q0PA 2IH1B 1MCIA 1A96A 1Z9BA 4U8GA 3SEFA 2XVAA 5D7LE 5HDQH 5C0FB 2VH5H 3BS4A 2J48A 2QIOA 1GFZA 3IS3A 5JJBA 5C8DA 5L9DL 3V5DA 3SIRA 1MC8A 1SVNA 1A6PA 4RJLA 2YVQA 2TMDA 4FEEA 3FDIA 4BNZA 2NY2D 4UQLA 4EJ2A 1XQ4A 1KVTA 5FFFA 4YR6A 4F4UA 3QJ5A 3OGCB 4LASL 1E6JH 5JS1A 1D7BA 2DBRA 2P3SA 2TRYA 1I10A 3LL7A 4DJTA 2FW7A 2EDFA 2LCQA 3OICA 4RJ2A 3WDLA 2IV2X 4Q3BA 4XD7A 1RWPA 1GL7A 3LVRE 5KX5F 2Y66A 1PQ4A 1SVZA 2DFPA 3LHPH 2NU8A 4LLVA 1NBHA 2AFIE 1OAKH 1X5HA 4JU9A 3WQSB 1A0QH 1OP5H 5AW9B 2X9VA 5IB4A 1DG9A 3N5CA 3HZYB 3WBBA 3AF2A 5AVSA 2VN6A 1T6ZA 4HCJA 2DKOA 2PYDA 2JIDA 3DSNB 3ULVH 1Z6PA 1KMHA 5DEOA 3RJTA 4ROSA 1C9SA 1YSOA 4YBLB 4X1OA 2ZXQA 1DBJH 1Y6JA 2QSQA 2I76A 3WLAA 3RHSA 4HKJB 5CCBA 4Q16A 4RGNE 5H37H 2G67A 2ZCJA 3O8BA 4WOKA 5DD1H 3LXAA 1REQA 3HR7A 5BS0E 4CMMA 2DSNA 3KWXA 3ULSB 2BZ1A 5T64A 5F7UA 4Y5VB 4L0CA 2DT5A 1G5QA 1KXZA 4Z99A 1ZD6A 2QKYA 2RH8A 3RRNA 1H2WA 5M04A 3CCBA 3L1FA 1L7TH 4BUQA 2IIJA 4XGQA 3DI2B 2ZTMA 1YAIA 4DKFH 4S12A 5T5NG 1OCWL 1F97A 2XPZA 3UH8A 4FQLH 2ZUDA 1ULVA 2IQAB 1OP4A 3PC3A 1FL5A 3OQ6A 4FOSA 1UEJA 2I65A 4HZIA 4JRLA 1LEIB 5ICXA 5SX4I 2P2ZA 1T2JA 5C9KA 3FE2A 2AX4A 3QS3A 2N56A 1Y4DE 1JDDA 2IHTA 4KN5A 1AN0A 4D92A 4RX1A 4WI2A 4EAQA 3N76A 3HS3A 3WGUA 5KKAA 1EAPA 4XBGA 4ZMTA 4QOHA 3X1FA 2GJ9A 1QIJA 4HHGA 2C9OA 3P19A 4MWZA 3FHEA 1B3RA 1UM4H 4X5RA 4AZ3A 5BW7A 1SOVA 2WY3B 4B1FA 3VNVA 4LECA 2ORWA 1M2KA 2F58H 2HNKA 2E9JA 1HT0A 4WADA 4QTUB 2XJLA 2C4KA 5DOZA 3TZCA 3NZHL 1B2RA 3EQ2A 2L7UA 2XIDA 2XDQB 1JA1A 3HLAB 1ESZA 1I82A 2PT7A 4AUEA 4XNYH 4E41E 3UO8B 2ATAA 1BAPA 5CR9A 4JY5H 4AT6A 5DLML 3U3XA 3GMRA 3JCZA 3N2GB