3ZE0B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
465
Chain Sequence
b'PNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 107
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze0B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze0B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze0B03
2NUTB 5HGJA 1QCYA 4G1EB 3PPXA 1FE8A 4JX0A 3EGDB 4GZ8A 3N2NA 1IDOA 3EOBI 1U8CA 1ZONA 5LN1A 4MMYB 1L5GB 5KYWB 2P28A 1IJBA 4IGIA 3RAGA 4F1JA 2O7NA 1JEQA 5E6RA 4CN9A 1SSLA 1ZOPA 1PT6A 5KYXA 3QA3E 1IJKA 4UM9B 5BV8A 4Z7QB 1JLMA 3OL2B 1UEXC 1YVRA 2UZYB 2WW8A 1BHO1 5KYXB 5E6UB 3ZE2B 3HXQA 3NIDB 4BJ3A 1CK4A 1RRKA 3FCSA 3K6SB 2IUEA 4IHKA 2NUPA 4WFQA 4WK0B 4C2AA 3OKWA 3AL8B 1Q0PA 3TXAA 4UM8B 4XW2A 3FCSB 1FNSA 3VI3B 1M2VA 1M10A 1SHTX 3K72A 5E6SA 4MMXB 2VDKB 4WK4B 2XGGA 3K71B 1AO3A 1AOXA 5HDBB 5KYNA 3ZDYB 2ADFA 4K3JB 1M1XB 1OLZA 4UM9D 3BN3A 3PPWA 3Q3GE 4O3TB 1N9ZA 1U8CB 1LFAA 4CN8A 1TYEB 3HXOA 4FX5A 1YUKA 4F1KA 3NVQA 1JEQB 5E6RB 4G1MA 5ES4B 3T3PB 1DGQA 1RD4A 1CQPA 3M6FA 2ODPA 1PD1A 1MQ9A 2I6SA 3TW0A 1ATZA 4C2BA 4PN7A 3FCUB 1JEYA 4NEHB 2ICAA 3EFOA 1M1UA 2B2XA 3EH2A 1SHUX 4FWWA 2NUPB 1XDGA 4Z7NB 1MF7A 3NIFB 1T6BY 2NVOA 4HQNA 2VDLB 4Z7OB 3NIGB 1M2VB 1U0NA 1OAKA 3K72B 5E6SB 5KYUA 2QTVA 4WK2B 2XWJI 2WINI 3ZQKA 3AFCA 2VDOB 2P26A 2VDQB 2VC2B 1SHYB 1QC5A 4IXDA 3TCXB 1SQ0A 4MMZA 1PCXA 4O02A 5KYUB 3ZDXB 3E2MA 3V4PB 1U0OC 3EGXA 2VDRB 3ZE0B 3EG9A 1PD0A 1JV2A 1BHQ1 2I91A 3PPVA 4G1EA 4O02B 3ZE1B 3EGDA 3GXBA 3AL9A 1AUQA 3HI6A 4HQLA 1YVPA 3EG9B 4HQOA 4HQKA 1JV2B 4MMYA 1L5GA 5KYWA 4G1MB 4C29A 1M2OA 1DZIA 3T3MB 5HJ2A 2VDMB 3BQNB 1MQAA 4JDUA 2VDNB 1RS0A 3VI4B 2XWBF 3IBSA 1JEYB 3BQMB 1IDN1 4NENA 3OL2A 1T0PA 3EFOB 3IJEA 4M76B 3ZDZB 4HQFA 5E6UA 4CNBA 3K6SA 4NENB 1N3YA 2M32A 2ODQA 1ZOOA 4A0QA 3PPYA 3F78A 3AL8A 3IJEB 4WJKB 4O3UB 1XDDA 2VDPB 3OKYB 1MHPA 1NA5A 5KYYA 3EOAI 1QC5B 1RTKA 4MMXA 3F74A 2X5NA 4MMZB 3EH1A 2NUTA 5KYYB 1V7PC 3K71A 3V4VB 1XUOA 3EGXB 3TVYA 1MQ8B 1M1XA 1MJNA 4DMUB 2I6QA
chains in the Genus database with same CATH superfamily
4LMQE 3KVRA 2JJ8A 2IYWA 2RJ3A 1U8FO 1C0EA 2JCSA 1ICTA 2FN7A 1KXTB 1GSKA 3NXKA 3QORB 2FI1A 3MBEC 1P0CA 2R51A 4GRLA 4Z7VB 3J07A 3X1MA 2DEUA 5H2BA 2VDPL 4MGYR 2XV0A 4QOEA 4GDMA 3H5TA 4C0HA 4LGPB 1RQGA 3QQNA 3QVMA 1RJEA 1KU6A 4F86A 3GDBA 2B1QA 2IWEA 2X1LA 3CRZA 5FW6A 4U4IA 1UQRA 2VN7A 1GY1A 1XXDC 2YMOA 3CJQA 4GI9A 1LDSA 4R2LA 3VXOA 2WP3T 4HS6A 4NRYA 5GVRA 3VR3D 2Q3LA 4H8WC 3DYOA 3LQ1A 2BSTA 1ID1A 3W4JA 1KTIA 4Y2DD 3O11A 2C5AA 4H44C 2X8AA 1X9LA 1SVMA 4HQOA 4ZPVB 4M99A 3MTDA 4PBXA 4FCHA 4F7PA 4F3NA 4D44A 1PRYA 3I2IA 4MB5A 1PX3A 3GN1A 1BGXH 4OFVA 5A6MA 4EUPG 4ORZC 4PGCB 4PJGA 5L8KB 2FJ0A 3F6LA 4H88H 2HFTA 1T8RA 2GLUA 3IDGA 5FQNA 5AB0A 4FT4A 3X17A 4FJZA 3ZNPA 5BMVB 1HNFA 4EYGA 5E6RA 1AB6A 2I9LA 2BP5M 1CEEA 1GKKA 2L7UA 5CLWA 5B1HA 1R1DA 5KHOC 1AKMA 5IGXL 4E2YA 2DBQA 4PUBH 4KMRA 4I9FA 4NR0A 4I4LA 4NZFA 3TBBA 4N2OA 4JHWH 1E2QA 3B6IA 3EGIA 3QKSB 4RWEA 1Z9PA 1Q0ZA 4UUNA 3FPAA 2IIPA 4UM9D 2P9GA 1N64H 4QXRA 4KR2A 3O8XC 3F12A 3L9EA 3VU8A 4JCWA 2PH1A 3EADA 4K03A 4KXAA 2BTEA 4BEJA 3EAKA 1WCWA 3ZTTA 2AF3C 5ITFB 4JELA 3UG6A 4XNQA 1ZEMA 2JKZA 4BNNA 1Z62A 3FFCE 4PG2A 4AZUA 2F9BT 4OQLA 1K3FA 3GJYA 2GYYA 2NUAB 1LY1A 4R96A 2I24N 5DK0A 3K0CA 4YUEH 2PJRA 5KVDH 5TH2B 5DR5L 1QVRA 1SHYB 4O02A 3MVSA 5DI3B 4IH9A 4HC1L 4R26L 3ULUL 2Z93A 4LP8A 3P45A 3THML 1ACLA 1XCPA 3FCAA 4M7OA 1OKKA 2IXFA 4R1QA 4U3CA 4BCDA 4OI1A 3KS0J 1ZLWH 4FK8A 4MW4A 3KYOB 4P86A 4FNGA 1ASOA 5KS9E 821PA 5DZVA 4HYTA 1GRRA 4JBIA 4HJ0D 1I9RH 3KPSD 3D0RA 4D0DA 2VBGA 2A5LA 4C54A 1EUCA 1N26A 3F6IA 1AXRA 3ZLJA 1UPAA 2X14A 4YHIB 4L27A 5BRQA 1OAOA 1A9XA 3QYCA 1FU8A 1TUBB 5EOVA 5JUWA 5ICXA 4BN5A 3PWPA 4AB1A 5EBLB 4QTHA 3PD7A 1CFBA 12E8H 2ZRJA 3ENQA 5BXQC 1M33A 4BJ3A 5FW7A 2K9UA 4PJCB 3UMBA 2EFGA 2RFLA 4NE7A 1YL7A 4KY1L 4BEBA 3KQMA 4YJFB 4R4BB 3ANMA 3L82B 3IN0A 5CNKA 1Z2CA 4ZSOB 4UF7C 1TM2A 4Q3OA 2DGDA 4I88A 5K59F 2PTUA 2PTGA 1O5PA 2ZP9A 1NDQA 3C74A 4N22A 4LAQH 5H4ZA 3BSYA 2JB9A 4N3CA 4YAIA 4E5XA 4UQ2A 3M6FA 3W79A 3RWCB 4LCUA 1QFSA 4GSRA 1CDDA 1G3UA 4AYGA 4DQOL 1IGCH 1TQUA 4KFRA 1BDYA 1DHTA 2L0XA 3BQUA 3ZT6A 2XWBA 4W5WA 3FTZA 1PS9A 2Y1EA 2DQFB 4I4CA 4PJ5D 3VKWA 4I4TF 4ABQA 2CA4A 4BBZA 2WABA 3EIEA 2DECA 2YWZA 1KSHA 2A73B 1ZNQO 4A2MA 5FJJA 3STYA 5KOJA 1TITA 4LVOB 5GGTH 5I0YA 1K7SN 4G1MB 3QUHA 1BM7A 1C50A 1VJDA 1YBHA 4X7RA 4G6KL 3ER8A 3VDAA 2P5WE 2XUZA 4L72A 2NY3D 4CRWB 5AI5A 1W2HA 1TDJA 2H9AA 3ZUPA 3R09A 2Y2WA 3VR5A 1ZJYA 4UQCA 5IJ9A 3E1KA 1GGCH 5IX8A 2R751 2WVVB 1G9XA 4GKJB 5CZXC 2Z43A 1J7VR 5FGBA 4IIFA 4QMEA 4X8HA 1TTRA 4Z7JA 3WL7A 2CXXA 3E3LA 2LDXA 4IDAA 1EUDB 3E9ZA 2Z92A 2XWZA 5D86A 1GDDA 4JL2A 3QKRA 3DBSA 4YZFF 3V0FA 1NOLA 4IBSA 3TZLA 1SBBA 5AZ2L 1RQPA 1S78C 1Z88A 2ID4A 4HS3B 3AEZA 1FUYB 1K5GA 2IEIA 1N6UA 4M7PA 4PBRA 4RTKA 1FNLA 2FFBA 3DPUA 4DO6A 3TN0C 2BVPB 1HJCA 4LZLA 2X1WL 2RD0A 2A9FA 3K96A 2AZTA 3TO5A 5C1IA 3Q8KA 2CV1A 4JFUA 4RANA 3SOPA 1N78A 4MWTA 2W58A 3HB1A 1PO7A 5B6JA 1U9KA 3H83A 4YFLI 2YJ5A 3HU2A 4XWAA 5TF1L 2HPAA 4XWGL 4KRLB 1Q0LA 1V6CA 5EA0H 1F06A 3HI1A 2WIJA 1GVIA 1I94B 3VSUA 3O8RA 4BQBA 1ZQ1A 4FQXD 3PHSA 4X98A 1GIGH 3FRJA 4JPSA 3F1LA 2QAGC 3BE1L 2FB9A 4LRNH 1U9JA 2QW8A 3V8NA 1DLIA 1C9KA 2O3RA 1A8SA 2VZ9A 1G6RL 4AJ2A 3PE6A 4U6HA 3PQ7A 2I7SA 3FTSA 1IUNA 2QTWB 2IOHA 4E7OA 1S3KH 3IV7A 2VDOH 3LRLA 2AEQL 1A9SA 1XJCA 5IFLA 1TVDA 3TDNA 3N85H 5JS8A 4O4YH 4DGVH 4G6ML 2QM8A 4BU0A 2G5GX 4ZS6C 2WXGA 1B2RA 4D8PB 5I6MA 1U63A 3Q3GA 4RZQA 5K3FA 3T5BA 1ID8A 1KLUA 2W0PA 3T4UA 3F5WB 2W48A 1G5AA 5DJ0B 3LDBC 4ZX6A 4FFPA 3CZUB 1UQSA 4L0MA 1R5VB 43CAA 3N2LA 4W4OA 1B0GB 3NHBA 4XVRA 4G6AD 2I2WA 2IANE 2J87A 2W6JA 1GPJA 4Q9BA 3O2VH 3DXYA 3TF7C 1Z13A 4ND8A 5CLJA 5B1CA 1U3VA 4PJHE 4AC2A 3I74A 2IF7A 5DLLA 4EA8A 2BSCA 3P9KA 3RTBA 1QSGA 1VMIA 3FYUA 4F04A 4OMCA 3TRIA 4OV5A 4FWIB 1HE5A 2BJMH 1BQ5A 5MENE 4QPJC 1K6MA 2Y5TA 1YZFA 1OP5H 4XNAA 4DUYB 4DK3A 1BVKA 2YARA 5J13C 3PGFH 3DBLA 4EQZA 4EMZA 3KEFA 2EWVA 3V4FA 3IVGA 3GZKA 3VR6A 1SAYA 3PSAA 4H7FA 1E9SA 5F9AC 2YN4A 2ZJ7A 2D62A 1HDOA 2WBXA 4EM6A 4P4SA 4TVSa 1EIBA 1SC3A 3N2GB 4IDNA 4G7VH 1YAJA 1YMME 2VDOB 4RRPG 3C9NA 4Z7WF 4HEJA 1YL5A 2H3EA 3IHLA 4D92A 3HR8A 1CS4C 2CVPA 1P4JA 4YAQB 4EHJA 1HXYB 5J1SC 3V46A 1N2CE 4TRJA 2XE4A 2NVUB 3UHOA 1DKOA 4BVGA 5KQLA 3O2NA 5LPNA 1JWUB 3R44A 3TS8A 5AYUL 3F04A 4U63A 5LCVA 2X0FA 3VTMA 5FYLL 2ZJ6A 1IUKA 1PYOA 4M6NL 4LLYA 4QC2A 2NUTA 3I0NA 5KTMA 1W93A 4OYHA 1SPDA 1JA0A 3O6FC 4XGIA 1C7RA 1XCWA 3FM9A 4TF4A 3SCMD 3L5JA 3KWLA 1U1CA 2O7NA 8AT1A 2XHEA 3QO1B 3CEJA 1NUNB 3MIIA 3BSZH 3ZUNC 3RS3A 3DBOB 4WHYH 1L1RA 4PJDF 2Y3NA 5I8PA 1XQXA 1VJSA 1EQ2A 2FEPA 4HNVA 3N44F 3SF0A 1P31A 1O6ZA 3VPHA 2ZAIA 2VT3A 4W1SA 1X1EA 3UQZA 3N06B 2JCCB 4P9MH 4PCTA 4HSGA 2HGSA 1KY2A 2WT8A 4EF6A 2O1SA 1QABA 3C6LB 3FB6A 2F8LA 4O59O 1NSNH 2ICWI 1TZGL 3CVWA 3D59A 4LQCA 2Q0HA 4ENVA 1BVHA 4C5CA 1KENH 1SB9A 2J4WL 3A21A 1S7VB 4BUZA 1Z7YA 1XVSA 3W7AA 3TVMA 5HBBA 3DC2A 1HYEA 1E2BA 2RG1A 4J0DA 2DLFH 4EIBA 1XV8A 1VGVA 3K8LA 1A02N 1GYRA 4BO2A 4DERA 4IRSC 5KBNC 2QG4A 4NO3B 3EQZA 4WOPA 1GTVA 1ZIYA 1WXHA 4EG1A 3FQXB 1P2UA 1CDUA 4Z7IA 3GRWH 2P0AA 3FPHA 1MQSA 5CVEA 5E5UB 1DFGA 1K8QA 4AQ7A 3VMPA 5D2NA 5AW9B 2WQXA 3ZX1A 1P1HA 1C5DB 3JWPA 4LT7A 1UXSA 4QHUB 1NFDE 1SXJA 3KTAB 3MOQA 3U5ZB 5EU3B 2VZTA 2Y0EA 2P8PA 5HGBA 4FXKA 3R0VA 4U39A 3BYTA 2NADA 3X12A 3KLLA 4R3WA 4C7JA 4JO3L 3R19A 2XPGA 2FDRA 2PGJA 1LH0A 2KLHA 4QQNA 3LX4A 5JLAA 5JZSA 5I9TA 3W2DL 4LTNA 2NOAA 3GKWL 4GRWH 1KERA 3HXOA 3I9V1 4CDNA 5T8KA 3TPUB 4B3DA 1KGIA 1JQ5A 4KO1S 2VJCA 1KJIA 5TDPB 1GU1A 4MJIB 4X5LA 1JJIA 4DOMA 2NWQA 4G5HA 4P08A 2L42A 5IFAH 2CIIA 1MHPL 5EO0B 4ZDKA 3H19A 5EN3A 4HLDA 2UUOA 3A6LA 4J0IA 3FFCD 1UH4A 2Z6AA 1KE1A 1EDOA 3LQZA 5TJ9A 1CD1B 1XGRA 3BWUC 2Q4TA 1J5PA 2CUZA 3IJ7A 2FR4A 3WG7B 1Y8CA 2ZJ8A 5LFAA 2GN0A 2J9ZB 3UC0L 2VZEA 3SFTA 5HJGA 5D5MF 4F97A 5EULV 3W77A 1E8MA 3N8KA 3RWHA 4E7PA 1AHPA 3UMFA 3GNMH 4P46D 5DQDL 3AEUA 3M7OA 1QNIA 3P9PA 2MWCA 4W1TA 5JWOA 1L9KA 2JBAA 3WISA 1RAEA 4ZFZB 3S99A 4X6DF 35C8H 2QU8A 5DBEX 4HXGA 1AY1L 2YAMA 3R3UA 4GG6A 1AKVA 5MEPA 1F6BA 2WUBH 3SE8L 3MUEA 3CPLB 3A3KA 3SC4A 2CHWA 4JI7B 3TJZA 2ZWVA 1OXBB 4PJBB 4Z2YA 4KKQA 5ICZB 2X6RA 4IQGA 3A4MA 3F6SA 3PJLA 3FCOA 1VFMA 2QAGB 1T34A 2QPLA 4J4BA 1ZFNA 5T33H 4Z9YA 2D1QA 3H2YA 1ZXKA 3MWFA 4XYGA 5KTKA 3MV8B 4IIJA 1DBJL 1NZRA 1NNLA 2LR0A 3ARVA 2PMKA 3G49A 4E5NA 3EY4A 5B4VA 4HNTA 1EXHA 3LZRA 4YBLB 3SE9L 1YZLA 3RSGA 3VM6A 4QE3A 5K0NA 3EFEA 3PXAA 3ZMRA 2YIDA 1A4JB 2O8FA 3L7YA 3AS3A 4PGJA 3E82A 2X77A 3LDBB 4GR5A 4GGMX 2IXTA 2JLQA 2QVKA 3L54A 3QIUD 3VXUE 2BBOA 7MDHA 3GLFE 2IYYA 2XKSA 4WK6A 1ZVSB 4DVBA 3HZMA 4JPKL 2FVNA 5AVTA 1DOZA 1OI2A 4PG7A 1R33A 3PC6A 3ZE2F 3I8XA 2VQ6A 3CX2A 4HIHA 5E2UL 2RAFA 2W94A 3PGDB 3F7OA 2PO6B 1M1YB 1OTSD 4Z99A 2UWEE 1X7TA 4OLZL 4LHSA 3L08A 5F4ZA 4HNHA 4FILA 1DSWA 1COZA 2P5WD 4HC1A 1RXVA 2Y1DA 1T3SA 3B3IA 3UHJA 3ZGYA 3M2PA 5J13B 2G72A 4MRRA 1A6UH 4JHLA 4XPAH 4F1JA 2BIIA 2H47C 1I7TA 1AXTH 4XN2A 2Y9PB 5HPMA 2CK2A 4HGNA 1R0AL 2HR1A 1TVBB 2X6TA 3RGWS 2EVIA 3CUPB 3HI6H 2BRQA 1YQ2A 1Q72H 4HU8A 4F2EA 1DOHA 4NUGH 4WHDA 3DYPA 3SD5A 2DFNA 5AWNL 2E4AA 3MNWB 3GUHA 3HUJA 5AOLA 1YQDA 3P97A 2WOOA 2JHAA 3HNOA 5D1QE 5J1SB 5T1LB 3UK2A 1A4KB 4F9GA 2WWNA 2F62A 1CD8A 3QUMB 2IYPA 3HC3H 2ATCA 4Q6IA 4JZKA 1NLUA 4EI5C 3PDIA 5DURD 5KMGB 1OBHA 4P0QB 1XCLA 3K1JA 4UMSA 4G5AA 5EZ6B 1Z0JA 4M6WB 1E6OL 4DE5A 2FPRA 4KMQA 2L7QA 1VDZA 5U4XA 2P24A 3T0EE 3SOZA 5T64A 4KZEH 4X8LA 5F52A 5EU6A 2ZI5A 1WMAA 1LC0A 2OKMA 5EF0A 3GLVA 4MINA 4QKQA 4GQ9L 1PVHA 5C07B 2RE8A 3MUHL 6ADHA 4HKJA 4KAQH 4JJEA 4QKXB 1NIFA 3RYTC 1KGCE 3OESA 4L07A 2WU4A 1TKBA 2F4NA 2Y1GA 3T35A 3F2VA 3KLHD 3RPBA 1DLHA 3I6QA 2GYSA 2A3NA 4PLOB 1Z8NA 2WK1A 1B4RA 3HS9A 2C8VA 2PKXA 4DL9A 5F9JB 3OOWA 2LP4Y 4Y2DC 3IGAA 4ZYKB 3G3LA 5F7FA 4W6XB 1GYCA 2EX4A 2TRYA 4QRQA 3PQ2A 3KQLA 2NY2D 3CCHA 1AC0A 3KWUA 2DBYA 4P5MB 3RV3A 2PMBA 4HW6A 1XDTT 2H32B 3P9MA 3VRLE 3S3PA 3S7TA 4FHFA 4NYMR 1U3CA 4HPWA 4FOPA 5TLSA 3A28A 2WWKO 4K9LA 4F1SA 4NBLA 4O4HB 4F84A 2JD2A 5BXFA 4F2ME 1P5ZB 2D1TA 2RGBA 3WSQL 3L1UA 1KLFB 4IRSB 1P9MC 4XPGL 1FE8H 3NH7L 2N01B 4ICWA 4Q1EA 4Y1AB 4UPDA 2J7PA 1E5BA 4PLVA 5KNDH 2RI1A 1DELA 2R1XA 3GCZA 5AT1A 1AZNA 3MOAL 2RCNA 4EB6A 4H25B 4RW0A 3I9LA 5AOBA 5ARCA 3X0DA 4W9CC 2DS4A 5G53C 1YMMD 5JVDF 2PSSA 2H0EA 3BQNB 3O4GA 1QQ7A 1ZGHA 4XWGA 1JDTA 1KJ3H 2OZPA 2W60B 5COAA 2GTZB 1DAHA 3H9CA 2IDFA 1OFIA 4HJTA 1YJQA 4QGAA 5I7SA 4ADIA 5AO9A 1A8ZA 1SJEB 1C8BA 2AFHA 4XQEA 1A9VA 1UJ3C 3BMNA 2PG3A 5K69A 1YSCA 2V8OA 4X7SH 1OXVA 1G6RA 2YVQA 1UJMA 4P9NA 1UG9A 2HHCA 4Q34A 4IRJA 4G6FB 4K7FB 1IJBA 1HMYA 3LVFO 4NU8X 3EYOB 2OYPA 4PQYA 4WSKA 3A6HA 3HSKA 2FH6A 2AR7A 3IO3A 4X64B 1DVQA 4YFDB 1W8DA 3ZDRA 3JQAA 4JMLA 2LAAA 2CRZA 3TFKC 4YT4A 4YOKA 3B5TA 2LLGA 1ZI8A 1PGQA 3HU1A 3VH4A 3D2UB 5ILTL 5I71C 3D7SA 1JJFA 4M9PA 3JWOC 5JHLH 4UPVA 4NAHA 2EYSB 4A7PA 1QG4A 4L6AA 4MP6A 4MVYA 3LMKA 3PCTA 2X9WA 3WN5C 3T06B 2HJRA 1ZT1B 3AKDA 1H66A 2H63A 3BAEH 3CX4A 1AS7A 3LOUA 1IHDA 4P5TB 1DWUA 3H7AA 2CKBB 5F1NA 4K73A 4JLAA 4OU5A 4CDGC 5D7JD 1AP2B 4FNLH 5AVWA 2Z5LA 1IB0A 4FNPA 2IWGA 5HI3D 1LYQA 5JJBA 1P8JA 1ECJA 4OA8A 4JODA 2MNUA 1TJ3A 3TLRA 1ML4A 3UTSE 3IDIB 3ADCA 3O2DH 1QP8A 4XZ3A 2M9MA 3OPXA 5I0WA 3REWB 1RCYA 3CZFA 4ZD3L 2WR8A 1GDHA 2J55A 4LVNB 2PSDA 5DCWA 3ZZQA 2QLNA 1S9HA 4IU2A 4V0SA 1YZ3A 2EDKA 5JORA 4NL4H 4ZFNA 3LV8A 4JRXE 5G02A 3OKLA 1G2QA 1GXEA 1B8NA 2QQKL 2QMQA 4RISH 1ZIAA 4TTQA 3BCSA 5L4FA 4MUBA 4FMBB 3K7EA 2NY3C 4F5DA 4F72A 2I34A 3M6MD 3VH8B 3DJYA 3AU8A 2ZTUA 4YZFE 4Q21A 5EORH 3E03A 4TT8A 4UFNA 1VCIA 4IHOA 1E94E 1DZ0A 2IQAA 4UHKA 2KM1A 4DUZB 1QO9A 2RGDA 1TM7E 1XCOA 2VAWA 4N3NA 4X0EA 1QOKA 5CZVL 4IUCS 2E89A 4K5MA 4EDHA 3ECCA 1GGUA 3MX0B 3RX7A 1C2YA 4MGXA 3LTNC 4DGYH 2PS3A 1SF5A 1ZPLA 4KJYA 2NZJA 1DBBL 3OT1A 1SJXA 2QRNA 3Q7SA 4CVXB 4U1JB 4LOKA 5B8CB 4BV1A 1LE5A 4F37K 4LJAA 3P30L 1GCOA 4WI1A 4JENA 1N6OA 4AI6A 3FMFA 3P5BA 3BWUF 4YHYC 3RIFK 4FGMA 3DXFA 4PR5A 1AKYA 1IVNA 3TIEA 2Q62A 1MX5A 1KWKA 1VMAA 3AU9A 2ITDA 3L3KA 3MODL 1DCMA 4Q3CA 1FNEB 1MG2C 2O30A 2JKRM 4MHTA 3CZMA 2PZMA 1U91B 3PXUA 1UFGA 4K15A 1H94A 2ALAA 4FQXC 1QAOA 3T7SA 2WLLA 2W8ZA 2J5KA 2VKXA 4R9HA 3A1NA 4YXFA 1DIBA 1E28A 4NZJA 4U6XA 2IXGA 4EI5B 1CU4H 1XCJA 2CBXA 3D4IA 1G5PA 3T1QA 1LO5A 4RSVA 1JSLA 3NAMA 1EGVB 3JQPA 2C88A 3X13A 2JZOA 3OSZA 2VW4A 1I14A 4R71A 7ADHA 2C0PA 3Q1LA 5AKZA 1VL5A 2X9VA 1G19A 3OHSX 1A7RL 4ENPA 1ZD4A 1UYWL 2P52A 2NNRA 3FHEA 3NASA 4H17A 5DZSA 1GAFL 4ZQEA 4JKIA 3B9KA 3O6ML 4DKTA 1Y8RB 4EBBA 1NDTA 1D6VL 2JELL 3BN9C 5FHQA 1HL3A 5FFOA 4G6AC 3OC0A 4MGKR 3C5JA 3LH8A 4BNJA 4YJGB 1ZVYA 4RKFA 4HJJH 3KQWA 1X6VA 4ODXA 4EA9A 2L18A 3QX3A 4DLLA 2RKBA 2C7GA 1C8LA 2Z8YM 3EXHC 4R81A 3TTWA 2CNOA 1G9TA 2FWNA 2UVPA 3NG5A 2CR6A 1D5WA 4HWOA 2XIBA 5FUCE 2B59B 3ARBD 2G76A 2RC5A 2WWYA 4L8VA 5ALJA 3ZV4A 2E18A 4PR3A 5CFPA 3MRXA 1P2CA 1EM6A 3EQ7A 3TKLA 1M7IB 3KM2A 2Q6IA 3KVYA 4POOA 1WHSB 3VXUD 4WNAA 5DZAA 1HYGA 1P6WA 4UTZA 2UXFA 1BD4A 1S3GA 1MHPA 2GGSA 3R75A 2AXFA 5BN5B 3IS0X 1IGJB 3B9EA 3AY6A 5ER9A 3C3DA 3DVLA 1XROA 4GKSB 4PONA 3SKXA 5J6GB 2N9UA 2MPAL 2GM4A 1R5OA 4KZKA 3TO4D 2NXNA 3ZHFA 3GXOA 4E5SA 1E2NA 4MLCA 4HS8L 2K8QA 3ZDZE 4DDWA 1V37A 1N3NA 4DUXA 4WUTA 2IDZA 1OFUA 3P26A 2VK4A 2PPCA 1QW9A 1Q17A 4PJDE 4DQAA 2I69A 4L37A 1PTJC 2VO1A 3AIIA 4G5YA 3ZBQA 3PC8C 1NINA 4HNUA 2Z91A 5KYGA 2FQXA 4PLWA 3SCMC 2BHUA 4RA9A 2J59A 1OMOA 3FI9A 1GU0A 3C2QA 3AAZB 5D1QD 4QAWA 4P23A 4E14A 2XWJA 2DKFA 1OV6A 4AKIA 4HALA 4KPHL 4LSUH 4M0LA 3TX6A 5ANRB 3L45A 4V3BA 1O97D 4GC5A 3WKCA 4HB4A 3W3ZB 1Q1QA 4FHCA 4RMIA 5LP6C 3WZMA 5HF5A 3UYKA 1QORA 5HRAA 4EG8A 3WJ2A 5C7LO 1BXRB 3NU1A 3W8NA 5KTTA 2LU4A 3T0ED 3TZVB 2ZCVA 1UUNA 2D0HA 2QN6A 2DYPA 2UY7B 1CLOL 2PR4H 1XU4A 3RASA 5A5GA 1KPRB 2QL1A 2ABWA 3DV0B 4Y89A 3IMGA 1K6QH 1WICA 1MABB 1W85B 4KFTA 1KGCD 1PL7A 5HVGB 2DBLH 4LNRA 2GDJA 3KPRA 3NUZA 1KULA 3URKA 4Y9DA 4QFCA 4BKLB 3OEHA 3GFRA 4XVTL 3W38A 4TTJA 3PD1A 1BIIA 2C1EA 1R3LA 1LSUA 4LVEA 1VI6A 3CCCA 3ULKA 2X2FA 3NVAA 1E3ZA 3V0GA 3V6OA 4LHZA 3QJTB 4JBLA 4M36A 2V9QA 2VQ1B 1DQZA 2JF0A 4JHXA 4YRFA 4GQRA 3LPPA 4CFSA 3E2HB 1NVVQ 4IMRA 2QHRL 1KN2H 2J88L 3TEFA 2OZKA 5CEJA 1SQFA 2NTNA 2YICA 3MBXH 5KANG 1LZLA 2FPWA 3VXSB 2FD6H 1UBKS 3WMPA 4OI0A 3BWYA 2FPIB 5JXJA 2QBYA 4JC4A 2QTVA 2Q2WA 5CH3A 1LPMA 1WG3A 3CPEA 4QYOB 3ZRCC 4AJOA 1Z0KA 1P53A 3LKPA 1CGUA 3W1WA 2FSVC 2H9GB 3R5SA 3KXFB 1IQWH 4KVNH 3EGVA 4IBWA 4JBSA 1EP1B 2OC4A 3LPNA 4UNIA 4PV9A 2XWBF 1THAA 1JG6A 3HJBA 1R4MA 5DT9A 4IH4A 4UB0L 1G7QB 1J8RA 1OARH 4BSJA 2IEYA 3L0BA 3OJVC 3HXLA 1G5QA 3F3SA 2EXTA 1SBTA 3HPJA 1XTIA 4Z7AA 5D5ME 2JFCA 5F9DC 4OD3H 3EF3A 4NP4L 4GDFA 1T5WA 3VKUA 1BLNB 1EDQA 2NU9B 2ZYAA 1CJSA 1UB6A 2KYRA 3TBTB 3NJHA 3CDYA 5EPOA 3AY0A 4FI7A 4NPYA 1TU2B 2YQBA 3GEDA 5ERWB 3W6UA 4N7JA 4X6DE 4JLOA 3KCWA 4RKWA 5EZYF 3NYKA 5KBYA 4EN3C 2WZPD 2B4AA 2AV7A 1Z6XA 3RV4A 3O9MA 5LDSA 4PBVC 5JS1A 1E1LA 5JSKA 1OAZL 4IRXA 3C43A 2WP8J 5ADOH 5J3JA 3MOBL 2WLNA 1QIIA 3AW8A 1VRWA 1PR5A 5MEQB 4KOAA 2VDUE 3R9IA 4E30A 1YDMA 2K7ZA 3LYLA 2YBGA 4E6PA 5H5JA 1H8NA 1MOPA 1DVFA 1L9RA 3AR4A 1QAMA 1PWXA 3X1JA 3PREA 1E5AA 2XB2A 3ILHA 3PQ5A 1BOFA 2C8KA 1JD9A 4HVBA 4HH4A 5AH0A 3WNOA 3F7YB 2JJYA 4YR6A 2ZTBA 3MGKA 3PHQB 3GFGA 1XCBA 1IAKB 3VHRA 3G6JE 1MLCB 1AA9A 1U8HA 3KIPA 3X2SA 3LKOA 1J8HE 5FYKU 3JTMA 3UOWA 1WW8A 1VADB 2GFBA 1T1GA 1YZNA 4WNYA 1F58H 5CYFA 1L9MA 2GS9A 2Q4RA 2OFFA 5BZDB 3GPEA 4K2AA 1U6AH 2AVGA 3IBFA 4YVUA 2WFLB 2EACA 3GJZA 1S7QA 3HGQA 5FOBB 4Q89A 3JT0A 1J9TA 1JOIA 3UTSD 3M7IA 3DURA 1R0CA 4ROTA 3VFNB 1BCSA 4CODB 1PHRA 2VXUL 2NZYA 3P9IA 4TKUA 4M54A 4A2WA 4CM1A 2JRLA 3FCEA 3V6BR 3PHHA 1JGVH 4GX2A 3X2QB 1J8KA 1UJ4A 3Q43A 1QLWA 1WL8A 3U7JA 2GAFA 1TDQA 1DL7L 3C6QA 2BDEA 3US9A 3FUCA 4XW2A 3B60A 3RVJA 4B9EA 4ZHSA 2BFBA 4YMLA 4JRXD 2X89D 3QXHA 1JBQA 1NMXA 1AHWC 2ONYA 1E5UI 4BCBA 1XSIA 4TSAH 4FDTA 4BNUA 5DZNA 3LB6D 1HHGB 2GHZA 4CF4A 1KB5H 1T7VA 1L5HB 3I6GB 1VHJA 4OLXL 4RDHA 5AW3B 3WBDA 2PMEA 4KO8A 3IQXA 5JANA 4P38A 1G8JA 5JW3L 1KB9K 3OMAB 3TR0A 5C1DA 1Z5OA 1H93A 2YMMA 1RQ7A 2VSDA 2RB8A 4TWJA 1TW2A 3D4OA 1VEPA 4BX0A 2WV3A 3DAPA 2ZOLB 4P0DA 5BVPH 4ND1A 2IU4A 3LXMA 1JGEA 1MC8A 1R75A 1BX2A 2MQGA 3DDSA 4R8WH 3GYBA 3TE7A 2MOGA 2PS0A 4X7PA 2A30A 1UD4A 4CKWB 5HY9B 4PGBA 4FQ2L 1EWRA 3CSFA 3ZTJH 3VUEA 4K71C 3T08A 2WJ4A 4RMGA 1OT3A 1GZVA 3T1OA 1XF5A 1S7RB 2DMHA 4ONHA 1D5IH 4CDHA 2X4PA 1OCEA 4ZJ9A 3MT7A 3LQAH 3UGUA 1W5TA 5FLEX 2G4EA 3CVHH 4TTDC 3MRFA 5LJIA 1UD2A 3UTZB 3RA7L 4OM7A 1WIOA 1U8JA 3ZT7A 4F80A 1C7TA 1D6EA 1V8PA 5F3BB 1NGXA 1OP4A 5E6YA 2I3GA 2GM3A 1KB5B 3WHE0 4MD5B 2ESVA 5TQ2L 4OXYA 4C9BA 1EK5A 4DPBX 4PHGA 3O3OB 5CN1A 1FV1A 1SHWA 2QQEA 3V10A 4XAKE 4GW1A 5FHBL 1TIPA 3KLHC 2ATVA 2ZR7A 1F4PA 3DZFA 2BEUA 1ZXXA 1SU7A 3GM0A 4J2HA 1TECE 1WSDA 1ST2A 4BUGA 2R69H 4R7TA 3AIMA 1BG9A 3W0WE 3B4NA 4QHKI 3ORYA 3NTLA 4OJKA 3KLNA 1YAHA 4Z7NB 3ML1A 3BF8A 4ILDA 3VCLB 1CFZA 2JL1A 2QI9F 4V0MA 1M67A 1CUHA 5TR9A 1M3JA 2I33A 1NURA 3CX7A 2JCBA 3AP3A 3TH4T 4LCEA 4JB9H 4NEGA 1Z9LA 4PRDB 3C0KA 2CT8A 1BHQ1 5E0KB 5DHDA 2DWCA 1TYAE 4RMHA 3OKOA 3DB2A 1UL1X 3CVHB 4EKYA 4EF3A 2DPLA 3RWJA 4N90E 5JIBA 1VPLA 3C3CA 1DMSA 2WTMA 3VFPA 2QJWA 4JDPA 2RARA 2PKWA 3TYFA 1RSYA 5EKDA 2FF5A 3DTXB 5D5QA 2YVKA 5SZJA 2WO2B 1KRWA 3MU3A 3PRYA 5EZ5A 4X6EB 2EJWA 1FRGH 4D8WA 5DXWA 2D06A 3E3NA 5DYGA 3FDJA 1GC1H 2A74C 5IABA 1GPNA 3D0QA 1T4MA 4WW2A 3GK8H 5GPBA 1PG7X 2BFMA 1PMYA 5CVTA 1JCKA 1DTEA 5KEIA 4GW5A 2ZRMA 4BQNA 3BRDA 3B9BA 2D03L 4NNXA 3FSEA 3W4IA 2YJ3A 2BOCB 1WAAE 1FIUA 4YP1A 3VFOA 3AOEA 2GEQA 4PLNC 4JLDA 2GTPA 3DGCR 3FU9A 4NQVB 2O0KA 1RHJA 4LGYA 1ZVVA 5BPFA 1J0KA 4CNIA 2I4IA 3OV6A 3F0TA 3MGCA 2F5BL 1EVEA 1GPLA 5JXEC 2FZ5A 2PA0A 4RGNE 4AKHA 1DLFH 4L85A 1RK0A 1NAHA 3HP7A 5I8EB 3V6ZB 5HWSA 1UMKA 1FGNL 3HVUA 1II8B 1HPLA 1N7ML 3FQTB 1YEKL 1T8UA 2VR3A 4JLVA 1IBLB 4RE5A 3VJRA 4WFIA 3DOSA 2XIDA 2BONA 4TTTS 1GTL1 5BN1A 4KJPD 5ADUS 4AY6A 5LP6F 3GELA 4L9RA 4Z4GA 2YIHA 1TNNA 2OTUA 3WLQA 2HT6A 3PWNB 2OYCA 1XZNA 1ULAA 2YJZA 5ICMA 4ETQA 5JYLA 4RFEA 4R7DB 3V7AG 1EHIA 3AT9A 4R8RA 2BFCB 3CJTA 1JXJA 3II3A 4XNXH 3GI1A 2WWXA 4KBPA 3WTVA 3P5SA 1LW7A 4PNPA 2NU6A 2N7BA 4M43L 1KGSA 1YEDB 3N8NA 2AKEA 3NSXA 4L3CA 1XTLA 4GP4B 1YKGA 2XZTA 4H59A 1Y18A 1HZZA 2BCKA 4GW4A 4ID3A 4L08A 3TTUA 5LB1A 5D7JC 1A95A 4ZAKA 3ZD7A 1EFXD 2EL7A 4D3YA 2FUCA 1B23P 5CU7A 4G7SB 5AOZA 3KSUA 5HI3C 2I1LA 4XIYA 5LAPA 2JFWA 1MA3A 5TF4A 1WABA 3AETA 4NOMA 4OSUH 1F38A 2GBLC 3P0GB 3WSVA 1CGXA 2DXIA 4QDKA 2QLTA 4R40A 4UVGA 5DT2A 3LXUX 3I4LA 4YMIA 3VZRA 1JQDA 2X76A 3CU1A 4BFXA 1Y4UA 4KPFC 4CIBA 1MCWW 4IDHA 5KVQA 5CFZA 3M17B 1JIBA 5GGSB 4V02A 5A2IH 4XDHA 3ZW8A 5AZEH 4X8OA 4N82A 2NZ2A 2X0UA 1UZLA 4YHLH 2WGNB 3K20A 5KZCD 4PY8J 4JU8A 1TZ2A 1DLJA 3A6BH 1FZKB 2P2GA 3G9QA 2BVTA 4IIJF 4JY7A 1SNRA 2VDKL 4R5MA 4OF7A 3ZIUA 3HMWL 2OTWB 1PZ5B 1YJDC 1FS5A 3WGGA 4LL1A 3PWVA 4OKIA 2IDTA 3VNYA 4FC7A 3QX7A 3BMXA 3COOA 3RVTD 2XQYA 2VJMA 3EJJX 1UXHA 1LC3A 1TO6A 1WBZB 4DIFA 1SKBA 2FWAA 4BQ6A 2H5IA 2JFVA 1G3RA 2CFCA 3MGAA 4OCLC 1CUVA 2GFHA 1RHKA 1ZR2A 1E5QA 4ETWA 1QHQA 2RBKA 3VVBA 1T91A 4FPXA 4JFEA 3QJXA 2KSQA 4INPA 5KC8A 2Z4QB 1PVVA 3EOZA 3VM5A 5ITBL 2L0DA 3DR5A 4TV8A 1FCCA 3K1AB 1AY0A 4KO6A 1SOMA 1FYXA 4DAGL 1NSTA 1WAPA 4D0CA 1QMUA 1AO3A 4GOKA 3H05A 1QV9A 4V1DE 2C2ZA 1KNOB 3JRXA 3PQ6A 5AHXA 2DB8A 2VO8A 4ZW3A 4CMAA 3D5TA 4GUAA 1KEML 5JMTA 3BUBA 5LKNA 3STVA 4PFKA 1J2JA 2ZJSL 1XYYA 4E1AA 4JG0H 3DVNB 4QNRA 1ZK2A 2A6PA 3MJWA 3PS6A 1R5WA 3WMWA 4Y2XA 1N2RB 4LRUA 5I7VA 1ZM2A 4YHOL 3VTZA 1T4KB 3BHIA 3KEDA 1DEEA 3RRFA 1ESOA 4UAGA 3ETSA 3U0VA 2ETXA 1UT5A 3TIIA 4XAQA 4YHPA 4S1SH 3VZPA 3SAJA 4AS1A 2D1FA 2A14A 1AO7B 5J11C 4O5OA 2PK3A 3QXAB 4O5LL 3OT5A 3CVCA 2XUDA 2DEXX 3QZWB 1J8HD 1Q2UA 2W90A 3ICCA 4N49A 4NAJA 3PAZA 1EFUA 3S3JA 1NBEA 5KKAA 3DWIA 1NCOA 2ZSFA 4MVBD 2NXZD 3VRJA 2ZTLA 1IDOA 2C3HA 4L5FH 3V4LA 4G7QB 4UJ3A 2F7SA 5E1DA 3V95A 4BRZA 2DJUA 1AI1L 2A6KB 3ARBC 3H8VA 2FJUA 4AJWA 5KOYA 4FXPA 4WN3A 1GITA 2GM9A 4F7CA 3H3FA 2DTML 2ED8A 4HT1L 3JR3A 4MEBA 2ZWKA 5IV2A 3IURA 3FUFA 4PJGE 1Z8DA 4K1XA 3L6UA 5ITSA 1J5EB 2YFKA 2GZDA 1V45E 2WSPA 1P18A 4WY2A 4LDCA 1LKZA 2CO6B 1Y3IA 3DKIA 3MWDA 3VWJA 5AD0A 4DLNA 3I05A 1ODLA 3AR5A 1U8MB 3MJCA 4KTTE 1UCTA 3F7VB 1CRLA 4DRXB 1A69A 1OGTA 3GS4A 2VZ0A 5K45A 1WW2A 5TD4A 2OHXA 4X9XA 3WO4C 3PQCA 1T2UA 1GPOL 3ADKA 1K63A 3D4GA 2P67A 4Z8XA 2R39A 3QMPA 1QBLL 2GG1A 2BRUC 5KKCA 3O6KH 3D09A 1NCDL 3MYRA 2ZETA 5IQLA 5B1AB 4G41A 1JHTB 5D1QC 1MCHA 5H83A 5JMOA 5IDYA 3EA4A 2FUNB 3G6AB 4YR9A 4KNYA 4QLAA 3GUTB 4GUPB 5DMKB 4LFBB 5DEJA 2DQHH 3BAKA 1O97C 4MMYB 5B6IA 4AL8L 4JANA 5GS1A 2B21A 4V0RA 4L5BA 2ZXFA 5CJ2A 3GH3A 4C6SA 3EDMA 4HK0A 4X7TB 2X8BA 5HM8A 3V4VH 2IVFA 3U4BH 4XVJH 3DCNA 1AK1A 4HDIB 7PCYA 4QUJA 1OY1A 4RNCA 3T0EC 2BSQA 1UWXK 4I8XA 1E8WA 4NJ9H 3BRWA 2DOKA 1E4KA 3DT9A 3CCBA 4GO8A 3MBWA 5TE7L 4XI5D 1R4AA 4G9DA 1J00A 3H17A 3W04A 1U58A 2X0VA 4TV9B 4APQB 3ERCA 3DRTA 4UHCA 2C0QA 2G80A 2MFNA 4G1CA 4EFKA 4RIRB 4TS3A 1J0YA 4FCTA 5I5MA 4XAKD 2QMYA 3PWPE 2H57A 3INNA 2PYEA 4F2HA 3ARDD 2I2DA 1E1RD 1YJDH 2VM9A 1GQOA 2FKNA 2V7QD 2A4ZA 5E4JA 1U3HA 1KZ1A 1RAGA 3W0WD 1NL0L 1I10A 3KB6A 1XGPB 1GPDG 2ZJOA 4W6QA 1MFZA 1WTGT 1XR3A 2ZOSA 1PD0A 2VYFA 5TDOA 2W9EH 2WSMA 5T1KA 3QUQA 1KGYE 4OQPA 2CU9A 4J6RL 5DK6A 1S3FA 4RK7A 2OCBA 2Q1UA 2R2HA 4QTUB 5MERA 4KOEC 4AX8A 5IYZA 1DSSG 3ONWA 2AMVA 1G7TA 5C1PA 4AK2A 4N90D 4PYGA 3ABGA 3RIKA 1C81A 3Q8LA 4GMTL 3V4VB 3AI3A 4OP2A 3LT0A 1YEIH 3QUTA 2ZRHA 2UZIH 2NY7H 4U1NB 2HKHH 3UAEA 2J5WA 2H29A 4TROA 3TEJA 4KJXA 2GAIA 4XTRD 1U33A 4XTCS 1MDFA 4B6QA 4UOJA 1KOFA 3GSQA 3DRQB 3H6KA 4H40A 4BEVA 2J44A 3S1LA 5FV1L 3OX1A 3QDHA 1N2JA 5HA5A 1ZA3A 3C8KA 1BIFA 1N0WA 1OGAB 3HS0B 4QTXA 3B8YA 2MR6A 2VSQA 5E4OA 5IF0B 1ZGJA 1KIQA 3IU4L 4K3DL 4PJAB 2CDFA 1CFQA 1QFWL 4II7A 3AZQA 5IAKA 2B25A 3E9DA 2ATPA 2ZT8A 3BIWA 3N1MC 5JYDA 2LR4A 3KH4A 1FK8A 1IVLA 5TQ2A 1Y7IA 3NACL 2AUNA 4I5BA 4YSCA 3UTCA 5TXGA 5KOMC 4RGND 3DXAB 2PS1A 4JPQA 4OPMA 3T77B 2Z4TA 3DMYA 5KSAC 4Q93A 4GZ3A 2HN9A 4YDIL 1DEAA 4JLRA 1FLRL 3AF6A 2YZKA 4GXUN 3KDMA 1NF2A 4CG2A 1Q9OB 5C2BH 2GRUA 1GEGA 1W72A 2O57A 1QRTA 4E51A 1DKUA 1PW5A 1QYVA 4UTRA 1Q9WA 2Z31B 5DBFA 2AAVA 2ORVA 2Q27A 3GPDG 5K4HA 3S70A 2M6LA 5JPMA 4Y9FA 1DIRA 5CT4A 1OPGL 3ZYCA 2IPAB 2DN7A 3NIDF 3DIFB 3A4NA 1PFYA 1JGLL 1WQ1R 1UANA 2WQUA 4HGWA 3IB6A 5BV7L 4IJVA 3PF2A 4NRDA 2JVJA 3IA7A 1FEZA 4U6VH 2XWTB 3FPYA 2RBLA 2CDGA 4AGOA 3ZDYB 3Q3GE 3PPWA 1BYIA 3NFSL 4XD2A 2P35A 3UJHA 4DWOA 1KT2B 1NN1A 1HYBA 5LLSA 5CFOA 3Q2KA 3TRDA 4UWQB 4OUDB 2NNXA 3PFGA 2QSTA 1GUAA 4LSMA 1TJ4A 3CRW1 1CE1L 1UFUA 3MINA 3RVBA 5J11B 3P9LA 1SBZA 3QNWA 1UJTA 2SBTA 3QFHA 4MUKA 1UASA 4PRAA 1H6BA 3A7DA 4M9ZA 4N8VA 4LOUD 1N2ZA 3A1FA 4AF8A 1L6XA 1KH1A 1NI4B 1ZIPA 3KX2A 1VSVA 1IXZA 2XWCA 4MVJM 3N58A 1IQRA 2HTEA 4R6WA 3KETA 4B8ZA 5DGHA 5ADPL 3S4SB 3QRFM 4ZI5A 3MV9A 1F8XA 4HWSA 5TY0A 4CV3A 5DFTA 3MA7B 4LIQE 3HB0A 1MCLA 5D1XB 4B3GA 1E5LA 3DZCA 4HRAA 3GGWB 5C51B 4OGLA 3U9PL 3UFIA 2ZTHA 3RSLA 4D1YA 3BUPA 1YS7A 1DVSA 2ZIDA 4GOMD 4ZVKA 2QAJA 1WFIA 1U8YA 3VDNB 1ZEAH 1LO0L 2R65A 2Q3HA 2G8NA 2ZJ2A 3FDZA 3ZCXA 4EI0A 4II3A 1RACA 2ZRLA 4PZ0A 2XEXA 3RIGA 3DECA 4P3XA 2QY6A 3U3XA 1ZAGA 4EX7A 1ZH0A 5FA3A 1JU9A 4FYQA 1MFDL 1CF9A 2R4RL 2ZT5A 5ACZA 4C56A 5LB4A 4TUKL 5EPEA 4XVSL 2ISSD 2GN9A 2WYOA 3ZKWB 1BQHA 2AD1A 4CV2A 3WO4B 4MIOA 5B7PA 2CVOA 4HK3N 3GZNA 3H97A 2QROA 3Q8BA 2PIAA 4YT8A 3K09A 3DFUA 5H3CA 1IAIM 4PQFA 4V1DD 3O2QB 4UATA 1MXGA 3OKMB 4Z77B 3BEVB 4GQBA 2VHQA 4GL2A 1TZIB 5L88L 5BUSA 3ETLA 3WG9A 2WNSA 3HJ0A 1FI8C 3ZZ0A 1URIA 5GJSL 2HAEA 2B98A 2UV8A 1ZCRA 2OP4H 4GRLD 2VQDA 1NE7A 3FB5B 4L1TA 2BY3A 1RLTA 1F3RB 5JXIA 3U60B 4K23L 2PGOA 4INOA 4KR9A 3ZK9A 2ZCZA 2QXUA 4HV8A 1GQQA 4KH1A 5I26A 4AG4L 4FXOA 1U5BA 1FP6A 2ZDHA 4XM2A 1EAMA 2OAAA 2IY8A 1OTXA 3SQDA 2H2DA 4JN6B 4K6FA 4PSAA 2JB5L 4Z9FA 4AIEA 3MRIA 1F8TL 4OYRA 3N41F 3OD1A 3ZEAA 2J31A 3SBWC 3ZTNH 4W9IC 3AG4B 3L4ZA 2JWYA 4Z0TA 5FDWA 2V1XA 2ZP0T 3FNBA 3NV9A 3RFTA 1FW6A 3VYNA 1BQLL 2DQCH 3O8BA 1P5VB 3QDMB 3A2MA 1WCQA 4Y16C 5CBPB 1CLEA 1ZWLA 3EMDA 5FUCC 3O84A 1T5BA 4MULA 1CP3A 1MCIA 2YWBA 5FNZA 5T3XL 3S36L 4RZKA 1EHCA 3A3NA 2V2XA 1UD8A 1I33A 2WXOA 3ZMEA 3LMJL 2PTTB 1J5HA 2X1XR 2OQ2A 4E94A 4OCYH 4LZWA 1A2YB 5D2NE 1M8FA 1ND6A 1YZHA 3MI6A 2C4XA 3P2OA 1SXJE 1QHYA 1J9QA 1MRFH 2UWEF 4U2KA 5AALA 3LZNA 1DDIA 4C6RA 2FRDA 3VO0A 1YN7B 4DKAA 1XMXA 3FY4A 1OSPL 2WAXA 5IBUG 1MXFA 3IXTB 2KJQA 3NNNA 3GBML 1GADO 4RMUA 7CGTA 1CLUA 5DUMH 2XNKA 1YQVH 4URKA 4N0UB 2IADB 4HD8A 1RZKL 1F7UA 3I2GA 3FUEA 3O2WL 4Y2HA 5U9CA 5EBMB 3ZPXA 1PJBA 2A6JA 1TETH 2E49A 1T1YB 4AGQA 4EL5A 1N3YA 1PZNA 3CO5A 3FWPA 1MAWA 4RNDB 3QEAZ 2VHZA 1NSYA 1IY1A 3NK3A 4NU0A 5B4TA 5LQAA 3OHMB 3E0QA 1TMOA 4O0MA 2PVCA 1YEHL 4DNPA 4DHEA 1D2OA 4N6GA 3WKEA 1KAGA 2CLVB 3ZO9A 3BM5A 4E33A 5A9RA 4K94L 3C12A 1IEAB 3IMRA 3D43A 2QR5A 3AV0B 3PP4L 4JM0A 2FYTA 5C8ZA 4F4DA 1T0PB 5F71A 2WQZA 4IXTA 4BQPA 1GNSA 4XWOA 3PITA 3FAZA 3BWVA 3TLAA 2WN3A 3B70A 3NO4A 2FBRA 5EN4A 3L01A 1OKKD 1YCSA 2OXGA 5C0BA 2P0YA 2EEAA 1ADQA 4NPAA 4NQSA 1M6OB 1X7WB 1ZX1A 4FEAA 2WIBA 3D3WA 3TR5A 1IVSA 4MWFB 1K4MA 4N65A 2UZXA 2WY3B 1SUBA 4FCCA 4L28A 2EDMA 2REQA 3V5DA 2I5YL 5ES3A 4N0MA 5JCOC 3P32A 2AEJA 2RKOA 1JZDC 2VTBB 3IMWA 4LP5A 4XOBA 3IP3A 5JRZA 2H26A 1AGBA 1RULH 1H05A 4RSGA 3SF8A 1K1EA 3PWPD 1PZUB 2OGSA 5GGXA 1QWSA 4WLCA 3ZJVA 2EE2A 4X4YA 4JL5A 1BKSB 5D8JL 3BMOA 4C4ZA 1Z75A 1T0OA 1HZHH 5D7NA 1RHFA 4Y2VA 2O8BA 4HCGA 5I1AA 3X1WA 4BNKA 5DRXA 1HHKA 4NH0A 3P2DA 3SC3A 3P4MB 2AH5A 5DCUA 1IZJA 1E2EA 3FO1A 1N6QL 1E79A 2EKJA 2B1JA 5LXVA 1NGPL 4IS6B 1TEZA 1EJ8A 3VRLF 3SHQA 1FL9A 3OPYA 3PWJA 4JW3A 5J3HD 4N2NA 4LJ6A 3GBLA 5D00A 4G8EA 1JWBB 1TTTA 5C92A 4BJHB 1JN6B 4IIZA 3BAXA 3NN8A 3E8VA 2DKOA 3BQUD 1I24A 2I2AA 5EMJA 3K5SA 3MRNB 4XBPB 4D9LH 3NJRA 3B5EA 1YZZA 4XAWH 3KT8A 2CHQA 3VDRA 4WJG3 1SUJA 1R6XA 3LQKA 4Q7JB 1NKVA 1HL8A 1Q7GA 4RLSA 2R7KA 1GGBH 1QA9A 3M5PA 1VL8A 4RPLA 1RZ3A 4GIPD 4C30A 3Q6FB 2PX8A 4FEEA 1DOAA 3IAS6 4BK8A 1FTWA 3PGLA 2IZ1A 1QRDA 2H6PB 4GSYA 3VR5D 3ATBA 5C0AA 1IAOB 5LBSH 3E15A 3P0JA 4MZ3A 4TZTA 3AJEA 2YSSB 1AGNA 3E0GA 3D54D 1TT7A 4M1EA 1G7IA 3EBAA 4B7UA 4I48B 3NHMA 3KFVA 4HUWA 3IDYB 1QB8A 5FV7A 4FKBA 4DDUA 2NPLX 3A4VA 4DXDA 5CCKL 4EKIA 1YNKL 2GKIA 2J1LA 2DWQA 4YRQA 5IBRA 3EUUA 5CJOH 2IKSA 3NBXX 2AN9A 3KLSA 2X5KO 3K15A 4TXLA 2I07A 4G5ZL 4F3TA 3ZTDC 2BGIA 2KPOA 2X1HA 3EOAA 1ZTMA 4FFSA 3VX0A 4YBRA 3DTDA 4A82A 1ECZA 3K9LA 2LD4A 3AHDA 4B3FX 5DSTA 5FUMA 1E1DA 1N32B 5EZIL 5LKAA 3OJDB 4FJ0A 4GNKA 4Q9QH 3P3SA 4UAUA 2V7NB 4H1LA 3LVQE 2WE8A 5EU6E 1LI5A 4D8TA 1NFIB 2FT6A 4UEQA 5L3SB 1SR8A 1EDHA 1TCVA 3X1ZA 3PNSA 1A5BB 7REQB 3PDUA 2BEWB 4WA7A 1QH8A 4Q82A 2WMOB 2ED6A 4PP2B 2AQ1A 5AW5B 4Q37A 4OGFA 5KWEA 1DTSA 1Z3CA 1S3IA 2PQ2A 2VMEA 4D9RE 5HRCA 1NCAL 3EFDH 3V52H 4ZMZA 4BGUA 3AZUA 1OH6A 1GT6A 3WIVA 3PX2A 1S9XB 4IWXA 5J23A 2NXZC 5L8LB 3GJTA 2KW5A 3V1NA 5I6PA 4NUPA 2V3DA 2BS71 2VF5X 2WTEA 4IIDA 3MAJA 5T5FH 4LRQA 3R6WA 5DK4A 3BH4A 4ODWB 2W6NA 3QPUA 3GMOA 1T2CA 3F6RA 1QOPB 2W6JD 3FHOA 1C80A 2JI3A 1FYFA 4UI2A 2Y0DA 2K5UA 3NANA 3KZOA 3ZLUA 1S2MA 1U5AA 2QMZA 2C34A 4KOBA 2XA2A 1O94A 5FPHA 3HS8A 5GJTL 1NQWA 2CFIA 3VA7A 2P9BA 2FW1A 1TTUA 4QBGB 1R4ZA 2C7OA 4XMKH 1ABEA 1E8XA 5ADHA 3FS9A 4YMWA 5DP2A 2ZBFA 2DFTA 3SZLA 1MR3F 2GUYA 5DJAB 3TUJC 1EFLA 2X8LA 4Q9JA 4Z7WB 2NXCA 3QUXB 4GIOA 3VR6D 3OEYA 3B2VL 4NTZA 3A1CA 4CV0A 2WFMA 5IJKC 4LXUA 2JKNA 3SZUA 4WKBA 4OJMX 5I30H 1ISGA 1MHTA 1SOVA 1EAJA 1BX1A 3SDXA 4Y2SA 3U3OA 2O8CB 4ID9A 1L4MA 5CLTA 1B93A 1B4LA 2YO3A 4UILH 4H8WH 2X40A 3HRZA 4PEVA 3W2GA 3S88H 5DRNA 3DFFA 4D9KA 5CEXA 1Q2XA 2F43A 3D33A 3ME0B 2FPPB 2AFHE 5DMIH 2D0IA 4JSTA 1RZJL 1L8AA 3LC7O 3E23A 3O3BA 4R90L 1Z6YA 2QPOA 1VEOA 2NLJB 3CLFL 1HOEA 2OBBA 3KL3A 2XADA 2H9IA 1RKBA 2P79A 1T04B 3D87B 3Q8WA 1BFOB 1JE6A 2JEOA 2EGGA 2H2PD 1JPFB 5DJ2A 6REQB 4HJGA 4QOGA 2OHHA 4P4KA 1F13A 4FG0A 4XO3A 3MBEB 4NNYB 4Q0XL 5F7LB 2D7DA 1JBKA 4TYPA 4X99B 3K2UH 1TQBC 1ORHA 4WFHE 3QUCA 4BFGA 4U2EA 3DX0A 3L3OA 3LJKA 2R1ZA 1FFTB 4XI5C 3S96B 3WZLA 3TV3L 3MR9A 1S3SA 2W2XA 5KCZA 5EEYA 4MV7A 1JPGB 3U7WL 3UJ9A 1BQ4A 2E0IA 2JK1A 1SURA 2WJAA 3C1UA 1JSCA 5JALA 2PXAA 5FECA 4N3GA 4LIPD 1K08A 4DAOA 4PYRA 4Q6WA 4J1QA 5JAOA 1RHMA 3MRPA 2BF7A 4JYBA 3V0DA 4PJFB 3NDJA 1ITCA 2Y07L 4ASUA 2WDZA 3DZIA 1JMZA 2GI7A 1PL6A 3KPOB 3DHWC 3ATEA 2WJWA 1MO2A 3PJDA 3NP4A 1VJRA 2NO7A 5I17A 1RAHA 1ET8A 3LM8A 1HOCA 4POZD 4UD6A 4OUOA 4GQPH 4KUZH 2EKSA 4FQLL 1EHLL 3D1MC 2CNWA 2VPWA 2QW1A 3EAFA 5KYKA 3FPXA 3L5OA 1MXDA 1CKEA 2XCRB 1T35A 1XP5A 3HN8A 2HK6A 4HDKA 4OIFA 4G36A 4R7XA 2UZ1A 3NRJA 4LARL 5IEHB 3ASNB 2HBYA 3WFEL 1XD8A 1PSDA 5A4DA 4XTRC 5FYLE 5AI8A 1UKBA 2JDIA 3KJGA 2OEPA 2VPQA 1N8ZB 5FOVA 4NZUL 1SXJD 2OXHB 1DDOA 5KTNA 1E2WA 3V9CA 4G72B 4M02A 4XWTA 5F5XA 1UBOS 3H75A 4BK4A 4DK5A 1PG0A 3O8XB 3DGEC 3ZDZF 4IO1A 1OW0A 1P1VA 2D7MA 4I9UA 2I54A 1GM5A 4R0VA 1EBPA 1QYRA 1E7VA 3WYRA 1DIGA 5AI0A 4C4BA 4ZGGA 3QUKB 2P30A 2PKEA 2VDJA 2VAAA 4U8HA 3SYLA 2VP3A 4FDLA 3T0BA 4D0RA 3SVZA 1ZMTA 3OJ2C 3KQKA 3WDLA 1WV0A 2UZ3A 1JHKL 4LPXA 5E4EC 5GGRA 4EN2A 1JU3A 1QIMA 2B0CA 4RGNC 1T22B 1VIVA 2LAGB 1TTGA 1N8KA 3VYWA 3JQFC 3LXXA 4WXPA 2ZJFA 4U1LA 2UVDA 3TPFA 3AHCA 5AW0A 4Y8VA 5K5EA 4P92A 3NIDE 5I1DA 1M5UA 4JBXA 5NLLA 1YR1A 1D5MB 2PCLA 1RQRA 1M5RA 4K9OA 1A96A 2OGZA 3OPUA 3NOQA 3CDZB 4TV8F 4DR6B 4A37A 5CH5A 4ZQHA 3L3BA 4A6YA 3DX9A 3TOVA 5B3JA 3IDMB 4PLFA 4WU5A 3KQHA 1M2VB 5AAPA 4QG3A 1O9VA 1V10A 2FJGB 4KX8A 2Z8VC 4E22A 3KELA 3AHIA 3ZKND 4DV2B 3ZU3A 3E22B 4WN9A 4PIPA 2D7NA 3EGDA 1M34B 4Q4LA 4RZIA 1SK8A 3MUUA 1VJ1A 4KH9A 4L8SA 1MUUA 1NBMA 4AW9A 3WXMA 2A1WH 5B1JC 2EIDA 1L8LA 5KTRA 1FNMA 1AXGA 1K88A 3LNHA 2OM2A 3QSGA 1D09A 3D6FA 3ZBUA 1NBCA 2K0RA 4LX0A 2IH2A 1QTYT 5BN4A 4TRRA 4MRCA 3BXZA 4D7AA 4QXTB 5IW1A 4G01B 4LC1A 4MHHG 1A8JH 1MZVA 1RE0A 3E58A 2KB0A 2YAHA 3KD2A 2EIZB 3DUHA 1TEXA 1AJEA 3FVQA 1L7VC 3DOCA 2NW6A 4A38A 2NY5C 3L1GA 4JO1H 3MLRH 3ZE2B 3PFWO 4UE2A 4NNPH 3R7RA 5KKNB 2CXSA 1T66D 2QVBA 1X80A 3U82B 2IPMA 3CV3A 2E9IA 2PWYA 4P84A 1MRZA 3D2TA 3TINA 1PV2A 5JD6A 1KFKB 1OGPA 1RIUH 2Y8EA 2M83A 3WJ7A 4ANUA 4F46A 2J1WA 3PQYA 4FB5A 4FTWA 1KQFA 3B1TA 4IJ3C 3CEPB 3BWEA 4NH4A 3HY6A 3CFKA 5GISL 1RBMA 1RI5A 4JDTH 4MRBA 2V4LA 3IUMA 4GLBA 4K9KA 1EZUA 5CNIA 1W8NA 5IJBC 3UO1L 2EJCA 3A6JA 3FTPA 3Q8XB 5FORA 2ARKA 2O61B 5GS3A 1P7QB 4QL3A 1TZCA 3QXDA 1OA1A 3ACDA 1N8SA 3TN0B 3U3KA 3VBCA 4QHTA 4GAGH 3PAUA 5ABZA 3FT4B 1KN4L 2WVUA 4MB2A 2AJZA 1CL7H 2QTMA 2HQ1A 2XXBA 1KXVA 5DN9A 2D4DA 1NA8A 4GRWB 1BMDA 1OHHA 3MD9A 2MDTA 1H2ZA 2CLZB 3PUJA 3OKAA 2W1NA 5AFSA 5KHAA 1VKNA 3IB3A 3OKKA 3ARRA 4Z3IA 4TMFA 3R1GL 4D46A 4DPAX 2YAFA 2W0MA 4NOBA 1QCZA 3AF4A 4KVZA 8OHMA 3IDOA 4FFBA 4AMKH 4GRLC 5CM2Z 1IN8A 4C2AA 2ICEA 1SA0A 1NDMB 5AVRB 5EU6D 4BKQA 2G9QA 2OM6A 4Q7MB 3A6PC 3ABMB 1Q8MA 1EMTL 5CCGE 1XRQA 2Z8XA 1A5ZA 1YC2A 4DV0B 3G6JF 5IK3B 2ZZNA 4UBJA 1SM3H 1M8JA 1N0XH 1XK7A 2JASA 1S5PA 3FHJA 3O3AA 3KPRE 2FCBA 1W91A 3H7BA 2UXBB 2FQFA 4D9RD 4B43A 1ZLWK 5EP4A 4NEHB 1XEUA 1N92A 3QBVA 1ESCA 1ZLXA 2HJHA 2PD3A 2YD6A 2B1GA 3NHRA 2PHZA 4BO7A 4BFRA 3HBNA 4MPRA 4L6CA 3V6OE 3E6HA 4WUUA 2CG9X 4NBWA 3BPNC 2P3YA 3U4QB 5FL7A 2WLYA 1G3IA 1T4BA 9LDBA 4DWWA 4YCNA 5T41A 4AF7A 4WTQA 4LZNA 3G2IA 2HG0A 3KZXA 5JDSB 5TMEA 5BT8A 2J7LA 2EQ5A 5IUKC 2E5WA 1T21A 3TOPA 3MDJA 3LUFA 3TGPA 1K7XB 2BHYA 3HWWA 2FO4B 3A4TA 3OY2A 1MJ8H 3W9BA 5E95B 4NMWA 1RFGE 4V0OA 4L8BB 5BSRA 1TKWB 2FX7H 2B20A 2Y6SD 1ZHKA 2J7PD 2CO7B 2VN5A 5CJXC 4DGQA 3JVVA 1EZVY 4JR0A 4LL4A 2C2KA 1P4LB 4CM8A 5IHZB 1ONOA 5IVKA 2QXYA 4UPEA 3L17A 1X38A 5GMOA 4CL8A 1TUIA 4HNSA 3K5PA 4YHBA 2DHCA 3D69B 3OZTA 3P1VA 2Z3VA 4TQ9A 4GXVH 3ESRA 3TQSA 2XX1A 2XXFA 2N3JA 1Z26A 4U7GA 1KI8A 3NTUA 3Q2WA 3HWSA 3GBNL 4IUDS 3OAAA 1HT1E 1C4OA 4JOQA 1XSKA 5J9PA 5J5AA 3O6FB 3QZPA 1E2JA 2LFGA 2AJSL 3HB9A 1Y9AA 1ZGGA 3U4IA 1KB3A 4O58L 5IB2A 3VHXA 4LZAA 1OP3H 4HU2A 1QHHA 1U92A 2J6WA 4RF5A 3K0CC 4NO2A 3VTAA 2PL3A 1CB0A 4EFMA 3CT6A 1MU0A 4XPBL 2FSEA 1QEWA 3CONA 4IRJD 2GIYA 2C78A 1EAPA 3OZRA 4OGZA 4ZMQA 1ZIXA 3DDUA 3WGNA 4HJXA 4AWJC 2GY7B 3BT2L 3WWOA 3WEMA 1H0HA 2ZCUA 2GD0A 1J5CA 3B2UD 2VRAA 4PGDA 4WFHD 4Z4FA 2PBFA 5AVVA 5EWIL 2V65A 4M60A 4C0XA 3G23A 3IC5A 4TXHA 3AVOA 4MWGA 4UBIA 1VOTA 2XXAA 4BKSC 1SD1A 2H2HA 3WJJC 1OAOC 1U3GA 3F74A 3ZIAA 2NY5H 3H4FA 3BHBB 4XP5L 1UBUS 2EDNA 3WWYA 3U2SB 1O9ZA 5J6HA 4P54A 2JGRA 3CX3A 1KTCA 3FTVA 4U2ZA 3PFFA 1FFXB 1IIBA 5IQ9B 2B4RO 2ZJ1A 2JI9A 3A1TA 2VMJA 3IRVA 4IGBA 3QHFL 3ZJYA 1CR4A 1YB7A 3Q7TA 2HMAA 4OGKA 3NPZB 1Q1ZA 1Z4PX 3AWGA 2CHVA 3D2LA 3H9YA 5J3HC 5F89B 2Y6VA 3KDAA 4YIQB 1JEQB 3IBTA 1CTOA 5F6IC 1AH1A 3D2AA 5EJMA 3BQUC 1XL1A 4I99A 2GKSA 2EZ9A 2VSMB 3WNMA 3U49A 1JZJA 5E6SB 2YS7A 4LQFH 4Z3FA 2CHDA 1FN4B 1ISIA 2E4XA 2FF7A 2VQSA 1NGYB 1EXDA 1FQJA 3HK2A 5FYLD 1NV9A 2XJ4A 3O8QA 1T8TA 3CURA 5JCJA 4MYRA 2GERA 1DBKL 4CKCB 3C3AA 1WAAF 4ER0A 1RXEA 2HDHA 3MGOA 1BMGA 2ZIVB 4AKGA 2V5UA 4IKPA 4KXXA 4GKNA 2RFXB 4AQ1C 4Y2RA 2ADFL 1LSSA 4HJ0C 3VKGA 2YRBA 1T3LA 2PCYA 4PHTA 3VR4A 2CO1A 3MLXL 3AR8A 3JWEA 1JT2A 3TUZC 2V7BA 4BLVA 2L4OA 1MH5A 4H13C 3ESOA 1XMEB 4LLQB 1E89A 4HAOA 3TMKA 1DC7A 3UK1A 3COZA 3OKWA 5C0IB 1RZUA 3C3EA 4NBRA 1QNZH 4R98A 1YPZF 3FOBA 2CN1A 4YRPA 4NCAA 1VHPA 3G2MA 1HE8B 3ROOB 4ZMSA 4GP9A 3SKOA 5I0XA 4JUDX 5DPMA 3T8MA 2W0FA 4EGAA 5BUGA 3VXQB 3CZCA 2EW8A 3INRA 5ICFA 5J4MA 3OM9A 3KPTA 1L5SA 1J5OH 1UOOA 4Z0BH 1TIKA 4PYOA 4BZQA 2G2NA 2VLKA 2GBPA 1EVKA 1TJ5A 2XB4A 3BCHA 1VSCA 2ESVE 4JNKA 1WEJH 3WIIH 2G06A 3U7GA 4KYUA 3GLIA 4UHHA 2DSTA 3VMMA 3M46A 2Q86B 1G7PA 2CBQA 4UE3S 1MCBA 4FYTA 4XP4H 4OHPA 1I1FA 4ANKA 1QGDA 1T03L 1C7EA 4WWKA 4KE6A 5DRWB 5LCXA 3HG4A 4YRDA 3GRBA 2RHBA 3AGPA 5TGDA 2ZBVA 4JMXA 1JVNA 1XX6A 3B9KD 2R8BA 1KR5A 2E37A 4E9XA 3QI7A 5K6AA 4EF5A 3C3XA 4V0ME 2FPGA 1AMUA 4W4OC 3KQQA 4YCDA 2FUQA 1Z83A 3M2TA 3RAFC 1ZS8A 4JFOA 2HUEA 4V0KA 3NRFA 4LGSB 3T9FA 2R59A 1M1ZA 3HFFA 2HLPA 4ODVL 1MEXH 4B35A 4KAXA 1R27A 1JDCA 2K78A 5FOJA 3H9HA 3FYUC 4YXHH 1T9AA 2VDLL 5K3EA 3H3XA 2XVGA 1U8AA 3H9GA 5L4MA 2C95A 5JFTA 2BFFB 3V4PL 3THWA 4M93C 3PU7A 3M4JA 1J42A 1SCNE 4PS4H 3BPNB 4AICA 3PD0A 3QMVA 2QN1A 4YJZL 5C3UA 2DMRA 3I92A 1QGYA 5JI2E 1VE6A 2W00A 2G83A 4FLQA 3L4EA 4TWZA 1GGHA 5DMYA 3RH0A 3WGTA 4WDIB 1GQ2A 1D1PA 3EUWA 1XH2A 1QKZH 1TF4A 4EJ2A 1D8TA 4NMHA 4DOHE 1URPA 4LAJH 5E9WA 2BVYA 3H3JA 4J8QA 4IPTA 3AT0A 1W15A 3UCRA 2Q5QA 3DA8A 1YJBA 3IUJA 2X1PA 5MF6A 1KG0A 1OAQL 2RCSH 2YWDA 4WI3A 3EXG1 3R3ZA 4X1OA 1WULS 3LVTA 2VWEE 3OM8A 3O41A 2O8VA 4ZXPA 1DQTA 3EC7A 4BTVA 4GD3Q 3U5TA 1G1AA 4N8DA 5CJJA 2QT1A 4LEBA 5EOQH 2P45B 3UT5A 4NGHL 3GGPA 2H2PC 3FW6A 2DETA 3IERA 1R66A 2M6SA 1XZDA 4BFYA 4FZRA 1GG9A 1NCCL 3KR3H 1XH0A 3FH7A 4P23D 1SY6H 4X7MA 1JTTA 1ZHNA 4LJRA 5BWNA 3ZV3A 3EXG2 4EY3A 4IF4A 2IHUA 2FFRA 2QI9C 4CQMA 3L95A 3I9OA 3C6YA 3SJBA 3M6WA 2JGKA 2XTSA 4ER5A 4I6JA 5DISB 3DIDA 4RNRB 3AG2B 5DM4A 3UUFA 5TGZA 4AJHA 4XA8A 2YZ2A 4JQXA 3CZLA 2G77B 3HJTA 2DYPD 3M3PA 1GL7A 4O8CA 2BMJA 4M4SA 1MQKH 4Y2DB 1QI4A 1R0YA 3RHZA 5M04A 3KPRD 2KMWA 1SCIA 3T7JA 2JAOA 3OEHD 3H0TA 2PW2B 2P9QA 4POZC 4Q6YA 4OGWA 3FSOA 3EF0A 5E1GA 1PU0A 1A7NL 2DICA 3DE0X 1MX1A 3CVJA 1TMYA 4JU9A 3CNHA 3UKDA 4ZUTB 4KZ0A 3V5HA 5I7HA 2R1VB 2C54A 3L8CA 2XNJA 7FABL 4COKA 3LPWA 1EO7A 3RUDA 4PJGF 1NCNA 2D8AA 4QDZA 2W37A 1I51A 1L5WA 3BXNA 2HA4A 4LCBA 3O3DB 3KQYA 5HD8D 5K3BA 5I2IA 3G2LA 2B78A 3HUFA 4GG8B 1OQAA 2W2KB 5DHRA 3IPEA 5D2NC 3CLHA 3CBJB 1TMCB 4JUIA 1T5KA 1VPEA 2D5AA 3FRPG 1U8CA 3JWOH 4KVCH 4FXKC 3FQRB 4XO5A 3I9AA 3VWKA 4UNNA 4UM9B 3VU0A 2ARJB 2JXMA 4FDAA 3ASWA 4H1WA 3CF6R 4KGXA 5JSHA 1G8GA 1ZD5A 3JTBA 2PCFA 2EKPA 2E6QA 2RIRA 3DB1A 4IX9A 4FGZA 3JWJA 1AC5A 4KVPA 2R15A 3BH8B 4WWPA 3G8BA 3NEXA 1EANA 2JB6B 2C1XA 5DWQA 3QU2A 1UJ3B 3FKUS 2O6PA 3QXVA 1WUYA 1TK3A 4NKDA 3Q2OA 2GHQA 4TUYB 1OBFO 4N0PA 5FBVB 3FSVA 3OY7A 5E8OB 4JFEE 4W6YB 1QRUA 3UBXG 3ND5A 4OBSA 4MDHA 2FW9A 5EXDA 5EZYB 5DJYA 2VN4A 3ALXA 1LGYA 2C94A 3NCCB 4TQEH 1G0OA 4AQ1B 2AEMA 2O5YH 4HGPA 3ASYA 2EDDA 3IAEA 1HINL 5DD6A 2VM4A 1GY8A 3KPSB 3Q06A 2PXXA 2Q20A 1BE1A 4DPRA 1VDGA 3EZ2A 2A92A 3SFVA 3GMQB 4QEDA 1WO2A 1OD9A 3E18A 2ZR8A 4WUKH 3QMMA 4OQ4A 1DRWA 3V9PA 5I71B 1R47A 1KMMA 4AF6A 3HBJA 3GQFA 2Z35B 2H85A 4N0YH 5A1TA 4FW9A 1UA6H 4G26A 4MKHA 2XQBL 1SEQL 3WN5B 1SEBB 5D1ZA 1YZTA 1AUOA 4C3VA 1W8OA 1HT3A 5ALVA 4KK9D 3BWMA 5E7FA 3JALA 4NT6A 2Z5VA 2AL7A 1MRDH 1BFUA 1XMIA 1DVFD 2A2QT 1U8PA 4PTUB 2JNWA 4LRIC 1AU9A 1P0IA 3FT3B 4MKMA 3QRGH 3B9VA 4X80H 5KYXB 4PFEA 1USIA 1DWQA 4OM0L 3WR5A 1E6JH 3WY4A 3ZTYA 3M6DA 3U2QA 1ECCA 3CH7A 3NT4A 4EYEA 1JYFA 1YQUA 1N5RA 1FFNA 2PW1A 4IJTA 3OQIB 3GS7A 3HYLA 1Z38A 3NFRA 4M5SA 1P39A 3QXGA 4OGYH 3KSZO 1PKQA 1AV7A 4AMZA 4GXNA 2DI8A 4UM7A 5K51A 1T0IA 4GUCA 4X8JA 5JY1A 1O6GA 2WZCA 2WLSA 2UYGA 4ZUWA 1C3JA 1U99A 3V0EA 4IM7A 2FZLA 3VV3A 3DO6A 4P3CL 4BLPA 3LPGA 1J11A 5LCVH 3ERXA 4EOWH 1MO3A 4PM1A 3QF4A 1QIGA 2VWPA 2NY3B 4MICA 3HZOA 2X6CA 1QVOA 4D8XA 1WHTA 2G2PA 3GTVA 2MCMA 3UTDA 1MAVA 5K5YA 2ITCB 4AK9A 3II6X 4LOAA 4WZAB 1X8JA 5F7DB 4YQXL 5JXGA 2AIRA 1B0IA 3IKJA 1U28C 1FL6B 1M05B 2GJZB 2ZE7A 1N6KA 1LO2L 2KWIA 3HJCA 3LC2O 2J3LA 2WJHA 1ZJBA 2REBA 4P46C 1L1EA 2J85A 3ZNOA 1IONA 1V3LA 1TVMA 5EWJA 4AMVA 4YHYB 1URZA 3PAYA 2WD0A 3VPFA 2IRWA 3WQSB 3F7NA 2WW8A 3EFFB 2HRQA 1H8EA 2C1OA 3OKDB 3NOXA 1E5TA 1Y8QA 1AJ7H 2BY4A 3UEQA 3R7SA 1C5CH 1CUUA 3DEYX 1DXYA 2AC4A 1OM3H 4E03A 1A2OA 4KQEA 3H13A 4M48L 4FQXB 5ECYA 1JPSH 1EJOL 2W6IA 3EZ7A 4PWIA 4KLRA 4OQDA 1P5UC 5CVJA 1A7KA 3CJRA 4DLZA 5JZBA 5FK9B 3BWZA 4TUJB 4B3XA 1B41A 1U95A 3IJSA 4G0NA 4BPRA 1OVMA 3PNQA 3BSFA 3LEXB 3JWDL 3GVCA 3PV6A 4FUTA 5GM1A 3RGBA 1TNMA 2WXQA 2Z7ZA 4XNDA 3OHXA 4MR9A 1B6TA 2YPLA 2V7XA 2FP3A 4KNUA 5CYOA 3NJVA 4ZTPH 3LFTA 3DROB 1O6SA 3SQBA 2D6FA 4MZDA 1KYVA 1HE7A 3PHIA 2ESVD 4I1SA 3KAPA 5JMWA 1NN5A 1WXIA 3DYMA 1SU8A 3EIUA 3QIUC 2ENQA 4AYDC 1CR0A 3CC5B 4DN4H 2J25A 721PA 3CFEB 2PYEE 5EPMB 1BQSA 5HS4A 3EEBA 1MENA 5KYYA 1J6UA 4HZAA 3VFVB 1YULA 2GSDA 4GS7C 1OFVA 3EXHB 1RLBA 4K46A 2MPVA 3MA9L 1OTSC 2CPCA 2WJYA 1BE0A 2PUCA 1K8IA 1QI3A 4RA3A 3QO0A 1KMNA 1SKYE 4TPRL 4GI5A 1LDBA 3ALWA 1UXGA 3MZTA 4HUQB 1VGKA 3O1IC 4RTRA 3WGLA 2BFEA 5EZLB 1P84K 3S2GA 4K9RA 2ADFA 3BGIA 2ADGB 1ODAA 5IR1B 4W99A 3GUVA 3KALA 3FPCA 3PHBE 3NYRA 2JJ1A 4TSKA 2Y6SC 4TN5A 5BMFL 5EE0A 4RGBA 2AXJA 3HZKB 4JI8B 1CCWA 1RJZB 2YHAA 4JVMA 5CDUA 1A72A 2PTVA 5KSBA 2Z9TA 4O9HL 3V97A 3NT5A 3L0CA 4K9EL 3MUY1 2XLCA 3J80A 1OT2A 3VAEA 4BNZA 1FVHA 1Z4OA 3EUFA 2FP4A 4LF3B 4C29A 4XZUA 3ILPB 1TYBE 1HMPA 4GKOA 3G59A 5ICYA 1S7XB 3O8OB 3SCMB 1NW6A 3T7IA 2JLVA 5ALCL 4F33A 1OXYA 2FYYB 2HB0A 2FIKA 2IWKA 3SZ3A 2OM5A 4L4XA 3FUVA 5JNRA 3FNKA 3TJMA 1YYLH 2AS5M 4IRJC 1U0RA 1MF2L 4TMTA 4JMNA 4X66B 3GJQA 4RD3A 2A9OA 2QVXX 1THMA 3MJ8A 2FEEI 5LP6B 5JPIA 13PKA 3KZMA 4C5BA 8FABA 3CFUA 3LKZA 3BC1A 4HC4A 4X20B 1N3IA 2V6MA 4C2TA 3B2UC 3BLPX 2O0LA 1VFNA 2VATA 3G88A 3KHSA 5IVHA 3CN3A 4K0OA 5I0ZA 2AX4A 3GB7A 4RDXA 4TWIA 4UAHA 4DYHA 1L5LA 2YRPA 4FKKA 4DR7B 2VWGA 1CHDA 2AV1B 2GCEA 1G0NA 2NY2C 2OLKA 5KUMA 1XQYA 4Z0NA 421PA 3OUTA 1TTHA 3G02A 5H02A 4O2AB 4Z1PA 3KGRA 4PXYA 4AQDA 4BOYA 2WINA 3FAKA 3L2NA 2ZKXA 2A9VA 3DKVA 4WZ6A 2Z83A 3OB8A 3V4PA 1H2WA 2R56H 1HGXA 2D3WA 3UKOA 1A5FH 4ZAKD 3L3IA 1PIFA 3ZKSD 2ZI3A 4JI0B 4C47A 1HK6A 5B3JF 1TJGL 2PX4A 2YXLA 3EJSA 2CXNA 1NBYB 3SK0A 1WZIA 3H86A 1HXMA 2B1HL 1Y6JA 2XTAA 4MWBA 4OAQA 4RDBA 1S2GA 2O1WA 2VJQA 3AM5A 3E84A 2OFOA 3H2KA 3HRKA 4XXCC 3ASUA 1KDPA 4EEZA 3P69A 4ZGWA 2OV4A 4JY6B 4M3JA 3QDJA 2WMDA 4EKEA 4KQIA 5CR9A 3TBYB 4OEHA 1MPAL 3EXLA 3HSYA 2VDRH 3MV9E 4WGWB 5EZJB 3Q2VA 4BSVB 4G5GA 5DDIP 1P7VA 1CYEA 3H9ZA 2Q3JA 1FSPA 4JLNA 4BJ5A 2X86A 1NQUA 5H4HA 1DRKA 2X87A 3K1ZA 4KMMA 4PCYA 1NM5C 4IMLB 1U4OA 2AG1A 3K46A 4A2PA 3TLBA 2B7CA 5L45A 2JFZA 4ACAA 3BC9A 5L3ZA 4YEFA 3HHRB 5K8VA 1RH8A 4KKLD 4I3HA 4F20A 4JPWL 1C41A 3FFCB 1YPZE 3DO7B 1HV8A 2BFAA 3ARSA 4BNLA 1MV8A 4EYKA 1KIPA 4CC0A 1ZD3A 3LS2A 2X4IA 1G5IA 1ACYH 3RRBA 4UCWA 5JDIC 2EXXA 4C56E 1ZTXL 2PU7A 4FABL 2ITEA 4HTFB 4JFED 1BWPA 4ZQBA 4JQIL 4X1IB 4EN3B 4KXZH 4P46B 1JQLB 1E3JA 2IH8A 4M89A 3UO8B 5AOJA 4O63O 4NDMA 4WXYB 4DO5A 1ILUA 4XP6L 4K0KB 5KS9B 3ILSA 2CMRL 3ND7A 2HIGA 4HJSA 3C08H 2CVHA 1VYUA 3TNLA 3QYAA 3P4OB 4RZXA 5CEYA 3U4CA 3DLAA 1FOEB 3RC9A 3BUYA 5CTJA 4D3CL 3SKMB 3FU5A 3MXTA 3WGMA 3OJOA 1GNTA 3KW8A 4URTB 2CVZA 4F1ZA 1VL2A 3U1PA 4EO7A 3ES6A 1P5UB 1K9VF 4GG6F 1O03A 4R0NA 2C4NA 3GCWA 4HWUA 1FO0L 4O2CB 3GEWB 4Q7KA 5BW4A 5F21A 1RWWA 4KIUA 1E2ZA 5K9QG 2H08A 1H2EA 3WB2A 2JQZA 1GJRA 4IYJA 2P4AB 2OSLA 3RJ5A 2J30A 2FHSA 4Q12A 3X1XA 4O2BA 1KTDA 2W4IA 2V96A 3WFBL 4ZVQA 2QVTA 1WC7B 2QY9A 2JJTC 2G5BA 1TB4A 2XVMA 3GA5A 5BR7A 2J2ZB 3QIUB 4K2UH 1E20A 5DT1L 1A7QH 5ALBL 2P91A 2Q4OA 3EXEA 1IXKA 5EJ2A 5E0OA 1ZHOA 4HF5L 4XI9A 2VPPA 4PW3A 4N86A 4Z76A 2GBFA 3NFPA 4RVDA 4MWOA 4Z1OA 4PTYA 2MYPA 5EVCA 2WVJA 5FYKL