3ZE0B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
465
Chain Sequence
PNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 107
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze0B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze0B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze0B03
3AL9A 5HDBB 4JDUA 5E6RB 1FNSA 4WJKB 3FCSB 1RRKA 4CNBA 2VDNB 3OKYB 3PPWA 5E6UB 1M10A 3V4PB 4HQNA 5LN1A 5BV8A 2B2XA 1OLZA 5KYYA 4M76B 3PPVA 5HGJA 3K72A 2VC2B 2ODQA 2WW8A 5ES4B 1RTKA 2VDRB 1AOXA 3EGDA 3E2MA 5KYYB 4WK0B 1N3YA 3EH2A 4IXDA 1ZONA 4C2BA 1UEXC 1IJBA 4A0QA 2VDLB 4Z7NB 1L5GA 1SHUX 1YUKA 1QC5B 3EH1A 4F1KA 4K3JB 2XWJI 4MMZB 1PD1A 1QCYA 1MJNA 2X5NA 4UM9B 1QC5A 3HXOA 4O3TB 3K71B 3RAGA 4C29A 3ZQKA 2M32A 1M2VA 2VDKB 1OAKA 1Q0PA 3EGXB 3ZE2B 2UZYB 3T3PB 4HQKA 3K6SB 4JX0A 1SQ0A 4G1EA 1AO3A 4WK4B 2NUTA 3TW0A 1JEYB 4MMXB 1ATZA 3K6SA 3ZDYB 3K72B 1CQPA 1DGQA 3OL2B 5KYWA 1T6BY 4MMYA 1SSLA 1AUQA 3M6FA 4HQOA 3ZDXB 3BQNB 3N2NA 1M1UA 1NA5A 3NIGB 1M2VB 1MHPA 2NVOA 4HQLA 5E6RA 4CN8A 4IGIA 5E6SA 2P26A 1JLMA 2VDMB 1BHO1 1XUOA 4MMXA 3PPXA 3OL2A 4FWWA 2VDOB 3EGXA 1XDDA 3IJEA 3V4VB 1U0NA 4CN9A 3HI6A 2QTVA 4G1MB 1LFAA 4BJ3A 2NUTB 4NEHB 2O7NA 3EGDB 3FCUB 3IJEB 4HQFA 1DZIA 3BQMB 1N9ZA 2I6SA 3F74A 1PT6A 4F1JA 5HJ2A 4NENA 4GZ8A 1M1XA 3EG9B 3EFOB 3OKWA 5KYNA 3AFCA 3TVYA 1M2OA 3HXQA 1MQ9A 5KYUA 1FE8A 1IJKA 4Z7OB 1CK4A 2ADFA 2I6QA 5E6SB 2P28A 4PN7A 4DMUB 3TCXB 1IDOA 5KYXA 3T3MB 3EOBI 3F78A 2NUPA 1YVPA 4FX5A 5KYXB 4G1EB 3EG9A 4NENB 4Z7QB 4O02B 2ICAA 3QA3E 2ODPA 1BHQ1 3IBSA 1IDN1 3VI4B 1T0PA 1ZOOA 3BN3A 1V7PC 1L5GB 2VDQB 1JV2A 3AL8B 3VI3B 2VDPB 1TYEB 4MMZA 4WFQA 3EFOA 4O3UB 3K71A 5E6UA 5KYUB 3GXBA 4UM9D 2WINI 1PD0A 3PPYA 3ZDZB 1RS0A 1RD4A 1YVRA 1JEQA 3ZE1B 4O02A 1MF7A 3NIDB 1U0OC 1XDGA 2XWBF 4UM8B 3NIFB 2I91A 1MQAA 1JEQB 1JEYA 2IUEA 2NUPB 4WK2B 4XW2A 4C2AA 4IHKA 3NVQA 4G1MA 2XGGA 1SHYB 5KYWB 3Q3GE 1JV2B 3AL8A 3ZE0B 1U8CA 4MMYB 1MQ8B 1SHTX 3EOAI 1ZOPA 1U8CB 1M1XB 3TXAA 1PCXA 3FCSA
chains in the Genus database with same CATH superfamily
4WCYH 2JH9A 3WKQA 3CLSC 2FYYB 5LUMA 1B8NA 1TD1A 3VD3A 2JAOA 5DURB 4IDGA 3HS0B 1Z0UA 5J4MA 3QVTA 4PVDA 4NOBA 3UBXB 4H0CA 5JXJA 3OSZA 3VACA 4L5CA 4LMRA 3VO1A 3EISA 2D74A 1C5BH 3ZDYE 4GOKA 3I3EA 4UTZA 4A2CA 1GAJA 3A6GA 3TZVD 4MW0A 3ZD9A 1B8PA 4KQFA 2R2GA 2HJWA 4ELKA 1NP6A 4TLLB 1RR6A 5D7EA 4I18A 2OYKA 4DP9X 3CNHA 4JKPL 3MYZA 4J1TA 3PYLA 4KIWA 2BZCA 2ESVA 2IPOA 1A5AB 4HDMB 3TX4A 3IPEA 4KXMA 4GEIA 2HY7A 3H11B 3TTUA 4ZSOB 4EUNA 3WLEA 5CM1A 4QVIA 4PJHF 5EF0A 4MWFA 2HCFA 3B7YA 1A64A 5LB2A 4A91A 1L7MA 3MXVH 3VFGL 3KNBB 3KPPA 4R51A 4KC0A 1S3GA 5GVSA 2BDUA 3QCUL 1FP2A 4DV5B 1JGLL 3QUXC 4WNQA 2WHYA 3A4IA 3MOGA 1IEBA 2XT1B 3RL1A 1Y1PA 1QZ3A 5GGXA 3GSVB 4O4HB 3M86A 3JT0A 1FLNA 4EG8A 4XE5B 1SHTX 1SDAB 2X38A 4GKNA 1OT4A 3GMPB 4PJFA 2XE8A 1EXUB 1WE2A 3LW8A 4BP3A 1KGCD 4RM2A 4ETMA 4WZAA 3L3GA 2Y1XA 1TM3E 5GHWL 3T4YA 1FRFS 5JRZA 2DY0A 3ETBF 1L3BA 3PX7A 4TZ6A 2AL7A 4O2FB 4Y2HA 3WELA 1IZJA 5J2TB 4RK5A 2QPLA 2YHBA 2FUG1 3LY7A 2WY3B 3DARA 2DVMA 4TKVB 5F2FA 4NERA 4MR9B 1MRDL 1PQZB 4O4HF 3KYIB 4PRHD 1O54A 1YY8A 4FIDA 5EQFA 2EVFA 3EIOA 5I9QC 5CA1B 4N85A 3BMQA 1IHDA 1DBJL 3S1SA 1H2XA 1PJTA 3PP4H 3L3IA 3QORA 1JF1A 5L0QC 3QZNA 4GECA 1BE8A 1C0PA 1IDOA 4CUCA 3H2HA 1JG3A 4DO5A 3QMWA 5F78A 2DQFA 4QDUA 4P2QE 4AIZB 2IYVA 4K7PY 2DDQH 1E59A 3WIVA 3FAXA 3QKRA 4F7WA 4ADSG 4X8JB 3NBAA 5EOTB 1ISFA 5C4MA 4MS1A 2QY6A 2AMJA 5B4MC 4DCQB 5HJ5A 4I3GA 4NYIQ 2RI1A 1UADA 5AUOB 1W16A 5DTRA 5TQVA 3BJ91 4YWHA 5F1NA 1UB5A 4N0RA 4CSTA 1ZR4A 2VNAA 4LHJB 1L5WA 2COEA 1QMPA 1L4HA 1SXCA 4G8BA 3L3OC 5HGBB 4CSSA 2JQZA 4HLUC 2C4TA 4FS3A 3TF7C 1OPRA 4R4JA 5SX4I 1X7DA 3QUXD 5C0CE 3OETA 1PJQA 4DK5A 3MJCA 3D18B 3MQFA 1CY2A 4JSYA 3HIZA 4HQOA 4PZDA 1GPJA 1PFGA 3CX5K 2A4CA 2JFCA 3A3NA 4IKPA 1CLYL 3VPBA 5EE3A 4F04A 1UJ4A 2WWHA 5KO2A 1X7TA 3IN2A 3SDAC 1AJEA 3N0PB 3RUEA 3UICA 1BQHB 1XRSB 4BLVA 3GJSA 3KQWA 1ZU4A 4LYAA 2EO9A 4P5TA 4PFJA 3UFIA 5D85A 3E7DA 3CRW1 1QZXA 3OJDA 4UYQA 2BMDA 1HDCA 3ND9A 1XFAA 4HR7A 5JBIA 3PFQA 2PR4L 4L2IB 2F4NA 3LKRB 4E11A 1FO0L 4CGUB 4TM8A 1T5XA 2BK8A 3I1IA 2QW0X 3O03A 4MJLA 4JM2C 1RHFA 1WCBA 2NADA 3L18A 4L8SA 4B0MB 1JT9A 3GBVA 3OCZA 1IN8A 3ETHA 2XGGA 4DF3A 3MA0A 5LPNA 1YRKA 2FJFB 2XAUA 2HMUA 3EVTA 3AREB 4XDZA 2XB9A 3NHWA 2FY8A 4RSGA 3MRCB 4Y9GA 1E90A 4MZXA 5MI0B 4AQAB 3GLQA 3OB0H 2NU7B 1PVOA 4FKEA 3F4BA 2GHQA 5EU5A 1RPAA 3GXMA 3PE9A 2HB6A 3QELB 2O2XA 1M53A 3JWNH 3RSFA 4JQYA 10MHA 1IHUA 3A36A 7MDHA 4H1WA 3QEQA 3U0WH 3SMQA 3J7HA 3RH0A 3WIHA 1P44A 4ZYUA 3ULVD 5AKXA 4NHCL 3LQKA 2UVQA 3UG3A 2WXMA 4RMVA 4IBOA 4RFEA 2JGMA 4JR1A 4EVIA 2EYQA 5IHBA 3Q9NA 4KXNA 2E7LA 2UXDB 1VCOA 2VXVL 3EGXA 5E2TL 3OKKB 1TKWA 1PZBA 4G43B 2JJ2D 4QAQA 4L5BA 1UURA 1R9FA 3PPEA 4JQVA 3BDVA 4IRUB 1MFVA 3HYLA 4L6IA 4CEIA 1BDMA 4ODWB 2XGMA 5GM2A 1D5CA 3IUEA 3OLYA 3UUWA 1GPOL 3T4AC 3AM4A 4CNQA 3KWJA 5A2JH 1Q92A 4OJAA 5T33L 1KCSH 3GTNA 3VI3A 2OBBA 5I4CA 1U93B 3SBEA 4R7LA 1EUCA 3U9PL 3NHFA 2BFVL 2LGNA 2ENPA 3ONFA 3IEKA 2Y3AA 4IGAA 2AI3A 4NIKB 4NWUL 3RWDA 4RO0A 4AYXA 1X6NA 2IQAB 4D4IA 5AKJA 5LMNB 1XAKA 3EUEA 3GMOA 3PEVA 3SZKC 3DL4A 1Z7WA 2PT7A 1OGAB 3N5AA 2WUFA 1YOBA 5HYJA 3PGKA 1ZM3A 2CRMA 1WD8A 3AV0B 4LE0A 1DBVO 4P4KD 4BAZA 1SOWA 2LCFA 2BCJQ 3V0IA 1AO7B 1JYFA 1P6QA 4RTKA 1FYTB 5CHEA 2NX5D 1EBFA 5CJOH 3ET5A 2YSTA 3D2LA 4KX8A 3CX8A 3Q6FB 1SQ0A 3E5RA 3GEWB 4TKUA 2CLZA 3SZOA 2I2AA 4E94A 2YKLL 4Z7WF 3SE3C 3GMMA 3MUGB 1YR6A 2ZPUA 1Y0LA 3ZEIA 4D8PA 2WFAA 5C7OO 2IDKA 2QBYB 4AT6B 2P8LA 2HJ9A 4WRRA 1JPNA 1F17A 4BWYA 1CZ8H 4XEUA 3X14B 5MN6A 5IQMA 1MAVA 4QSMA 3KB8A 1BQ3A 1H2YA 4HH0A 1YYMH 1IQ0A 4UTAL 1V35A 1KKUA 4BFGA 3EN0A 1BD4A 5ITBL 4P32A 3SE3A 4GAAA 3Q8CA 2WGXA 1B2LA 4BHUA 4RFNC 4DW2H 4X45A 1D09A 1T9ZA 3VX0A 4JV5B 5HBBA 2WQVA 4HOZA 5IB3B 1IKFH 1P4SA 3K35A 4Q3LA 4QQNA 1NDUA 3FBGA 1XMVA 4IRSC 4YHBA 2PQMA 4IUYA 3B13B 4RWYL 4EMZA 6PAZA 3KP1A 3EJRA 2GSMB 4PJGE 2VBFA 2L19A 4FW9A 4PWFA 4ETWA 2AQ2A 1N57A 5LXVA 1MRFL 4B83A 1FNMA 5F5LA 2BEVA 3HR4A 4A7QA 4HJEA 2DFKB 1P1ZB 1UMBA 3KXKA 4NESA 1A1OA 3BGVA 1EXVA 2QJOA 1RKQA 4N8CL 4W5HA 2AK4D 1KAHA 5CCDA 3U3DA 2VQ1B 1RADA 5F6HJ 4CJ0A 4D81A 4QELA 3ZJUA 4AP5A 3ROFA 1RZRA 1I8KB 1T89C 1KBPA 3CX6A 2HLNA 4AYFB 3IPYA 3ARXA 3VTAA 5KB3A 3P4LA 1KEGH 3SO3B 2VDNL 3KPSB 2YQZA 2IBZY 1D5IL 1E8DA 5KOYA 3GHEL 5AICA 5B2EA 4BFZA 4BGIA 4W7IA 1HGXA 4OK3A 2C5GA 3CFYA 1DBAH 1MCJA 4ZS7L 1X5MA 2Q5HA 2LFEA 3QDGA 2Q28A 1YY9C 4GYWA 3PLYA 5HJ2A 4JKNA 4NWTL 1E2UA 4TLEA 4XP6L 2P3LA 1TQ4A 4NZ8A 3K9WA 1F3JB 4PJEB 4D4MA 5K3OA 3SDAD 4PM1A 2CBGA 4DJEC 1KYVA 5KQLA 4PCVA 2WXNA 3WQSB 1G84A 4KKLC 4L50A 2QLYA 1TGYA 3BJIC 5JIDA 3CFUA 1JFFB 1ZD4A 2HAZA 4XSVA 3WIEA 4Z3GA 3H1EA 4UQ9A 1SVBA 1OYYA 5B1JA 1SEPA 3UBXI 1WIPA 1K7EB 4F5YA 2I22A 5U1PA 1SVMA 4BK4A 4K9MA 3C2AL 1DN2A 4QDXA 1CDCA 4EHHA 1CLVA 4QXWA 3FQWA 2J0EA 3WFCH 3LV8A 3CLSD 1E28B 4EVRA 2YXFA 3GXNA 4Q1EA 5CPBA 2WSIA 3WFDL 1ULZA 5AD1A 1K2WA 3VGHA 4V3CA 5ISZA 2VC2L 2PMCA 2QJWA 4GG8B 1BQKA 1K8DB 4O3TB 1H3TA 2GZAA 3ODPA 3T77B 2XLCA 1OD9A 4WZBB 1CQPA 1HR0B 1MCBA 5F1IB 1DVFA 1QIFA 1JJ7A 3CPSA 1A4AA 1Q0YH 1G5RA 5ANMA 2PMEA 5TGZA 4ZHQF 4A6YB 4AL4A 2D2XA 3ZTNL 1E3LA 1MB2A 3IHWA 1BMFA 4ZMRA 1QEWA 4YP7A 3WHXA 4J3UA 5I9LA 2AOWA 4FFMA 1KCUH 2GCYB 3N43B 4CLEA 2AJCA 1P69B 4UOW1 2QVGA 3Q3JB 3MT7A 1XC7A 4ODHL 4FXGC 1QP7A 3FYUA 2A88A 4YH1A 1EHXA 4TUOB 4FQXA 4K6FA 5BYJA 3M1AA 3GHYA 3V4ZA 1CUJA 1CD0A 1X19A 2XZCH 3WSQH 4LOIA 2MHAB 3Q1SL 4JO2H 2WKSA 1SXPA 1CF1A 2ADFL 4U7JA 4PWIA 5FUCE 2PZJA 3R1IA 2Z9CA 3RM3A 5AKHA 1RLWA 3PGXA 4ZUVB 4DVJA 1CD9B 2J87A 2TRYA 1FAIH 1OLSA 1JOIA 4Z7UA 4ROSA 4PV8A 4X7TA 4HVTA 4RDQG 4GUOA 5A9TA 2FR4B 3DBVO 3N39C 3VJMA 3D6MA 2BMWA 5BPHA 5I1AB 4S1WA 5T41A 5JW3L 3GEMA 4E42B 1QKZL 3UA4A 1BPVA 5FX2A 2JH3A 1FZJB 2GIXA 1SXGA 2QDXA 4WZAE 1FDWA 4B48A 3JWDL 4YDLC 4RQTA 1PNTA 4P2OB 1NDMB 1HO3A 3WMPA 2BM9A 4LHSA 3V5KA 5JS7A 4QCIB 1II0A 1SSLA 3REVA 2VLMD 5EFZA 1N2SA 4EB3A 2APXA 3OJXA 2ORVA 4Y9DA 1A7RL 3PE4A 2YGNA 1SB9A 1PLJA 3LK6A 2HK9A 1DBKH 4I08A 2L7QA 3T52A 1JXQA 3I0ZA 3L4ZA 5CX1A 5C09E 3VB9A 3VPDA 2Q87A 3EYWA 3IEVA 4J6RH 2AJSH 1IO4C 3SXUA 4C4YA 3TX2A 4AIXA 1QKJA 3MUJA 1JU4A 4AIEA 3H2KA 5KYXB 5I9QB 5E99H 3RHFA 2B1IA 1C1HA 4CJ1A 2AQ1A 1NWPA 1JZ6A 2H32A 1XGTA 1U0HC 2ZT8A 4H2AA 1NGYB 1NMCC 1OZTG 3HG7A 4ZK6A 2EVIA 3UJ7A 3JQFC 1D5IH 2YMQA 2FFAA 3BVPA 2ITDB 1X2EA 5EE9A 2AK4B 1M54A 5AENA 3GR6A 1R4NB 1UT8A 4JMPA 5CSBA 4KL8S 3AVOA 4U3HA 1YI8A 4QRBA 4E07A 1YWGO 2FR8C 3VXSA 1UDXA 2GPNA 3CZKA 1XD8A 3EIQA 1HZHH 4RMIA 2BOCB 4BNXA 4YFDB 1ADQA 1WEJH 2R79A 4Y9TA 4BYGA 3AUUA 2I32A 2PJZA 4RGMC 1R4XA 5C81A 4NIMA 5KS9B 3LJKA 3RDTA 3ROQA 5DK0A 1DIBA 4LYYA 4HSQA 4FD2A 4A1OA 1DI0A 5DLLA 4BXSV 5A2GA 2OQJB 2PH5A 2FK7A 3MCWA 2HREA 2GB4A 1GDDA 1S5IH 4KZDH 3QRLA 3O8OA 4ZRGA 4PGEB 2YASA 4LTDA 1OXVA 5DZPA 1U3CA 4D4LA 3I6QA 4Y0GA 4AM0B 3HJGA 1TYBE 2P48B 3T8YA 1TVCA 3CFEA 1WXIA 1UAYA 3INTA 1GRWA 4A2FA 3WNNA 3BJZA 4E08A 5F9JA 4PRNB 3LYUA 1RFLA 2QSUA 2PRSA 5B7EA 5F1NB 3BGFB 2B9BA 4MEBA 1UGNA 3FYUC 4NBSA 3W1WA 1X44A 3X3FL 5AXBA 4BMDA 5FDWA 4Z7JA 4WW0A 3NP9A 4ELMF 2AJTA 2D0PB 3HU3A 5CEEA 1B3BA 2ICCA 4DXAA 3E27A 3HI5L 4LCEA 4Z4CA 2BH0A 3IH5A 1JR3A 3R5SA 5LMUB 5EHQA 2JELH 3CZNA 3SIRA 4CSPA 1SHLA 2Z3FA 1QCCA 1TTTA 1KWKA 1FRVA 421PA 3G5YA 5EXPA 3ALWA 1SA0B 5EIBD 3MOBL 2OXGB 4Z9KB 1I1HA 2R6HA 4PG2A 1XTSA 4X1KB 5E2UL 1HAUA 4INJA 4D80A 1I30A 4FFVC 2OECA 4XIGS 1XZEA 2VQ3A 3DHPA 1Y1TA 4D9RD 1UA6L 1K3ZA 3ROLA 1FJGB 1K9TA 4MQSB 1I82A 3PNQA 1FL6A 3N28A 1N5AB 1KORA 3ROOB 4MMZC 4Q7EA 1FSKB 1G98A 1ASPA 1U0SY 4IJ5A 1UQRA 4F46A 3D6JA 3TO2A 4J1UB 3H05A 3LC1O 1AZCA 2ZKIA 1R47A 1V1RA 2OB2A 1TTBA 1KC5H 1TQ8A 2BFDA 3F65A 1ZGJA 5ILQA 4F0JA 2IP2A 1T21B 3C6BA 3KJ6L 2B0CA 3PWPE 3IE4A 2X4QB 4XNYH 3O84A 4FUQA 2VJNA 5ABPA 4NKDB 5F7UA 4DTGH 4FXGB 1OH8A 4B5EA 2QR5A 3ZDDA 1XDTT 2YY6A 1WHTB 3ZVNA 3BKCH 5CZKA 1KCSL 4YO0A 4FQLH 2M1ZA 2BYTA 1CLUA 3TRDA 2GFIA 4F8TA 2VLBA 1E8NA 2AC2A 3OZAA 1L4EA 4UBMA 4JR2A 1BO6A 4G6KH 4XX5A 5CSGA 4ABUA 3CJRA 2EP5A 2BJHA 3G5ZA 4Q6WA 1HE4A 2IU6A 1G2OA 3SQWA 2F61A 1HL4A 4TVPE 4YTEA 4P7BA 4XM1A 1E2IA 3LIZH 5DM4A 3T1QA 1SXNA 1S8FA 3QXWA 4TVPD 4FFYH 1XNQB 5JO5B 2Q1YA 4FILA 3E2HB 4R83A 1G8FA 3NFNA 5A4DA 2H7XA 5KYTA 4NZOA 1IZKA 1A1MB 4BAGA 4JDTH 4RTRA 4B9JA 3FL7A 1XTUA 5GS0D 5FM5O 3G6AA 3I62A 3L4BC 4OCRH 4I48A 1FDUA 4OLJA 1H8ED 3K2UH 4A67A 1GNTA 4Q7JB 5ANRB 4BKLB 2B9VA 5D5PA 3RIKA 4N2EA 1CMOA 2JIQA 4M38A 1RI5A 3IK2A 2ZOTA 3FF8A 3HN5A 1JE6A 1SULA 5CYGA 3F47A 5DX1A 1ZGLM 1NIDA 2PJUA 4B87A 3CU7A 5FB8B 1UM5L 4HDNB 1HINL 3OKDB 3ZTEA 5IF3A 3OHXC 3EIHA 4HGPA 1NGWA 3UAAA 5JNVA 1ZP6A 3LDBB 3E38A 5KVEL 3DOCA 2YIVX 2JJMA 5CIYA 4KO9A 3IDIA 2VN7A 4NRYA 4H25A 1U0NA 4V0ME 3FTSA 3GCDA 1HQ4A 5JPNC 1I7TB 2DQYA 4YDRA 3BUSA 3R75A 3EX7C 2JFOA 3E9YA 4NQDE 1WKVA 5BZDB 1AGBA 4C2TA 2CJYA 2JJ8A 4UU9B 5IKEA 5CK4A 1NR5A 2IZ7A 5M7QA 4N90E 3CZ4A 4M88A 4CMJA 1MV8A 4F2PA 5B2FA 2R5WA 4M5ZH 4MA1C 3CCFA 1R8QA 4P2QA 4O4LA 5HDQA 2BDEA 1LUAA 3NRQA 2MNWA 1G0NA 1XSKA 3BD6A 1DQJB 2C5HA 1UWXK 2H29A 2I9KA 3UT5A 4OB5H 5ESQB 4RA6B 2P3QA 1TQHA 1ZJ6A 3PPVA 2ODQA 1AOXA 4PRLA 4HB4A 3STBA 1BGWA 4QG3A 5B4MD 4MJXA 1YMHA 1W0KD 1PL7A 3MCVA 5KZCD 4K3JB 4WFKA 2O5YH 4IIJB 4AJ0A 4QRPD 3U4AA 2P67A 1X9QA 1SOSA 2AEQL 2VYFA 3H4FA 4ZMBA 3CY6A 2UYOA 4MMXB 1UB6B 4E9RA 2XIJA 3FZGA 5AYQA 4RDCA 5TARA 5FFGA 2WGNB 4JLDA 3AI7A 4JG1H 2ATIA 2CF6A 5B3JF 3C6YA 1P1RA 4F6RB 3KX2A 2F74A 3R3SA 3U46B 4WSJA 3PTZA 5AVJA 2GWHA 2D2FA 1TEZA 4UBIA 1T6BX 3VKGA 3V4SA 4KFTA 3PCYA 7ABPA 1KI6A 4LBVA 2VXTH 4F8OA 1ZLDA 3AGWA 3QHFL 4L8LA 2FF7A 2MQCA 4RKYA 2H7VA 1I51A 3UBGA 4AFNA 5DJDB 5FDFA 4L74A 2WWMD 2FZ5A 3PWJA 4ZZ3A 4IZ6A 4XCYB 4KQMA 2LTQB 2YEZB 4FC6A 5EDSA 3ORHA 4LFHD 3A21A 4CMHC 3QFDB 4X0KA 4MQLA 4O3UB 2Y7QB 3E03A 1RM3A 3BTVA 2C3VB 2QL5A 1NCCL 4MR7B 1XVUA 5ALBL 3ATEA 4XMVA 4YHPA 1ZVVA 2V7NB 3BH9A 3QX7A 3K0FB 1XFDA 5CGYC 2MQ0A 2ANBA 3L5WB 3JQGB 1HMYA 5JTTA 1FFPB 3ZDAA 3UQZA 1T9CA 4G0YA 4ZO9A 3UFXA 3U48A 5I8ZA 3T0VA 2NNAB 4PJ5D 2B4AA 3C1TA 3CG4A 5AUQA 1N5LA 3CLRC 3F67A 2A9OA 1XDZA 1MNQA 3EOZA 4IHJA 3C98A 4XYEA 1NJ2A 3V5DB 2YW2A 4IDQA 2CV1A 1CV2A 1EIBA 1HXYB 3DIFA 2WXJA 3CSGA 1P2GA 3ARGB 4GMXA 4CV3A 4EARA 3S1AA 1OTUD 1FPQA 2WMOB 1AKUA 1BROA 3BN9D 2AZTA 5DYOA 2WVUA 1QHHB 2OG1A 2ZWZA 2B5IC 3CEMA 3ABKB 1NH6A 1S5HA 4BK5A 4UNTA 5EIOA 1XA3A 4B3VA 4UHFA 2P47B 3L1EA 1IQWH 4QPPA 1MPTA 1TADA 3I09A 3WWYA 4G6JH 1ZGLA 2QUKA 3LNGA 2KPOA 4WZBA 2ZT9C 3ILQC 4GGMX 3U26A 4KK9D 2ZJBA 4KIGA 1E2MA 3LXAA 4M43H 1W72B 4WCVA 1HU8A 5EU3A 3MVSA 1P0SE 4TSBL 3TBBA 3NOVA 3KQUA 2A9CA 1KQOA 2DMRA 4JELA 1GQOA 2AUNA 2XTNA 3QBVA 2VW4A 1NN3A 5FW8A 2FDRA 1S6YA 1IGIH 3G5XB 4IILA 4LHYA 3ETLA 3C08L 2OXHB 2P80D 2OV4A 4S1VA 3O3UN 1XD0A 5HGGS 1NNI1 2D31A 3N85L 4HD8A 2N3ZA 3DV4B 2UUAB 4HADA 3DX1A 2EX0A 1QORA 2C34A 3THSA 3O45B 2OJZH 2E3VA 2X7LA 3M8OH 1J00A 4YQFA 4TSRA 2CR3A 5AXCA 4KTDL 4QKXB 3NSJA 1JS4A 3D5EA 3DXZA 3U9UB 3EASA 3I2GA 1KRWA 2F1JA 2R7NA 4P2YA 3N2EA 8CGTA 3WLWC 3ETJA 4OJMX 1MIEL 3H16A 4BWTA 4A2GA 4ZUWB 4L72A 4M6WA 4QHMB 1AGEA 3RKRA 2F9LA 3JATA 3LRSB 2HWKA 3GZTB 4K6KA 1E6JL 5CXXA 2IWGA 1BFOA 4Q1CA 1Y1LA 3DRQA 3GN2A 2AJBA 5L4SA 4YHNB 1H8HA 1DJPA 5GIRA 5I8OL 3CXHJ 2ID5A 2EBWA 3N0XA 1L5HA 3BIJA 3E58A 3QE4A 2I1QA 3ASYA 1JR3E 4H08A 1JTEA 4WINA 3NT2A 2UUPA 2BSRB 1QKKA 4FYKA 2JV6A 7FABH 3OCWA 3U4QA 1FYTE 2BEUB 3NQ41 1RJCA 2BMJA 3QVWA 4X4MA 2C4NA 4OFXA 2AJYL 1E9RA 1ETB1 2WWIA 2B8WA 1V3KA 3OM9A 5MI0C 5D55A 4G7YL 1H15A 4UE2A 1QU2A 5HJ3B 4MW7A 2IY8A 2VJYA 2G7ZA 4J3OC 3L3JA 3VFRB 2P91A 2A77H 5AUMB 2G1JA 4NBLA 5GRJL 3RGVA 3CPEA 4ILEA 4MLZA 2H26A 2BM3A 1T6XA 3D50A 1LK3H 1X14A 3WGOA 4ZYVA 2O2CA 2OHIA 5D2LB 2QRVB 4W5JA 2YZ2A 4JP5A 4EH1A 3GZKA 3USES 4QUIA 4LDLB 3K6KA 3I05A 3OXRB 4PWEA 1S9YB 2BZ0A 2J3DA 4OI9A 3GI8L 4PRID 5LR6A 3V7AG 4FYWA 3IJHA 3VD0A 2X58A 1E5YA 3VZBA 4Q4HA 2P9FA 2ZRLA 4NN6C 1UOKA 3Q5TA 4W81A 2R83A 1QB8A 3KLDA 1NHWA 4R1TA 1ABFA 3THWB 1U7PA 3DZ8A 1GR0A 4WN3A 5SYMA 3WJMB 1A9YA 1G87A 3IR5A 2JGDB 3DECA 4YO7A 5HNKA 4HOMA 1F12A 1KC5L 2F1IA 3ZWKA 3R7QA 2WJHA 5CO1A 3JXEA 1N33B 2ID4A 2WM8A 2R44A 2QZ5A 2CIIA 1PSWA 3BOSA 4LDZA 5G55A 5CD3A 1CS0A 1T3GA 4D9IA 5I45A 3RIAK 2R2EB 4ZCRA 1CUXA 3C14C 2A0KA 4HXAL 2GH1A 3O2DL 3AUKA 1S2MA 4ZTBA 1ENZA 5EUCA 1S7QB 3IVXA 5H83A 3QNXB 3LRMA 5I3CA 5EVJA 4ZZKA 5CB4B 4OF8A 3NM5A 4G9DA 4Z0XA 1NSYA 1SC3A 1ETUA 4JKMA 4MYHA 5CNMA 2PUCA 2N1BA 5CD1A 2CPCA 2HYIC 4K94C 1KCVH 3DPBB 5ITZB 4R7GA 3P4NA 1Y4ZA 2G1AA 3ZU5A 4J07A 3FONB 4B3JA 5ITFA 1Z5ZA 1K06A 4YFYA 4KMRA 1U8JA 4AQ8A 4TV8F 1UBHS 2KZ1B 4LS3A 3ROKA 5JSZB 2WM9B 3IGAB 2I4LA 4R2KA 2H5UA 1QFXA 3F64A 4ZYZA 4ZFQA 4REQB 3O91A 1KYOJ 4XBMA 5ISZE 5KSAD 1BJKA 4OQFA 4H3KB 4AL8C 1AGYA 3N40F 4ARCA 4IDHA 3B5TA 5JMWA 1N0IA 1NCNA 2RH8A 5KNDD 4C4UA 5LBSH 1F1GA 1VA4A 3K15A 4GQBA 4V2BA 4YBQD 1QDUA 1IC4H 5JCOC 3O8RA 4UZEA 2Q1EA 4M7JH 3LRKA 4Q21A 4XJSA 2NY3B 3DTNA 3S40A 1R0ZA 3P9CA 2J8UB 2UVPB 1IBGL 1NXWA 4JKPH 5G1OA 1E7YA 4EY6A 1JPSL 1M7UA 1A14H 4CC4A 1KB5A 1FGNH 2BXZA 4TQ8A 4AOFA 3TNFA 1R46A 1U28A 2OHXA 2X0RA 3QQ4A 5DTFA 3EPPA 3IDJB 1MVNA 4Q9RH 4U3CA 2EW1A 3KG2A 2IEIA 1QHOA 3QIUB 4OVKA 3AINA 2R1UA 4F2EA 3HBLA 2K7QA 1J8RA 3F7YA 3JYPA 3B82A 2LUOA 4XMPL 1Y4DE 4F92B 3P3SA 3KTAA 1E2HA 1PDOA 3N05A 1FX1A 4KODA 2AZXA 4H1LH 3JWDH 4F7KA 4U5XA 1NTDA 3IOMA 1S4QA 2ENSA 4ZX3A 2W6MA 3A14A 4Z3OA 4NBNA 3GFFA 1EAPB 4BH8B 4G1BA 1QWSA 5I7WA 4ZXBA 5ALWA 4QC2A 1G20E 1M0EA 3MS2A 1MIML 4GBXA 4Z5RB 4P3CL 5EO0A 4UVDA 3KWLA 2FLWA 2J9YB 2WIAA 3T5AA 2OMYB 4F8NA 3RNLA 4M1OA 2G76A 3PVZA 2G67A 1GOTA 1Q1AA 4K5PA 4EKIA 1Z6AA 1J5OL 1FRQA 4BLUA 4F4UA 1EG2A 4TM7A 4HMOA 3ARQA 2VABB 4KXBA 4U1JB 1JEEA 3HACA 4MB5A 1GPUA 3L9EA 2GEBA 5KBNC 4OGWA 4HDNA 4B3DA 1QHGA 1RLIA 2RHTA 4GWGA 4QEKA 5EEWA 2XZPA 1GSAA 4P93A 5H35A 1H9VA 1ORDA 1UOWA 1I2BA 2QD3A 5BOZG 4POOA 4WJ5A 1UG9A 3TBWB 4YECA 5JHDE 3P9NA 4F1SA 1QSFD 1VGKB 1B0RA 1DKNA 2NM0A 4FEIA 4ALJA 3O4RA 2C61A 3NVAA 5I8KH 4JT8A 2YJ3A 2HM7A 4CNBA 3L43A 4I3SH 1ZXLA 1SU4A 4LOLA 4MQUA 2YXWA 3EYOA 1G3IA 3RYCB 1SRRA 1Z6TA 3FQTA 4JHWL 1DRUA 3GKZA 5JECA 2J67A 1JPVA 3DAFA 3C8DA 2WLLB 3QRFM 4JZOA 1SBYA 3EPKA 3ZQKA 3FUFA 5J3HD 5BVGA 2P41A 4NZUL 4FBLA 1U2YA 4H7IA 2IY9A 3CSTA 4DPBX 3M6LA 1J2TA 4MUKA 1MP0A 3MV9A 3G0BA 4PHHA 4B47A 3DUFB 5HI3C 2AKRB 3O4OB 1RUML 4LO9A 4J23A 4KPGA 4CKYA 2VKWA 3WHE1 1OBFO 4ZQIA 1XU7A 3ESUF 5I1GL 5KWVA 1O6CA 1RUAL 2VUTA 5BUSA 3RAFC 2JF0A 2SICE 1LEIA 4JITA 2EP7A 2GRUA 1CLEA 3DX9B 1TNMA 2ZOLB 4EDWH 1E6LA 3BMOA 4ACAA 3FSVA 3DV6A 4XP5L 3FSGD 2YWYA 4U7GA 1W0WA 3W8DA 1AJ7L 2JI2A 5BQOA 1Z4MA 4PXYA 4HISA 3GVCA 3T2OA 4B3EA 3BPLB 3MZTA 3H9HB 5AW8B 2WIGA 2CHXA 3JWDC 3LTEA 4XBGB 3L49A 5H4HA 4PYOA 4FHCA 4ARAA 3WN6A 5EWLB 1WLYA 1U8CA 5ALBH 2MFNA 4LHXA 1Y48E 2QRPA 3ZE2E 5I17A 2XDWA 1U3FA 1ZHNA 5SZKB 3DLAA 4HJJL 5EPMB 1Z0ZA 1UBNA 1VIDA 4GO9A 3E80A 1Q21A 3PWJB 2PQ2A 2B94A 2Y05A 1CE1L 5FNVF 3FROA 4BRWA 2UYHA 5HHPB 4O33A 4D82A 2JHCA 3E1GA 1LPMA 3PQYB 4IUDS 4PX2A 3WRXA 4LCIL 1HK6A 1Q0SA 5JJKA 2QVTA 3VC1A 4X42A 3WTYA 1YZNA 4HKXA 4G0OA 1D7CA 2VNJA 3WWCA 1E79D 4AT1A 4YJGA 1G4MA 4AV5A 3Q5DA 2HG5B 2R7EA 2YO3A 2VN4A 5JPNB 1ODUA 2HFJA 4U1LB 1KKMA 2X2OA 3RRXA 5C34B 3LKRA 3WFEH 4LX0A 1HEIA 1V7NL 3ZU2A 3JQEA 2AJ3A 4JRXE 2CGRL 3MBXL 3NHJA 1D5BB 1G0XA 1L5QA 5FEBA 3G89A 2AXGB 4K9EL 4RORA 4HIXL 4DUZB 3DIFB 2HKAA 2E7DA 1E7SA 1F3OA 2CMKA 3GJ3A 3IOCA 1UT2A 2FD6L 1T13A 3LT4A 1GHFL 1VACB 4JO8A 1IY8A 1L5LA 1S5HB 1MPAH 1CB4A 4YALA 3FOFC 4Y18A 1KI8A 4LSUH 1DQLH 4GW1A 3HNVH 2Q3HA 2R25B 4W9FC 2WXHA 3FSJX 4MWBA 2JVJA 3QZWA 2B2XA 1GSIA 3QVKA 3G0GA 3CHRA 1MGPA 5K6AA 1TI7A 1T1YB 4M7ZB 3CF2A 2FG6C 2RHCA 1Y6RA 2ILTA 1BXUA 1TQBB 1NQBA 3DVLA 3PDGA 1I0ZA 4OG2A 1Z8HA 2XWQA 3DYMA 3ZK7A 3WGGA 1JKXA 3WS6C 3T5WA 2GJ8A 3UK7A 1D3AA 5IVXA 2G5BB 2GJPA 2QSJA 3C3XA 3OZWA 4LWPA 1CQKA 3OWHA 5A6SB 1MRCH 3P4OA 2UAGA 3PA6A 4DR5B 3TYGL 2BHUA 1G38A 3Q6GH 1YDEA 4JN2B 1RL1A 2JHPA 2WMDA 4G70B 1J5DA 4KKBD 2X6CA 3OAUL 5H9WA 1SZCA 1RXEA 4RD0A 2WSDA 2FLMA 5I5RA 4UZFA 1VZ2A 3F78A 2JBWA 4PVNA 4YSTA 2VR4A 2PR2A 3NAQA 2DKNA 3ZVMA 4HZLB 4NOMA 3RNKB 3THYA 2WV3A 1RD6A 4PJDF 4EZJA 4K8RD 3UO8B 4KH2A 1T2VA 2VCEA 3OQPA 3K7UA 2AB0A 1KC1A 1AP2A 2RHMA 1AQKH 1HX0A 4ZN6A 4N8VG 1L5KA 2QVIA 3GNTA 1T0NB 5EFIB 3SOTA 1W4ZA 3BWVA 4DQXA 4DCJA 1E2JA 2AW3A 4LK4A 3K0WA 1N0XH 5K93A 5DHRA 2IEDA 2JFZA 1BZ8A 2WO2B 4FQXC 3H3KA 1XO1A 3PC6A 3TTVA 1L3IA 2BSRA 4AKPA 5JQWA 1T2DA 3COJA 5JDJA 5J8OA 3DUSB 1ZK2A 3WKML 3LOUA 5H4ZA 1VFUA 1HHKA 1ZMOA 1BVOA 5B3JE 5D7IA 1N9KA 1PEDA 4PFQA 4J4PD 1V7ZA 1E8XA 4HETA 1T35A 5D6CB 3KUUA 1CG9B 1BZ9A 4LOFA 2FR1A 3FQXB 2IBMA 2JK1A 5C35A 2BVUA 2FGZA 5E8DL 3OZLA 4TT3D 2H0EA 4ICWA 2MPVA 1WYJA 4OKIA 4EQ6B 4HK0A 4L4JA 4B3RB 1OEZW 4IIQC 2X4RA 1NMAH 4BN0A 3SCZA 2OSXA 4LNRA 5FBRB 1OC4A 3BVVA 1MB9A 1FVXA 1EXMA 1N8SA 1PEKE 1UM9B 1HHJA 1B73A 3CPJB 1FP5A 5DEGB 4K9QA 3RI3A 5JJIA 1R19A 4PCKA 3LZ6A 2FJUB 3VSVA 5F7WC 1E89A 1I8LA 5C3LD 4EGQA 3UTPD 2AC4A 2P2SA 4IAOA 4US0R 1K2DA 2EIDA 4XP6H 2MCG1 4YRCA 1SC9A 1O0SA 4FI8A 5A7EA 3D8HA 3R6DA 4XI5C 3ULSA 1BFSA 3WP0A 4DF9A 3I76A 3LPPA 2C2ZA 4Y7MA 4EFNA 4M54A 4AYFA 1II8B 5FF6B 2CO1A 3ARRA 3KPSA 1PIFA 4KK3A 2LNDA 5MN5A 1YZYA 5HYEA 2AN1A 1C5DB 3UC0H 2BM8A 1C4OA 2IYUA 4GMGA 4A7SA 3LUHA 4DMMA 1U3HD 4F9LA 2G9VA 3BGMB 4PO9A 2CBOA 3H3FA 4ZOQI 4O4IF 1DC6A 3F83A 4RTQA 4O4JB 4GFXA 4QUDA 3U7QA 1OAXH 3OEYA 5CA0B 1CJSA 1MHPA 4KNQA 2EDCA 4I2XA 1J1IA 1Z3IX 1FG2A 3LPOA 4GUAA 4OUDA 2GHRA 5IXSA 5K0FA 1X1BA 3K2BA 4G0WA 2PEYA 3P3RA 4N0CD 2XMZA 5EIIG 1ZWIA 3SEZA 1QQDB 1K6XA 1RXLA 5E6SB 4L8VA 4PLZA 4RVHA 2JCGA 1A2BA 3WJ1A 5CJBA 4KQ2A 3OCJA 2J57A 5T3XL 1E3FA 2KPWA 4RGNE 5C8ZA 2CHVA 3N3EA 1ZOOA 3HUDA 5EUMA 5BQ5A 2VZSA 2C04A 3QW4B 2O61A 3DE2X 1N9GB 4LCWA 2BP0A 1OWPA 2LVBA 1NC3A 3EO1A 4ELDA 3IEAA 2Y06H 4NCBA 3ULVE 1IUNA 2HR1A 4RXMA 1Q0ZA 3CMGA 2EDNA 4HP5A 3WNOA 3INNA 3RD5A 1E3DA 2VWEC 3OT1B 1NI3A 4BNZA 2YVUA 4DVBB 1USGA 1WHPA 3PG5A 4AUYA 2O1XA 4XVTL 4I4IA 1FPTH 3R0XA 1TM4E 1J07A 3LKQB 1LE9B 4YRLA 4FCVA 3SQXA 1I9RL 3KKLA 4MVJE 3FHJA 4EDHA 4R1MA 3SXPA 4RYDA 4M6NH 2R0WH 3BDBA 3BL8A 4PSPA 2OMXA 1YEEH 4WKXA 2QQQA 2CO6A 4M5ZL 4IRZL 1QTPA 5IDQA 3FOCA 5GGSA 3WEXB 2AK1L 3WLSA 2H1XA 1NRXA 1T7ZA 3MWEB 4KO3S 5B37A 4ISCA 2IRWA 4OV5B 4QFMA 1CZUA 1HYGA 3WQQA 3SP1A 2XLLA 4ZW7A 3V0GA 2AN3A 3AWIA 4JHUA 5BOVA 4IKNA 4NO3B 2DPKA 1S4IA 5B2ZA 3NIBA 3R7BA 1BVLA 4ZNCD 1WZMA 1FNFA 3MROB 2UXVA 1X3SA 2R8EA 2ZWPA 4EHLA 2Z31D 1UFVA 5EZIH 1Q17A 3OVMA 3UAVA 1DJQA 3PQDA 1OXTA 5TDOB 4FDUA 4J1TC 3WA7A 1Y42X 4D8TA 3MNWA 3EKCA 1OFUA 4QRFA 4WN9B 4GP8B 1E4XH 5SZHB 2ZKHL 1PFQA 3MRSA 2Z2ZA 3HJEA 1WZIA 1KRXA 4B8YA 3CD4A 1E5BA 2BM1A 4DW8A 1EERB 2R1VB 2H48A 1CYWA 4JBNA 4N8CH 1KVSA 4XTCS 1RZKC 1MREH 2PL3A 4MNQB 5CX4A 5ARCA 1N3YA 4ETQA 1XOIA 3JQAB 2FEEI 1OH7A 5EZSA 4E2OA 1DIOB 1D6NA 4DN6A 1MF2L 4E4YA 4B34A 1QWOA 2VR9A 2YOHA 1ZH6A 3QJSB 4RGYA 4WJ5B 3EVDA 3ROMA 3TSAA 3LSTA 1NOKA 3THMH 2WJ6A 1VGKA 1BV8A 4PZZA 1F4XL 3DMMB 1J87A 5MEND 2BOBA 2AFNA 4NZRL 4OHCA 3FTEA 3KYJB 3DJ9A 3OO0A 4DLWA 2BP7A 4TS1A 5FV4A 1B43A 1GCFA 3DBLA 4XWOD 1W8DA 3EEBA 3DX2A 5FJJA 5BJTB 2A9NL 4FK8A 3OHMB 4P5DA 1BM7A 1FH5H 2IOOA 4F1ZA 1YEFL 4XFKA 1XLTA 5IVDA 1XG5A 1WDKA 3NJIA 3A27A 3PEWA 5I8WA 2RGYA 2XE4A 2PW2B 3NR2A 4CCYA 4NPJA 5EJ9A 2H2DA 1HNFA 3MV9B 2Z2YA 1BD2A 1F45A 5HCNA 4HGZA 4I3HA 3KDAA 3SE0A 5JQGB 1KXHA 5F52A 1A7PL 3PY9A 1XDWA 2BO0A 2YFKA 3CVIH 3RKDD 3W4KA 4FQHA 5I1EH 5AFSA 1M0TA 2WV7A 1U2GA 2WBXA 4TTGA 3GSWB 3NVQA 3HRKA 2H7WA 4GLBA 4Q5IA 5TPZD 1WT5A 3IKMB 4RKQA 3PX2A 2CA4A 5L2KD 3P2YA 1L5VA 4ERSL 5GGUA 1JILA 4QXPA 4RGVA 1I8KA 4OCXL 3K0CA 4U6YA 1CUSA 3Q6IA 1CR9L 3M1CA 4PN6A 2Z6FA 5K9OA 4TXLA 2ZNWA 3SEPA 2CZGA 1NFQA 1UMCB 5D1ZI 1ZQ1A 1GXSB 4PUBH 3JW8A 3LVBA 3FMGA 3PLNA 3FTQA 2WG1A 2L17A 4OGYH 2C9CA 5EG5A 4OI0A 2V7VA 2GPAA 3OC0A 1CFNA 3GRUA 4FYJA 5DGCA 2ID8A 3A6OA 2CZCA 2PZ8A 4EG5A 1OI2A 1M6OB 5EIEA 5I75B 2IYLD 1MCOL 3FXAA 2BIPA 3TJHD 3HPLB 4RGND 3JYQA 2FLKA 2IIPA 4GI1A 1IBHA 1ADBA 9LDBA 4HFRA 4X8XA 3A70A 3M4XA 3RSZA 3WV0A 2X6RA 1IQDB 1NLZA 2VIRB 4F1JA 1NLYA 1I7ZB 4TWBA 3QA3A 5JQHC 3R7FA 3FB1A 2XFXA 4XZUA 4HWPA 4I5EA 1DOAA 1LPNA 4MYUA 4Y1RB 3AL0C 3L1FA 1JHXA 2M6LA 3QHPA 1BG6A 4Z7VB 3HC4H 2XZAL 4PJXF 2XQYG 1INLA 1U7DA 2I2WA 3PQ3A 4L1KA 2RHEA 3H97A 2JLWA 3JR7A 3PXXA 4B2IA 1A7AA 4YJGB 2PIDA 2WMPA 4UPVA 4BO2A 1Z5HA 3OJ0A 4ENRA 4AJYV 1JFVA 2J6EA 4NPAA 3QPQD 4NXSA 2QMYA 3WWPA 4DQLA 3KYAA 4KKBC 2XHZA 4NHUB 8GPBA 4GH7B 2XQGA 4IGFA 2OSLA 4JD5A 4E5SA 5IHLB 3SJCA 2MQGA 4XX1A 3QORD 4KKLD 4DGIL 3EG9A 4KDEA 4DQDA 2AJUL 1V1RB 1F4WH 2X8BA 5SWZB 3L82B 4U3JA 4FP8L 4LSTL 2XUIA 3MLSL 2BE9A 2G4CA 3KR3H 3RA7H 3HNSH 4F57L 1ZANL 1C30B 5DQ9B 4DJAA 3S55A 5MERB 1TETH 7REQB 3GXTA 3A3KA 2P2LA 1CQXA 4FR0A 3RVKA 2Z43A 3HG0A 4WVRA 5BW4A 2WYWA 5AHWA 3SDCC 1YECL 2NTJA 4XHJC 1DINA 3RHTA 1AXTH 5J2TF 4GR9A 1IB5A 3P32A 1R3KB 3TBCA 2X6BA 3HHPA 1YNTB 1TZ8A 2C9RA 1N6VA 3TI9A 1TZGH 2PUDA 5C0JB 2I9TB 4AH2B 2FWOB 2VXSH 4A6YH 4DQVA 3KJXA 2IXGA 3RREA 1RSFA 2JLBA 4YCJA 1LDPH 1WCYA 1NNUA 1U8QA 1U3ZA 3LQZA 5BN4B 2PLTA 2AH5A 3RU2A 4Q4EA 4MUIA 4OSUL 5ALTA 1VP3A 2J4FA 2OCIA 2ZUUA 4J0JA 4A7UA 1G3QA 2WHVA 4LKOA 2O93L 4NR0A 1EHCA 3D52A 4OIIH 3B6SB 3D5QA 3SPXA 1JXAA 5JPMB 1OSPH 1KSRA 1BEYH 2G04A 1U2DC 4KFCA 2I76A 3HUUA 3QBEA 3BMNB 5BT9A 5BNXD 2BX5A 2I4RA 4K28A 4LDEB 1QP1A 4P0PB 1ZH4A 2AFIE 4IDFA 1H0DA 3TB6A 4HDRB 2B77A 1NCBL 1AXSA 3GZQA 4KFMA 3COZA 4HVAA 4PZEA 1M8JA 1DJWA 4PRIB 1C7JA 3IDIB 3T1OA 1X7WB 3HCWA 3RIAF 1VRCA 4PJDE 1V3UA 2Q5LA 4J9UE 3T3OA 1RZIB 3OZFA 2XPZA 5D1QC 2I99A 1IN4A 3G9VA 4EJSA 2VP6A 1WZCA 3TU6A 1E5CA 1N1GA 1NKGA 4A7TA 4TVSa 2R51A 3U2SA 4AN1A 5ELXA 4CKBA 2QQLH 1UXOA 3L2MA 1NF2A 4D57A 5BXYA 3OZTA 4F7MA 1H2FA 3OQHA 4LF6B 2H4JA 3LOPA 2FPIB 2FN4A 3W5AA 3KL3A 4FFLA 1U9YA 2QG6A 3REQA 3N2KB 5D3QA 3K70C 3PUYA 1P7WA 2O57A 3H0KA 1TU3A 3RS9A 4HJJH 1JKIA 3HEMA 4OPMA 2I2BA 3VFMA 4IS6A 3CF0A 2CWWA 4E6EA 3LTVA 5H4YA 4KJZA 1ADQH 4RJLA 2GUYA 4F1WA 4UT6L 1A0QH 5B1EA 1LJMA 1SCIA 2Y2UA 1EHIA 4OJEH 2VQDA 3UIYA 4MIOA 4XBEH 4ZFOL 2C7QA 2OGZA 1C9JA 1EVQA 1QLFA 4CMMA 4D9LL 5LUBA 3LP5A 1YQVL 4LDAA 2WXKA 2RHGB 1TKBA 1BYIA 3UTSA 5IBQA 5E9DE 1L8QA 1Y3CE 4XDYA 1U3JA 4DOMA 3L4JA 2CL7X 1DQVA 1MCRA 3LZRA 1IVTA 2Y06L 2BNQA 1TDQA 3NFSH 4NU5A 4EN2A 3HVJA 5IESL 1K8IB 5IZ7A 3UMCA 4Z7IA 4D9FA 2PF6A 1ZHLA 3QUMB 4UV4H 3N8KA 5BN1A 5K2OA 1C3OB 2ZUTA 2BR4A 1X80B 3VC7A 1T1EA 2INGX 1LA2A 3GBNL 1A8IA 1WSST 1J18A 3V9AA 1F4WL 3NYWA 4ZV9A 1BMWA 3HBGA 5IREA 4RVNA 4FP9A 4K1LA 5F2EA 5BMVF 4PQXA 3F98A 2VXQL 3C6ZA 4MR7A 1IILE 4XPGH 1S8OA 1BQ4A 4P34A 4WY2A 2OZKA 5I1IL 4IY1A 3OG6B 1E6MA 1XI2A 3O92A 3NBYC 1JTTA 3E0XA 4Y16D 1YB2A 1MCCA 4YJDA 1MPXA 3OLVA 3D6NB 3PXDA 5BQ7A 1LK5A 4JCOA 2QBWA 2XWTB 3EZGA 3BP6B 5CLZA 4K3JH 4AKSA 1SN2A 3MRLA 1QZUA 3UFXB 2BS9A 1BZ7A 4YAOA 4PPQA 1MHTA 2NUPB 4EYSA 4LLVB 1PX8A 5ECDA 2F5AL 1BDJA 1J05B 1PSDA 1RFDH 4LGRB 1RYFA 3QPQC 4XNYL 1LVHA 3WMSA 4WU5B 2WJAA 4JFRA 4LSZA 4H8VA 2D9QB 3DVAA 5JYEA 3SQOH 3INRA 4LCYA 1PL0A 4LQDA 1LZLA 4YL9A 1OB1B 3R20A 1IFXA 3RO7A 2NYYD 3MREB 3VYUB 2ZEJA 2GA8A 4HAOA 2EXWD 4C56D 1ZN9A 3H5AA 1II9A 1MFCL 1G6HA 3IJ5A 1CS6A 3L6FB 3U36B 3UYPA 4LL4A 3QJYA 3BHJA 5E8EB 5CLGA 3JSAA 3CCHA 1V45E 3TVMC 4JGMA 3BT2H 1C1DB 4P2GA 3KWMA 2GO7A 4XB1A 2QHRL 3X2SA 4PJIA 3HL4A 1EWQA 4G0PA 4Z7UF 1B8VA 2IELA 3C39A 3EDCA 3PEUA 5E9JA 5JFTA 2R85A 4Q1AA 5EBWA 4N87A 3P4UA 1EBAA 1CFSA 1G291 3GFBA 3PNBA 2NZUG 5SYAA 1ACJA 3UY4A 2BY2A 1RI2A 2MSNA 3QNZB 1NBMA 4JB0A 2H9GB 1JG6A 1CLYH 2AEFA 5CLIA 4RHTA 3PQ8A 5LYJA 2X7LB 3ZH2A 5DNYB 3Q0EA 2ZRIA 1V8BA 2HA0A 4BYMA 4EPYA 1U1CA 1QQ7A 5HE8A 1ZIYA 4GB9A 4CM3A 3P0FA 3L9WA 1CQIA 4FDAA 3KR3L 2X0JA 1BVYF 3CT4A 4U49A 1TEGA 1XR9A 4C2UA 1RIVH 3EJPA 2EEAA 4EB0A 2ZBFA 3SD5A 5DS8A 4IV5A 2W9EH 2FLRT 4NKMA 4TUYB 4CLXA 3BH8A 2R8YA 2AMFA 3QF4B 4X7MA 4XTRA 1RRVA 4PLWA 3OF6D 4MW6A 1WP9A 3KL4A 4FYQA 3TQRA 3T1FB 1SXQA 5INDA 2EIJB 3JXAA 1FQKA 3NUZA 4DPAX 3N0RA 1PI3A 3GUUA 1W2GA 3B5GA 3GGSA 3V5HA 1QMGA 4F4FA 4QJ3B 3CWCA 2FMTA 1OANA 3B8SA 5SWQA 4APQB 4AYDC 3KKNA 5JROA 3RASA 2GAAA 1TZKA 2OO5A 4E9YA 3QIWB 4UU9A 3SDAB 1MC4A 2X12A 3Q2VA 4CM9A 4D02A 4LIQH 1C7EA 2XZDA 3BSZH 5EWMA 4XGNA 3A6ZA 5I76B 4KXZI 1MVLA 1UXSA 3X1NA 4JXZA 4BVEA 5J63A 2DWOA 3A4MA 5FTLA 4BO5A 3VU9B 3T0EC 2D0GA 5CIPH 2CHUA 4TL4A 1X5YA 2TMKA 2FZKA 2B99A 3KSAC 1HG0A 2O7QA 5JBNA 2OOKA 2VXVH 1GSHA 2BIQA 1I80A 1D7OA 4C7JA 1IPFA 1QPGA 4WCYL 4PANA 2YAFA 3ZHUA 8PAZA 3IMWA 5K8UA 1P4UA 2DQFB 1A7OH 1U3NA 3AB8A 3O1LA 5F9HA 4ONOA 2CY0A 4YK7A 5C2UB 4X92A 5CIQA 4JO3H 5BJTA 2BJWA 3V1TC 2XQVA 1TZAA 4U7HA 1ZO8A 3TN0C 3QBTA 3OX2A 4IEFA 5LGYA 2PCPA 2V7UA 4FYVA 2A78A 1W4CA 5CT6A 2M26A 5AL8A 1FNLA 5FPHA 1KEMH 5FFOA 2WTPA 1GZHB 3OZRA 1VBKA 2AFVA 4GMHA 1P3Y1 5K9KB 1I8AA 3LIUA 1KAMA 3CTPA 1EO7A 2FPGB 2ZRGA 3OA2A 1T7YA 4LJ6A 4B6FA 4KEAA 5LWQA 4D9KA 3DDGA 4JFOA 3KB2A 1QVWA 3V8OA 4D6YA 3FVWA 5DUML 1JIVA 1A4JB 4DEPC 3K9NA 4MAYA 1NMXA 2I29A 2I2FA 3H2SA 2IF7A 3HKBA 5D72L 2BVYA 1UDBA 3S5UA 4JPWL 4BU1A 1Y6MR 1QBKC 5KBLA 5M34A 4BO7A 4Q2ZA 3Q8WA 2HFTA 4IBTA 43CAB 3DETC 2QN9A 4BNIA 5E03A 4I0PA 5KNCH 5KTKA 1BQEA 1QSVA 4J3SA 2CK0H 3QAZB 2O3SA 2A59A 1JV5B 2O7SA 4GS7B 1MSPA 4XCXA 2ITEA 3M17A 5FTWA 5EZJB 3R7NA 1KY7A 1ZJZA 1KDZA 3VYTB 1UOVA 3HS3A 2DLGA 1T5BA 1N92A 5C9ZA 5KWJA 4EUPB 1WD9A 4FS8A 5ETUA 4KR2A 1OWNA 4PBXA 1K89A 1J8QA 3HC4L 1Z88A 2FMHA 2FWAA 2BMAA 1J10A 3I3OA 1MOPA 1NBEA 3ESQA 4DN4L 2LP4Y 1PZSA 2CMRH 4Q9AA 4LRQA 3R9KA 3TQCA 4HU2A 5IM4A 1BDYA 4UHEA 4B7IA 4GBJA 1WMAA 3LZLA 2Y24A 1SK8A 5ITVA 4JFWA 2CNDA 4M7PA 3BCSA 1D0VA 4HT1H 3TO4B 2BOVA 4X6DF 3EDEA 4N68A 1I3GL 3S4SG 3FB8B 4HJ0C 1X9LA 3MHZA 3RK0A 2IQ5A 5KC9A 4JI0B 5JLJA 1ZCJA 4BK8A 3DQQA 1OSPL 1UFGA 4XRGA 4YJHA 3VSBA 1L3WA 3BRFA 1J2EA 2AP2A 1KPUB 1GD1O 4HPOH 1OWMA 1HL8A 1ZRNA 1MAUA 2IEZA 2WLYA 3GF8A 1NULA 1AQLA 2GJSA 4GE0A 5C37A 4XUCA 1H3EA 3RG8A 3DLBA 1TTGA 1DN0A 1SIWA 4L3EE 1WFOA 2PNDA 3KYDB 4Q3AA 4L8FA 1TCAA 3D0QA 3WIBA 3K9LA 1R0BA 2B4TO 2RQ8A 4PW4A 1L7DA 3V2GA 1SCDA 2EJUA 4XN1A 4LGYA 4R90H 3OSVA 1QDEA 1BM3H 4WU7A 2J6BA 4HJXA 1FL3B 1ORSA 2XKNA 2QDKA 1J1PL 2EZ4A 4PJAB 1Z8FA 1F38A 4W1QA 2VZEA 3WTSA 2W6JA 1YRQA 2EFJA 4HXAH 4FCCA 1RMQA 3F5QA 3UV7A 2R47A 4PLOB 5E8NB 4JBIA 5AOJA 4HFJA 4H2DA 1JR3D 2GJRA 5FHAH 1VHQA 2YUIA 2C8JA 2C4WA 4KZEH 4E9TA 2FWNA 3K05A 4KOAA 3T7RA 4FFBA 4XM2A 4DO4A 1L4BA 4L4ZA 5HHNA 2JKYA 1VAHA 2HRHA 1F3LA 3TOZA 1ADWA 1YGPA 4EJFA 4M8NE 3B2EA 3HNOA 3DJRA 2VJLA 1AO7A 1D7AA 5KW9L 2HWYA 1YN7A 2OZ4H 2EAUA 4R71A 3KR1A 1FDRA 2H16A 5HFAA 3KKQA 1FP4A 5DRXA 5KOMC 3HRZC 4B50A 3G6JA 3QP9A 4NCNA 4OLEA 3E5MA 4BVBA 1X7WA 3Q7PA 2G2RB 1INDL 1X3LA 3I9MA 1EX6A 3MB5A 2HSIA 2QJTA 1XTQA 2R1ZA 2I07A 2JHFA 4V0NA 5A03A 4BWGA 1CRPA 2NZ2A 1ACMA 1YYML 1ZRSA 1G42A 4ASUD 4JPWH 4KXZH 2MWCA 3QEKA 2GRAA 2CC2A 2PMWB 4ZTOH 4Z7NF 2HO4A 1AF7A 4G9BA 3WO1A 1UEYA 3RILA 2EXTA 3KLHC 4NSKA 4G1CA 1JSLA 5CB0A 2FXVA 3OCYA 2XYPA 1RMTA 2QX9A 1DSYA 2WEKA 4DQOH 1VJCA 4XXWA 4NUQA 3FMIA 2FX8L 1S4MA 4FDMA 1VRWA 1LGVA 4PS4H 1XQ1A 2FQGA 2VOJA 1ND0A 2M1KA 2XCMC 4EBQH 2AKRA 2I2DA 5L95A 3OU6A 3NJMA 2VEDA 3AG1B 2R8SL 3WNZA 1EPUA 2QV2A 2YQ2A 3VXPA 1Z3GH 3NU1A 2WM3A 3SF0A 4HUUB 4ALAL 5DHSA 3W8RA 1NOLA 4LMQI 4M4SA 3W11C 1L7BA 3I53A 1BOGA 3JZ7A 4OH2A 1F2DA 1XPOA 3LN9A 3RKUA 3NRJA 4XNAA 1ZH0A 3LCMA 3KVRA 2HFEB 4HATA 3KQNA 5IVZB 1FQJA 1PGNA 1BHO1 1JWBB 1PV2A 4K3DL 1W0WB 1F4AA 1VJ1A 4POZC 1CKEA 3JVIA 4XEHA 2UZIL 2PL5A 3S3DB 2V7GA 3NHMA 3IXMA 3OUTA 4N6RB 3MRFA 1FYXA 4ODTL 4QHNB 4HIXH 2G0TA 5BN3B 2DJUA 3RUGB 5DMGC 2DBLL 2BI8A 1I1AA 5H16A 5D1QB 1WP6A 4PW3A 1TQ6A 4QMEA 1U8AA 2VERN 2H1VA 5ISZD 3FZEA 4KKCD 1CY1A 2CJUH 2F67A 4R0MA 3M1OA 3HI4A 12E8H 1EH9A 1HBJA 2XBDA 5K0EA 3L1UA 5HYFA 1BF5A 1B0WA 4ZCQA 3ERCA 1OB2A 1E4KC 1U2TA 2FZGA 3TRFA 3B9DA 2PK3A 3MHPA 4KI5F 2O2JA 4M5YL 1N7MH 3M5DA 1UBRS 3X44A 4F85A 5FUCC 3IQXA 1EDHA 2HA4A 1XFPA 2A92A 2UUBB 3IJ9A 4Z95L 3BIXA 3VDAA 1O7JA 3DSNB 3CLUD 4Y19A 1G3MA 1JFTA 5BS0D 2LQRA 2VH1A 4UNNA 4CTMA 5KBKA 3KD4A 2ENUA 3AONB 5GTDA 1BKYA 5K9JL 4XIFA 3HY6A 2P45B 3GBML 3UMBA 3O0RL 5ADUS 5F21B 4Z77A 4IGEA 2V17H 3RDTC 4D4GA 3PL6A 2PETA 2JAWA 1NQUA 3QIBC 2CRIA 2HRLA 5L8LB 2AG6A 1S2LA 5KBPA 1H5QA 2X4PA 2GAZB 4WU5A 1CXEA 1ZD6A 1W0KA 1S3KH 5GRYA 2EH7L 4G8EB 3TYGH 4L9LB 1DVFB 2J73A 4RH4A 5IB2A 3H7BA 4NWIA 3SCMA 3TI7A 3BAIA 1H2AS 3JWJA 2QHRH 1ABBA 3LN4A 4CA4A 1MG2C 3O4OC 1VIWA 5I1LA 1BQUA 5GS2D 3Q9QA 4TXMA 1KO4A 3PNKA 1NBHA 3PGA1 2XAAA 5CFOA 1T66C 2VDLL 2Q5QA 4FI3C 2EOAA 2YJQA 4OZGF 2VAWA 3ZBMA 5F9DC 2O54A 5E8EA 2BHLA 4Q8BA 3OEHA 4RZUA 2JKIS 1T6ZA 3QXTA 1I9JH 3TKYA 1B6RA 2YPKA 1XJ0A 1RXUA 2J59A 4EKYA 3KWWB 1QHNA 3QWRD 2RQEA 4H3SA 4IHKA 1EUDB 3DX3A 4C3OB 4ODVL 3QWHA 1UWKA 5REQB 4MIYA 3ZUPA 1G6VK 3TEJA 3QDME 1G1YA 5CBPA 1XH3B 2XG4B 4J2OA 4N65A 4Y4KB 3QZBA 3AZPA 4PFSA 2CDCA 1DQZA 4OBEA 1XXHE 3HUJA 3CLFL 3CNQS 1N7IA 4NM4H 4C2BA 5D4QA 4FFWC 1G7LB 4NZUH 4TLUA 4MGHA 2FR4A 2N1TE 4N2HA 1E4WH 4CVXA 4ZFGL 3FFCA 1AQIA 4BXOA 3ZHCA 1ZN2A 3NO4A 2QRGA 2NPOA 1T9KA 5DD5L 4Z7OF 1P4JA 1DNPA 2AQKA 3E3MA 5C07E 3EXHC 1ZYUA 2D7NA 4XC1L 4L5FE 2JARA 4C7VA 4YPFA 4FWWA 4UUNA 2E56A 4RWEA 2VN3A 2AJSL 2ZR0A 3KQOA 1MIHA 2I8AA 1LK0A 4F9LC 2QTNA 3ATAA 3UO1L 3WIIL 4YRGA 4PAMA 2UVFA 1T2XA 2ZRAA 1VFAA 2DR2A 2FJ0A 1W2KT 1Y18A 1ZOXA 2P5ED 3EW7A 4D0DB 1ESEA 4AQZA 4YHIA 3UGQA 4GP6A 4ALIA 2XY2A 3UPTA 1EWTA 1KGYE 1TJGL 3WLPA 5CINL 1RM5A 2FO8A 3EVNA 3HO6A 4QIRA 3WL9A 1I3OA 2EW2A 4Z3HA 2EVGA 4BB9A 3QDJE 3TBSA 3BULA 5T1DH 1XTTA 3IUJA 3LH9A 5ANHA 1AKVA 3IDXL 4IZIA 1LY1A 5M5BA 4DM7A 3G7NA 3Q3CA 1QVOB 4Q4JA 2F8TA 3KLHD 3G8AA 4G07A 4KROD 2JIZA 3KT6A 1S9WA 1BWPA 1IAIL 3DUFA 3INUL 3QEQB 2B0SH 4LLUA 2X0WA 3CRZA 4ORGA 2WUWE 4KKRA 1M8PA 1T1JA 1EQWA 3IAGC 4TYWA 5IYZA 1OCZB 4GOOD 3B60A 1ZRHA 3N0VA 5LU9A 2C5LA 1MV5A 2B59B 4X5LA 2QZQA 4KUCF 2EFCB 3DXAD 5C46F 3MLUH 3H9GA 4PG8A 3SJVA 4Y5YA 2VSFA 1DEEA 1UC8A 4RENA 1RE0A 2VN8A 1HH6B 2YS6A 1ZV5A 4HSGA 1OGPA 1VMEA 1FFTB 1YB6A 4AMGA 5KTPA 4LC1A 3JALB 3ZBTA 1YIOA 2P5TB 1DZBA 1ZR2A 1S96A 4N5MA 4W4TA 4LF3B 4YGAB 1ZCBA 3MC0A 5K8TA 4DN4H 5K9JH 2X89D 3GAZA 5DURD 3HJHA 4CE6A 2OW6A 2JB6A 2FF5A 3N04A 4FMKA 4ZPTA 4Y8AA 3S2EA 2EKLA 4B3XA 4RL4A 4UEJA 4U4AA 2IQAA 3NCHA 2OJ1A 4ABQA 4PTZA 2J8HA 2X8JA 4MJ3A 3IAHA 3ZVRA 5HYSA 3PR2B 1OGAA 4W9KC 1XT5A 1C7SA 1ISHA 1P77A 2KS0A 2G3NA 4UF7C 4OYHA 4OVVA 3QVMA 3LW7A 3QXDA 1E3ZA 3UK1A 4E9LA 4UHKA 1WFIA 5I82A 1FO0A 3RIFK 2YMTA 4M93B 1QW8A 5D2CA 4R7XA 4YONB 5HQJA 1KIQB 4DCVA 1F4VA 2Z35B 3PKIA 5ETUB 1U8XX 1UH5A 3OPYB 4MS4B 5GZ6A 1MJFA 1MJNA 2CO7A 4FFZH 4TQGA 3J80A 2YR0A 2GVDC 2AZ4A 3G8YA 4B6PA 4JBXA 4Y9BA 5C7IO 2Y5QA 3VRHA 2A73A 1U1DA 1U9ZA 1JYEA 1E1MA 4B43A 2XGJA 5HKOA 1S2OA 1AV6A 4I5BA 1A6UH 1RLJA 2E4ZA 3DQPA 4FQIL 5E6SA 2IUFA 1FE8H 4XMLH 1MOZA 4PEVA 4L2YA 1X38A 2VPQA 3L3KA 5GGVY 4F5CE 2OCCB 4IBYA 1F7UA 1KDJA 3MU3A 1AGRA 8ADHA 3NI2A 2AAVA 1JNNH 4ABTA 3AABA 1EGVB 1BX2A 1MCIA 2NQ8A 4FFTA 4M6ML 2Z08A 4DUYB 3RZCB 2WCPA 2DV6A 3WRXC 2PS0A 2RK6A 4NYMR 1EXGA 4Y6GB 5I1JH 1JGDA 3MSPA 1P7HL 2ZXEB 5AM0A 3W6PA 4LB8A 4QLRA 4J3JA 3F2IA 1PFKA 2NTVA 3AITA 5CHNB 2OBXA 4Q4IA 4YGVA 1QX4A 5K0NA 2BHFA 1FY2A 2XWBF 5DSTA 4RYLA 3M81A 4HIJA 2BEVB 2HUHA 4X6FB 2V3WA 2PEZA 3DCYA 4FERA 2E8ZA 3TBFA 1JFHA 4AU1A 1A1OB 2SECE 1Y8RA 4A2DA 1G19A 4OBWA 4M8QB 4XPTH 4ESKA 4IHOB 2DPMA 4EPSA 2X9XA 3IMFA 3H8NA 3TZLA 5AD0A 1ZA6B 5G0UA 3FYDA 3WIOA 3ZW8A 4Y1AD 1UJ3C 3KELA 3DWIA 3QXHA 1AHPA 5LAPA 4TV9B 2TS1A 2HVJA 3ZY7A 1EHLH 4U2YA 1DRVA 1IBSA 4QPCA 3U9TA 5F4ZA 1RPZA 3LQQA 3RFZB 1CQWA 2GYYA 3HWRA 1O96B 4PJEA 4UUJB 1P2BA 4N90D 1FL5B 4H7KA 3VC2A 5DULA 1QF6A 3MLBA 1TFPA 2R4UA 3STZA 4RKFA 3PI7A 2K45A 2FOXA 4HMDA 4KN8A 4KREA 4OQLA 4UOEA 1BE1A 1WY5A 4TUKL 4JFYA 4KJWC 1BD2E 2GZMA 1TZIB 4RBPH 3FO1A 5LQBH 3A58B 1CDUA 3HJUA 1DSFL 1T2EA 2BHRA 4B2YA 1EBPA 1UK8A 4GKLA 1T25A 3IJYB 3UATA 3MO1B 4C58B 3V0JA 4CU6A 2XNKA 4IH1A 1Z33A 1S8AA 3FSWA 2KI6A 1T8UA 4BNUA 3DE0X 3EEOA 3VO0A 4WKOA 3UW3A 2AJXH 5TQ0L 1XHFA 3AEQA 3I02A 5IR1B 1JIQA 2CJPA 4LKRA 1KP2A 1LNZA 5JMOC 2VSYA 3EY4A 1A7RH 3ZRCC 2HT2D 2Z65C 5FUBA 5JASA 4J7RA 1ORHA 1KT2A 1AKQA 3H9QA 4ALNA 3KPNA 5AM1A 2HT2C 2G2RA 4LQCA 2IL1A 4KOEC 4Q1FA 4F72A 1KENL 4OCLC 1MVOA 2H54A 1JIIA 2Y4NA 1K4KA 3JWNG 4HNAB 1AXRA 3TAHA 4MYDA 3SC2B 3KCNA 5FWNA 4BX2A 2XUGA 4AQ7A 2OCYC 2FUQA 4QT5A 3ARBD 4MHHI 5GGVH 2MDTA 1GAFL 3T4AB 3VX1A 3O6VA 4L28A 4R1NA 4UQCA 221PA 4P5TD 1NVEA 3N85H 5F7MC 3LQYA 4TWJA 2E9GA 1FH2A 3JV6A 2XDAA 3GMRA 2FJUA 1ZL0A 3FYUB 4PZ0A 4ES9A 1MEEA 6ADHA 2ZG2A 1AACA 2PYZA 1DDHB 4PJ7B 2QU7A 1JD7A 4DKEH 2VJPA 4GPTA 4YLEA 3QPDA 2WE8A 3ULSB 4K9JA 3U0PB 3BFPA 4MVJP 4QO7A 1QW9A 4YC7A 1GYAA 3ZU4A 4EJ0A 4BE4A 4LXUA 3H19A 3GG2A 5LL6P 3DFZA 1WCIA 1QYVA 4DNXA 3D4GA 2IXQA 1GQFA 4XKJA 3PFKA 5EN2B 4NRDA 1J48A 3FD8A 2I4TA 4WGWB 5IEKA 1OZHA 4TMZA 5FA3B 2RI0A 1XVVA 2X4NA 3IAPA 2WDZA 4PO1A 5EWIH 1DEKA 1JPFB 3CW8X 2VAJA 4S0TD 3WDLA 5TDPB 2KT6A 3JAWB 1DKPA 1ND6A 3E2MA 4J7XA 5KVMC 4NQCA 1NIFA 4DDKA 2JJWA 5DBEX 3G2NA 1TFHA 5AKZA 2IHJA 3UAOA 1JDSA 1QG3A 2B20A 4GOXA 2B6HA 1TIBA 1QV9A 4HIHA 4LSPL 2NNAA 4PTUB 1ETZB 3DX7A 2ITCA 2FPPA 4LCJA 3VFOB 9ATCA 3QZOA 3AP3A 2ZAYA 4FCHA 1UD3A 13PKA 1JCKA 2DHEA 2G75A 1M2FA 4BFJA 2N7SA 4PB9L 1P9NA 1A2KC 5TY0A 5DNAA 1JZHA 3M6AA 4GMSH 2DIEA 2OYMA 2GKIA 4I50B 4L8DB 3I2YX 1LX7A 4JT2A 1QRKA 1CEQA 1NAMH 1NU8A 4N7MA 3KM0A 2EIEA 2QQEA 4HYTA 4R90L 1C9MA 2J44A 5LQRA 3G82C 4JI2B 2WUCH 4TLAA 3WA6A 3L84A 2FEDC 3CK0L 3ZZLA 4PM4A 1IM2A 4FG4A 1SR8A 5FC9A 2G5RA 1I1QB 3P0RA 3J7TA 5FULA 3ONEA 2FSUA 3KALA 2YNMD 2XSKA 1YRBA 2OXIA 2AK4E 4KTDH 2XA9A 3LCJA 5E95B 4ZTPL 1OFGA 3MT0A 1XR3A 1S2IA 2FQQA 2XDHA 2G5TA 3CVIL 3PWTA 3V6MA 4MA4A 3HZKA 5AK6A 1L7IL 3ROEA 4PHZA 1H6FA 2VYVA 4BQCA 4WI9A 1YRHA 4IRJC 3PGMA 4M1SA 3PPIA 1GMIA 2FMKA 2YV3A 1CO1A 3L3HB 3HZ3A 3KLAB 4I0KA 3H6GA 3MRBB 4BMZA 2V96A 4AYGA 1IN6A 4YSQA 4OA5A 3ZE7A 1EXHA 2RAMA 4MPRA 3MUY1 3L17A 4CKWA 2YGOA 2QAIA 4IIUA 4JT4A 1UXMA 2D2VA 4IJKA 3RC1A 3OD5A 2W58A 1I8TA 4DSTA 1W0VB 1Z5UA 2YWFA 3T71A 1OREA 1Z4NA 3TVYA 4N1EA 1FXSA 1SQSA 4ZSOA 4N9GA 4NC0B 4IFIA 5ALVA 5BQXA 3GIWA 4TS3A 1TYDE 2GN2A 4OZGA 3BF8A 4M1WA 4PPGA 1JNLL 4KOCA 1F3DH 2R7AA 2O8CA 3D8BA 2BUCA 5DJAB 1R64A 5T8KC 3AUFA 2JCWA 1VLXA 2O3RA 5ESDA 4GI3A 3JTTA 3KG5A 3W9EA 1Q84A 5BV7B 3OMWA 4AVYA 1JHVA 2YZ7A 2UZXB 2EC5A 3AS0A 2PR4H 1EXUA 1F0PA 6TAAA 4P80A 3RKPA 5K09A 1T8PA 1FIGL 2TSBA 3ZHKA 4E9VA 4P49A 1UOEA 1USIA 2EDJA 3DSRA 2XLBA 2EJTA 1VDMA 1TC1A 2RDMA 5TPWA 3ARFD 1P8JA 2AG8A 1E40A 3KXPA 1AKWA 4CLHA 1SUPA 1OSEA 5FLUA 4G2TA 4YUAA 5C0OE 3MBEA 4M7KH 3RCBA 1YJDH 4L1DA 1DBSA 5IDXA 4H6PA 5LOVA 2BW4A 3RARA 4M60A 1CGTA 1WHTA 4PZUA 1XA4A 2A83A 4RLDA 4GUDA 2DZDA 4KX3A 2JCBA 5L0QB 1U7WA 1O0CA 5THXA 3R3UA 3LYLA 4NX0A 5J3HC 4OFYA 5K0LA 3QG7L 4ZC1A 3KZCA 3MBEC 3BUPA 3T65B 3H4VA 1RC1A 2XF8A 2XYQA 4P3PA 3C5WP 3RVSA 1T5LA 5BWOA 1V05A 3OAZH 4PXSA 2OORC 2J5LC 5IT9A 3U7FB 1A96A 2ZJSH 2QPAA 3HXTA 2M2DA 2P1ZA 1YBMA 3L7FA 4HWZA 3EJ6A 4W6QA 3QUZA 1EZVX 3M3PA 2B37A 3NM6B 4Q4AB 2ZSVB 1M9WA 2B59A 2YUTA 3PJRA 2HJFB 4Y6PA 5JIIA 1AKTA 4DZRA 2XZZA 3KR2A 3EULA 3FQNB 3RVMA 4GMFA 3FQ4A 2UZ1B 2R23A 5AVTA 2HA7A 1OXBB 1XTBA 1EQAA 2F5AH 2X1PA 1TPZA 2HKHL 4DGVL 4YDLB 2ZNXA 3K81A 2HSWA 1F6FB 4ND8B 2OMUA 3CJQA 3LQRA 4N4YB 1AXEA 4P5EA 1G6RB 3DM9B 4EG3A 4Q15A 1FNDA 2E7BA 1ZWLA 1AMUA 2GCEA 2RMNA 1M6OA 3QEMB 4XVHA 2B2NA 1C1XB 2FP3A 2QFPA 1YA4A 2VDVE 2AG5A 1IB6A 4UXJA 2AEWA 3ZXAC 2JGJA 4HUWA 3OXSA 1CUVA 2IEBA 1TLFA 5TEVA 5I4BA 4AJNA 2Y8EA 2GAOA 3H9YA 1GL3A 1NGPL 3WLLA 2E9BA 3O3MB 2ZCUA 4I36A 2HWXA 2MCAA 1EO5A 4FE3A 3LQ2A 2REQB 3O2VH 3BIAX 4QWMA 2HRRA 2Y7OA 1IAIM 5EP4A 2ASVA 2Q8BL 3U1SL 4L4VE 4NB7A 2V7PA 2Q7YB 4B9IA 1UP7A 4A6EA 2HJLA 1JLHA 4LARL 1TFRA 3QA9A 1OTHA 4G9FA 4BX3A 1R6XA 2QE7D 5F33A 2WK2A 5F93C 3Q0HA 2HHHB 4YLBA 3NJJA 4R2IA 5DRWA 4GYJA 5DR5L 3BP7A 3SZGA 3IGLA 4YSAA 4P2AA 5CXSA 4A9AA 2CG9X 1NW3A 3IM1A 1H5UA 2HK6A 1DCMA 2VZ8A 2PYEA 4ZWNA 4NO0B 1S5IL 4BFRA 4B27A 1HOCA 2J8UA 2UVPA 2HT3D 1R37A 4CM6A 4KQEA 5BPPA 5IEBA 3UT5B 3AW5A 5HDWA 3H5LA 1WO8A 3AOEA 4GZ3A 5T3ZH 1OAQH 3U2IA 4H8PA 2PKXA 1FVOA 3STHA 5IJKA 1VDZA 4HRVA 3U7IA 1BFVL 4Z7QF 4Z1OA 3EJJX 1YMHB 4XR9A 5AW2B 1NOAA 5HCIA 2A9JA 1HYSD 2O20A 1J9TA 2NXZB 3DI3B 1GS8A 1H6DA 5D1XD 3MTBA 3G9TA 1C08A 3UZEA 1L6RA 4OLXH 2NY3D 5MHTA 2X9ZA 4FXTA 3RJQB 4HNQA 3Q11A 4DABA 3NHYA 1PGOA 1IGFL 3N40P 5AOMA 1TPYA 2EFHB 1ECPA 4YMHA 5LD2C 3FTCA 4ARIA 4EW2A 2R39A 4S0SD 1TW2A 4FTVD 4AL8L 1AZBA 4B3HA 4BUGA 3GMQA 3VBCA 1GTRA 4ZS6C 1QQTA 4XA8A 5EH1A 3GZNB 5EPEA 4MD0B 5CIPA 3THXB 4KDRA 4ZDHB 2APWA 4G43A 1CQJB 5DJDA 3P73A 4GLJA 4BQPA 4YXKH 1XGQA 3K9QO 3ZHFA 1QSFA 3GLHB 4H1LG 1FA9A 4FN4A 4JJKA 5CDUA 2OV2A 4D5EA 3HNPA 1JSXA 4ZI7B 5FPYA 3B6SA 3WN5B 3JD0A 2IEGA 5L8VA 2G9RA 5LKAA 4YK4C 4C9BA 1B3JA 1WZEA 2IAMC 2YPVA 4G6MH 4DFIA 2XUOA 1BDHA 3QPUA 4RH1A 1SXJC 5EP2A 1SELA 3QVJA 2YIMA 4YDHB 4M02A 8OHMA 3ARFB 1AFVH 3U7YL 3SYTA 4ETNA 3OGCB 2A4MA 4QKTA 5HPMA 4G1MA 3ZD6A 1E6WA 3VHQA 2XWEA 4PJ8C 5F0JB 3M1YA 1QP4A 3TRIA 1JK9A 3EARA 3ESMA 4UHCA 4X7RA 3EJCA 1RXYA 4E88A 2Z4QB 5AR1A 5CCGE 3TTSA 4A68A 4OAOA 1GFSA 5L8JB 1V8HA 4XOIA 4RHYA 3RL2A 5JA8B 2VA8A 4PR5B 3W39A 4QU0A 1KFAL 3ARGA 2R0KL 4QYIB 1ZM7A 1PV1A 2GB2A 3DL2A 4Q58C 3B1TA 4GKJB 3ZE2B 1A27A 4OOEA 3GEHA 3CURA 1E9EA 3DOFA 3V10A 4JZOB 1UXSB 1P7QB 4XO5A 4BIKA 3PL1A 1DXYA 2OCDA 2P1DA 2ZIAA 2EFDB 4IQHA 3QFSA 4MGXA 1WXGA 2FSEA 4CI0B 1FXWA 2FFJA 1MC1A 3AQ4A 2HRPL 2NU9A 2EECA 4FS0A 4O2BA 1HUQA 1ESDA 3PQYE 2QP4A 4HQ0A 3QCTH 2G0AA 3I04M 1JTOA 5HVHB 1DB3A 1N8KA 3NIFF 3SC2A 5FLXA 3HVUA 4M4PA 4UEQA 3ELWA 2V0NA 3ZHZA 1W72H 1WBDA 1Y1SA 2LD4A 2WYHA 4R8LA 2BISA 4Y9EA 3GLVA 4P4RB 4LRUA 2JD2A 1Z6GA 2FPKA 3QBTB 1QFWL 3KOXA 1EDBA 4RNCA 2VISA 4PJBF 3M34A 3UJHA 3EH5B 1ZCZA 3QQXA 1RVV1 3ROPA 3ZZUA 4CU7A 4F3FB 4I9GA 2E4XA 2CL5A 3G3LA 5GZ3A 5FK9B 5C09B 1DLIA 3OZCA 3GMRB 3MK31 3UJ8A 3ZGLA 1KG0A 3UACA 4WPGA 1JK8A 5JXHA 2ARJB 5AW8A 4PYKA 3NIFE 3GD1C 1G8AA 2PGNA 2CLMB 2IHNA 1W6UA 3SODB 4U4IA 3X13B 1AKYA 1QYXA 4HOWA 1UKSA 3OV6A 3L5OA 4PC6A 1CUDA 4HT1L 5AKGA 3WD5L 1V4BA 1Z5OA 4ZICA 4P5KA 4DCOA 1ILSA 3KVDD 1PNDA 2BIOA 4TYPA 4DR2B 2PSSA 3CH5A 4XCVA 3JQ9A 5NLLA 2RC5A 2J48A 3DNMA 1J0YA 2N4IA 2GM4A 4K2UL 5EN2A 4TKMA 1AKEA 2ZWOA 2FZEA 3PTLA 1DPFA 4JIMA 2AI2A 1OFTA 4DHLA 2X4NB 1BFDA 2RFXB 4HTAA 4OW6A 4FQQB 1EZ1A 4LCBA 1O6BA 2EATA 4ANFA 5E1AB 3S2SA 3MRPB 4WA8A 1P4BH 1J5CA 5HTKA 4JKOA 2YVKA 4N6QA 4C4KT 4OZIB 4NKQB 2BGTA 2FI1A 5EJAA 1MZPA 3GT7A 3B1FA 5D7JA 3NABL 2XN9A 5IB5A 5AK3A 3CC5A 1JHLH 1LEHA 1IARB 2EV9A 1LQUA 4BLQA 1SZNA 3FH8A 4NNYB 3BIKA 2NUPA 3OKOB 3M9LA 1Z2AA 3UJ9A 3KVOA 2FWJA 4IOIB 1AKRA 2R0WL 5EZQA 4NU0A 3IBTA 1BMZA 3HJBA 3CRNA 4JVUA 2P43B 4AZWA 1B2WH 5HDOA 1OBOA 1TMCB 3PNLA 5IB1B 5K59F 1GZ4A 2YPVH 3FT9A 1Z0FA 3LV3B 4AYID 1KBKA 4X8LA 2JFHA 4BQ8A 5JSKA 1XTRA 4IIVA 4FTVB 5EJ5A 2DD8H 1GARA 4JU9A 2UZ4A 3L92A 4DUGD 5MHSD 4UI2A 3BVWA 3LVTA 2G30A 1OP3K