3ZE0B

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
465
Chain Sequence
PNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 107
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3ze0B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3ze0B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ze0B03
4K3JB 4IXDA 1RS0A 4WK4B 2P28A 1M1UA 1N9ZA 1PCXA 2X5NA 2XWJI 4UM8B 4WK2B 1Q0PA 5E6RA 4A0QA 4G1MB 3OL2B 1JEQA 4C2BA 4G1MA 3OL2A 3PPYA 1T0PA 5KYUB 5KYNA 2I6SA 3IBSA 4DMUB 2WINI 4HQNA 2ICAA 1FNSA 4HQFA 3AL9A 1RRKA 1YUKA 3OKWA 2O7NA 3PPWA 2M32A 3M6FA 4BJ3A 1U8CB 4NENA 1JEQB 4O02A 1IJBA 5E6SA 3NIDB 1XDDA 3EOAI 3F78A 5KYUA 4CNBA 5E6SB 5E6RB 4O3UB 4MMXB 3FCSA 3AL8B 1QCYA 3TXAA 1MQAA 4Z7OB 1IJKA 1RD4A 2VDKB 3NIFB 1U8CA 5HJ2A 4MMZB 4CN9A 2VDOB 3ZQKA 5KYWA 3IJEA 4JX0A 1N3YA 2XWBF 5HDBB 1DZIA 1M2VB 3V4PB 1CQPA 2B2XA 5E6UB 3EGDB 1M1XB 2NUTA 3HXQA 4G1EA 3K71A 3EG9A 5HGJA 3TCXB 4NEHB 1IDOA 1U0OC 3T3PB 1ZOOA 1JEYA 4GZ8A 3T3MB 2VDQB 3E2MA 2VC2B 5ES4B 1SHYB 3AFCA 4WK0B 2I91A 1L5GB 3K6SB 2VDPB 1U0NA 3V4VB 4Z7QB 1BHO1 4PN7A 1JV2B 5KYXB 1JLMA 1TYEB 3QA3E 5KYYA 1MHPA 1JV2A 2NUPB 2ODPA 1IDN1 3RAGA 3K72B 1FE8A 4FWWA 4UM9B 3NVQA 3F74A 5LN1A 3EFOB 4MMYB 4JDUA 2I6QA 3VI4B 1ATZA 1LFAA 4HQOA 1MQ8B 1NA5A 1MQ9A 1PT6A 3TVYA 3ZDXB 3ZDZB 1QC5A 3BQMB 1PD1A 1OLZA 1M1XA 1PD0A 2ODQA 1YVRA 2IUEA 1M10A 1MF7A 2P26A 2NUPA 3PPXA 1UEXC 3EFOA 3BN3A 3PPVA 1XDGA 1OAKA 1MJNA 4HQKA 5KYXA 3ZE1B 1ZOPA 1ZONA 3NIGB 4XW2A 1XUOA 2VDRB 1T6BY 4IHKA 1L5GA 3ZE2B 1AOXA 3ZE0B 1CK4A 1SHTX 1AUQA 3EH1A 3OKYB 3FCSB 3AL8A 3HI6A 4MMYA 1M2OA 5KYWB 1QC5B 4CN8A 3HXOA 2VDLB 1AO3A 4O02B 2NVOA 4IGIA 2NUTB 4C29A 3EOBI 2ADFA 3ZDYB 3K6SA 3EGDA 3Q3GE 4FX5A 1JEYB 3K72A 4M76B 4G1EB 3K71B 4Z7NB 3EG9B 4F1KA 5BV8A 1YVPA 3N2NA 3FCUB 1M2VA 1V7PC 3GXBA 2VDNB 1SSLA 4HQLA 4MMXA 3IJEB 2WW8A 4UM9D 1SHUX 2QTVA 5E6UA 4WJKB 4C2AA 3BQNB 4O3TB 1BHQ1 3EGXB 2UZYB 2XGGA 4MMZA 3EGXA 3VI3B 5KYYB 2VDMB 1SQ0A 3EH2A 4WFQA 1DGQA 1RTKA 4F1JA 4NENB 3TW0A
chains in the Genus database with same CATH superfamily
1NDHA 3H5TA 5FTNA 4C4UA 3OL2A 4RVFA 3GLZA 4ZW6A 1Y6NR 3IEPA 3JZFA 4DL9A 3ONFA 1LY1A 5J4VA 3MNWA 3OHXA 4MJ3A 3RJ5A 1D9KC 1Q0EA 3H1FA 4HMEA 1TKBA 2BMJA 1LO3L 3FTNA 3ASYA 2PMKA 2HT1A 5DYOA 4K5NA 5J2UF 4RWZA 2BIIA 4L1BA 1O0CA 2A9NL 3SX0A 2QLTA 3FR7A 4FOTA 6ABPA 1NFDE 2BFAA 2VDPB 4EXKA 1NGWB 3E9RA 4PJDB 3WY2A 4YBQC 2A6DB 4EN3D 1AJEA 5D5MB 2WWKO 1Y1TA 1A7PL 1N5JA 5ENZA 2DQUL 4CGUB 4PR5A 3EPJA 2PN5A 4MA7H 3O4LA 2ZX7A 2YXEA 3LCRA 2XKSA 5EVCA 4BV1A 3MWGA 3IAUA 4XI5C 2H4EA 1DELA 3AVUA 4U0KA 4LQFL 4ONGL 5K3CA 2L7UA 3D4PA 2VZVA 3ARWA 3G9ZA 4WJZA 1CGSL 3K0EA 4QQ8A 2ZUUA 5IMSA 3OY7A 6CGTA 1VJ1A 1UJ5A 5I9SA 5FR1A 4D4HA 4OUOA 1R0YA 4ZUVA 1AKVA 3AR2A 4FDWA 2ZB2A 5A0TA 1Z4MA 5AG8A 3JWPA 2A78A 1P7WA 4DC9A 1Z34A 4N7RA 1Z25A 4IXDA 2HVKA 2XZZA 6LDHA 3HZYA 3TT1H 1Q91A 5JA8B 3C1AA 5TQ0H 3C09B 3EBLA 3MWEB 5LJLA 2JFUA 5FW6A 4L3FA 3MMEB 5ARDA 5FUOL 5JEDA 4BX0A 4AQ7A 2XZAH 4R7NB 4F2FA 1MCWM 4NU0A 4D8OA 4D74A 2NPIA 2J6EL 3EZLA 1J8HA 4P32A 1Y3FE 4I46A 3NSYA 4ENRA 2H1CA 3ARQA 3STZB 1USKA 4AXWA 1B16A 5JOFA 3EOYG 3NC0C 3P0GB 1B4DA 4Z4FA 3GB7B 3CWGA 3IP1A 4L0PB 1JHAA 2H7CA 4FLQA 3LNIA 1VHQA 2L2QA 2H4YA 2HJFB 5EPMB 2NGRA 5J1SB 2PETA 4NC2B 3C16C 4AZ0B 1XSOA 4MYTA 3LIZA 3NCJH 4Z76A 4NE9A 5EZOL 4ABUA 3DKIA 4ZZFA 1QRNA 4JPWL 1TQSA 5IJXA 2QKSA 3PQEA 2W0SA 3GBDA 4DBLC 4F2WA 4ALAL 3M8KA 3D4GA 2SHKA 3MRSA 1OTTC 3L4CA 5E9DD 4RA6B 1T03H 2HL6A 4PGCB 2RHGB 1ADCA 4LXTA 5IAEA 3BIOA 1RZKL 2PVSA 3QDJE 3U3JA 4HS8L 1JEYB 2DSNA 1IBYA 4XXCA 2ZF8A 3KPQB 4EFLA 3PFGA 5HJDA 1AR2A 1BD2B 1U81A 4I9XA 4ZD3H 2CFRA 1P4JA 2N1KA 4GLOA 2DHDA 1L7AA 3N0AA 4OZFA 4BELD 3MUZ1 1T1WA 4DPKA 3C3EA 4NOBA 4URWR 1TG8A 2XUFA 2XUJA 2JTYA 2ZROA 1MFVA 3FO0H 3MHTA 1OGTB 4HUVB 1NPTO 2ZYIA 3RC1A 2ZQZA 3NX4A 1J0YA 3OLZA 2PLFA 4HUKB 3QQNA 3R7FA 3HR4A 3F9RA 3ZU8A 3VSAA 3GNMH 4HBCH 2I6GA 3D1JA 4TQPA 3FB7B 4B43A 3KD4A 3TL5A 5GJSL 2RB4A 1MABB 3LK6A 1PQZB 1V8PA 3O3DB 3QP9A 3P94A 1VADA 3KTOA 3MF4A 4QIHA 5A1AA 1YMVA 3GRVA 4TTGA 1E9EA 1SNRA 4JFXB 3VXUE 4YRIA 4HGPA 4YMSA 4EIZC 3FQRB 1XO1A 4HPJB 3PXJA 4DR2B 3O94A 1PT6A 2EJVA 3OZCA 4Q93A 2W6CX 1DSSG 1C3XA 2A1WH 4INAA 1JZ2A 3CSPA 2C5AA 5HYIA 4R1SA 2GPZA 4MRSA 2DKNA 4JDVB 4NJAL 1FDLL 4AKSA 3C7KA 5I8KL 5JRJA 1XEWY 4HEA1 4CLHA 4KXWA 1VPWA 3VRJB 2QSCH 5LQSA 4CMIB 4CUCA 4EI9A 3S34L 5FV7A 1QYIA 2OYRA 3VXTB 1C8QA 4JKYA 4EMTA 4UUBA 1I3CA 1BA9A 1BHSA 3JASA 4ETIA 4QR7A 4Z7WF 4YJFA 5GV7A 1PZBA 4X3OA 2RHBA 1ZCRA 4H8QA 5GSVA 4B82A 4DIOA 5JMTA 2NSMA 4JJKA 4D7PA 3DE3X 1EZSA 4ZMBA 1XAUA 3S1AA 4X98A 4JS7A 4JL5A 3MV9D 5F6HI 2OVBA 5CU5A 1BMQA 2YR0A 3ILEA 3VRJA 5FOXA 3DJYA 1WZUA 1E8MA 2JKWA 4FYIA 2QI9F 4L95C 1RRGA 4LRYA 3DBHB 2ZGVA 3I4FA 4KXFB 5KSZA 3MV8D 4JKKA 3TFKD 1KBWA 1MLDA 4Y5XC 3I8OA 2XG4A 3BZEA 3BKYH 4QG7A 1WETA 3OLEA 2NX5D 4Z3FA 5CHEA 1SVOA 5LNDA 3L4KA 1F5SA 1BVLA 4EI5C 2JFYA 4ZYXA 4OFIA 5MN5A 3VGFA 1ZV9A 4OK5A 3SE9H 5JDJA 1SUBA 1HL4A 3AREA 4R97B 4OLXH 5GJWC 4L5YA 4BGVA 3U4QA 1IUOA 2ZI6A 4R7ZA 2X8JA 4RVHA 4BJLA 1TIUA 3CJTA 2OENG 1R18A 4YJ2B 3EDEA 3RBVA 5DD0L 3WNPA 4PJ5E 1OXTA 4MLSA 2IHTA 3DVFA 5AW2B 1F00I 3H42B 1UFGA 1H66A 2X76A 3ALPA 1XNHA 4RGVA 4A2CA 3WYNA 1OCEA 4MAZA 3L49A 3QEQE 3AK4A 4AJ4A 1BF2A 5EU6D 2YV3A 5I6KA 4W1PA 2IWRA 5KOYA 4BO8A 5BQ3A 2H1PH 4Z4HA 2HN7B 1JTEA 4AT1A 4IRSD 5BUPA 2EU8A 2H2FA 1MDFA 1CDBA 2X4OA 3ABMB 4BNHA 2CCWA 1DVFB 3LT2A 2HO4A 1SY6A 1H8ED 1SU8A 4QDKA 2JI7A 2PZKA 5JHGB 3IDYB 5HVWA 5IP5A 2K6GA 2RE8A 2BRRH 4BE7B 4JPVH 1WXHA 1HEJC 3QH4A 1H3NA 2PL3A 5K8VA 4J3OG 5JR3A 1N7JA 3L8CA 2QVYX 1I7ZB 5E6IA 3KPMB 1BDJA 4NO5B 4U6VL 3TFWA 4CKVX 2R69H 2CFCA 3CW2A 3DTUB 2H1HA 2AVFA 5JWRA 1N8NA 2X1HA 4OCXL 2O5VA 3GZJA 5IKCB 2XRAL 4UASA 3VI4B 4EDHA 3II3A 4YCCA 2X6UA 1GGEA 1J4AA 4KRXA 1GZ3A 4QTFA 5B8CB 4EAAA 5KTEL 4GXQA 1EJOH 3IVKA 1QG2A 3QKUA 4EJFA 5HVHB 4K6KA 4UMDA 3IBTA 1RLJA 1DRJA 3BVVA 3VO0A 2J43A 4ZAYA 1TD9A 1QYGH 1C8PA 4B2PA 1QVRA 4M8NE 1WP4A 2VBCA 1PZ2A 4CVZA 2WVVA 4ZO8A 1CR6A 1XTZA 4MQXD 1U8NB 2XKNA 2IGBA 2HH9A 4LBEB 2GZ3A 1R6UA 4LQFH 3C2AH 1ZHKB 3WYAA 1NCAL 3PFWO 4X6EA 3N6XA 1VIWA 2CBQA 2CDFB 1UZGA 5B1DA 2ZPTX 4DP4X 3K8MA 4Y2QA 5KYKA 3CVVA 2P28B 3EDJA 1V5WA 1VPOH 4BJ6A 3CHSA 2WTOA 4XNYH 4PJBE 1R3KB 3JVDA 1NBZA 3TDNA 1W75A 5K9QI 2VSCA 5C0CB 4FQXA 1B8PA 4YEEA 1ZA1A 1IGTA 3KYKL 3VHRA 2H4XA 5JNUA 2IANE 3QJSB 5AYVA 2C2BA 1T2UA 2GI0A 3RY4A 4XCFL 2YGQA 3UJTH 2QUBA 1TEFA 3TAUA 2JVIA 1I36A 3SDAB 4YWGH 4UV4L 1FFTB 2L69A 1JVLA 1EG7A 1JZ4A 1OCRB 2FWUA 4FEYA 2QQLH 1FOEB 2GARA 1F6DA 1MO3A 3REWA 4R1QA 4UNTA 2G1KA 1UJBA 3EDQA 1TLMA 2D2VA 2FJPA 2V3WA 2R85A 3FBQA 3RS2A 4NF2A 1HNGA 3C9NA 5JLJA 4XC3L 4YSOA 3B89A 3STTA 3TZCA 4EI0A 4M55A 1UG9A 1Y6FA 1FFNB 4LNUB 5JTWA 2GHWB 1QIFA 5IXJA 3K0WA 4IXMA 4U1HA 1L0BA 3X0DA 4B3BA 5ADUS 3EZNA 3GMMB 4RZQA 3E0XA 4UI2A 5CFRA 2JJQA 3L9RB 5H2BB 2A74A 2B8WA 1RZJL 4RORA 2Q76B 4FQPA 2CKBH 5CHNA 5EG6C 1OBVA 2CEKA 2CVPA 4B76A 2CN1A 1L4LA 5CSZB 1Y6GA 4FLEA 4UT6A 3IJYB 1OQOA 3FT2A 2XGGA 2EG9A 3K8QA 2IMMA 2EXWD 4G43B 4HWPA 3D4YA 2HFKA 1E5ZA 5FUYA 7PAZA 4KDRA 2HVBA 2J1LA 3D6JA 4LTMA 3QQ3B 5DN6A 1M6OA 4AURA 3NFPA 1E40A 4FQCH 4KQIA 3K2IA 4AMYA 2O0HA 3HZOA 2WLIA 4M7ZB 3DPBA 2HH0L 3QCTH 3K0HA 5HF6A 2BNRA 2FH6A 1HXKA 2J4DA 2VAVA 4N90D 1QZTA 2XUGA 2GYYA 2P75A 3DRTA 1W76A 2ZT7A 3PHAA 1E6LA 2P9ZA 1BZ7B 3D85A 4BZ1A 3N59A 3JWOL 1KJVA 1JKJA 5SX5H 2SNIE 5I1GL 1MCNA 2VXSL 5JO0A 1CS6A 5L4JA 3BOVA 5G2OA 4RGBA 3FQNA 2DLIA 4HWEH 1SH7A 5U1PA 1XXLA 1GAFH 4YQFA 3BPSA 3OTGA 2ZS7A 1I2MA 1E9OB 1YA6A 3K9NA 4NWTH 2ZWOA 4WLFA 3GDBA 1N75A 2A73A 3S2ZA 3REVB 3AG4B 5FOBA 2RKWA 2C3WA 2GEDA 2GX6A 3CDZB 4JODA 2NY1D 1B4LA 4OQTL 3N3BC 3QLVC 5CDGA 4EI7A 1LBIA 1BCRA 3B20A 5MHSD 2FSEA 3FO2A 2DBRA 1JDZA 3K74B 3SS7X 5KANI 4ZVNA 2O06A 2ZJ4A 1A5FL 5H1YA 1ARZA 4M6OL 4DB4A 2ADFA 2HAZA 3WV0A 1YBAA 4X3PA 4EWLA 2AX4A 1S4IA 3N2YA 5GSRA 3MX0B 1Y4UA 3L7YA 1BQKA 3SSOA 1JVBA 4HJEA 1ZT1A 2B98A 5B4UA 3AQIA 2ODAA 3GXTA 3FTCA 3OTOB 3EPHA 2YOAA 4FQXD 3CVIH 4TSRA 1G66A 2YRZA 1GT6A 4LARH 4PZLA 2VWEE 2K5UA 4O4IF 4KKLC 4XCEB 1FBIH 2X3BA 3BUSA 5INTA 1XL0A 1AB6A 3BWVA 1MOZA 1QZ3A 1QNZH 4HP8A 4HT1L 2O48X 1O94A 1EWRA 1X4ZA 3FU8A 1YJQA 3SM3A 2OGWA 3V8MA 3RL2A 1H3PL 1AACA 4FB4A 3JATA 3CSGA 3NHWA 1U3FA 5IAAA 1KZ6A 3UV7A 3QK0A 5DGCA 3QSYA 5JOQA 2W6ZA 2FVXA 3T09A 4B3DA 1QXSA 1LDGA 1RT9A 1YRWA 2I7CA 1OZHA 4MWCA 5GRZA 3QKSB 1PG5A 3X1BA 2NO0A 2IWGA 3ELYA 4P5RA 3KXFE 1IPFA 5SY4A 4Q15A 1KDPA 3GGWA 2CUMA 2KH2B 5JA9A 1FVDB 4QGAA 2ONYA 1R34A 4WDIB 5AI8A 3GVCA 4ZYWA 1C8KA 1GSKA 1AFVH 4X6DB 1XCBA 5G0SA 2QTGA 4XVHA 2N42A 4RQQB 4HAFA 3LPGA 2C0QA 2I76A 1JGLL 3E9QA 4FMBB 2DHCA 4MS4B 4R71A 5AW1B 2Z0UA 4P0DA 2X3UA 1VACB 4ND4A 5LUAA 4OIIL 4ZFOB 3VGHA 1ZNXA 4ZJ9A 4G5ZL 1XRPA 4P2RA 1W5SA 2JA2A 1F6BA 4B50A 1OB0A 3LPOA 1K4DA 2EGGA 1CYDA 5JAQA 2WTRB 4IV0A 1U8CA 3QIWA 2GUOA 3QX9A 5CFAA 4TYNA 4OLUL 1NM5C 4X6FB 1LLDA 5C3UA 2ZRLA 2Q5IA 4ZI5A 2YD0A 3HAEG 1E3DA 5BRZA 1JDTA 4FFNA 1F20A 5C1MB 3UW1A 3ULUL 2BNRD 1LSOA 5HHPB 1XQ6A 5IYZA 3GD1C 3BL5A 1P7VA 2F54E 3FT2B 2Q50A 4FGKA 3GLHE 1PPIA 2XZLA 3BSZH 2JCWA 1F51E 1XU9A 2M6LA 1AUOA 1A4KB 2GNOA 4CETA 3BPNC 1WIWA 3CQFA 1DJPA 4BQOA 4P23A 1RKXA 1W88A 1XD9A 1YD7A 3RC3A 1F58H 2BVOA 1OKKA 5C6TH 4HK0B 4KR9A 4LXXA 3PUHA 4ZEOA 4J3OH 1V0JA 3RYHA 1SLWA 3D1LA 4FE7A 3O4GA 3MV01 4NQZA 5B4VA 4YMPA 1KQFA 1M1SA 4CADB 1RFGE 4RHFA 5BQDA 3ZT7A 3DMMA 2GFIA 5ILTH 2G1PA 3F83A 4L8VA 4N18A 2F15A 5GAJA 3DC0A 1BEZA 1RJZB 3MJ6A 4CM9A 1X7QB 4IIYA 3OZRA 4YRFA 1FZJA 3I74A 2APBA 5KWEA 4A0HA 5GTDA 2WNKA 1J8HB 5KHLB 2I29A 3LKSA 5GGTA 1X5ZA 3AUWB 2NPOA 1BVNT 3L4BC 2AWNA 1AR1D 2FZ3B 2D6FA 3BIXA 4DQAA 3B1KA 5SWSB 3I9V1 4U9IS 1NRWA 3MCAA 5A5EA 3TQRA 4RV9A 2D9CA 1GL9B 1CJMA 2J0UB 1WHOA 5A2AA 1YOBA 4DZBA 2P6NA 5I7EA 2GAAA 4DC0A 3LG2A 4RLSA 3K6RA 3HRPA 3N8KA 5GJSH 1HLPA 5A4FS 1YCDA 3HKZA 1HKLL 3IN0A 4B3SB 3Q5TA 1JAIA 3LY8A 4EZEA 3WIAA 4OLYL 2XF8A 4U39A 2OM5A 1BVUA 2YYAA 5F7UA 3NH7H 4KWCA 3MJ7B 4GDMA 4LESA 2BY1A 3PZRA 4G37A 2PL5A 3UDWC 3PGFH 4PYMA 3QZNA 3OQ1A 5DEGA 4D9NA 1T4KB 1MW3A 2A6PA 4MWEA 4G65A 1NLYA 2JGKA 4AQ1B 1C9YA 4J6EA 3CZRA 1G2IA 4Z1MD 2QW1A 1DRKA 1CFNA 3IVKB 5I2IB 2DBJA 1ZI6A 1VLXA 2TMGA 2XVXA 3OFND 2JB6A 4CNIB 4R2KA 5FO1A 2UZ1B 5EHZA 1EWYA 1MI5E 2DTSA 5GZOC 2AE2A 1R7RA 4JQOA 5BQPA 5LUBA 1TXKA 1A9RA 3NUZA 1JR2A 3DAGA 3Q2NA 2D7QA 5D4QA 1TM2A 2JKLA 4MXQC 3B5GA 4K2UH 1VBKA 3ZW3A 2OWDA 2EDDA 5CCXA 4QF1B 3JQBA 3IJEB 3BPCB 3O7WA 1BH2A 3EK2A 4OGAD 5BQ7A 1D5RA 1CL7L 3SY6A 2CKBL 3BVNB 3WNCA 1SMDA 2G8LA 1XF2A 5JS1A 5K99A 1V3JA 3BJ91 3ASOB 3IXAA 3MRRB 3GSWB 5EEZA 2Q8BL 5HDBF 3UYOD 5C09A 1K7FB 1KTLB 3QPWA 3E3LA 4JRXD 2QAGC 5LN8A 3WIHA 4TRPL 2WSIA 1YA8A 4OSEA 1WOYA 4DQDA 3COWA 2F54A 4JFPA 1L6IA 2VXVH 4GKKB 2X2JA 5ALTA 4IWYA 3HHSB 3H8VA 3R3HA 3RWEB 5LGHL 2WJGA 3NSFA 2WKWA 3I53A 1FQOA 3W2FA 1J2YA 1COBA 1MZVA 1RWVA 4K05A 2XRYA 3E1KA 1VYUA 2DJ4A 4HJTA 3E22A 3AM8A 2WILA 2R8ZA 4QE3A 2BM8A 4CCYA 3AROA 3DO4A 4DILA 1G98A 4PJFE 3T3PE 3RB8A 3FUVA 1XE3A 3QEKA 3RFVA 1FZJB 5I9TA 4E9XA 4MQ6A 4YPVA 1FO0H 5TPZA 4EMBA 1EHNA 2A92A 1QSFB 3FT1A 4BLVA 1QBBA 2X4QA 5LJYH 4WXEA 1X19A 2GIYA 3OAUH 2Y6VA 1K86A 4AKEA 4P4RB 2BZ1A 4LNVA 4WEOA 4PJ5A 4J7AA 2CBOA 1KPRA 3PWLB 1HE8B 1VRWA 2OYKA 1HBJA 3B5HA 4XCCH 3VPCA 5T5NG 3UAXA 1D09A 1SN5A 2APWA 1IAIL 3I72A 1EQAA 3CX7A 5IUNC 4JPIB 2BCMA 2RD2A 3C5VA 1NXOA 1GQQA 2R66A 5DCWA 3HL4A 3C2AL 5DGHA 4ONFL 2ZXGA 3DA8A 5F7WC 2L19A 4O1IA 3ZQXA 1TGYA 2FZWA 3L7LA 5A7BA 4RIHA 5HD8D 3VYNA 3QMWA 2LV4A 3Q3VA 5IB2A 3FPLA 4BE5A 3BDXA 3J7AC 4MHHI 3VG0H 3VXPB 5E94B 1QLRA 3ES9A 1ITCA 1XCWA 2VW6A 1CE1H 3E03A 2ZAOA 3H0KA 1FSSA 1C7TA 3DETC 3OF2A 5IEKA 1G8MA 4KMSA 2ZKHL 5DUPH 1J5CA 1W47A 2V0NA 4WY2A 2XWQA 1TZ8A 1PGPA 1JNYA 2CLZB 4LUCA 2ZSEA 1T3LA 3BSSA 3TN7A 2R6JA 1DC7A 1BDHA 3AU1B 2IOIA 4PRIB 1A50B 3WJLC 2XTJD 2JBAB 5C2JB 4A26A 3DMMB 1U0BB 2IU0A 3V4VL 4R26H 1BMTA 1F4YH 4F7DA 4S1DD 3I6GB 3IPEA 4ZMOA 1M66A 1ZUNA 3VQTA 5B57C 1EBBA 4L05A 3WWDA 5F33A 3WLKX 1P1BA 2D2CC 3U17A 1VKNA 3RVJA 3TIXB 4ZBJA 2Q4OA 5I7OA 3DFIA 1AO3A 3PQ2A 1EINA 1TPYA 3QJ5A 2BSTA 4C6RA 5DR5H 2GFBA 1VIYA 1FS6A 1V8DA 1BVKA 4B96A 4C4BA 2CHVA 3EN0A 3NC4A 5LSAA 1UC9A 4YR9A 1ZVVA 2FH5B 3NTVA 4IGBC 3CIAA 1ZU4A 3NHYA 3V1MA 5A9TA 2Z1KA 3WFDH 1TU0A 1S9YA 3PDDA 2ZRJA 5AW0A 4WY5A 4R1UA 3U61B 1BOFA 3PCTA 3HMWH 4GG1A 3LC0A 5EZJA 4OZHB 3OB0H 1OTSC 2VHUA 5INDA 2B5IC 3QJGA 3ESDA 3DV9A 1ZEMA 1IGFH 3M5WA 3EY9A 2GMWA 3QITA 4MS3B 4WV1A 2C4XA 3BMVA 4MBRA 3KCPB 5E2TL 3TZVB 2EEDA 4BB0A 2AI3A 1VJDA 1WTCA 3IB6A 2GGSA 1YS4A 1CE6A 3DX6A 2C84A 4KNYA 3IAHA 5AW6B 3KB6A 3TG2A 5BS0D 2WHRA 3ZIAD 3H2QA 3ZW9A 4JOCA 1HIML 2OLKA 5F98A 3MOSA 2OMWB 1X5GA 1QIKA 3WDSA 2DKMA 4Q9NA 2I1WA 4NIKB 4J3OC 4FRWA 1JJIA 1FDVA 4PNHA 3EAQA 1RAMA 1TT6A 3RT7A 1T5SA 1T0MA 1LHZA 2WE7A 5HCNA 1MHEA 1JPGA 3FRPB 4H35A 3DBOB 3WMEA 4DWVA 1UBFA 5EU6A 2HKFL 2ODHA 2REXB 2OD2A 3HY4A 3WXBA 3ZUPA 2BYTA 2Q6WA 2F00A 2C2KA 2M1KA 4A8JA 2VRCD 2GN4A 4WHTA 4ZXPA 3W6OA 5I75C 1AGRA 3EFBA 4AVJA 5F9FA 3CZAA 3U2QA 1WXGA 2VDMB 2JJSC 4BASA 1P53A 1JKJB 1KACB 2X5NA 3FUEA 4EEZA 4M8QB 2QPOA 4E32A 3B5EA 1ASOA 3F9CA 3RVVD 2GM3A 2WLIB 3Q7QA 5JMOC 4EY7A 3RWEA 2AP2A 3H9BA 4RMTA 3SIXA 3LLSA 3GRBA 2Q2OA 1KV7A 2QBYB 3GSXB 2R3SA 4XM1A 4JCLA 5DK2B 5E6ID 1HRKA 2N7BA 5CEZE 1DBPA 4B9JA 4QJ3A 1O75A 2CKBA 1QTIA 4YDHB 3KBFA 4V0NA 2OV6A 3X2EA 4QYOA 3SGKC 4HSQA 1HWGB 2QYTA 4FKKA 3L6EA 5IMKA 5C8VA 3K6FA 3CUPA 3N28A 4HNRA 2Y1VA 4GYKA 4YASA 5DKFA 1D6VL 4WUTA 4J3FA 4LP5A 4L3ED 2ZG1A 4AQ8A 1VKZA 1RP8A 2GAZA 3VU3A 4RD0A 1BBJA 5LQCA 2ERCA 4EPRA 4TQ9A 4H1LG 3T2PA 2CSPA 1YH3A 4QWMA 3TURA 1Y1LA 3MUJA 4GI5A 5IR1A 1MO6A 4F11A 1YEFH 3GEFA 1QM5A 1Q2XA 3VCLB 4S2SA 3TBHA 1RL1A 1S9WA 2Z93A 3MLPA 2QU7A 3LZCA 4RETB 4IZHA 4MQFB 1XCXA 1GXSB 4A7UA 4Q4LA 2LCIA 1WB6A 2RGAA 3GA0A 1EB8A 4WCYH 4HR7A 1J05B 2VN6A 3IBGA 3LYUA 3OOYA 2ODIA 5KBMA 1YB5A 3CPEA 2NNAB 3TPUB 4F56A 2BVQB 1DUVG 3NFRA 1N6VA 1BPVA 3GFPA 4I2VA 3RJQB 5C1DA 2D0DA 1DI0A 3IAQA 1Y0BA 1EDEA 2ATIA 4HKJA 2VJKA 4FGZA 3RAJH 4KQ0A 4FA7B 1I8KA 5C7IO 4URXR 4ZVOA 1A5AB 4EX6A 1T8YA 3DO5A 2Z1NA 3IIKA 4ZOLB 5J3HD 1DZIA 3ZDRA 3TF5A 1ZMYA 2PH7A 3HB9A 1JZDC 1MH5B 5EFIA 1CF4A 3EAKA 5ADOL 2HT2C 1ODTC 4EG5A 1Y1KE 4CT0A 2CVHA 2R69L 1C7FA 2FEPA 1XEXA 4IUDS 4H16A 1WRFA 3QELA 1K6EA 3P5BA 3RK1A 2YPKA 2NY7H 2WT9A 5H82A 5JCOC 3AH8A 4RVCA 3CT6A 3ZIYA 4B31A 4NN6C 1N6KA 4QO1B 2OK0H 4O8CA 3O2VH 1RI3A 4QXTA 4FYKA 3W82A 5LN4A 2C31A 2VDPH 4XZ4A 4AQ8C 4J16A 5EDSA 3IDXL 4YBHA 4B0PA 1PFOA 3RRXA 2XJKA 5ARBA 3UBTA 4ZSOA 3ZPXA 3MNVA 4NWUH 3CBQA 1U0TA 3DT9A 4WV1C 2WC7A 5LVAA 1PK9A 3TXXA 1YZ3A 4BGEA 2AN1A 2XACC 3AG3B 5HIKA 4BMSA 2OSBA 4S0TD 5FFNA 4ETYA 4U05A 1TU4A 4AJOA 3MJ4A 2J7LA 1AB5A 1FRNA 4L0QA 4EYEA 3QXDB 1S8OA 1RLBA 3WICA 1JXQA 1JJ7A 1B1CA 2ZJFA 2QR0A 1W4BA 3T1TA 4M7PA 3FOZA 1I7UA 2AV7A 5KOJB 15C8H 3QFFA 5A40E 2O8FA 2WQVA 1HINL 4AX3A 4Z4GA 2I2BA 1CGSH 5LGJB 2H26A 3H3XA 2FHBA 4P23B 4URYR 1W2WB 4G8GE 4X9IA 3SDDC 3QOXA 5FO7B 3LLVA 3BZWA 1E6OH 2J44A 4M4SA 3NEJA 3IFNL 3T94A 1JMXA 1EDQA 4YRNA 2RI0A 4K86A 4CTOA 3LI2A 3TO5A 3QPXL 3DKKA 4I50F 1IBGH 4I9WD 1A7OH 2JQMA 1LNUB 3EYQC 4PPYA 3UJ8A 4FFZA 3SF8A 1RXWA 2DB3A 1A9EB 3H54A 1VJCA 3DONA 3TJHC 1NN3A 5TSDA 3A70A 1A8ZA 3KL2A 3GJFB 4YNBA 2C61A 2VRQA 1A9PA 4BZ2A 1PLKA 5AP9A 1U8HB 2BBOA 2B59B 3ZDXB 1BSVA 2Q9CA 1YECL 3GEEA 3V46A 5L6MB 1W15A 1KNXA 2RKBA 1A82A 4D9RE 3B3GA 4X45A 4CDGC 1FRFS 2X86A 3KOWA 5IYZF 4IMLB 1IHUA 3U30C 4Y6PA 4Q21A 2F67A 4P4KA 3LT4A 1H05A 2JK1A 4BO2A 5ALRA 5JZ7D 3V0VA 1R74A 1YFZA 1T4CA 1QOKA 4E2OA 4JUBA 3LTVA 1ZJZA 2QRVA 2MOVA 4N2AA 2BZ7A 3JZDA 3ZN2A 4XBMA 4DO6A 4Y1EA 2Y66A 3R5FA 3MRTA 1J1XH 1T0BA 5EBGA 3RGHA 4OB5H 4NQED 2P24B 1DDHA 1DVZA 3GDGA 1TAGA 2JWHA 1JS1X 1Q9OB 3MGAA 1C1XB 4L3AA 3ECWA 1AO7A 4HISA 5TS2A 4YEDA 1XCOA 4EHJA 4LPYA 3SQOL 1ODJA 2W60A 4WO4C 2E37A 3R7QA 5ALOA 4HFWB 4JG0H 4JKPL 2X0DA 3GD5A 4WFKA 5B12A 2OPHA 4LEEA 1ZLEA 4OREX 1EERB 2AD5A 3DD1A 3I28A 3UXEA 2FGKA 3HI1B 3RU9A 3RA7L 2OUIA 1FGNH 1FE8A 1T1RA 5LM3A 2QV2A 3B70A 4I1IA 2W95A 4C76A 3AFOA 3NTUA 1Q90A 1U98A 3CDGB 1KBQA 2CXNA 3Q8EA 1SBTA 1X5IA 3WIEA 3WLRA 2GEEA 1EXMA 4RMNA 3UG4A 1CQWA 5KTYA 4Z5RA 1S4MA 2HRCA 4KYUA 4RGND 3BRSA 1G17A 1HSAA 1N2IA 3BXZA 4F8OA 1YSOA 4F9LC 2ARKA 2BMVA 3Q2KA 4F3FB 1R15A 1MDAA 3IEMA 4MLCA 4QI3A 1CRLA 4DYHA 2E87A 1XJ5A 1PZFA 1ULSA 4HUQA 3VR6A 3B9KC 1S2LA 3EAGA 1A1OB 2G5TA 1H6BA 3S35L 5FOWA 2WC1A 4JFUA 2XNDD 4PJGA 5C8JB 2PP8A 1NC4D 3HVUA 5KOIA 4M3NA 5BOVA 1IEVA 1MABA 1NW9B 5CLWA 1R0WA 3RWDB 2IF0A 4RV5A 3P2MA 1ED3A 1SHXA 5DDIP 2NV2B 2JCXA 1OZTG 4BZPA 1G5PA 4WLUA 3E8UH 1BXRA 2VDRH 1NR7A 2O0JA 3I02A 1ND0B 2JFFA 1DFBL 3GUYA 4JROA 3DOIA 4P8QA 5GGRY 1E4XH 4GG6F 5KSAC 3UFBA 4D96A 1CYGA 5JPMB 4ZRNA 2GHZA 3FLMA 1B8NA 4BVLA 4RADA 1NQXA 5L88H 4OA5A 4X9XA 1JPTL 3PNKA 3ZWWA 3UGQA 3G5MA 4FONA 2K2QB 4A6DA 3RS4A 3QOWA 1T66D 3IVCA 4NQQA 3HB3D 4FFWA 1MCOL 2HA7A 3JCZA 5CVUA 1GZ4A 3CDZA 1NBOA 1Q3TA 5AIBA 2O8EB 2YUVA 3CXRA 3SCMC 4PRNB 1YUNA 1RZ8B 1XGRA 3OKEA 1QYCA 5DFVC 3NWEA 1PFUA 3T2NH 4CQMA 4D98A 4R84A 3AJ8A 5LBIA 2YMMA 1FFSA 4AUMA 4XNQA 2F1OA 5GGXA 2W0MA 5BY2A 2JI8A 3S36L 3P9PA 3U9SA 1MO4A 1X7ZB 5L3QA 1SRQA 5HYJA 2CO3A 5BZDB 1I31A 4H8WL 4JFZL 5D9SB 2ESRA 4AJ1A 4BNVA 3IX7A 2O8CA 3D39E 1P2DA 3R6WA 1FL3B 3S5UA 3SQBA 3QI2A 4TZ6A 4DANA 1FRGL 3H86A 3R0NA 3V8RA 5JPNC 4N25A 4EVNA 4OXYA 4ORGA 2KZWA 5AL8A 2D2IA 3HCVA 4DV7B 4O58H 4JC8A 4IJQA 2BFPA 4P2RB 4FIDA 4FFLA 3AUUA 5FLKA 1OP3K 3QM1A 3KLMX 1JF1A 1DBQA 1FUIA 1AQKH 1N92A 3RA7H 3T2QA 2BIHA 2CUHA 5TMPA 4HKBB 3D8BA 3FOMA 4HD8A 3MYJB 3DMRA 3CUKA 2YFQA 5SZIA 1I2BA 3ZUNC 4NDZA 2YJQA 1RJYA 2C5SA 1A7PH 3T52A 3FOWA 2ZT9C 5J5AA 1QHFA 3ZQKA 4WE3A 2NO6A 1EVEA 5D70L 4UREA 1OHZA 1CVSC 4FNGA 2CMKA 1GJRA 1U0HC 3NLLA 5BT8A 1P2VA 5ALHA 4ZI3A 1WA2X 2G04A 2O1AA 1G1MA 4B6SA 5E70A 4INPA 2VJLA 3SLKA 2G9RA 1YEKL 3ETDA 2YJTD 1URLA 3X2SA 2QYOA 3MBKA 1BX1A 4FFYL 3EDOA 3BGFC 2H1FA 5AHWA 5DU2A 3FGOA 3BIJA 4CVZB 3KWTA 3LVRE 3L93A 4AXBA 3LNDA 3I02B 2EOAA 4L4TB 1CFTA 2B1HL 2PX6A 5LDUA 4JLSA 3AY6A 5BWBA 2CT8A 2ZCLL 4LF3A 1YY9D 1XA3A 3O4VA 3OPYI 1ED3B 4M0KA 4K3JH 3A23A 5J1AA 3TIEA 1ACYL 2TYSB 2VLRB 3O6KL 5GHWL 3V8OA 1XMSA 1AKRA 3R6DA 1OROA 4YGVA 3L3BA 5EJGA 2J3IA 6FABH 5FKJA 1M73E 3IKCB 5TGZA 3HC4L 4OHZA 4O4JA 1C12A 2Z8YA 2CGEA 4W8GA 2AABL 4TYQA 4AQAA 4Y5VA 3Q0EA 1HDMB 4D94A 1S2IA 3LDAA 1ZL2A 4AROA 4QTHB 1F4AA 4IBVA 4RZ2A 4GMSL 5EP4A 1JNHA 1SOSA 4EVSA 1FBTA 3ZWYA 1X5AA 2A9OA 4QHPA 4GQ9L 5EJ2A 4MW6A 1WBDA 3ZTWA 1MWAB 4BMDA 2GCEA 2P35A 4ID3A 3ZGHA 5FPKA 3KXIA 3V3KA 2VLRE 3T5BA 3X1FA 1RCUA 4LGPB 3KPSE 3QQ4B 3RYIA 5JHHB 4HLDA 1JZEA 5KSPA 3AR7A 1K8QA 4NCJA 3H05A 5TTRA 4YDKL 4GB9A 1VB9A 4FQ7A 2I7XA 1U8HA 2XQJA 2HHLA 4RPLA 1T5WA 4KVAA 2Q8QA 4NBVA 4R8WH 4NAMA 4AGMA 1T9GR 3IE4A 3NRPA 3R5TA 4DK3A 4Y2LA 1W6LA 1U7XA 3ONEA 3G5XB 1FE8L 4N0FB 3IRUA 2JB5L 4UM9A 3UPTA 1BIHA 2JTDA 5CG1A 4HV8B 3JTTA 3I9FA 3N86A 2ZI4A 2NVWA 2L82A 3WJMB 4OX9B 2NY0D 3M8OL 1YCFA 4BO5A 4HNQA 4V11A 1OIOA 1ACMA 2ZW9A 1BFTA 5CJ5A 3PBKA 1EUYA 1XVLA 3OL2B 1G9EA 2FE4A 4IM7A 1G21B 3QQXA 1OH8A 1SKUA 4BLUA 5K3FB 4PJ8B 1W49A 2EV9A 3ATEA 4XXHA 3LJ3A 3RU2A 4HATA 1T9GS 1UBOS 3O83A 2HGZA 4BCDA 2QEQA 4M00A 3DWIA 2XIQA 3M1BB 4IWNA 5HYSA 1BVRA 1ZI9A 3SZMA 5I6LA 5E95B 3BFOA 2AR7A 2ANCA 5CCHE 5AK5A 3BERA 1F8YA 5L4NA 2ODBA 5KN5A 2O2IA 2EYRA 4OCRH 4GZ8A 3EJZC 4P4KC 5L9DH 4KR6A 1G8GA 4FYHA 3GFVA 2RCSL 2OMVA 2VT0A 4QOKD 3U0WH 4P4SB 5EUKA 5J4HA 3PQYA 2VH5R 3VA7A 1I75A 3IEKA 4CYMA 3RSSA 2WV7A 4YWHA 3HSSA 4FCVA 4PLKC 3HG5A 1AYRA 1KZYC 4IDOA 1BJRE 4G6FB 3VFNA 3RRZA 1G0DA 4AY6A 1UM9A 5L9AA 1EHYA 5DD1H 4BPRA 1I4LD 4OHBA 4MNQE 1QGZA 2GTZB 4G0PA 4J0CA 4KTTE 5DDHA 3MQIA 4DEUA 1FX0B 1G20A 3TRJA 5T3XH 4D1YA 2O1WA 3GZTB 5AOBA 4YPGA 5LB2A 5FYLD 2HQOA 4DABA 3A1UA 3SWWA 4HQ0A 3HQ4O 3GNLA 2E6QA 5LZ4A 2H06A 2OBYA 3A0RB 2FD6L 3FSWA 1EG2A 2E89A 2F53B 3SQDA 3OEED 3VA6A 5LYJB 4COKA 1RXUA 4RYDA 3EFFA 5FYKL 2YOCA 3CWQA 1FFXB 1ORDA 2BHFA 3R41A 1OGIA 1GPAA 1HJCA 3D8HA 3WLEA 3TEXA 2FTAA 3JALA 5GRYA 3HVDA 4OH7A 5E9AA 2HYIC 4X20B 1AVAA 2Q1YA 2FCBA 9ABPA 5IULC 4YX9A 3SE4C 1CFVL 3USES 5MI0C 2X6RA 3D5TA 5J3HC 5SWSD 1LZLA 4AQAB 3FQ1A 1EVZA 4Y8VA 3PU6A 4PSPA 3D4BA 1RUAH 4I4CA 5DYNA 3MV8B 2YFKA 4S1QH 2VUYA 3D18B 3OG6B 3OX1A 4QBKA 3OXRB 5FH9A 2K7FA 4NYIR 3DX7A 2CVZA 2VQ1A 1CF8H 1N18A 2VK4A 3SJCA 2IGFL 4R3SA 3FU0A 1USGA 4KJQD 1HXMB 4ZXFA 3MLXH 2FEEI 5KQGA 3NNNA 5AAWC 1CBVL 4FQLH 2JDIA 4DNXA 4MEBA 4Y7OC 1BM3L 2IYTA 2R0WH 4RMRA 1U0SY 5K8UA 3A6HA 5HGGS 4GQIA 1VFNA 2J12B 3F3HA 1ORHA 3T3IA 4D3YA 3QG7L 1LI7A 4OLEA 1L6XA 2HVJB 1PAUA 5B3AA 4G80A 3DB1A 3EXG2 5F2EA 2L8AA 3FD8A 1SUWA 3RTLA 3VJ6A 4A37A 1OUMA 2VG8A 4DZBB 1NMSA 2ZXBA 5L7XL 1JYVA 4HX1B 1QYXA 2O5CA 3VDRA 4L4TD 3DUFA 4W5TA 5G0UA 4XSVA 3KYIB 4KX5A 2JCYA 1WO8A 1ADQL 1P74A 3ZU5A 4B32A 3KT3A 4P5KB 3A27A 1P4BL 5LA6B 4D3SA 4ZOQI 4WKNA 3FCXA 1XSEA 2QTRA 4MVJI 3ISJA 1YFKA 1XROA 5E3JA 5EBWB 4B0MB 4X4XA 2XWXA 1HHHA 2FWAA 3GV0A 2I71A 5I6PA 3I30X 3N44B 5IHBA 3BHMA 5JS6A 3GG9A 4KMQA 2IKQA 1SCNE 2QQGA 4GG6B 2D7OA 3LF2A 2VDMH 1UUSA 2VJOA 2XTJB 4R8LA 4X7SL 3W0WA 4TYYA 5IJKA 2Y0BA 2DR0A 1OTSD 3E5NA 4XWGA 4YMGA 1ICIA 3C85A 4WTZG 1RFLA 2O8DA 2VR4A 3APFA 2WYWA 2EQBA 3PSHA 3HWWA 2JIOA 1WPGA 2I60L 4DV5B 1Z9SB 3KKEA 5A6VA 2WZPD 4B9ZA 5D55A 1AGDB 2ED8A 2W65B 3QYCA 1HYHA 5DJ2B 4G07A 3RPKA 4NP4H 4JO3L 4L2IB 3KFXA 4ARSA 1NNSA 1INQA 2HLHA 3E7PA 4WTZA 4TOIA 3QS3A 2EJWA 4XM2A 2FRDA 1K5GA 4Y16C 3KKNA 4F3TA 5JYBA 3MMEA 2FSUA 1QQTA 5LXTF 2V2XB 4PJGB 5C8JA 4PO8A 3PPWA 1ILUA 4ANFA 1I82A 4YO7A 3ZNPA 2R25B 5KJEA 5BRZD 2R2BB 1S96A 2YNMC 4OMUA 2OJZL 2D1RA 5TDPA 1ZLYA 5WRFA 4CG0A 1IBLB 5IUJC 3VD9A 3JQ7B 2GHTA 4LEOA 4PSKA 4ZEXA 1PJTA 1L5ZA 2GPAA 5DT9A 1GNRA 1SXQA 2Z2KA 2R59A 1GZ7A 1K3FA 3GFOA 1D8TA 1D5CA 4U1KB 3HR5A 3BO8B 1K5HA 1WE5A 3TBWA 4BB5A 1IBDA 1JFRA 4L37B 1UQSB 1OFGA 3UAJD 3V6BR 1I3GL 1C0EA 3T7JA 4DGYH 2G9HB 3KJFA 3V1TC 4KDVA 3SYPA 3QXHA 4R8MA 4GSRA 1TQ4A 4DAEA 4M6ML 3PFNA 4CN8A 1PI3A 3G8BA 1YEHH 4REMA 2IVZA 4ZU1X 5IT9A 1WHSA 3BTSA 3LH5A 4FDTA 2F59A 5K0LA 4HWGA 1JPVA 4JFEA 2DWEA 3LB6C 4XQGA 4OAWA 4BINA 1ZS9A 3I5MA 2DM4A 3DZHA 3HCWA 1FO0L 3EYFA 1MGPA 1S9VB 1O58A 2ZRBA 5IKXA 3PWPD 1SBZA 1IXYA 1N8SA 1ZHHA 4P3YA 4M99A 5J5CA 3S96A 2RGGA 4GVXA 1E7WA 2OILA 3BEVA 2EP6A 3JQDA 5DD1L 1K8IB 3IJRA 2V7UA 4BVJA 3IFPA 1Q1NA 3HV0A 4MDFA 4JKPH 1BG6A 4LLAA 3RHWK 1ENPA 3Q9NA 3N9IA 2X0JA 4Z7AA 5IF0B 3A5VA 4B44A 1TAHA 4LVOA 4HHGA 5BUZA 4FJZA 2PKQO 1ECFA 1JRHL 1XZ0A 5D4IA 3JR3A 5E1AB 4XLTA 3RJOA 4RKEA 3IIMA 1F1DA 4UBKA 3UJNA 1AXIB 1SBCA 1GW0A 2YCBA 1TM7E 4OSPA 2B4CC 2NXZD 4BNDA 5AM3A 2F2TA 2PR2A 2ATCA 2AW3A 3VNYA 3ISWA 2D3VA 1YR3A 4A6XA 1AZBA 3S2GA 3EJTA 3O75A 3PIIA 5JUEH 2J73A 4DW8A 3IDSA 2DYPD 1UPFA 5CH8A 3C41J 5ICFA 2O5ZH 3GI8L 1QFHA 2GN8A 3LHKA 3NDRA 3UCQA 2CLCX 3UMBA 1A6AA 3BWMA 3SBOA 2IUYA 1T2EA 2BBTA 3K1ZA 2GSIA 4WACA 1REQB 4M8SA 4BKRA 3EHEA 2XLLA 5LQAA 3DFFA 2WVAA 5ISZB 1JDAA 5B2FA 2W38A 1FUEA 4D9FA 2EL9A 5AIAA 3MRQB 3UJJH 4KI5F 2EQ5A 2HRLA 5DD6B 4R3UC 2FN8A 3NPAA 4G1MB 1JJUA 2P2CA 3EODA 3E2HB 1T9HA 1K68A 4JR0A 1A21A 3V97A 1PJ3A 4PMFA 3IPFA 4QHUB 4OLYH 2QL6A 2ZSHA 3V5KB 4IQ0A 1EI9A 1JQ3A 1SU7A 4AT6A 3NHMA 1F0KA 2DTEA 1OI2A 3RG1C 1NN1A 3VUFA 2VABA 1IGFL 3FJYA 3EMDA 1DBVO 4A23A 4P99A 3KLBA 2JFGA 4X8XA 1S8FA 1HZHH 4UTBA 2QG6A 1DQQB 3TW4A 5KEIA 4OV5A 5AHOA 2J8ZA 1ADQA 3PL6C 2ENPA 4OQQA 5C0BD 4K7PL 3O9ZA 1ZLWK 1LE9B 3J81k 4NARA 4YXFA 2XNAA 3ZOKA 1A27A 1UMBA 1FG2B 1MCJA 5EF2A 3VXSD 5BN5B 4AMUA 4HQKA 1RK1A 5CS7A 5ENWA 5AUMA 1ZP6A 3D7KA 1QQ6A 1QPXA 4JDZB 3EIHA 5CAEB 1VG0B 1SOKA 5DTFB 1JXDA 1XT5A 2FRVA 2PRYA 3IMRA 1HT6A 4HHAA 4APQC 2MOKA 3GELA 2ZYGA 4DLYA 1PTJA 3TQSA 2QJOA 1SUCA 4ISCA 2ZB8A 4WQOA 5B21A 1HDYA 2AXGA 4ZVPA 3IAPA 3IJHB 4FZ8H 2XN9E 4QAWA 3FXAA 4W70A 2OWEA 2GA8A 1MC5A 1HL8A 5IREA 1N9ZA 3OJMB 4ZMPA 4F57L 4AIZA 5BVHB 4M0EA 5EFIB 1V1JA 5AK4A 2IIBA 1NM4A 3MTEA 5EUOF 3NV9A 3U1BA 3FRIA 1OLSA 2PGOA 1E1CB 4CF4A 5E5MA 4F5EA 2R5FA 1SKYE 4XN5A 2DP4E 4HCFA 3T95A 3QXWA 4HUXB 3OJXA 2JLBA 3MJHA 2W88A 1NC4B 4KDFA 4XR8C 1AS2A 2ZBRA 4PGEB 1OXVA 1PQYA 3S0PA 3RGVC 3NRFA 2AN9A 2UZAA 4JO4L 3PGJA 1F90H 4RK4A 4XPFL 2V3FA 1QHHA 2HM7A 1DQMH 3TH3T 3LC1O 2IOFA 2PIAA 5DFWH 3W34A 1BECA 2KS6A 5I5RA 4QOIA 5JDSA 1R3HA 3X12A 1GXSA 3DZDA 3L2MA 5DRXA 3RIGA 5G1OA 1L9TA 4Q03A 4HJGA 4LGRB 4MZRA 2FW7A 3PJLA 2QQNL 4FNSA 1YNLH 5ALKA 2VJPA 5GGTH 4Y19B 2JIZD 3ZO0A 1DUIA 4X9HA 5A71A 4PYKA 5F7XA 2BJMH 1T0PB 4X5XA 3AOGA 2FGZA 3BDAA 4IDCA 1YB7A 3N2NA 3OWOA 4FNUA 3VU0A 4BFGA 3U7QA 5E6UA 5JYCA 3E58A 4EFMA 2FJUA 2WYHA 1I3KA 4NCAA 4OXKA 2XPGB 4LOJA 3ERCA 3O95A 3H4MA 4NIYE 5I0XA 1DHRA 3LKVA 2QMQA 3EGSB 1MLCB 3STHA 1Y6JA 3SXUA 2YICA 4C4SA 5BVPL 4H0LC 3PD0A 4UIMA 3VI3F 4J4BA 4QJ3B 4DZRA 4EJ0A 1YGPA 4FNRA 4IIQA 2E4ZA 2ODWA 1U3UA 2ORWA 2P2LA 3A4LA 4J0FA 3MJDA 2O61A 2WJ7A 4AKOA 3ZGOA 3KWFA 4N3AA 2NW2A 4GRWF 2EC9U 1NR5A 2GBIA 3WDIA 3TS1A 2FOIA 3G49A 3SO3B 3LQQA 2NZ9D 2CF6A 4X6DA 1HQRB 1N26A 4IBTA 2YMPA 1CT9A 2OAP1 4N0CD 2Q41A 3N0VA 2MU1A 4E9YA 4MNQA 2H1OA 3MODL 4TKUA 3IBOA 2DWUA 4H9GA 1RZIB 1N5DA 1TF5A 2YZKA 1H6AA 3UGKA 3EH3B 5FUZH 1Z13A 1XN1A 2NY2B 4H6XA 3Q2OA 1Z35A 3T8XA 3KXLA 1QFSA 2WUEA 1P33A 1RYZA 5CCEA 1JV5B 4GLFA 3PV6B 3KH4A 2O52A 4F6RB 1DL7L 4BQSA 3I04M 2VSQA 1DEXA 2P43B 1X70A 2BEKA 4WKZA 4PQRA 4DP5X 5C8XA 4XVTL 5IJ9A 4KPHH 3VR4D 2X7XA 4ANUA 4JGJA 3VSEA 4FFSA 4CRWB 2FX8L 3ECUA 5HM8A 2G1UA 4CIVA 1DSWA 1E8XA 4WJG3 1C30A 2CDAA 1NX6A 2DBZA 1R4NA 4QHMA 3QUXD 3ABQB 3UGTA 4HIIB 1IULA 4TS4A 2OAAA 3WNQA 3UPUA 3ES6B 4PD4J 1Q17A 1T8RA 1QIEA 1L9XA 4CKBA 4AF8A 4BQ8A 5EG5A 5TVKA 1PWYE 3JVVA 5ID1A 4M8RA 3P9QA 3NBXX 1P2UA 1B2LA 1K7SN 4A9AA 5D7JC 3MGGA 5I1JH 4XPGL 2XN1A 2NYRA 1YL6A 4JG0L 3O9WB 2ZRIA 1YS1X 4U1SB 3D0VA 1UMDB 1U9KA 3LS4L 2PSFA 1YEIH 2BY3A 3HPQA 1MQKH 3V7YA 3UAGA 2H4WA 3TFOA 5AZ2H 3WLJA 4LHXA 2B5OA 1HF3A 4UTBL 5ALPA 4GW4A 1QC5B 3I5YA 3HZHA 2MH4A 3Q9SA 2OSLB 4MW5A 1Y18A 4P93A 4HIIA 2B7CA 1HQKA 4LEOB 4JM2B 4BMZA 4OLWL 5ELLA 4E5SA 3KZVA 3AACA 3NWPA 1IQDA 4HHWA 5KVVA 1M2VA 4X5LA 1PJ2A 3AB3A 3W8RA 4UDYX 3QIVA 1PQPA 4PYGA 2FJGB 3PC7A 2Z2ZA 4OVUA 3OR6A 1ODCA 1R5WB 2PV0A 3D54D 3FSEA 5I6OA 4RZCA 3HS0B 1THZA 1PFYA 1JVKA 1K7XB 1ZRMA 5TDOA 1WXXA 3NJJA 2ICWB 3GPIA 3CVDA 3E3AA 3VJKA 2IXQB 4G25A 3QDMA 1JH8A 4XWWA 1P7HL 4KQKA 1RURL 1BWWA 1GG8A 2C98A 4RFSB 4RS4A 4DLZA 3SCZA 3R76A 5CJQH 2UY6B 2VOEA 4EAQA 4DMKA 3QEUB 2RGXA 4G0WA 3RO7A 1D5BB 3HUJF 5IMOB 1ADYA 3HCNA 2BZ0A 5LXGH 4IQ8A 3IQIX 2AC7A 5C3MA 2X4OB 4MNQB 2O7QA 1P5VA 1PGNA 2ADJA 1DKQA 1XL1A 3NJXA 3K70D 2J46A 4KLNA 3OX8A 1DJMA 4JKOA 2UDPA 1DYZA 2UYLA 4M03A 5EF1A 2JGDA 1SWWA 1AQ6A 2WU1A 1SOUA 2WSBA 3H2BA 1X9QA 5EJ9A 1T6NA 3PI7A 4F71A 2X5JO 1IGIH 5K9ZA 5FV2A 2RAFA 5DF0A 3W7AA 2WK2A 2XXJA 4C14A 4E9QA 2D54A 1VB3A 5CH5A 3BJRA 3K6NA 1NKGA 1U9CA 3L7EA 3UGEA 1HHHB 2ZYRA 1Z2KA 3W5VA 1I2CA 4KROC 3JQOB 1JPFB 1ONOA 1VECA 1BVLB 4PF1A 1Q72L 1ZSDA 3A67H 4A2EA 3LP6A 4FFBA 3IQFA 1FNAA 5ERWA 4NZ8A 2V59A 2VF7A 1J7KA 4JB2A 4PJ9B 5KTEH 1HL5A 4I5GA 3FNGA 4HWUA 3WSVA 4P98A 2IRWA 2HMIC 4JNCA 3IMSA 2YMXL 1XF2B 4QOKE 1FPTL 4M1QA 1ESDA 4Y98A 2J3JA 4UT6L 1ZNYA 2UVDA 2G2PA 1YNSA 3I1JA 1SLXA 3NIDE 4DMUB 5FGRA 3DSNB 5H35A 3F5DA 4MJIA 5TPWB 2ZZMA 4K71B 3C8UA 5HGBA 2X5XA 4CMCA 1EWHA 2R7EB 1J12A 4H8HA 2FZKA 1H2EA 3CZLA 3T3DA 3DE1X 4M5TA 1QQDA 2Z08A 3VRIA 3L77A 3BWSA 1FX0A 1G20B 2Q6LA 2W07B 4B2IA 2DERA 1NH6A 3H1ZA 1XXHE 2I9LB 4A7GF 5AVXB 1AM4D 3FKUS 4HW6A 2AIRA 1N59A 4NQTA 5LR6A 3HBJA 1RMFL 4J7CA 3LIIA 3REWB 3U4BH 2EE0A 2I7SA 3WQRA 4G41A 2WVJA 1T89C 1D1SA 2D06A 3ZCXA 4JG5A 3T5AA 2AKEA 1QIIA 3A7EA 4QU5A 1RYYA 2Q7XA 3ESCA 1BE0A 3NYIA 1KO7A 5DUMH 1OU0A 4U9UA 4WN3A 4XASA 3WL5A 1JERA 1CS4C 4DLWA 5C0RL 1JF6A 4PTUA 1TOXA 2P3YA 1OREA 1AMYA 2R1TB 3R5JA 3D0AA 1TZCA 4AZ8A 3KPLA 3HBFA 3M9XA 3IUQA 1P5VB 2VHYA 2BFFA 3E7DA 4FHEA 4JUCA 3BWAB 4TUOB 4O3FA 1A7KA 4KNQA 4V1DA 1M5RA 3FUTA 4ZAWA 4CVXB 3SI7A 2A9MH 4RLHA 5JQGA 4CTNA 3T8MA 1ORIA 3RWCB 3RLIA 3SR4A 1QLWA 3ETBF 3BT2L 2ZSFA 1EWTA 5LYJA 4RANA 2O7NA 5A43C 2NR6A 4GT1A 1F2VA 4YX2H 4UOW0 4RWEA 3PP4L 1OP3H 1KPHA 1QQ7A 2ZIAA 4NZOA 3LP5A 4HVCA 5MF6A 5EZIL 4M1GH 2NN3C 4M1SA 1IEAA 2G0KA 3VXRD 2HH0H 4Z7VA 2M8XA 4HU8A 3QS2A 5I66A 4A8JC 3SDYH 4AZUA 1Y37A 3T77B 3T0XA 1KU6A 4MW9A 4NZYA 2E4YA 3EZ9A 5AVSA 2O8NA 3RVXD 4KRMB 4PN7A 1A6AB 2JBAA 3EVFA 2HY7A 3A10A 3FF1A 4AYXA 1RHHA 2EXWC 1TLTA 1OEZW 5KVEL 4LSPL 3QRGH 3SQOH 3JQAB 4YQZA 5IFJB 3TCKA 5I9QB 5F9OL 1QC5A 3UPAA 3HI5L 3T8VA 2HJVA 4FINA 4G5RA 3OXSA 5BZWB 4LLVB 2V54A 1TYRA 3RKDC 3EO9L 3S34H 1QONA 4PRNA 2ADJB 3JD2A 4Z9AA 1BJ8A 1QAWA 2WF5A 1GUBA 1P5RA 5HBRA 3UWSA 1GL7A 4DHLA 1YDPA 1DBMH 1WTGT 4U2BA 4AZ0A 3S68A 1L5LA 5IT2L 5BSEA 1BIIA 2V7PA 2XE8A 4FW8A 3UC2A 1ULUA 3R6LA 1X9UA 2OGUA 1Y63A 1E3QA 1M83A 3DO6A 5K59E 1G5FA 6PFKA 4CKCB 3GG2A 3KSUA 4L4VE 4P5TC 1ODAA 5IK3A 2WQUA 1Q1QA 1F2XK 1G21A 1K88A 3AXIA 1S3RA 5D7SL 1MC4A 3BKCL 1E9VA 2EG5A 4V02A 2EIMB 4GI6A 4L51A 1MCRA 3DCNA 1EFLA 1WFTA 2H9YA 4R16A 4IJVA 3MRGA 2R1VB 1G3MA 3Q8XB 1GPOH 3K80A 2HW8A 2WBWB 4LF3B 3PPIA 2VC2L 4FKMA 2PY6A 1GRRA 3TINA 4QRPA 3HXPA 1Q1BA 3DVGB 3T3PB 1TCVA 3BXXA 3GJFH 4ZZ1A 4R7LA 5JVDB 5JAPA 2FK8A 3G8DA 3PXDA 3CF2A 4OZGA 4EKXA 3VZBA 2A3TA 3IBEA 2HWYA 2QY9A 3QQ9C 4D26A 1TZAA 3IU3A 2PH3A 2GI7A 1INEH 1NFDA 3PR1A 3D0VB 3ZO9A 4ZD3L 1S3IA 3S2YA 3W6ZA 2W9XA 1P5UA 5IBCA 1HC1A 4M1WA 1AZTA 4OMCA 3B9KB 1U8PA 1K97A 1A47A 4EIWA 4JG1H 4L9WA 2RH9B 1RYHA 1WIPA 2YINC 3WLIA 1P69B 3MG9A 2BDNL 3O0RL 3RL1B 5A02A 2VJBA 4TQEH 4GM0A 4KWEA 5TV2A 2YKKA 1GKYA 1WEHA 4HIEA 3C87A 3B5IA 1S3KL 2C1PA 1XH1A 1UC4B 3H42L 4J07A 4IOJA 1WWKA 4NQCD 3D7SA 5FB8B 1T21B 1KCVH 1FYXA 3ZKMC 4KIGA 1Z7WA 1Z6TA 1N1DA 4DPCX 2NW2B 5HDOA 4EDWL 2Y9MB 4OTXH 3FK3A 4IWXA 3ZY5A 4I0PD 2GS9A 3EMVA 1MN6A 4KC0A 5LC1A 5EEYA 3RIXA 4ZMTA 3GLSA 1IY2A 1FJHA 2FSEB 3FO2B 2XQYK 4Y30A 4HZ1A 3RVPA 4D57A 2J5XA 2HRZA 5HOEA 4ZQIA 5HILA 5IMMB 3JQAD 1A88A 2ZLBA 1WCIA 1BBJB 4OHVA 4N65A 1RR6A 2JZNA 4NKOB 5L6LB 1UA7A 2EEBA 5KS9F 5DSCB 4M6NH 5IHZA 3HSYA 1ZCZA 4AC9A 1MD9A 4LSVL 4IFIA 4RMGA 4G0XA 2NXZB 1U0LA 5CILH 1X80B 3F7MA 1XG5A 4MB3A 4UFOA 3INUH 2B4TO 4WIAA 5J9FA 3TVMA 3U7WH 4GMKA 3MCZA 4Z0BH 1J49A 2PNJA 1ZD4A 1QO9A 3QHFL 1RZJC 2KDGA 3MRLA 4KY1L 1W0VA 1RCYA 1C5CH 3INYA 1YZFA 1YQGA 1K6JA 1VLZA 1M9WA 4ALIA 1KB5B 5EZYB 4KO2S 2IPMA 2Q3AA 3PGCB 1KCWA 1BQ5A 3O8OB 2Z30A 1TPXC 3DVGA 5I7UA 3L8HA 1DJOA 3PUJA 2CE7A 1E9SA 3CV3A 3EQ7A 4NQCE 1W8IA 2B1AL 5C0EB 2P46B 4H0IA 3JQ8A 1U4OA 8CGTA 4R68A 5CT9A 3L18A 2YV5A 3MJTA 3QRLA 3HZVB 4I50B 3ZV7A 4QXRA 4XX1G 5FDWB 3RZCB 1UZ8B 1BWRA 2ED7A 4JUIA 2P4AB 2B0CA 4TMWA 5DS8B 1AHWA 3BTUA 2C5HA 1JIVA 4KTVE 4D9LL 2MSKA 4QRPD 2IIQA 3VOSA 1E27B 2P5EE 1QV7A 4PLFA 1I0ZA 4RA9B 2WTEA 1DCKA 2VT3A 4MDHA 2P40A 3EVEA 3U3MA 1IZ0A 5JR1L 1YRBA 1NL0H 3CXDH 4FYYA 4UEJA 2AXQA 1GGIH 3V9EA 3RZCD 2GSWA 3MTAA 4R05A 1H3PH 5I74B 1PQ4A 5TK4A 3CUVA 3L16A 1NGYA 1U0RA 3J81A 2PYEA 2QF7A 1IKFH 1D2CA 4F2GA 2ECOA 5E3HA 2BSXA 3T1FA 5FYJU 3L02A 3BDBA 3CNOA 1WQ3A 5HF8A 3B6SA 4OQXA 1F1BA 4OCWH 3KCPA 3AQDA 4NCHA 3VXOB 1FNCA 2DZEA 3RDTB 2FK7A 1KP3A 4YR6B 1PZSA 2FFBA 2NTVA 1YS7A 2I1QA 2OP4H 1MFMA 4GKSB 3LHDA 1F8UA 3UZUA 2GJ6E 4FXGC 1GYUA 5D7LA 4G1CA 4YROA 1PRYA 5KSBF 4ZT7A 1A5FH 1T15A 1EVUA 4M8LA 1RXCA 2B9VA 3PIRA 1S7WA 1WBYB 4LQ4A 3VH1A 3KLNA 1WS7A 1QLEB 4Q4EA 2AJLI 2O8BB 4OQTH 3W5AA 2A7QA 3S7ZA 5EYPA 2Z6UA 1ZS8B 5JQWA 1VL1A 4YV1A 1VHDA 2V37A 2BFGA 1JG1A 1JZFA 4H1LB 4NIMA 2AC0A 3N9GL 3LXUX 4FFDA 1I5EA 1Z73A 4RGOH 4FJ0A 4ZGGA 4XNMA 1IM9D 4S11A 1NCTA 1PD6A 5CDUA 1IY0A 2NZ9C 2Q46A 1KEGL 5GVRA 2K0RA 4NC0B 4R2GD 3IP9A 4UTRA 2VQ1B 1RHJA 2IEDA 2V5SA 3ZL2A 3TNJA 1VXRA 1KMHA 2DFVA 1JUFA 3H4HA 1XTPA 4WNAB 3LNEA 3V4VA 2BY2A 4YFLI 3UPDA 4C0QC 1W1IA 2PZFA 3O4HA 2GBVA 3QFRA 4I66A 2R4QA 4XPIA 5DNYB 3S88H 5DRNA 1YNTB 1EO8H 2RGSA 2BCGY 4G23A 3FYTA 3K7UA 2HJSA 3AZOA 1AXSA 4M0DA 1AFVL 2H45A 1YQEA 3NCJL 3OOSA 5HGAA 1NSNH 4NLAA 1GEEA 5FEBA 3KWJA 2GEBA 1PS8A 2DTML 5FA3A 5GSRB 3MJVA 1WIOA 4OI2A 3RVDA 4I6JA 3WGTA 1HE1C 3V7NA 3GP8A 4IS6A 5CD5D 5JW6A 1XMWA 2A4ZA 4PY2A 4DCQB 2YIJA 2A9BA 3FULA 1AN9A 3D6AA 3PNRB 3HPJB 4HAUA 4LMPA 1M2VB 4BUQA 1MC1A 2XUIA 2A73B 1TC2A 4Y4KB 4BP9A 2XFXB 1JLLA 3S37X 1GL4B 3UBXA 4GT0A 4EN3A 3FF8A 3O9WD 3GF8A 3OBBA 3DOEA 4UBDC 3PHGA 4RIRB 3JYHA 3ABGA 3HG7A 2BGNA 4IGKA 3OQJA 3MJRA 7FABL 1F45A 2BGKA 4G6JH 4N0UA 2Q7YB 3MCKA 1BTOA 3RNOA 5JOEA 2X3YA 1CETA 3LV8A 1VFAB 2FB4L 2PXYA 4OQMA 2FQYA 4YP0A 1B1AA 1AUQA 5ITBH 2EIBA 5JSHA 4AMGA 1KXVA 4NRYA 2ECQA 3AREB 3V8EA 5L3VA 3VDNB 4DWOA 4OQNA 1OAZH 1XXHB 1BV8A 2J59A 2OG2A 4AIIA 5IVXE 5EZLB 4JITA 1E6UA 4OQDA 3WGMA 1DE4B 5MN6A 1L7XA 4N1AA 1BHQ1 4MA7L 4GHWA 3GRPA 2FZCA 1K92A 2WSMA 5HDWA 2VW4A 1PCXA 3A4DA 2XPYA 3ALWA 5KUTA 1V26A 1JEQA 1OZ0A 1DBJL 5JANA 4ZICA 1JIIA 1NANI 1J09A 2LD4A 4V1DB 3HWRA 4XARA 1U8CB 3W05A 4Q82A 1NJ1A 4X6CB 4PIVA 1QCYA 2I2XB 3ZKAA 2DV6A 4FQ2L 1YKSA 2FNBA 1JK9B 1PT7A 4REOA 5TB5A 1DKNA 1UWXH 2APFA 1CRWG 3BE6A 1TQCC 5HHQA 3UT5A 4HLEA 3F5FA 5AOKA 3DMGA 5KAQF 4RY2A 4FP8H 4XNUL 2LPMA 5LJIA 5CDTA 1MCFA 3WO4C 3T1FB 2KZKA 3ZHUA 4IRSA 3T3PF 5FPHA 1E67A 4KO1S 3B3QA 5LBSL 2WP0A 5K3DA 2I66A 5CEYB 4I4TF 1H0RA 1TE2A 2XRZA 4ZNCD 2FSPA 4E5XA 4N2NA 2C8VA 2O9JA 3E8SA 3CX8A 5E1BA 1AZCA 3UJIL 4EUPA 1YI8A 3E9YA 3SKOB 1HOTA 1F1GA 4UVIA 3IVRA 1E1RD 4TUKL 3K8LA 2YD7A 2R2BA 1KLUB 4ICWA 5E1OA 3VOAA 5CNMA 5K2OA 3BEWB 2OCXA 1JP5A 3PFBA 5F88B 2PO6B 4BMNA 1B00A 4X6EB 4ON9A 3O90A 3JAMA 1XRNA 1C3JA 5EXXA 4S1NA 2C9AA 2XWSA 4PWJA 3S88L 1H94A 1ZHLA 2X28A 4PE5B 4Y4KA 1DO5A 3CMGA 4D0SA 1N5YH 3AY7A 1IEQA 5E6SA 4XLLA 5EE0A 3MAAC 1F3JA 3FUJA 1Y80A 3NIFB 4YRPA 3PQDA 2FJUB 4F92B 1OZAA 1P1ZB 4URUR 3N8DA 3NDJA 2DPGA 2YNMA 2NY3B 2YPVL 2PXXA 3CRZA 4WFGD 1GAFL 1DDIA 4L0YA 3ZK9A 3G0HA 3VGGA 1H6UA 3H85A 3T3MB 4IZ6A 4W4NA 2NMVA 2GTHA 4I1SA 2XYGA 3GEHA 2IYAA 2D31A 3K9QO 4EHNA 5EKTA 3O1IC 5F3DA 1SC1A 2HV9A 3V8VA 3H97A 3Q9QA 1VP9A 2W8BA 3T6XA 5EPUA 1EBPA 5THQA 2DMHA 2VDLH 2ENWA 3IUMA 2HF7A 4JX8A 5F7DB 1Y5IA 5KVFE 4IRUB 1BZOA 4TSAH 4UXJA 1FZOB 1MO2A 1OGAD 4JPSA 1PQWA 2GZSA 2X77A 4CMEA 5IDWA 1YDWA 3IB4A 4IIZA 4KK4A 4O2RA 4NBXB 3WTCA 4A36A 3QEUA 4HEHA 3P0FA 4A8PA 3I6IA 2Y1CA 1X38A 5J6GB 3TBCA 1GSMA 3PNQA 4NU6A 1OLOA 1WISA 3EYVA 4W9LC 4G1VA 4YRGA 4BFOA 2IOMA 4NGHH 2BI4A 4HUUB 4QY8B 1VEOA 4ZAKB 4IRJD 1SIOA 3HNSL 1Z37A 2IG2L 3L8MA 3K70B 5LD2C 4Z8YA 4YUEL 1ZM7A 5I47A 2VR9A 2IQAB 4MAAA 4OV6F 1E20A 2EW2A 1SGWA 3QY9A 2DRUA 4XC3H 3QNZB 2QUJA 3IDOA 3OT4A 2ATPB 1ZCBA 2VK8A 1E8DA 1RYDA 1ZNWA 2PZEA 5EU6B 1F58L 2J3KA 5JW4N 2E5EA 3PWKA 2BTOA 3VTMA 3VYTB 1GGVA 1PKQB 3VMPA 1F4PA 1C5DB 1JU3A 4HVAA 1G9NL 4LCWD 2ZK7A 4G8DA 1JLMA 2WOYA 3FVVA 1RIVH 4X97A 2FEMA 2NY3D 4FFZL 2Y5TA 1ZRHA 5SWQB 2XV0A 3P4LA 3UTQB 1ZU5A 2E82A 5FPQA 4HPWA 3UJTL 3LQ1A 5KVGE 4RJIA 2MYNA 3WSWA 2QVMA 4ZCPA 1ET8A 1FYTA 4RKRA 1J22A 3DL0A 1SVBA 1KJIA 3GH3A 1JJBA 5HKKD 1RPTA 4I36A 4QO7A 5JVDA 2YUTA 2OFWA 4YRZA 4OGZA 3OESA 4W81A 2ZBUA 2CLOB 2XYRA 4N8VA 2GZAA 4C4XA 4MB0A 3I6YA 2NZYA 1FJGB 4CT5A 1XHHA 5FYLH 1P1RA 2XWBA 3EYOB 4G36A 3UENA 3STBA 2IY8A 2I7VA 2ARJQ 5BMFH 1XJQA 1IGCH 4PGBB 3KH3A 1GAEO 2Q2LA 2P1RA 1V43A 2HFFA 1NV9A 1JK9A 3VDAA 1GZUA 3CVOA 3G17A 3VMOA 3BFXA 2FUTA 2VH5H 2P9BA 1HWYA 4L8GA 1OKEA 4UILL 2Y92A 3CFMA 4F8QA 5DK0A 4BTLA 4QRBA 4TKLA 4J3NA 4MPDA 1D03A 3BBLA 3DHYA 1MI5B 2YGOA 3DX0A 3MLZL 4ER3A 5AVUA 4US2R 4RZKA 2Z83A 1KY4A 2LU5A 3EXIA 1GZPB 3FZQA 2H8KA 3FRUA 4HH4A 1EMTH 4RCAA 2IDMA 3WSTA 3VFNB 5ABAA 3HP4A 4KI0A 1O0VA 2V5VA 2CYCA 4O2EB 2B37A 4NN7B 4RVBA 2JI9A 1CFQA 2DEXX 4HLUC 1R24A 4D9KA 2QVIA 3T3ME 4JLMA 1T3SA 3C60B 2DTMH 4GLRI 4IIGA 2SEBB 4JK3A 1Q5PA 1YDEA 4LCCC 1WWAX 3ZE8A 4ETNA 3L5XH 1CE8A 2C77A 2YR3A 3TTVA 5FJJA 4FTVA 4WW2F 2IY9A 2YY7A 2UY6A 4LZZA 3LY5A 3IKTA 1XZPA 5DE3A 2AJXH 5EOTA 1QRUA 1J5EB 3SZLA 3NJ8A 1MW8X 4MJ4A 1HE5A 4HDAA 5A05A 4EKIA 3LLUA 1RI1A 3TMAA 4LYGA 4I89A 5FP0A 1ZVMA 2EZ0D 3BMNA 4GVPA 1ZOLA 4AJ9A 3DARA 2Q0SA 3IAEA 5I4IA 4IKKA 1GSAA 1A1NB 4AVYA 4DLXA 4FKHA 3QHZH 1RLTA 3T4UA 1C8BA 4LCWA 5LDHA 2IBBA 1YMMA 1PJRA 1JSLA 4RGOL 1SA0B 4EDXB 3HUDA 2B59A 4AQ1C 1KGWA 3G04A 1RQ7A 4DTIA 1ZXBA 5T1DH 2XWBB 2D5IA 5ADWA 3P40A 4G2AA 3MLRH 4TSBL 4ZK6A 1QIDA 3H5IA 2E5LB 2NUBA 3G88A 1V48A 5IOKA 4HY3A 4PCVA 3G9AB 1VSQA 1QH8B 3RLSA 3X2QB 3LEYH 5DLML 1LNUA 1JWMA 3HJRA 1OY3B 4Q3DA 4NDMB 3IDGA 2RG1A 2D5LA 4LCEA 1GGBL 1PJBA 4CF6A 2ZR9A 2LGNA 2FWSA 4BU0A 4LI0A 1TAQA 3ZHNA 5JISA 3S3SA 3CURA 2QX6A 4U33A 3T5TA 2WO2B 1WCBA 3AF1A 2DI8A 4IKPA 2A7XA 1E6KA 2OSXA 3OB0K 2OKMA 3PFIA 1QFOA 4JO2L 4PJGF 2XN2A 3TX2A 2UZYB 3ARVA 3BWDD 1OAKH 1E8NA 4JJOA 3NM5A 1K3ZA 4LE0A 4ND3A 1BXKA 4PJ7B 3DEIA 3MRIB 5L6YH 1DLIA 3CMMA 3VD7A 3LRXA 4LGCA 1Q1EA 4BUHA 5AQ0A 4X1OA 4AYMC 2BOBB 3TBTB 2REOA 2XY4A 3HJUA 5A7HA 3PNWA 2VLKB 1PR1A 1CW2B 2NADA 1N36B 2DKUA 3X1XA 4XRCB 1GCOA 2Q8AH 5BSKA 4JDVA 3FOFC 1OE0A 2H3KA 2HRGA 1UEMA 5GIRA 3FTPA 5HP5A 3FO1B 3LV3A 2W4QA 1SVKA 1Y48E 2ABWA 2O6CA 3CA8A 1YNOA 2P9QA 1K5NA 2OGSA 4K1XA 2LU4A 1YKFA 4GKVA 5BWOA 3UUWA 4MWZA 3G6JB 5FECA 3NZUA 5KJ4A 4G2TA 1A14L 1D5MA 4P9HH 4AMBA 3EH1A 1GFWA 3AVEA 3N2KA 4M29A 4C03A 4QHLA 4DTCA 2G0LA 2PWPA 3NT2A 2JGEA 2OMEA 1DL5A 1GZVA 4A68A 4HAWA 1NCAH 1BGXH 4LMAA 5JD6A 1V11A 3WBDA 3WHXA 1GCUA 2WJ3A 5CYOA 2CHNA 4GO1A 4IOFC 4P5KA 3UAJC 5DTQA 3Q6GL 1PK7A 3EJYC 4MJXA 4GX0A 3FBKA 2YXLA 1BKDR 3B7GA 2ITDA 2JI3A 2JKRM 3SDXE 1GS8A 1ZRUA 2FZLA 2CO6A 4NSNA 5T5FA 4F7KA 3O2JA 3HXMA 3NOIA 1P4LA 1TCRB 3QIBB 1HZJA 2QJDA 2VRNA 5FL7A 3NATA 1UXKA 1U8LB 2EW1A 4KJPD 4NKIL 3KB1A 2X41A 4FYJA 3AQYA 1G9NH 5DEFB 5AVRB 3ZIMA 2IF7A 2BTQB 5BSRA 2VOTA 3HM2A 3WTBA 3MU3A 4ZCSA 3TFBA 5K39A 3ND9A 5GP1A 3ARDC 2HPHA 3BP6A 1KI6A 3UMTA 2OECA 1XALA 3GRWL 5B1JA 4FL4C 1QUNB 1CUOA 2G9KA 2HIHA 4DXHA 1LPNA 4QYXA 1SK9A 1D1TA 2DYPA 3WSQL 5JZBA 1KGSA 3GYGA 4P31A 2GVNA 4ND7A 1NN5A 4QRQB 2PFGA 4PCLA 4RHEA 3JZAA 1J0JA 1OAUH 2VR8A 1GIGH 2V7HB 3IR5A 5B55A 3IJPA 3H1GA 1N2SA 5SZHB 4IJ3B 3H9SB 3K5PA 3KEGA 3CZQA 2OB2A 3PDIB 4MHSA 5M29A 2KPOA 1AKTA 2G3YA 3V4UL 3M17A 1MQKL 1BKSB 3C5EA 4MMXA 5CX1B 4KY2A 4EENA 2OAGA 4B4VA 1DRUA 3HG3A 4TT8A 1XH0A 1BEYH 5JYLA 1BA3A 4LAFA 1SN0A 2AXFB 1PYWA 2E76C 2K1MA 4HGMA 3DTNA 3DIFB 3VDCA 4M1CC 4J75A 1JFQH 1UT2A 4PH8A 4F5CA 4FABH 1KDRA 1WJ3A 3TGWA 3TZKA 4DT2A 4TXVB 5ECWA 1TYJA 4Z18A 5CH3A 4IRJB 1DEOA 4B8YA 5HZGA 1QSEA 2OCAA 4F6RA 2AI0L 3EY4A 2X5KO 1FGVL 3AGWA 2B5WA 2BZDA 3BPOB 1ZHBA 3KPYA 4Z0PA 3RGWS 5C3LD 3CH1B 2CXXA 2YAPA 2JARA 3D3QA 1P91A 3A32A 3KKKA 3VZQA 2GPWA 2BSTB 3KPRE 3TSCA 3M82A 1EDHA 2C2MA 3QA3E 4BXVA 4QOKB 4RBNA 1KPVB 2FQGA 1NIEA 4YPFA 5JQ6L 5DYFA 5EIAA 1JWSA 3BB3A 1DQIA 3C24A 4YJHA 3EFDH 1MPXA 5EJAA 2GPJA 1F18A 4OHPA 4HYTB 1CNFA 2HJWA 3SGJC 2WTXA 5HEKA 4DPLA 4MV5A 1TW3A 3FPXA 4RAHA 1UXSB 1O6BA 4KXXA 2P8LA 5CWSB 2P5WB 2BVNA 4K3EH 5FR2A 3OQVA 4PRKA 1JZ7A 2RA1A 4BFFA 2I62A 1J9RA 2P5EB 3ZQ4A 3SDAD 3M4XA 3AHDA 3QFJA 1XX6A 4WKGA 4PNPA 1IV8A 1EEQA 1DTSA 5EBLB 3OKKA 1ZGLA 3JVIA 4RGNB 4DKEL 5TARA 5D5ME 4AJIA 4XMKL 3UTTD 4JI5B 4EB8A 2QZ5A 2VJCA 5DMGD 3KDAA 2P2YA 2OTWB 1QAOA 1M7XA 4H7JA 4PRDA 2WG1A 3OMNB 2VJNA 4XCXA 4C7OA 5C51B 4MOWA 1WF3A 5DJ2A 4YAQA 4AENB 3O3EA 1DJYA 5KWVA 3DBXA 4LMBA 4PC7A 4P3CL 2DQHL 3MLVH 3PDUA 3O47A 3OR6B 1Y34E 4YC2B 1MG2C 5EHFA 2I4MA 3CO5A 2QLMA 3VR4A 2PAFA 3NDIA 4M4PA 5B39G 2AYYA 1JU9A 4P4RA 1VKXA 1PV4A 1QG6A 5IM7A 1XTTA 5LGYA 1S3SA 5KQRA 4M60A 5HYFA 4MXDA 4QYWA 2FFJA 3RVQA 3G0IA 3CYFA 3HUUA 1DUZB 4PCYA 3L8QA 5ILOA 4BLWA 3WLSA 4S3MA 2PKRA 1RHMA 3BMCB 4WFED 2OX5A 2KPWA 1DL7H 4U1SA 2GF0A 1L9NA 4KDTA 5DURD 2KDYA 1AXEA 1GV0A 4B4DA 2AEOA 3WAJA 1U2DA 4WKPA 3KPUA 3BD7A 4X71A 4Q9AA 5CR1A 3GHYA 5F6IB 1E99A 3RIEA 3UO1H 2GZDA 2A5GA 1JDSA 5BQXA 1T36A 3TPKA 4L7QA 3GJEB 2CJWA 2CMRL 1Q0YH 3QHFH 4Z9XA 5I8WA 3WO0A 2P6UA 1IBBA 3TDKA 3MELA 1DBKL 3VSCA 3EYOA 1AC0A 4Q1FA 3HPRA 4LOEA 3GTVA 2X9NA 1EUDA 2O23A 2QUAA 5CKGA 1S5HB 1Y5RA 3SE0A 3Q88A 4XP9L 4GPIB 2Y71A 1W2GA 2AJ3B 1BU8A 1DMRA 1PE0A 4A16A 1QYVA 4UYQA 1DBBL 1J9CT 4Y9CA 3AX6A 2YHIB 4F7MA 5E4FA 4BTVA 5E8PB 1KAOA 4O2LA 2WYVA 1NCUA 4R2JA 2H2PD 4TQIA 4OBSA 1OLXB 5CMAB 1OCZB 3GGSA 2WICA 3GSQA 2PIDA 4K6HA 2XT9A 1KLFA 4ZK2A 5KZMB 1GGFA 1DO2A 3NNSA 3R40A 3HG1E 3REGA 2C7PA 5DURB 1ZUWA 3H5LA 1T5WB 3PPVA 4B9IA 4RDBA 5FNVB 3HKBA 5AICA 3CVUA 2NQ2C 2CG9X 4EUPG 2OMTA 2I0FA 3M9LA 1XAHA 5FM4A 3RV3A 3NSCA 3AI7A 4TLTA 2FSVC 3LEXB 4KX9A 1PYDA 4MWGA 4JCWA 4BS9A 4QBGB 3AHJA 2WBXA 3WMQA 2YVQA 1UD2A 4KK3A 5I23A 4DRXA 2YQ2A 1JNLH 2JHGA 2PK3A 2Q9BA 5IMKB 5KDOA 5F2OA 3PXHA 2VDNH 3VX1A 1KMGA 4QXMA 3CVHA 1IN7A 4YRCA 5EERA 3AEQA 5DD0H 4Y4KD 1OALA 2IWEA 4PLPA 3KPOB 4PX3A 2DWYA 3BRGC 4ZUWB 5CAYB 1JHKL 3P77B 1GPWB 4B3EA 2X58A 4CI9A 4PC6A 2JLQA 4LTNA 4X99A 4LSGA 5F2KA 2AQRA 5FBVB 1WNFA 1RRFA 3DMMC 3QUML 3T9BA 2UUBB 3SAJA 3OX2A 4MMZB 5SWSA 1SCJA 2VMDA 1QMPA 3A1SA 1MLCA 3ZRSA 3BMCA 2I6TA 3H9UA 3TO2A 4NC1E 1KULA 2BS71 5HRCA 1RKRA 2Q29A 4S1WA 3SZOA 1LXMA 5SV2A