3ZE0F

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F01
3BP4A 5LG1A 1O7VA 3PP3K 4W6YB 4KTYA 2OS7A 2XA3A 2AI0L 2XG4A 5JUEL 4D94A 4N0UB 4HS6B 1WWAX 5EBMB 2JCCE 4PJXF 4X4XB 4F8QA 3MOQA 3P4LA 2P8PA 4JKMA 4P9HH 3VG0H 5BV7B 5MI0C 4X6DE 4M1CC 1LO5B 1NCAH 1SEQH 1QBLH 1BVZA 3HE6D 4LQFH 1HHIA 5EO1B 3H9YA 4G6ML 1IEAA 1H3WM 2EIZB 4HEPG 4EOWH 1A14L 2B1AH 1LP9B 2BNRD 2EYTA 2EYRB 3OF6D 1T2QH 2I60L 3MV7B 5DD5H 1IM3A 4PY7A 3PWLB 3WS3B 5IKCB 1OAZH 1CT8A 2IPTH 4F58H 3JTSB 5A43C 5BS0D 2OJEA 1IAKB 2FWOB 4N8PA 1JPSL 4OQTL 3U46A 4KUZL 2YXMA 2DQTH 3PWPE 3QFJD 1M4KA 5F7EH 4GJTB 5J3HD 1MUJB 2NY2B 3EOBA 5DR5L 1IT9H 4HUUB 4QRRE 4XCFL 2ESVB 4AL8L 7FABL 4CMMB 1JIBA 5EBLB 3OX8A 4Y5VA 4MNHB 4LRNH 1U3ZA 1MFBL 4LFHD 3D39E 4HWZB 4OLUL 3ZDXF 2B5IC 2YMXH 4NJAL 4FQLH 1HYSD 3SY0A 1JF1B 3UTZA 1BM3H 4QHLA 1UCTA 4MCYB 4ZS7H 3HZVA 5C07B 3H9SB 1G1CA 1P4BL 2EH7L 4GRWF 2BHZA 3BXNA 3I84A 1MREL 4HXBH 1NMAL 4WHDA 4W6WB 1BFOB 2LAGB 4ZO6A 3EYOA 1Q9LB 1LEKA 4MJIE 1RK0B 4JKWA 5E9DB 1A9EA 5I74B 5GSRB 1K8IB 4BA8A 4MDJA 1XF1A 2GTWB 4O5LH 4XP4L 5KBNC 1AHWA 3ARBC 4WFHE 3RDTD 1O7SA 1ZAGA 3QISA 4UUJB 5AZEL 3QWOA 4W68A 5F7KC 3ARBA 3QXVA 1MCSA 1V05A 4PJ8D 2OYPA 3GSOB 1FNGB 3NFSL 4HJ0D 3MRPB 4Y4HB 5EUKB 4R90H 3QIUD 1I7RB 5IVXF 4D8PA 4U6YB 1XGUA 3IF1B 5D6CB 1CICD 4FFZH 4GW1A 5IVNA 2A1WL 3IT8D 4PJDA 4S1RH 1BIIB 3KYKL 2JJTC 2EYSB 1A1MB 4KK6D 4AIZA 4MAYD 5JXED 1EHAA 1UB6B 1UM5H 5D1XC 1LE9B 3LEYL 3BPCB 4R6UA 4M5ZL 4OB5L 2DLEA 3O8XC 3T0EC 2FX8L 5LGHH 1QBMH 3FRPG 1DBKL 3WIFA 4TYUA 4KQ4H 1FV1B 4M7KH 1IAIH 3QULA 3QCTL 4JFFB 1HWGB 5IFJA 1RHFA 4GBXC 4PJAA 1NFDF 3BDBA 1HI6A 2AXGB 1RFDL 1K2DB 3CDYA 1ACZA 4K8RH 1I4FA 1NBVH 2M8XA 3MPCA 3GKZA 5HYIA 3KPSB 5KVMC 1S9WA 2GK2A 3TZVB 1RK1A 4RA3A 4PJIF 1B4JH 1XT5A 3BPLB 1MCBA 4LHUD 4N90E 4HG4J 5J89A 4BZ2L 4OCSL 4OAWA 3VGEA 4NQDB 1I8MA 1XEDA 4QXGH 1D6EA 5TF1H 1YYMH 5GHWH 4PGBB 3KXFB 2VQUA 4MA8H 3V8CA 2CRZA 1BD2A 1LK2B 5IV2A 4EUPA 4ZD3L 3QUZD 3VFGH 2LE9A 4DKFL 1ZT7A 6CGTA 3BW9A 4P3DA 2W0FB 2D7OA 1DBML 4F2MB 3VXPB 5C0BA 1BBJA 2LQRA 2WBJC 1NGYA 3HMXL 5T33H 1CYGA 4NRZB 4YHKH 3N85H 2H26B 4NDMB 1JGEA 3MRMA 2OP4L 1V7NL 2WBJA 2DLFL 2XYCA 1KBGL 1F4XL 3BQUA 3C8KA 1U3JA 3SGDI 2EEDA 3KLHD 2P8LB 1DEDA 1OTSC 4QO1A 3F12B 1FVDB 4U6VH 4YK4C 3KYNA 5TDNA 1YN6A 3RRQA 4L4TA 2A83B 1MWAB 3O3DB 4G3YH 4UTBH 2IG2L 2XQYG 3T77B 1T5WA 1RIVH 1G6RB 3GJEA 1NJ9A 5F89B 1LO3L 4UIKL 3MCG1 3HAEH 1JUFB 4FQIL 2AJZB 4UINL 4U1GB 3DMMD 4NFBA 5ADOL 3ZYJA 1IVLA 1U92B 4XHQA 5JW3L 3T4YA 8FABA 4IJ3C 3FFDB 4UIMA 3UMTA 3BUTA 1G7IA 4PJ9C 1QG3A 3GI9L 2KKQA 4M8VA 3WJJC 2HT4D 1IGCL 5KW9H 4NFCA 2DBLH 2YZ8A 5GZOD 2P5WD 1KJMB 1OLZA 1ZHLA 3UXFA 5HYEA 1CIDA 3PQYB 4QHKJ 5IHUL 3FN9A 2ATKA 5GGVY 3QDJE 1NDMB 1WSST 2D3VA 2BVYA 1IGIL 2P24A 1ZOXA 1CFVH 1DQLH 1IGMH 4Y16A 2V9TA 3FQXB 3MLUH 2ZG1A 5HI3C 1E28A 3TBSA 1TDQA 4JPVH 1KTRL 4RZCA 4OZIE 1YNKH 1XGTB 5DD6B 4PG9A 2XNAB 2OXGA 4ZUUA 3MLPA 3NN8A 3KYMB 1A7NL 1C08B 4R4FL 1V3JA 1BLNB 1J0YA 4N1EA 3D3VE 3FOMA 3L5XH 3JV5A 4XPTL 4JPIA 4WFEE 3NFNB 3O4LD 4GAJH 4TUJB 3TA3D 1QEWB 1JWUB 3NCYP 4M6NL 1U3HD 4OQTA 3QWRA 4Z7WF 3ULUL 4WGWB 4YC2B 4LSQH 1IILE 2WUBL 4IMKC 4LLDA 3MSPA 1AC6A 1WV7T 3GSNB 1U8IA 2P45B 2ZJSH 2JB5H 2VLKE 5IBLD 1AQDA 1J1PH 4LGSB 2NY6B 3WO4C 1N5YH 5EA0H 4WWKB 5LGJA 4ACPA 2AEQH 3WNMA 4PRPE 4I0PC 3L5WB 2DYPB 1N2RA 1YEIH 1MH5A 4YZFE 1S5HB 3VH8A 3I6LE 2Y9RT 3TGXA 25C8H 4MAUL 3D0LA 4MLIA 1KGCD 3DRTB 2JE8A 1BJ1J 4ELMB 3QUYC 2WW8A 4ZPTA 4PBVC 2NY5L 5A2JH 2GIYA 3O6FD 3L3IA 1YNTA 2HMIC 4PLKC 2NW3B 4HKJA 2DQFA 4APQC 3ARFD 4PJHF 2CLRA 5E2UH 1ZT1B 5F7NC 3LSOB 4XWGH 4X5XA 2ED9A 4XAKE 3RHWK 5E1HB 5CJXC 4OZHF 3SKJH 3NTCH 3VXTA 2YHGA 1EBAA 1R5WB 3QI9B 5J6HB 3CAFA 4PP2A 4RFOL 4QGYA 1H15B 3FJTA 4UU9A 1YUHA 4C59B 1LQSR 4G6FB 3KYOB 3OGCA 3BEVB 2XTJD 1Z3GL 5HGDA 4HV8B 4XMLL 2UVFA 1L4IA 1S7WA 3ROOA 5IBTH 4FOMA 5JHDE 4CVWA 3SE8H 5IROC 3S5LG 4J1UA 2B1HH 4ISVA 5D7LD 4FQHA 3STLB 5ITBL 1EVTC 2VIRB 3GMRA 1OHQA 5ALBL 4PB0H 4QRTB 4Z0BL 3QIWA 4FNLH 3REWA 5IMKA 4GW5B 5L6YH 4OD1L 5TE7L 2C1PA 3HFML 3PWVB 3VFPA 5I15H 2PYEA 2DIBA 5HYQB 3KDMA 4ZS6D 3LPWA 3OJDA 5DJ8B 4X6BB 3UTQB 2H32A 1IQDB 4JM2A 3TPKA 2OTUA 1R5VB 4OI8A 4JDTL 4QWWD 4RISH 4GRLA 3QEGH 1E4XL 3FQRA 2Y36H 2AV7A 2EZ0D 3L7FA 2YRLA 4PGDB 1PZ5A 3FB5B 3MV8E 5GJSL 3W39B 4WDIA 5D7SH 1A0QH 1VKXA 1BX2B 4O51B 3HMWL 5DJCA 2BSSB 2FECI 2W9DH 2E6PA 1TJHL 1CGSH 5BOZG 1ZS8A 1P2CB 3QQ3A 3T0WA 3FB7B 2OBGA 3OKLA 3P4MA 4I18B 4NJ9H 1V3LA 1BQHB 5DC9B 4CADA 3AC0A 2BXYA 1MLCB 5F7DA 3E8UH 1YZZA 5EUOF 2Y25A 2ZZUT 4L9DA 1MVUB 4HPYH 4H0IA 1VEOA 1A6PA 4JGUA 1NKRA 5MEQA 3LDBC 4WO4C 3Q48A 2BJMH 1S5IL 4NWTL 5IMMB 3SKNB 4H26B 5E6IC 4TRPH 1DBBL 4NNXB 1LE5A 2FHFA 4EI6B 3KJ4C 1OVZA 2P49B 4KK9C 3QDME 4XBGB 3CLFL 2QQNH 1UH4A 3HMXA 3P11L 2AABL 5J57B 4FABH 5JTWA 2Y06L 2Q7YA 2W91A 1LWRA 4P48A 5DJXB 1JPTL 5E8NA 1P7QA 2MTPA 1IAII 3TIEB 5IG7A 4F33B 1CLYH 5I66B 4ZFOL 2ARJB 4J12A 4MD4B 1I1AC 4G9FE 1DSFL 2C3GA 3HRZB 3UJJL 1EERB 3MRFB 1CFBA 2DQUL 5D7JA 4KKBC 5C6PB 2NR6C 5E2WH 2BNUA 3HCVA 2MQCA 3UTPE 2NYYD 3WFCL 4JPKL 4HF5H 4HHAB 4LASH 3RUGF 4LSTH 3TNMA 4E41B 1UH3A 3CSYA 1FRGH 4L29A 3C6SA 4ZO7A 4F57L 2VXQH 3BZ4B 3E0GA 5I0DA 4GXVH 1KUMA 4IRSD 4HZLB 3MOBL 3VXUB 3MRIA 1QFWL 3T1FB 3TT3L 2FLBT 2P47B 3MMEA 4WI7A 5HDBE 4IRZH 1HXMA 2KZWA 3P0YL 5ECJE 1BQLL 1CF8H 3IFLL 3SDXF 4GMTL 3QIBD 1KENL 4P3CH 2ICWI 5KN5A 2V2XA 4PIRF 4PJEA 2AEIT 4U2ZA 2X1WL 3RZCD 1FPTH 4ODWB 4YDIH 5FYLD 3QUKB 5GS3A 5HYFA 4R0LB 2WBWB 4XPHH 1Q8MA 43C9B 5GSVB 5MHSE 4YX2H 4I3GA 4W4OA 1IM9A 1WEJH 1NLDH 3UBXA 1NAKH 1JWSA 4KKCD 1JTTA 3CU7A 4L1DA 3UTTB 3VXME 1FCCA 4NN7C 4WRLA 3LS4H 1B0RB 5AUMB 4DJMA 4QRPE 1MQ8A 1NUDA 1D9KB 2VLRA 4PR5A 4O2EB 2HG5B 4W4NA 1KCVH 4NFDA 3ESUF 4OI9A 3QQ4B 2R2EA 1XGPB 5FA3B 4JREB 4G6AC 5F6IC 1YMMA 2QLVB 2H8PB 4V1DE 3WS6A 3BISA 1S9VA 1G9EA 1OGTA 5AG9A 3PL6A 3PWPD 3VFOB 2R2CA 4GKNA 4HUXA 2ERJB 3GGWB 5IR1B 5HVWA 2FRGP 4P5TD 4BJLA 4WHCA 3BT2L 4QHMA 4O4YH 3TPUB 2VABB 4QRRD 4KJWC 2HFEB 4PY8I 3UZQA 4JFXA 5KSAC 1IRAY 3CC5A 2Z92B 3BN9D 1HSBA 1T7WA 5KOVC 5ETUB 3QNXA 2IFFH 4HGWA 3SCMB 4D9LL 3A6OA 5KVEH 1XIWC 2UZIH 1T1WB 3WFBL 3BHBB 5B39G 2EH8H 3CH8A 4Q2ZA 4YNYB 4GG8B 1DVFC 5DRXB 5FOBA 3QDGB 2Y5EA 4XXCC 4J6RL 2CD0A 1MRCL 3ZT7A 5DJ2A 1K3ZA 1A6WL 1XZ0A 3IS1X 3MRDB 5DRWA 2GT9A 3JWDL 2E9BA 3PWUA 5ESAA 2PXYA 4ZFFA 5T1DL 1FDLL 4MJID 4F9PC 4LCYA 4L5FL 4N8CH 3U0PB 3OHXA 1L7TL 3R0NA 3F6IA 4WFHD 3KPPA 4PTUA 3HE7A 4L8BA 5JW4R 4HWBH 2D0FA 2EDBA 3CFEA 4PJFB 3HNTL 1VA9A 2X05A 3FB6B 3KAAA 3AROA 4JHAH 1GZPB 4XGZA 1A6VH 1IMHC 1UACL 4EN3C 3ULVH 5EZJB 4NSKA 1EMTH 4WEBH 5FGSA 1EFXA 4ODTH 5ADPH 5DFVC 1WITA 3IXTB 5E8EA 3BVNB 5MERB 4J4PC 2VZOA 3V0WL 3OKMA 1BAFH 3WEXB 4U05A 2Q7NA 5TE4H 3BX7C 4WGVB 3MRJA 5JO5A 4J4PA 2FYYA 4LCCA 1A6ZB 3IFPB 3K4AA 3SKMB 4DGIH 2OK0H 4OCWL 4M8QA 3KPRA 3QUMB 5DVNA 2X9XA 3VD3A 3MO1A 1XR9B 4XP6H 2WQRA 4EQ2A 3FQTA 2CXKA 5L2JA 2X7LB 5L8JB 3O4OC 3NCYS 5C09A 3RVVC 3ALXA 4HFWA 1ZVSB 4JB9L 4YFLI 3X14A 4JFDD 5F88A 3BGMA 4LDLB 1F90L 3DURB 2PO6D 3MUZ1 3RGVC 1F6AB 1KELH 4Z7OF 4N90D 2YSSA 3VXSB 1QFUH 1FBIH 2A77H 4NGHH 1R5IA 2CK0L 4JRXA 5C0FA 1JZ7A 1TTGA 4OFYA 3GSQA 3OKKB 1WFUA 4BFIA 3ZKMD 4Z78B 1Q72L 2BVQA 43CAB 1P7KA 1D5ZA 4MGXA 1TNNA 1KJ2H 4X9HA 3EYFB 4Z7VE 5F9DC 1WT5A 5D2LE 4NKIL 2DM4A 4B50A 1CD1A 1ZV5A 3GMOB 4NQTA 2NY1D 3ZHKA 4QXWA 4QEGA 3KS0H 3G6AB 4NKOA 1R0AH 4UB0L 5J7CC 3ZT6A 4LL9A 1AH1A 3T0EE 1JFQH 4PRNA 2NLJB 4HIEA 2VXUL 4PJAE 2UVEA 5FYJU 4GKZA 2AGJH 3WKNA 1A2YA 3WLBB 4XNMA 4LCWB 2XPGB 3TN0D 1U8LA 2BERA 4ZFOA 3PDGA 4LVEA 3S4SB 1YY9D 4XHJD 2CKBB 4O58H 3CNKA 1SYVA 1OARH 1PG7H 3T2NH 1IGTA 4JKPH 1JN6B 2HAZA 1FZMA 4PGZA 1QO3A 1MF2H 2EKSB 3O6MH 3D69B 3NIGF 5C08D 5MEOA 4KV5E 3V5HA 4RRPA 1FFNB 1RAMA 5TDPB 1BF8A 3JTTB 3BKJH 3NPSC 3TBWA 3V5KB 4ZSOA 1P53A 5GGRB 3MZTA 4TVPH 1A4JB 3QJFB 5GGTH 2VC2H 5HHNA 5D7IB 3EYVB 1G7MA 1BD2E 3F65A 5TE6H 1ZT4B 5H8DA 3O2VH 4L3AA 4EJ1C 2EECA 1N5AA 1AXSA 4L4VA 4DOHB 1DBJL 1H8OA 3PWJA 3IVKB 2A9ML 5HI5D 4R7NA 3BZEA 5CHNB 1BMGA 2CJUL 2X1XR 4QTIH 2VLJA 2Q20A 3JWOC 4L8SB 3DRQB 2HVKB 1RZFL 1I9RL 5I1DB 4LPUA 1AGCB 4IOSD 5E08L 3KPMA 3EGSA 3IDXH 2WM0A 3LZFL 3O9WD 2ZG3A 2LTQC 1V3MA 5KSVA 2YPVH 1VPOL 2DTMH 3QDJD 3PXJA 2XKUA 4Z0XB 3TVMD 3HNSH 3MV01 5L0QB 4HUVA 1LILA 1ORQB 1YEGL 3PIQA 5C0AB 4K3EH 2D9CA 3DETD 1I1RA 3QXWA 1NGWA 1I9IH 4DUVA 5BQ7A 1GHFH 4NZRL 5C3TA 4CVZB 5KAQG 4CGTA 1U91A 1FFOA 3TIDB 3L6FA 4KWUA 1VFBA 2CKNA 2HJLA 3HNVH 5I1HL 1A64A 3KYAA 4PJBA 5I2IB 3D3VD 1H3PL 5TPWL 5CP3H 1J18A 4WENB 4TSAL 1DLHA 3GKWL 5BVJB 5BV7C 3TJHD 4WFED 4PTTA 1JYXA 4LSUL 1SY6H 4L8DA 1G9NL 3DUUB 3TNNA 3CMOL 3MFGB 5I17A 2CDGB 5EO1A 3TCLB 4WUKH 2G5BB 1KCLA 3MRCA 4L3CB 1NAMB 5JORB 5IQ7H 3RU8L 3WE6A 2CUIA 2JCCF 2VLKD 3F7PC 3QDAA 4MB3A 1NCWL 3V8OA 4KVNL 2EYRA 5GGVL 4X6DF 5T1KB 3JTSA 3C9NA 1IAKA 1FLRH 3BSZH 4PRPD 3P30H 2QL1A 3V0AC 4G6KH 4K9EL 3FT3B 5CILH 2NZ9D 3ZTNL 1F6LL 4XVUD 2BSTA 5E94A 2FJFB 5LAXB 1NCCL 4X6CB 1S7RA 1KG0A 4DUXA 4PLOB 1HDMA 4Y2DA 5DEFA 3HZKB 1AGFB 3CDGA 3LKPA 4LEXH 2XZQL 4OM1L 1ZTXL 4LRIC 1N7MH 2XN9E 3QUXB 3LH2L 3RX7A 5DHYB 4NQVA 4LSRL 4ZO8A 5I18L 4XAKD 1U2CA 4MCYA 5ALCH 1B0WA 4J2XA 3N1PC 3KWWB 4F8TA 1XF3B 5JHLL 5LWYH 5IJVB 2I9TB 4FFYH 4TSBL 5T5FH 4UMGA 1E4WH 1IEHA 2VWEC 1U8HB 3MODL 5E9DA 3VFRB 3WHXB 1K8IA 4XMPL 4NUGL 5DUML 2IF7A 2VLLB 4OCXL 1RHHA 1R3JB 4XPGL 1A3LL 1RPQA 3C6LD 5EOQH 3V4PH 4Y4HC 5JHDD 4XPBL 3GMNB 3L3KA 3HR5B 4GH7B 4POZC 1OT1A 4QRSA 3CDCA 5EC2A 4OLZH 2W65B 4ZYKB 1UZ8B 4EQ3A 1QR4A 5CJQL 3CSBA 2F74A 3GMPB 1WZ1L 3RL1B 3E2HB 4R4BA 3MOAH 1KF9B 4KRLB 4UTAH 5JDSB 2VXTH 5DK2B 4H1LH 4XX1E 4D3CH 1A1MA 4ENED 1FZKB 1BEYL 4M48L 4NYLA 3IKCB 4G8GB 1T0NB 3BPCA 1D6VH 5FUZH 5CBEB 6FABL 5DD3L 3MV8D 1I9JL 3RWFA 9CGTA 4N5EC 4PYHA 4FQXD 4XRCB 4FXLA 2Z93B 1TJIL 3UEZA 1FL6B 3K74B 4LPTA 1J0ZA 3MJ8B 4E9LA 2HFTA 1X4ZA 1C12A 4Y8DC 2DMCA 5D70H 5JW5A 3TZVC 3F7QA 3ARXA 3BPLC 1WBXA 2RJMA 3FMGL 5EIVA 1M6OA 2R1WA 3QXTA 1L7IH 4GOSA 3RTQB 3QNZA 5E00B 3KPTA 3AS1A 4ZOEA 4NWUL 5C8JB 1CR9L 3KHQA 4LSSH 4NP4H 3P2TA 4PRHB 2YN5A 2AJUL 2B4CL 4OKDA 4XTRC 5E8PA 2BNQA 4LMQI 5D1ZA 3HLAB 1F4WH 3V4UH 3AM8C 5HGAB 1J1XH 4BH7B 1MJUL 4NO0A 5GS2H 1PY9A 4NHUB 1OTTC 1CDYA 4UDUB 5I1GH 1KB9J 3NABH 5J9PA 3MACH 3LIZH 1F4AA 1NGXA 5BXFA 1W72B 3SKUD 4J23A 2H1PL 1Q1JH 5GIRB 3QG6A 4LU5L 5HHVH 1P9MA 3INUL 4LIQH 2AJSL 1IQWH 4K3GA 2X4NA 4XVJH 1V8HA 1UB5A 3EYQD 4R26H 5JMRA 5IIEB 5H35A 5CZKA 4P2CG 4ZAKB 2AXFB 1RVFH 3UTPD 2R29H 1AFVL 1Y6MR 3EOTH 1RI8A 3GHBL 2D03L 4NRZA 4LHJB 3ZDZE 2H26A 1JNLH 1LGVA 5CP7B 5EN2A 4WW2B 4YHLL 2L4OA 4YWGH 2G75B 1LD9B 4HDIB 4HIJB 3MCKB 2APBA 3SKOA 1JNHB 1UFUA 5E4EB 4ZNEA 3RAJH 1FFRA 5T3XE 4RAVA 4U1GC 4JQXC 4QT5A 3RWGB 3JV6A 5CMAB 4UOW1 1JUFA 1C16B 3W5MA 3JWOH 4J3OC 2APXA 4LDEB 1AP2A 5HYJA 4JVUA 3L3GA 3KNBA 3LHPH 1JWMB 4LVHB 3BP5B 4BZ1H 3WFHA 1N6QH 4NM8H 1ZGLP 1KFAH 1MEXL 1LNUB 3RVXD 4ETQB 4N0FA 4PJXA 1TZHB 5JNYB 1C5CL 3HTLX 1ND0B 3OKNA 5HPOA 3I6KA 4UQ2B 5MHSD 5DT1L 2PTTB 4KXZH 4R8WL 3WN5A 2J8HA 2G60H 4QHNA 3N9GL 2XZCH 2PCPB 2IAMD 3C09B 4JFZL 5ILTH 4C56B 5ICZA 2HFGH 2YEZB 3EYUH 3VXMD 2GUOA 4EDWL 3MLZL 2F58H 1AIFB 4QRPD 2IANB 3W0WE 2E6QA 2F54B 5CD5C 3WNLA 3BFOA 4R9HA 5BV7H 5HHXH 1K4CB 5KVDH 4ONHA 1ITCA 4P23D 3FO1B 2PYFA 1PKQB 4P2OB 4V1DD 3MROA 3VXOA 1ZSDA 2F8XC 3LRSB 5I8KL 3IU4L 1FGNH 1DL7L 4OZIF 4OSUH 1BHGA 1JI2A 2R69H 5DI8A 3BDYH 1UWEL 1I7TA 1BIHA 5C0JB 4PJEE 2VXVL 3M17A 3WD5L 3RI5F 3VDBA 3SDCB 3CX2A 4TN9A 1HHHB 2NY3B 2VOTA 2JJWA 1AGDA 5JIKA 3HPLA 2NY6C 1S7VA 3RGHA 4WUUB 1JGUH 2Z91B 5KANI 4WWKC 3P77A 2F19H 4UNUA 3T0DA 4JCMA 1SJEB 4N8VA 4N0YL 4JY5L 5LXGL 2N7AA 3TO2A 1UQSA 4ZFGH 2BRQA 3BIBX 1PFCA 1FZOB 1JGLH 2O5ZH 1MOEA 2DYPA 1QSEB 3VFWA 3UC0H 5AYUH 3V6FB 4S0TD 5IB1A 4YHPA 2DOCA 1QNZL 4KJYA 4JDVB 3DRTA 2VLRE 1X7QA 4HC1L 3QAZB 3SE9L 1UXWB 2AKRB 4OZ4B 4XX1G 1A1OA 2BOCA 3P9LA 4FRWA 5GJTL 1FYTA 5IVXA 3PP4H 2QSCL 4OUUA 3ULUE 4YZFF 5INCB 4PRDA 1HH9B 2DQEL 1AO7B 1BPVA 3U82B 1ZT1A 2YK1L 2V7NA 4LCIH 4UV4H 3CFKA 3LD8B 4J7RA 4NCC2 3T8XA 2KZ1B 2YOCA 4S1DC 2Q76A 4XBPA 3QI9A 5DSCB 1TETL 3EDDA 4YHIA 5IESH 1C1EH 3L9RA 3NGBB 2CSPA 4Z76B 5IHZA 2HTKD 3MXVL 2GJZA 1GGUA 3F58L 2FNBA 1VFAB 1NEZA 4BFGA 3K1KC 4PRBB 1R3IL 3EZ8A 1SM3H 3JV4B 3U9UB 1BZ7B 4HV8A 4I2XB 5SWZA 2J1KA 5T5NG 4Y19B 1NL0L 3O3UN 3RL2B 2F8VA 2XXCB 3ROLB 4KTEH 3B9AA 3HC0B 1DFBH 1I3GL 1YPZA 1MI5E 1MY5A 1QSFB 3TBVA 4GW5A 4JANA 2H41A 3RWCA 3HI5H 2X4PA 5HYQA 4ZUVA 5AEAA 3UTQA 3ARGB 4PB9L 3GUTB 3QJHB 3ARBD 2WP3T 4DAGL 3GFUA 4KDVA 4XCCH 1PLGH 4P9MH 4ZUSA 4NHCH 1YYLH 4HKBB 3FB5A 2FIKB 1J10A 3W39A 3BH8A 3L3HA 2FD6L 3LOWA 1P4LA 3I50H 1BX2A 4LEOB 1OAQL 5CEZH 4I18C 1KCSL 1LDPH 3LKNB 4X98B 1IGJB 5FYKH 3PWNB 4QOKA 3MRRB 1V7MH 1S7UB 1EO8H 1AD9A 5D1XD 2ATPB 3PGDA 4RWYH 4Y4FA 1IEBB 1ULVA 2QSQA 2GSIA 5CZXC 4PS4H 3WNOA 3O8XD 4TTDC 5HD8C 1S8DB 1L9MA 3BH9B 4W6XB 4BQ6A 5DWUL 1FAIL 5DRZB 1Q9KB 4Y4KB 4NZUL 1WWWX 1MRDL 4GBXD 3CD4A 3D2UA 1HWHB 3SKNA 5C09E 4H26A 5EZOH 4L8CA 1QOKA 4K3DL 1P7HL 3Q1SH 4OKVB 2HWZL 3TBYA 5CUSH 5CCKL 5IB3A 5CWSA 5E6ZA 3P9MB 2A6DA 5A2FA 2EDRA 1FZJB 5DJXA 4LGPB 4OFDA 2YD4A 2Y07H 4ZOBA 1J8HB 5I66A 1EEQA 4KAQH 4NO3A 2RAMA 1MWAH 3SDYL 4JG0H 4AEEA 1MCQA 2GITA 1BD2D 1G6RH 3OAUL 3X3FH 1HCVA 3KJ6H 3ES6B 3H7LA 3C60B 5FA4A 2XWBB 1KB5L 4OV5B 2WWKT 4FQCL 2P44B 3W82A 1RZKC 3QDHA 2FGZA 3O2DL 2EIBA 3W9DB 4JZJB 5HHPA 5C0BD 5JQ6L 5C3LD 1S7SB 2OM5A 3S35H 3CXDH 1T80A 4OZFA 4R2GD 5SX5H 5T3ZH 5A2IH 4HZLA 3VXUA 3T1FA 1KN4H 4LGRB 5BJTB 4DEPB 4X7FC 2WBJD 1T3FB 3BQUD 5M94B 5IMOA 4NZJA 4XAWL 3MBEB 3H2WA 2EDEA 1UA6L 2BVTA 4LIQE 3OPZL 1KPUB 1UWGL 3FQWA 3K8KA 4M7LH 2VDNH 3CSPA 2RFXB 4BSWA 5HDBF 4AH2A 1I8KB 1CBVH 4R0LC 1OM3L 4ONGL 1ZANH 3CK0H 3LEVH 5EO9B 1KC5L 4ODWA 2BVOA 5ISZB 4XC3L 5EU6B 3QNYA 5EFIB 3F5WA 2WP3O 3VFUA 4ZSOE 1NC2A 5LKNA 4TUOA 3ABZA 3S88L 2EXWC 2OCFD 5GSVA 2N56A 4X83A 3FQNA 3VD4A 4K3HA 4CKVX 3VFNA 4JAMA 4LCUA 3MGTB 1X5HA 4OCRL 5B38B 3UBXG 4L4VE 2CIKA 3DV4A 4O2FA 4M6OL 2DQJL 4PJIB 4M61A 5DO2C 1FNEA 1DQQA 4BH8B 1D9KC 2NTSP 2VLJE 2DQIH 1BVKA 4PJ9D 3MREB 2R23B 5KSUB 4LP4A 4JREC 3SPVB 1XH3B 1J5OL 4DVRH 2CDFA 4LSPH 3OKOB 4DQOL 1BVLA 2A6KB 2XRAH 5FEBA 2DMKA 2BHUA 2A74A 2BNRA 2ERJC 3W5NA 5BMFH 2P8MA 1EJOL 2IH3A 3MR9B 3NH7L 4MNGE 1UKTA 4L3EA 4JFEB 4IHOB 4XNXL 3TWCL 1MLBA 1U58A 3SCMC 1BJ1H 4Y1AA 4P4KB 4PJHA 5ICYA 1IGFH 5GS1B 5K9QG 2A2QT 4B7LA 4HGKC 2OJZH 4IOFC 5F1SA 5AWNL 2XN9D 4OZHA 4PJBE 4P59H 4BUHA 3EKCA 1T1WA 3U36B 4NKDA 4U0QB 4OGYH 3C08H 4HC1A 4N0UE 3QDGA 3EUUA 5KAQF 3D85B 1CLOH 4F15B 1RZGB 3MLWH 1DZBA 1YQVH 2VSCA 4OIIL 5C9KA 2Y7QB 5I71B 2ZUQB 3MRDA 1UM6H 3DXAB 3QWRD 2SEBA 3VE0B 1QR1B 4BK5A 3VFMB 5IWLC 3MRQA 5HI4D 3MJGX 3QPQC 2WWKO 2NY0B 3SHSA 2OTWB 1OB1B 3MV7E 5EU4B 3A67L 1VFMA 3FOLA 1WTGT 4PJ5B 5HDQL 2OR8A 1FO0L 4R4NC 3RDTA 3RIAF 5I19L 3WXVH 2VSDA 2ZCHH 2P1YA 5EU3B 1KEMH 32C2A 3IS0X 4OTXL 2D9QB 3DV6A 2F8OA 3RKDC 2VISA 1ZLSL 2ESVE 1MCIA 1A3RL 1IBGL 4IMLA 3FZUD 4PG2C 5DD0L 5DZOA 3WDIA 4MSWB 1E6OH 3QUYD 4NT6B 5IT2H 1U8KB 1CICA 1T1YB 5DXWA 3SN6N 4JHBA 4Q9QL 3KPNB 2WSKA 1F58L 2OZ4H 1W0YT 3R1GL 3RX5A 1G6VK 4PLKD 1S3KL 4MAYA 1A9BA 5JXEA 4APQD 3LEXB 5MENA 1EZVY 1MCCA 4NRXB 4X7CC 5I1IH 1A6ZA 2R8SL 4P5KB 2FR4A 3H9SE 3MBXL 1XCTA 4I77L 4M02A 5DEZA 4WY7H 1SMOA 4HIHB 3VRJA 5FM4A 1F6FB 4H1LG 3PDOB 4HAGA 3MXWL 4KJPD 5EUOA 1ONQA 5E9DE 4NC2B 3S36H 4CW1B 2DM2A 4ODBD 4XPAL 1U42A 3H3PL 2GAZB 1T22A 2G2RA 4IS6B 1EA9C 5C0EB 1XF2A 4JRYB 4DCQB 3DURA 2AI0H 5JUEH 4PLJC 1F6AA 2JLLA 3CX5K 5FUOL 5ITFB 4RGOH 4Y5XC 1HEZB 1MCPH 4U1HB 5D1QB 1GGTA 5F96H 3QIWD 2Z9TA 5IBUB 1SBBA 2VDLL 4Z7WB 1ZGLB 4Z78A 1BFVH 5D8JL 1T5XA 2AK4B 3T3ME 2W07A 3GIZH 1ZHNA 1HOCA 1FC1A 5I30L 4JM2D 5DVLA 3RNQA 1A02N 1QACA 1NBYB 3EYFA 5KS9B 1O0VA 4GRLD 4O9HL 3FO0H 1J05A 1UYWH 3SE3C 2DAVA 5IGXL 1OAXH 3HE6B 1HHGB 3ARPA 2VR5A 2DI9A 1H3UA 4YHYB 4H5SA 4HK0A 4MWFA 4U3XA 3RUGA 1RUQH 4Z7VF 3O2WH 4RFNB 5E03A 4JFFE 3DECA 5D2LF 1JGVH 4OFVA 2BY2A 3SDAA 3S96B 1EEYB 3KPSE 4XP9L 3QG7H 2XOTA 3QFJB 4E42B 1GJIA 2CDEA 3O3EA 1MFBH 1RJLB 4N9GB 3NCJH 4YO0B 4FMKA 4NQEB 5DZNA 2HN7A 5HHME 3UAJC 1HK6A 2P4AB 2R2BA 4PJAF 2HVJA 3D0VB 5C0ND 3SDXA 4HGMA 4YR6B 1KB5A 5T3XD 5D2NB 1INDL 4JJ5A 2BNQE 1Y6NR 1CQYA 1IC7L 4NQDE 1RZKH 4YXHL 3JTTA 3RWJA 4K94L 1MREH 5FYKE 3V5KA 4AEFA 15C8L 4GO6B 3ZKXB 1IC5L 3KXFE 1K6QL 2I27N 2XWJA 5DYOA 5FGCB 1V3KA 5E6ID 2YZ1A 5HXMA 1TCRB 1ZT4A 2L0DA 4DWHA 4RMQA 1DUZA 1NDGA 4TSCH 3HI1A 5F9JB 4KV5F 3CFJA 3UJTH 1EXUA 2ICWB 4KK9D 3TBTB 5J06A 2CIIA 4N0RA 4BM7A 4L8SC 4M93B 1P7QD 4MQXD 3QZWB 4HJJL 1HHKB 2FZ3B 3NFSH 5DHVB 1JZ3A 2ZSWA 4GUPB 3CXHK 1CGTA 4G43A 5D7JD 4CNIB 5L0QC 4PJGB 4Q74A 3ZL4L 4YXKL 2P5WA 4JO2H 4Z0XA 4ZXBA 4K3JL 4ZODA 1ORQA 4KDTA 3BGAA 2Q3ZA 4PJ8B 2W9EL 1LDSA 5J6GB 1KLUA 3PNWB 3QIUB 5F93C 4Y8AA 1QQDB 1G7QB 3LEYH 3OXRB 5FYLL 1FGVH 5T1LA 4CVZA 5H94A 3HAEB 2P5EB 1JI1A 5F3HB 1YJDL 2LV4A 3FN0L 3JUZA 3SE4A 2V17H 1II4E 4YH6A 4RIRA 4YHZL 5I2IA 1N4XH 3QCTH 2QQKL 3MUGA 3EO9L 4NRYB 4D0CA 3BO8A 1OY3B 5E5MA 4U1LB 4ZTOH 4U0RB 5H2BB 2E6JA 3MLYL 3G5YA 3T65B 3IAGC 2BOBA 1KIRB 3MRHA 5T3ZE 4XMKL 3O4LA 3TA3A 1RUPH 5EDXA 4QHKI 2UZYB 3FL7A 1U3HA 5ERWA 4MD0A 1WBZA 4JN1H 4I4WB 4AEHH 1IM9D 3PQYE 1AE6L 1KIPB 4CU8A 3AGVA 5KOMC 4RMUA 1OW0A 4NNYB 5ICXB 3CVHH 3AAZB 1MAML 3WIIH 3DGGA 2CK2A 1DEEA 3LN4B 3NOIA 1HIML 5DURD 5GGQH 1CQKA 1DQTA 4LHUB 1MIML 3PE9A 4ZD3H 4TOYH 1A3QA 4GAGL 4DKFH 4HWUA 3ZSTA 3NCMA 4YDKH 5BRZB 5GGSB 2VLRD 3MLTA 4RFEB 5T1MA 3V79C 2GTZA 5LQBL 5SWSA 1QLFB 5L88L 3QUXC 1JPFA 1SBSL 4ERSH 5HY9B 5C2UB 4XVTH 3VI3E 5K33A 3ULUD 2QADC 2PKDA 3QUZB 3PL6D 4G6AD 2BDNL 3HMXH 1WAAE 2DLFH 5KSBB 2HJFB 4NZTL 1KBGH 3VFVB 2YN3A 3OAZH 3HB3C 3B6SA 4DVBB 4KJWD 3B8SA 1CFTA 1CXLA 1AY1L 2YXFA 1H9VA 1FO0A 5EWIL 1R3HA 3CUPB 1MQKL 1IKNA 3NZ8B 4HMCA 1I1YA 1G7HB 1EH9A 4O02H 3SEPA 2A6IA 2JB6A 5ACZA 5DS8A 1HH6B 1MCJA 4K07A 1AXTH 1NMBL 4K2UH 4UINH 3MA7B 1M7DB 1YEFL 4QXTB 4TUKL 1DUYA 2GJJA 4DKEL 3WUWB 1KTLA 5JW3H 2PXYD 3RBGA 2H3NB 4ORGA 1YMHB 3LKQB 3E2HC 4WHTB 2UYLB 4ZYKA 3DX8A 1UZ8A 5D5MB 2AJXL 3QEUB 4F7MA 4QYOA 2ZKHH 3QUMH 3DMMB 4X99A 4BQ8A 1P5VA 2WIIB 5D7LA 5HGBA 5F9OL 1LEGB 3EHBD 1S9YA 4ELME 3HE7D 5FKPB 3IETB 3DBXA 3RWHB 1FYTE 2NPLX 4ESKA 3WIHL 1KEGL 1L0YA 3I75B 3LV3A 1MFNA 2X4SB 5FB8B 1J0KA 4AMKH 1CN4A 3BN3B 4A2MA 2MSPA 4RMRA 2FH6A 4QCIB 1IGIH 3AU1A 1B0GB 1F3JB 1EVUA 2ZCLL 1U8PA 3PHOB 3S37H 4XP5H 4EN3D 1WK0A 1DQMH 4JR9H 4P4RB 3QXUA 5DFVD 1J0IA 2X4OB 3RTQC 2R4SL 4J4PD 2X4QA 1T1XB 1TCMA 3MRGB 3WLWD 5SWZE 3KPRD 5FGBC 4RAUA 3K81A 1HZHL 2ICEA 2E7MA 3OR6A 3MV9B 4S2SA 4N68A 4P2YA 5IMLA 1MFEL 3O11A 5DUBB 2E5EA 3GMMB 3FRPA 5EOCH 1YPZE 2E7HA 1UXSA 4EZMA 5DMKB 4HQQH 2MCPL 3U0WL 3JBG7 2XZZA 2X4TB 5HGAA 5C09D 4BH7A 1EEUA 5DRNA 2A38A 1MHCB 4IIQA 1CXEA 1YEDA 1B3JA 3ETBF 3LN5A 3RVVD 1X9QA 3EDKA 1KCRL 2IQ9H 3M8OL 5T5NF 2E8YA 1MNUL 2VXSH 2E27H 1X5IA 3RGVD 2VDOL 5DJAA 5I1LB 2CKBH 5CKAA 2VDQL 5ESQA 5CJOL 1BWMA 1NCDL 2L7UA 4ZAKC 2O5YL 4JM2F 2B2XL 3HZMA 3PG2A 2CPCA 3CJJA 1PSKH 5DC0A 1BZ9B 3QEHB 5FO9B 4QF1B 4WW2C 5FO7B 3ALWA 2NY5H 4GXUN 35C8L 4Z8FL 5D7KE 3TM6A 5E4EC 4S10A 4XI5C 2G75A 2IADA 3WFDH 4YFEA 1LD9A 3Q6GL 1HHJA 3QCUH 5GS2D 4FZ8H 3CCHB 2HKFL 5CGYC 3ZDZF 4F7TB 5DJZB 3O6FB 3RVTC 3B9KB 4CU6A 4JO1H 3G5XB 5IHLB 2VTFA 4G7YL 3DUSA 3TC9A 3ARFB 1RUML 3QHFH 3GO1H 3ZLQC 2YR3A 4LVHC 5DQDH 1ORSB 4NIKB 4N9OB 3DHMA 3I9GL 5SX4I 3KPLB 4ZDHB 1CI5A 2XKNB 3EFDL 1JWMA 1LO2L 2ARJQ 3QFDA 2D7QA 4ODVL 5E7FA 1HSAA 3H42L 1CZ8L 4ZTPL 4FHBD 1LNUA 5JMOC 1CL7H 4ETQA 2EE6A 2R0ZL 4JKKA 5FCSH 5DMIH 1ZHKB 4Q9RH 1URLA 1M71A 4GG6A 1RMFH 3FT4A 3TJEL 4F37K 5ITBH 3C09C 1NGQH 4PRAB 1EAPB 5TGBB 4Z7UB 2ITDB 4HS8L 2EO9A 4L4VD 2QQLL 1JHKH 4FP8H 1UG9A 2X5PA 3AXLB 2VLJD 1I8LC 4OBRA 1B90A 4X6DA 5DJ6B 4E41E 1RULH 5HHOB 5EU7C 3EIFA 2F54A 2AEPH 1E4XH 1ZA6A 1OT2A 4DZBB 1K4CA 2Y6SC 4LAQL 2ADIB 4P2OC 3PGCA 4FQ1H 3VXUE 3SOBL 4X5LA 4BKLB 1XGQB 1ZLUK 1U8QA 2Y5TB 1PKQA 2YKLL 4NUJB 5IFAL 1NAMH 4JFQA 5GGUB 1T4KB 1A7QL 4OLWH 4NN5B 3MGOB 3PWPA 4MD5A 1FFPA 1WC7B 4TQEL 3SDCC 2NY3C 2HLAA 1OP3H 5CINH 3LQZB 1WTLA 3UDWA 3UJIL 4QRRA 1F02I 3BEWB 3WL9A 2FO4B 2A0LD 3VDCA 2LAAA 5BZDA 4OF5A 3G08A 4U1JA 5EZLB 5TFSL 4WCYH 5EBGA 1PJ9A 3D39A 5ABDE 4N8VG 4X8JA 2J4WH 3S34L 4PJEF 2BRRL 4MA3B 5GRZA 3WFEL 3K4ZA 1GGBL 1A6TB 1PW3A 2P43B 2MKWA 5MEPB 4M1DL 1EDQA 3UTTE 2W38A 3NZHH 1QSEA 2CLVA 4U3HA 2AABH 3QCVH 3QAZC 2Y06H 5DC4B 5TDOA 3RKPA 4HG4K 2AERT 4JZNA 3IU3A 4LARH 1INQB 4P9HL 4Q6IB 2QEJA 3FQUB 3VG0L 4AM0A 4MJIA 2BY1A 3R8QA 1NCAL 1SEQL 2HLFC 1QBLL 4LQFL 3GJFA 2I07A 3EFFB 4H8WL 1JNNL 4TPRH 1LHZA 5INCA 1N6VA 3LD8C 4ALAH 4EOWL 1AO7A 2B1AL 3C2AL 2NY2D 4NO2A 1JHLL 4WNQB 1T2QL 1TTFA 2HT3D 1OAZL 2ESVD 2IPTL 4F58L 4Y1AE 2O61A 3PHQA 3EDJA 3NGBC 4DFHA 4Y2DD 5DVKA 3ULUF 1DLFH 4NQXB 2Q8AH 3VMPA 1YDPB 5F7EL 5AZ2L 3MOBH 1XGRB 1L0XA 2BXZA 2DKMA 4EBQH 4G80B 1MHHA 1CE6B 1IT9L 5A40E 2PW2B 1FG2A 3QDGE 3V7MA 3MRBB 1BECA 1SVZA 5JPNA 1C5DA 3RVUD 2GYSA 2ZUSA 3C5ZB 3GSVA 3H9SD 3JV4A 3IFLH 3WIHA 4LRNL 5D9SA 4FG6D 4NQSB 4FQLL 2FJHB 1MHEA 1W8OA 3NAAH 2F5AL 1BM3L 2IEPA 1X6LA 5E9DD 5FUCE 2V7HB 3P4OB 1GOHA 4MCZA 2HTLC 4ZS7L 4Z77A 3ARGC 4OZGB 3IFNH 1VADB 5FYJH 3U0TA 3TESA 3QIBB 2IH1B 3VRIB 2X40A 4HXBL 1S9XB 3O45B 2BHYA 4K23L 5DDHA 4UILH 4Y4HD 1D5BB 2PO6A 3RZCB 2VL5B 3JVGA 4A2LA 5HYSB 2FJGA 4O5LL 5BZWA 4HIXH 4HKBA 5F97E 4LKXA 3Q6FA 1EIBA 4JFPA 4YGVA 3BD5A 3C5JB 1OSZA 2JCCB 1DDHB 1OQOA 1W0WB 2FHCA 4X98A 3OB8A 4R90L 1M05A 4FQJH 3PWNA 3EOAB 1TVBB 1PEZA 1T1ZA 3CZJA 4WV1A 4FFZL 2ATPA 1KIQA 4S1RL 1IEBA 3MCLH 4R96B 1ERNA 1SMAA 4Y4KC 3BT2H 4YEEA 4JFFD 4UT6L 3RNKA 1UM5L 1BOYA 2Z0BA 4LNVA 1OWRM 1ROWA 2XV6B 1K85A 3KPSD 3OXSA 3VJ6A 4D9LH 2J88H 3NFPA 4KQ4L 3WFBH 4P5TB 3MQIA 5HHMD 4OKVA 1PYWB 4Z5RA 3LPGA 4NKQB 5KVFH 4YHNB 2O26U 5GRVK 3VXSE 1NBVL 3EDFA 1F11B 2BNQD 4NQDD 3ILQD 1G7JB 1TJGH 1KPVA 4IM8A 5F7YC 3REVA 5FYKD 3QXAB 4NO0D 4LLVB 4WW1B 4HULB 4U7KA 2BMKB 1B4JL 1U95B 4MMXC 4WU7B 5A16B 1BREA 1RIUL 3C60C 5I1AB 1Y6KR 4WO4B 3V7AE 3UBXI 1L7TH 4UT7H 2DWDB 2DLTA 2XWBA 4F7PB 4KK5C 4QXGL 3D25B 1JRHL 1NUNB 4JZJC 5TF1L 3TT1L 1YYML 1JNJA 5SWQB 1UCBH 5GHWL 2IPKB 2C3WA 5GRJH 4MA8L 3HNTH 4ZQKB 5B8CB 1FL5A 4MJ2A 2H2SD 3V5DA 4U1KB 1VEMA 5DEGA 3GSRA 4AY0A 2CRYA 5M7QA 3QO1B 3VFGL 4DEPC 4C54A 2J8OA 3VCLB 1KACB 1GGIH 4FQQA 5DMYA 3IGAA 4JFYA 3MBEC 2VDRH 1AGBA 5AG8A 1P1ZA 2QTEA 3TO4B 4LCWE 1UEYA 1UJ3A 4DTGH 1B88A 3MFFB 1G7PA 3QDJA 1E0OB 2J8UB 3L3OB 3TVMA 1VACB 5TH2A 5T33L 2CMRH 5ACMA 1GAFH 4YHKL 5C0IA 1Y18A 3HUJB 3W9EA 4JEGB 4PBWD 4NCDA 3QEQB 3VGDA 3CFDA 4HX1B 5EO9A 5D4QA 1NQBA 2HFFB 5D93B 1SQ2N 3NIDE 1ZVYA 5C6WH 4OBSA 4U6VL 1CXKA 5D7IE 4G3YL 2FX9H 5L8KB 1RIVL 2BC4A 3DO7B 1EGJH 3IXAB 1QPXA 4HUMB 4MJ6B 1C7SA 3OB0H 4XCEB 4DOHE 1CXHA 3LKSA 1UVQB 1B9ZA 1CFSB 3RA7H 3P3YA 3Q3GA 5J56B 5E70A 2X9WA 1DQJB 1A21A 3CVIL 2OLDA 1U93B 4GQ9H 4MQ7A 1LMKA 3SPVA 1AR2A 1XH3A 3GI8H 3TYFB 4LNRB 3PQYD 2A6KA 4JFDB 1R3KB 3MRLB 3T0VA 2DI7A 4EIZC 3OV6A 2VLKA 4QRQA 4XZUB 4X7SH 5FXCH 3FCTA 1HQ4B 4WFGE 2CUHA 5KW9L 3ZHDA 2DBLL 1H5BB 3ARSA 4MXQC 3ECBB 2NW2A 4FXKA 4Y7MA 2JJSC 3U7YH 4U1IB 4NKIH 5I16A 3M1BB 5ID0B 5GS1C 4ZMAT 2OL3B 4P4KA 1YQ2A 5L9DH 4F80A 5GS1A 2ITCB 4NN7B 1CFVL 1NMCB 1DQLL 2WWMD 1LO0H 3MLUL 1ES0B 3GB7B 3D5OF 4Y5YB 4JPVL 3B5TA 3J8F7 2VE6A 4F15C 1YNKL 2GCYA 5F72S 3V0VA 3BYYA 4U6HA 2WBKA 4X6EA 5I71C 5GZNC 2ZUQC 4XNQB 3DX6A 4PD4J 3SBWA 1E4XI 3G04B 4PJBF 1BOGA 3L5XL 5GPRA 2NY0C 1EPFA 2C1OA 4Y89A 3VFMA 3B3IA 2BFVH 3AMLA 1K8DA 3BUYB 1IZJA 3TF7C 4GAJL 4JQVA 1KNOA 2NY6D 3NVQA 1OAKH 3WHE0 5IB4B 5EU4A 5HSFA 4U6XA 1WBYB 3FN3A 3AS3A 4LSQL 3ALPA 5FV1L 2DYPD 2WNGA 4LAJH 5C08B 2DM7A 4X9GA 5JHDA 2ZJSL 2JB5L 1J1PL 3I02B 1N5YL 3CLEH 4EDXB 2A9MH 1GC1C 3LB6C 5EA0L 4F7CB 5IOPB 5SWSE 5C7XH 2YC1A 4X6CE 4YLQT 5C0DA 1FYTD 4IRJB 1RZFH 4H25B 2QSTA 4KK8C 1YEIL 5E08H 1TTUA 1JPGA 1U8MB 1JZ5A 25C8L 4AT6B 2R0KL 2DQHH 1VPOH 4G42A 3VGGA 4JY4B 3BZFA 5IW1A 4YE4H 3V6ZB 3SDDB 4YDJB 3VGAB 2C3VA 2A73B 4UAOB 1QRKA 3MV8A 3QI9D 4GQPH 4N1CA 4LOUD 2R2HB 3O9WB 1INEH 4PGCB 2Q87A 5E2UL 4FQXA 4XWGL 2Z8WC 1IL1A 1M7IA 4CL7A 4RMVA 2HH0L 5C0GB 1T21B 1WGOA 3NTCL 1I75A 1E6JH 5KTEH 1F3DJ 2GAZA 1EHLL 4G6FD 2FEEI 3S98A 4JRYA 3UPCA 2ZOLA 3MNWB 5SWZD 5AD0A 2PW1A 3D9AH 1CFNB 3X13B 5FAAA 2EDDA 5D1QC 4WU5A 2UWEB 2BCKB 1HEZA 1U8JA 3O0RH 4ZUTB 1N26A 1LK3H 3VWKB 3GSXB 1AQKH 3D3VB 1JV5A 2R1YB 1N64H 2V5SA 2AK4A 1ED3B 1QFWI 5IBTL 4DN4H 1EX0A 3SE8L 4D2NA 1PKOA 3V7AG 4EI5B 2B1HL 1A4KB 4YDVA 2IPUK 3HE6C 4L1HA 4M7LT 1GGCH 3K7UA 4CRPA 4KROB 4G7VL 3C2SA 3AREA 3QDMA 4FNLL 4YHYC 4G8GE 5F7FA 4NPYB 3M45A 5L6YL 3SGDH 2DI8A 4JGJA 5I15L 4LBEA 1KTKE 3T3MF 4RFNC 4U7MA 1SYSB 4K8RC 4K9EH 3E6FB 2DRUA 5DD1H 5EO0A 3STZB 3ZTNH 5FYJE 3UTOA 4RISL 4GRWH 3U48A 4G9FA 4PJCB 1RURL 4JRWA 3GRWH 4QOKD 3WSQL 3VXNB 5E2TH 3OKEB 4KC3B 5J3HC 4PRPB 5EOTA 1A0QL 5D7KD 1T0PB 3S4SG 1B6DA 4YHMH 1YY8B 2GY5A 2CLZB 4D0BB 2FIRT 2BSRB 4YO0A 2R0WH 2W9DL 5D2NC 1CGSL 1K4DB 1SJHB 5JPMB 4P57A 3H6JA 4NJ9L 4JM4H 4O00A 1D5IH 1J9CT 5JR1H 4Q0XH 4PRHE 5HD8D 4TTDD 1ZEAH 3NA9H 3VA6A 2XXMB 1NC4B 3ZKXC 1HYSC 3HG1A 3D2UD 3T04D 3E8UL 4X0KB 1SEBB 4HPYL 2CGRH 2CUMA 2ZSVA 5EIIA 3MODH 3VA2C 3UZVB 1DBAH 4MQTB 4M93C 4XMPH 5F9JA 3MNZA 1XFPA 4NUGH 5J0BA 1VGKB 2BJML 1RZ8B 4OLVH 4XP1L 2GSGA 2OR9H 4TRPL 3D87B 1NGZB 4KTDH 4BQ9A 2YPLB 4MLSA 4B7IA 4G8IB 1NFIA 4JY6A 1JTOA 3IJSB 4PJ7A 4PGEA 2Q86A 2X1PA 5I8CB 4FABL 4PJGA 3CFBA 5IK3B 1RJYB 1G9MC 5MP6L 1WZ1H 3V6OC 4D0DA 4PJ8C 2DQDH 3C6LB 5FGRA 1T04B 4HJ0C 1CLYL 2A6JB 4X80H 3QIUC 1CD8A 1OPGH 2I5YH 4OFKA 4E41D 3SQOH 3BRFA 1OF2A 4CDHA 5LJYH 1ADQH 2MNUA 4I48B 4LLUB 4RQQA 1RIHH 4QRPA 2GFBB 3VXUD 5HPMB 2VRAA 4FXGB 3HAEA 4KK6C 5F3HA 1T20B 3IDGA 4HF5L 4LASL 3H7BB 3FO9A 3IDNA 4LSTL 3X3GH 1U8NA 4F9LC 5HVGB 1FRGL 4P23A 4U0RC 4LLWA 1MCOL 5DQJB 2PR4H 2VXQL 4ZFZB 4GXVL 5IEHB 4V1DA 4UI2A 1NANI 5E8OA 1RUAH 5H2BA 4P5MA 5F9AC 4HUWB 8CGTA 4X9IA 5CEYA 5DJDA 4IRZL 1KPRB 2R4RH 5BO1L 4Z18A 1A1NA 3RY6A 1CF8L 2Z35B 1RZ7L 3IDIB 5CEXB 1NC2D 3UTSB 4GG6E 3I3EA 2AJUH 4P3CL 2JELH 4I4WA 4GW4B 3U6RB 2EXWD 3WNPA 3BPOB 1FPTL 4NNYA 4YDIL 1HN1A 1XAUA 4NQCB 3L3JB 3FAWA 5I8OL 4YIQA 4C56E 2BX5A 3KPOB 4UQ3A 4G8EB 5L2KB 1J0JA 4S1SH 4KZEL 2IANE 2VUYA 5DJYB 5DO2D 4YX2L 5BRZA 2F54E 3PABB 2V2WB 3V4VL 2JJUA 2P46B 5F1IB 4L4JA 1WEJL 1EEZB 1W0VA 1NPUA 3VWJB 1NLDL 1Z2KA 1NAKL 5C92A 1R24A 3QUZC 4TNVF 5DFWH 1CFQA 1PKQE 4N0CC 4X5WA 5EC1B 2KDGA 3FFCB 2X70A 3LS4L 3BI9X 5ENWB 1HQRB 3E6HB 1CK0H 1RZJC 3EJJX 4XNYH 2JIXB 3G5VB 4NO5B 2NX5B 1ZA3B 2NNAB 2JK5A 5I76A 4L3ED 1KCVL 5KG9B 1T0MA 1MJJB 4Y1AD 1N8ZA 1QUNA 1ZLWK 3VI3F 4YHLH 1AR1C 3GSUA 4DVBA 1JZ6A 3LS5L 4ODUB 1MELA 1JGDA 3P4NB 1Z0NA 3BAEH 3P73A 3FT2B 3ILPA 4IOFD 3U2SB 1WAAF 2C4FT 4O4YL 3M07A 3L3DA 3DIFA 4HJGA 1EJ6A 3PXHA 5C1MB 1GC1H 3QDGD 3SGEI 1F13A 1JPST 4P46B 1PX3A 4J3XA 1L6XA 4DKDC 2IFFL 5KVEL 5EBWA 1HXYA 5DQ9A 2UZIL 3WUWA 3L7EB 4MJ5A 1QSEE 4G9DB 1A6AA 3DMMC 2AXHA 4PV9B 5D5MA 4QRUA 1I7UA 1FFQA 4FQPA 3DVGB 1D5XB 2WIIA 4X6FA 1LEGA 5FKPA 3CH1B 2V9QA 3WKML 1AD0B 4HFUH 2FLRT 5F71A 1CTNA 2X4SA 1ZVHA 1X5JA 1DR9A 2HT4C 1AO7E 4N8CL 4C57C 1HCFX 5GZOC 4R4ND 1I85C 2XWTB 3MRNB 4A6YB 1QLRB 4HH9B 5ANMB 2KQNA 2ADGA 4DGVH 4EDWH 4ELMF 4YAQA 2VR9A 4YQXH 1KLGA 4HWBL 2C7UB 1TITA 1FJ1B 1X5AA 1FE8H 3BWAB 3IDMA 3ULSB 4OV6F 1UH2A 2IAMB 3DVNB 4JHAL 2W60B 3MJ7A 5GRYA 1A6VL 4U7SA 3ZKNC 4FTVB 4Z7VA 4LF3B 1S7XB 3T4AA 5MEND 5D2LA 3O6LL 2WLYA 1EMTL 4WEBL 2JJTA 1ZHBB 2WUCL 3IU4H 3H9HA 1QA9A 1K5NB 2IQAB 5JW4N 4HW6A 4ODTL 2G9HA 5ADPL 2E7LC 5D1XA 1HKFA 1XR8A 5HGGS 4GXUM 4AG4H 4Y19E 4B5EA 5DTFB 1BAFL 1MFCL 2D7TH 1GZQB 4ONFL 3UO1H 4DZ8B 3GMMA 3O8XA 5TE4L 3T0EA 3AY4C 3I6GB 2VXVH 1YN7A 3WD5H 1J87A 3L95B 4DGIL 2OK0L 3ORJA 4B41A 1PG7W 4GBXA 4XCYB 3QT2A 2VYRE 4XP6L 5EU5B 1MFDL 2BVUA 3VXSD 1YPZF 4WIQA 4PLJD 2HJKA 5I1LA 4N0YH 4JY5H 2RR3A 5I8EB 4HKXB 3BP4B 5F3BA 2P7TA 2XKSA 1GOGA 5E7BA 1KELL 1KJVA 3GNML 5FF6A 4DW2H 4XXDA 1QPPA 3RWEA 1FBIL 1QNZH 2A77L 4NGHL 2P8PB 1T66D 3QEHA 4PPTA 1VGEL 1A5FH 5EZIL 5ID1A 3GBNH 3T0BA 3F62A 1HHIB 5IEKA 2QSCH 5LCVL 5T3XL 5JLZA 2O5XH 4MDIA 5B21A 1KJ2L 5CJ8A 2YK1H 4CDGC 1HINL 2EYTB 3N06B 5FO8A 5LVEA 1KTDA 3SO5A 3O6FC 3B9KC 4KJQD 1CT8B 3R0MA 1RJZA 1J86A 3CFCL 2OJEB 3ARFC 4QXUL 4F7TA 4LCWD 5DJZA 3SDAD 5DHVH 3GSWB 1TETH 1T6VN 3U46B 1OP3K 1R0AL 4MXVE 4E5XA 4PRIA 5E2VH 1JFQL 3EOBB 1OOAA 4K7PY 5EPMA 1MCWM 4K55A 4RGMB 1G9MH 5IB5A 3UAJD 3AFLA 3OX8B 3K1DA 4AEIH 4Y5VB 1CU4H 1D5MA 4JZOB 1J8HE 4O58L 4LVOB 1OARL 1PG7L 3SY0B 5F1KC 3UTZB 3T2NL 4QHLB 2XTJC 3DSFH 4R7DA 4JKPL 3HPJA 3LN9A 2N1KA 1EAPA 3O6ML 3FAXA 3HZVB 2C4FU 2KH2B 2H6PA 5FECB 2J7LA 2XFXA 4O2CA 4C55A 4XNZB 3BKJL 3BXNB 4U1NB 4HK3N 2W92A 1FSKB 4TVPL 2VC2L 1OGAA 3EYOB 1LEKB 4DAGH 4CN4A 1J1OH 1A9EB 3MV11 3V95A 4YPGA 3DUHA 1MHPH 3O2VL 4ZS6C 4MDJB 1T03L 3FTGB 1F42A 1AHWB 5H37H 1KV3A 5JOPE 1Y0LA 4PJ9A 2FD6H 4QWWC 4Z95H 2Y5TA 3QWOB 1X5YA 3WJJA 4ZXBD 4QTIL 1OAQH 3GBMH 4WFGD 4MXWH 3LKOA 4K71B 4XB8A 4CJ0A 4NN5C 4WVRA 1GIGH 3FONA 3IDXL 1XGUB 5T1LD 4HS3B 3B5HA 1VB9A 4TNWF 3ZHLA 4M6ML 2YPVL 2DTML 4P2RA 1BBDH 3HNSL 4PJDB 3LQZA 5FKAA 1FCGA 4X4ME 2J6EH 3BEWA 1NSNL 5ISZE 5EU6E 1I9IL 3QH3A 1GHFL 1REIA 2XN9A 4NZUH 4KKAD 1MRDH 4ZPVA 2Y1VA 1H0DA 1QRNB 1QFOA 3WIFB 3HNVL 1T89C 3QULB 4E0RA 4LLMA 5IFJB 3I3BA 1RZJH 4PJAB 3TEUA 1HI6B 4Q6IC 2DIAA 2ADFH 2NMSA 4JO4H 5KJRH 2CR3A 3S8WA 1EZVX 1S9WB 5HVHB 4MVBD 4RNRB 4X9BA 1RK1B 3SDYH 2M1KA 4LLYA 4IMKA 3OAUH 4WUKL 1FLTX 3DGCR 1KB9K 2VMFA 4ORZC 4JFHE 3A6BH 4M7JL 4LKCA 4OAWB 1I8MB 4FQCH 2XA8L 4FFVD 2NTFB 5DLMH 4HUKB 5SWSD 1D6EB 1R6VA 4JPWH 1FLRL 4I0PA 5IV2B 3O2DH 4EUPB 3DROA 4G6KL 5JQ6H 3FO2A 1MIEH 2FEDD 5CILL 2XQBH 1N0XH 5INDA 3BDXA 5GRWA 5D6DC 4P3DB 3C5ZC 3E3QE 3QUYA 2PW2A 4IRSC 3QQ9D 3LRHA 2ICCA 1BFTA 4LEXL 5C0BB 4CU7A 3CU1A 2YBRB 4APQA 4R2GB 1BBJB 1G0YR 3DXAE 1NGYB 5CJXA 4BYHA 1JGEB 1ETZA 3MRMB 1NBZA 3QIBC 2VO5A 4HXAH 3RIFK 3C8KB 1KC5H 1MCDA 4OZGA 1FVCB 2OQJB 4HWBA 4U1MA 2IH1A 5LWYL 3KYNB 5TDNB 4P49A 1YN6B 1S9XA 5ESVB 3O45A 4IDJH 4PJ5E 3GDBA 4L4TB 3RZCC 5T5FL 1ZK9A 1E4WL 3ULVC 1IAOA 1T5WB 2E9IA 5A3ID 3HRPA 3GJEB 1NJ9B 1UWXK 1E4KC 1JTPA 1HYRC 2HP4A 4Z6AT 2AVGA 3H0TA 3K2UL 4POUB 4M6OH 1I9EA 3FHAA 3RPIA 2DMBA 5EOQL 3V4PL 3THMH 4WEMB 5IROA 2DJUA 4QNPE 3T4YB 2R1XA 8FABB 1RQ5A 2VDPH 4OLZL 1U0QA 3CZFA 3D18B 3W2DH 1EUUA 5FK9A 1G7IB 4PREA 3MOAL 1XGYL 2VXTL 5FHAH 1QYGL 5DF0A 4Z9KB 1BFSA 4D3CL 3ELAT 5FM5M 1ZHLB 3SJVA 5FYJD 5B3NA 3GHEL 2ATKB 1AGEB 1D6VL 3H8NA 5CD3A 2P24B 4NBYB 4Y16B 4P5TC 4RCAA 2M26A 5DVMA 1E28B 3TBSB 1O5DT 4RGNB 4EXPX 4RZCB 2X9YA 4JRYE 3RTQD 2AJVH 2GK0B 3LQAC 4TTGA 3IJHA 1CCZA 1P69B 4PG9B 5I1KH 4ZUUB 4PRHD 3NN8B 1CDGA 3C8DA 5C9JB 1PEWA 5D70L 1N59A 3JXAA 3OB0K 3FOMB 5GRUH 1QVOB 3O6KH 1L7IL 2VNCA 4KPHL 4NNPH 4RMSA 2AK4E 1KJ2A 2LU3A 2ORBH 2Q6WA 5A16A 3S7GA 1Q9OA 2L7JA 2VLMD 3WDJA 5I1AA 3DARA 3B43A 4JPIB 1U6AH 3GIVA 2WMPA 4WO4A 3S3PA 4OLYH 1CDBA 5KS9E 2X09A 1F4WL 3V4UL 1G7LA 2X4RA 5E6IA 1J1XL 5B8CC 2Y23A 5DK0A 3AMKA 5BW7C 5I1GL 4LLDB 1R3LA 4ZQKA 2KQMA 3NABL 3RX8A 4HWNA 3MACL 1AQDB 5DFTA 3TO4C 4I3SH 4OTXH 1Q1JL 4MNQB 5HHVL 4FFWD 4LIQL 5LGJB 2FEEL 3TO4A 1IQWL 2JJVA 3RWDA 3WFZA 1I1AA 2X44D 2ZCKL 4XVJL 1N2RB 2EIEA 2CO6B 3R06B 4R26L 1MH5B 3VH8B 2MFNA 2WZPD 2BY0A 3WCYA 2DWEA 3D0LB 3U79A 2CR6A 4NQEE 1FNHA 1VACA 5DGRA 2I9LA 1RVFL 2R29L 3EOTL 4XI5D 1S3KH 1ZMYA 4GSDH 3W0WA 3UP1A 4ZPTB 2VZUA 1JNLL 5D93C 5D2NE 2R8SH 4NM4H 3SGKC 3L3IB 1YNTB 3HG1E 5CGYD 5CKGA 4YWGL 3GZKA 1A7RL 3BP7A 2DQFB 4U3CA 2VITA 2CLRB 1HILA 4X5XB 4FZEH 2N7BA 5FGCE 3RAJL 4M9OA 5B38G 3OKDB 2GJ6B 3VXTB 4GLRH 4MJ6A 1WZMA 3EAKA 1FVEA 1F45A 4IEFB 2MQ0A 3ET9F 3NIDF 3JWOL 3QHTC 3EO0A 5FUOH 5AAWA 4PP2B 1CFSA 2C3HA 5D7IF 2EC9T 2MMXA 4UT9H 3D48R 3W81A 5K9OA 3LHPL 4UU9B 4PJ7E 1YUHB 2GKIA 5IQ9A 4BZ1L 3TYFA 1H8NA 3MLVL 4LNRA 4PJGE 4NM8L 3OGCB 1N6QL 1KFAL 5HGDB 4WTWA 1IAMA 3ROOB 5D8JH 1S7WB 1H5BC 3EDEA 1C5BH 4C56D 2F9BT 3RFZC 3LKRA 5ELIA 4UOW0 4ISVB 1MCFA 2IAND 3ZKMC 3ECBA 4FQHB 1QSVA 2F54D 2BVPB 3GMRB 4O9HH 2G60L 3P9WB 3QIWB 2PTUA 1NMCC 2V9RA 2XZCL 3VFPB 5F1NA 5ILTL 4QHUA 2PYEB 2P5EE 3OJDB 5C70A 2H32B 4GRMA 2ITCA 4ODXA 4Y5YC 3EYUL 4JM2B 3RPKA 1LVEA 2F58L 3ME0A 2YUWA 4GRLB 3C5SA 5BV7L 3FQRB 5HHXL 2AV7B 3L7FB 1Q94A 1ODAA 1SY6A 4ZOCA 1PZ5B 5KVDL 1P4IH 4WDIB 1MPAL 3NCBB 1VKXB 5DJCB 1BGXH 1NCNA 3G04A 2NY3D 1FGNL 3TN0C 4CN1A 3UROR 1ZS8B 3QQ3B 3QO0A 2HKHH 4OSUL 1CG9A 3OKLB 2NXZD 3P4MB 3MZGB 2ZPKH 3BDYL 4CADB 1YEKH 3BUYA 5KSAA 3OBAA 3D39D 1IC7H 3ARUA 3OL2A 3B83A 3CVHB 2OSLB 1P84J 2RQ8A 15C8H 1XIWA 2J5LB 3MUHL 1K6QH 4H88H 2W0LA 1RY7B 1DVFA 5HGHA 1QSED 5DJ0A 1JGUL 5F6HI 4XXCA 3VFTA 5MEQB 2F19L 3I2CH 5BRZE 2EDOA 5F1OB 4U2YA 4X7TA 3DI3B 2X4UA 2V2TA 4IRJC 4MB5A 4F7CA 1LE5B 3NACH 1MI5A 4ZFGL 4JO3H 2RCSL 1LEIB 4HJJH 1JGLL 2O5ZL 4J3TA 3NCCB 4HIIA 2X1OA 3U7WH 3UC0L 4F9PA 5AYUL 5C0CB 3EO1A 3SDDC 2Q7YB 4CVXA 1AO7D 3OR7A 2YUVA 3VGAC 2FL5A 5E8NB 2R0LL 4JY4A 4UAOC 5IG7B 1GPOL 1JF6A 1F00I 4XH2A 1CVRA 5KSBE 4LPWA 1DN0A 2W9EH 3HZYA 4X6CF 3O9WC 4M1GH 2OTPA 3PP4L 5E1AA 4B53A 2H9GA 5D7JB 3BZDA 2BNUB 3VFSA 3HCVB 3MRKA 4LCIL 1LO4H 3RZWA 4DGYH 1I1FA 1P6AB 3SO3B 4EN3A 3G5ZA 3STBA 3H3KA 3TNMB 3CSYB 4XC1H 5BCAA 3T3PE 4L29B 3MYJA 3C6SB 4I5BA 1KYOJ 4M3JA 3MNWA 1C1EL 1CFNA 3X13A 3MRIB 4Y19D 3VWKC 2BCKA 3H9ZA 3MMEB 3TFKD 5IBUG 3PV6B 1HXMB 1MFAH 5D5ME 4YUEH 2D31A 3TJHC 4EI5C 1SM3L 3GMLA 4H1LA 4WI8A 1YEHH 1ED3A 1KT2B 2HTLD 4HT1H 3GMQB 3ARGD 4M6AA 4KROC 3VMNA 4KTEL 3B9VA 5KN5B 2V2XB 3FRUA 1DFBL 4MJ4A 4L9LC 2AW2A 4P2QA 2FX7H 2C9AA 4OGXH 1T83C 3HI5L 1JBJA 3EJZD 1A7OL 3BKCH 1HIMH 3RGVA 2PNDA 1MIMH 1W2KT 5J1AA 4Y5XB 3LQAH 2IALA 1IM9B 3UPRA 1OAUH 4XCCL 3U4AA 2EEAA 2EC9U 1QFWM 4RDQG 4P9ML 4NHCL 3UBXB 1JWSB 2HRPL 3IJYB 5HHQA 2Z31B 1OD9A 4EVNA 3I50L 3BESR 5CEZL 5JZ7D 1YY8A 4D0BA 4AENA 4RSVA 1LDPL 5AYQA 2VLRB 5HJ3A 4PR5B 1J11A 4G8FA 5FYKL 2APFA 1Q0XL 3G6JA 2XACC 3MV9E 4GMSL 4QLRA 4N1HB 2R2EB 1V7ML 2DDQH 2LFGA 1YMMB 1EO8L 1JK8A 5GGRY 1S9VB 5IJKC 1OGTB 4RWYL 1CDCA 3DTXB 3PL6B 2DL9A 4H8WC 4GKNB 4JN2B 4HUXB 4PS4L 3B9DA 3IRZA 4QHMB 1H3TA 3QPXL 1QZ1A 4TVSa 1S7TB 4JFXB 3CC5B 1NMBH 4OF3A 4AQ1B 1HSBB 1E27A 5IM7A 2VZSA 5GS0C 4HGWB 3BIKA 3QZWG 5EZOL 1MRFH 4OT1H 4TUKH 1J8HD 3KR3L 4BFEA 4R3SB 4HBCH 2YPLA 2I25N 2X10A 1U8OA 5FOBB 4RX4A 3IJSA 3QB7C 3C6LC 2AJXH 4KHXH 5DJ2B 5EORL 3V52H 3C60D 5F9OH 1T04A 5DRWB 2GT9B 4ZUWA 5ESAB 3MJ9H 3PWUB 1MWAL 3WIHH 2PXYB 1KEGH 3O41B 4JG0L 1G6RL 3S6CA 3RHWF 3X3FL 4LCYB 2AXJA 3KJ6L 3VW3L 3VU2A 4ODSH 5JOPD 3HAEG 1VENA 3KPPB 2MCG1 2OMNA 2C4XA 4PTUB 3HE7B 3BKYL 2ZCLH 3CFEB 4WW2F 3O3AA 1BQUA 2EDWA 4ZFZA 4K7PL 2DF3A 1S78C 3S35L 1E4JA 3CXDL 3KPQA 4PRIE 4QY8B 4XGZB 5T3ZL 1DJSA 2ADJA 4MX7A 3RWIA 4ELKA 2E9JA 5IF0A 1KN4L 3OJVC 5FOJA 4NSKB 4R97B 1S7QA 4MNGA 4X7EC 2D7MA 5JOFA 1Z5LA 1EFXB 5CSZB 5E5RB 2UZXB 5EU6D 1X5ZA 2Z35A 1EK3A 3BP6A 5E8EB 2A9NH 5KZCD 1A7BA 1I7ZA 2OL3H 3OKMB 3DSNA 1X3DA 1TZIA 3BPOC 3MRJB 2VAAA 1AKJA 2VDNL 4KU1A 4M7LL 5JO5B 2MCPH 2FYYB 1TNMA 4LCCB 4Z7UE 5CS7A 4KZDH 3CK0L 1GOFA 1OAYL 4N0UA 4JHWH 3KPRB 4M8QB 2YD1A 3ARDB 3H3BC 4HS6A 5EBMA 4X4XA 3MO1B 4LHUG 3KPOA 2B0SH 4GG6F 1OGAE 3M8OH 5HHOE 1RUKH 3WJLC 1LO5A 4RA0C 3VWJC 5L2JB 3PABA 1UEMA 5C09B 5I75B 1OSPH 4HFWB 3WJLA 1H3XA 1MVFA 5F88B 3BGMB 2EIZA 1CLZL 1LP9A 2DLHA 2B2XH 3MV7A 5LBSH 3PWLA 3WS3A 5IKCA 1R5IB 4JFHD 4JRXB 4GLRI 4NO5A 2FWOA 2Y4SA 4DVRL 3GSQB 4MXQD 2B39A 4BFIB 2XRAL 3I6LD 1MJJA 4P4KD 1MUJA 4P2RE 3LRGA 2BVQB 3GSNL 4U33A 3F7YB 3L5IA 4ODUA 5BMFL 3Q6GH 4HUUA 3ZZ1A 2ESVA 1A7PH 3KLSA 4CMMA 4YJZL 5EBLA 5E99H 4P46C 2E9WA 4MNHA 5DK3A 4NKOB 5FIEA 3D85D 4HWZA 2DJSA 3BPNC 1IGFL 2QADB 1IC4H 4G7YH 1JF1A 3T0AA 4LRIA 4EKXA 5GZND 3WUWG 3DXAD 4P59L 2DQCH 1CDIA 3OG6B 4HIEB 5C07A 1FYHB 3H9SA 4GKZB 3EFDH 3VI4E 1A6UH 1A2YB 4JLRB 4OGYL 3C08L 4XNMB 4ODVH 5CLTA 1U8LB 4ZFOB 1BFOA 5JW4M 1F3DH 3MLWL 1YQVL 2LVEA 1Q9LA 1RK0A 3VD9A 5K9JH 1SYVB 1UM6L 5GSRA 3CH1A 2OI9B 4PJ5D 1FQ9C 1IGTB 2GTWA 2WINB 4XVSH 1FZMB 1YNLH 1QO3B 3TYGH 4UUJA 4LSVL 3V5HB 1QLEL 2AJYH 2QQLH 2EEBA 4KRNA 3GSOA 3TBWB 1FNGA 3IYLW 4ZSOB 3MRPA 4Y4HA 5EUKA 5K93A 1I7RA 3QRGH 1G7MB 12E8H 1KN2H 4U6YA 2IAMC 4I8DA 3DHJA 3IF1A 1FJ1A 5D6CA 3HS0B 3WXVL 1N5AB 1AXSB 4LAQH 4L4VB 1FNAA 5SV3A 1G1YA 3ULSA 3PWJB 1BIIA 4KK8D 2EYSA 2YKLH 4R7NB 3BZEB 3G9AB 2NY7L 1UB6A 1LE9A 3RY4A 1PG7X 1A7QH 1E6OL 1AI1H 3KPMB 3EGSB 1L0QA 3ARWA 4YGAB 5KSVB 2OZ4L 1X5GA 4DZ8A 4OCLC 1FV1A 4JFFA 2EDQA 5I1IL 3DYOA 3OG4B 1G0DA 3A6CL 4OZGE 2AXGA 1K2DA 3U4BH 3QHZH 1MY7A 1NGWB 4JRYD 1MSPA 4WY7L 5BQ7B 4LPVA 3BRGC 3KPSA 4XCYA 4DN3L 1U91B 5C0RH 1FFOB 3L6FB 2ZUYA 3S34H 3EYSH 1VFBB 2BRRH 3S36L 3TZVA 4NC1C 4UV7H 3NBNA 5F7LB 2HJLB 3KG5A 4HLZH 5I8EA 3ULVE 1MAJA 3B9EA 4LMQE 4M1DH 1DLHB 3ZKSD 2AK4D 1MJ7H 4NQDA 1JHTB 4PTTB 4RGOL 4LPXA 4L8DB 2IC2A 4PGBA 2LABA 3KXFA 1MCPL 3TNNB 3AM8A 5D72H 5TQ0H 5F96L 1LK2A 3ARED 3QDMD 4IDLA 5I17B 1BFVL 3MRCB 4H8WH 1JNNH 2IGFH 3GIZL 2X89A 1JCKA 3WE6B 3NMEA 3C2AH 1JHLH 3SJVE 3B2UD 2W0FA 3FO0L 4G9FD 4K8RD 5DUPH 4F2MA 3T08A 3VXPA 1UYWL 1I3RB 5I73B 4G6JH 1OAXL 5GS0H 3C9NB 1SVCP 3MLRH 4OD3H 4BSVB 5IUSA 3GSWA 1WFOA 5AZ2H 4NDMA 4RGMC 3P40A 1RUQL 4NQED 3O2WL 2BSTB 5E94B 2P8LA 4Y5VC 1JGVL 3F12A 4MHHG 4XWOD 3WYRA 2ARWA 1S7RB 1KG0B 1FVDA 1HDMB 2FB4H 3C87A 4Y2DB 5DEFB 3CDGB 3LKPB 4LVOC 2HTKC 2QQQA 3HG1D 3QG7L 4XCNB 2A83A 1MWAA 3O3DA 4JZOA 3T77A 4NQVB 3IAPA 1G6RA 2VDKL 3NCJL 4MXVF 5F89A 2F5AH 2AJZA 4XNZC 4JQXA 5FECA 4HPOH 1QKZH 2K7QA 3HC3H 1FSKC 1RZKL 1U92A 3PGFL 3T1WA 4JG1H 1D7FA 4U1NA 1QBBA 3HN3A 1NGPH 3FFDA 4K23H 1TVHB 1AHWC 4H20L 4TSCL 1VDGA 3FTGA 3UJTL 3DO3A 3GBLA 5CBAB 1RHHB 4UBDC 3GK8L 2MJWA 1G84A 1KJMA 4TULH 4K71C 3L3KB 2X41A 3PQYA 4QRSB 3WBDA 5EC2B 1NDMA 1YECH 2J8UE 2NXYB 2F74B 3FQXA 4HS3A 3VG9B 2YD6A 4IOIB 4R4BB 4U6TA 2P5ED 4JO2L 5JXAH 1I3UA 3HUJE 1UM4H 2XZAH 1XGTA 1FC2D 1QBAA 4HEME 3QEQE 5DD6A 2XNAA 4TVPE 3F7VB 4UT6H 3KYMA 4NYLB 2FBJH 4X4YB 5E6YA 1C08A 1FGVL 2FATH 4HCRH 1BLNA 3RWFB 1QRNA 1WAAA 2H45A 2V17L 3OZ9H 3VXRB 1ZWIB 2QSVA 3ESVF 1N4XL 3NFNA 1MCKA 4TUJA 1QEWA 1JWUA 1UENA 4ZTOL 2VZ3A 3LCYA 1C12B 4KI5C 5HVHC 4LDOB 5JW5B 1WBXB 4BSJA 3GSNA 1M6OB 2R1WB 4JFDE 3QNZB 4RNRA 5HHMB 1JZ8A 4DUWA 1RUPL 1RIUH 3WO3B 1FL3B 4FMFA 4WWKA 5E8PB 5E8DH 2BNQB 4JN1L 5D1ZB 4HKZB 5BRZD 1NCBH 5IHBA 4KKNA 4AEHL 3HI6H 5CIPH 3L5WA 5FCUH 4M1CD 4OIAA 2NTFA 3MLXH 1JRHH 1S5HA 4NO0B 2FBOJ 3TT1H 4YXLL 3CVHL 1F8TH 3WIIL 5GGQL 5J9PB 4KHTH 1CVSC 2DQGL 4Z7QE 1CIUA 4TOYL 1NGXB 4ELMA 5BXFB 4YDKL 4N0CD 1VFUA 2F53B 3F6LA 1JP5A 3QG6B 4JGMA 1FH5H 5B3JE 4LVNB 2NW3A 2X4NB 1EHNA 5SV4A 1P6FA 4R2GC 4ERSL 1UB5B 4XVTL 2AV1B 3TV3H 5J13B 3LSOA 2G5RA 5H35B 4WI5A 1ZLUH 2YBRA 2DTSA 1AR1D 3BQUC 4A6YH 1R5WA 4V2BA 2EXYC 4AYFA 5J6HA 1QTYT 1CD9B 4OCYL 5EN2B 1FVCA 2R56H 2OQJA 3W11C 2D0HA 1H15A 4F3FB 4JDZB 1NLBL 3SKOB 5ESVA 3IFOB 1F4YH 3KYOA 3OQ3B 5IFHH 4O02L 3BEVA 3QWQB 4YHOH 4RAVB 5C08E 1WCBB 4QT5B 3QSKB 5HYSG 3JV6B 4XPFH 3CPLB 1AXTL 4K2UL 1ZKAA 1CWVA 4U31A 3FKUS 3STLA 2VIRA 4OLEA 2HRLA 4QRTA 1AP2B 5HYJB 3L3GB 3CVIH 3KNBB 2OZ4A 3PWVA 3WFHB 5BVPH 5DJ8A 4X6BA 3D18A 3V6BR 1IQDA 2ZUXA 2ZKHL 3QUML 4N0FB 4PJXB 1R5VA 3OMZA 3OKNB 3MLSH 3I6KB 1BP3B 4QNPF 4PGDA 3WN5B 1J7VR 4J3WA 4QHNB 4AMKL 3MUJA 4Y16C 5F70A 1AGEA 1F3RB 4O51A 2EDTA 2ZUVA 1WWBX 4XNUH 2BSSA 5ICZB 4RGNC 2GUOB 3EJYC 1P2CA 3FB7A 2HYMA 4I18A 4HK3J 1BQHA 3ZKND 2XT1B 3S37L 4PUBH 4XP5L 1BF2A 3WHE1 4JCLA 3UYOD 2GK0A 1MLCA 4HUNB 1DQML 4JR9L 3MV9D 4ONHB 1FORH 3BGFB 3X12B 2UWEE 2PYFB 5C9JA 1TPXB 3T0ED 2MPAH 1MVUA 3MROB 3VXOB 1ZSDB 5KVGL 4PV8B 1VEPA 3S3SA 1QVOA 4HMEA 3ZSSA 1FIGH 5IMMA 5DI8B 2EDNA 4YDLB 1I7TB 4NNXA 4EI6A 5EOCL 3M17B 3HC4H 2C26A 1DCLA 4HQQL 4P2QE 1UC6A 4XBGA 1CDJA 5HI4C 1AGDB 5HBBA 3HPLB 4P0DA 2Z4QB 1S7VB 5CFHA 4CVUA 4GRWB 4AJ0A 2DS4A 3P77B 3TIEA 2IQ9L 4KY1L 4F33A 2FGWH 3VMOA 3L5HA 2VXSL 2E27L 2ARJA 2FDBP 5KS9F 4N8VB 4MD4A 2CH8A 4PJCE 3HRZA 3TO2B 1UQSB 4MNQA 5I1CL 2CKBL 3KLAB 3MRFA 4HWEL 5DHXB 3U7AA 3R06A 3VFWB 3JV0A 3DNKA 5IB1B 4HHAA 4YHPB 4KJYB 2R0KH 1PSKL 2YD5A 1X7QB 3FZUC 4E41A 3G6JE 4KKLC 2M2DA 4YBQC 1FG9C 4RDQF 3BZ4A 1A1OB 2BOCB 3P9LB 1FYTB 5IVXB 4HH8A 3B9KD 4OUUB 3VGFA 1V5JA 4M62H 4PRDB 3WFDL 4PRID 2V7NB 3QCUL 2R15A 3CFKB 4JQIH 4FZ8L 2HH0H 1MCRA 4LPCA 3T8XB 3OKDA 2GJ6A 5D96B 5J11B 2Q76B 4XBPB 1EHLH 4KVCH 1KJ3H 4JO1L 4KJPC 4YHIB 1IE5A 1OTSD 2H2PC 4OF6A 3QHFL 3GO1L 3L9RB 1ACYH 1DP0A 1C7TA 2E3VA 5IHZB 2YPLE 5DQDL 2GJZB 3U9PL 4KQ3L 2J3SA 3QUKA 2VERN 3IDJB 1NEZB 4J3SA 3UYRH 4RBPK 5KANG 1H8SA 4R0LA 2MKLC 1NFDB 4CAGA 5JIPA 5GISH 43C9A 1YEJH 4MA7L 1CL7L 5SWZB 5DMIL 4Q9RL 1RMFL 3QIWC 1OGAD 5HHOD 1OTUC 4Q9BA 1YPZB 1ZLVK 2EDXA 2BVPA 1NGQL 4PJ7F 3U1SL 1XF4B 4G7VH 3UTTA 3TBVB 4PJGF 4UZGA 4JANB 1B0RA 4JM2C 4YBLB 5AUMA 3RWCB 1JHKL 2X4PB 4FP8L 1FP5A 4ZUVB 1OCWH 4KRPB 1D9KA 4GRLC 4O2EA 4ZG1A 2HG5A 2AK1H 3O3BB 1RULL 3QQ4A 1XGPA 2XQYK 5FA3A 2AEPL 3B2VL 4OJFH <