3ZE0F

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F01
4MNQB 5GGRY 2ZCKH 3WDHA 2Q76A 1OOAA 3NZHH 1MH5B 4GBXA 4R26H 3Q6GL 4TTDC 1R0AH 3DUSA 4GRLA 1M71B 3INUL 4PLJC 4JB9L 1H3PH 3U9PL 5BVJA 4EI5C 3ZLQC 3OX8B 2JJUA 4QRSA 2PUQT 4AEIL 2N4IA 3PP3H 3HC3H 4Y88A 4K71C 1W72H 1CCZA 4ZPVB 4JY4A 5C0RL 3CSYB 4R7DA 3N9GL 1BIHA 3WFCL 5DK2A 3ARXA 4PP2A 3QUYC 3X17A 1FGVL 5CJ8A 4GXUN 1N0XH 3QDJE 5KG9A 1C1EH 1IKFH 1E4WL 2XI9A 2YUXA 2P5WD 1A64A 3C8KA 3GMPB 5HYQB 3KPMA 1ZEAH 5EOCJ 2EE3A 3PDOA 4JZJA 1JI1A 4P99A 2XWBA 1FN4B 4IRJB 4X9IA 4YHIA 3KPPA 3I3EA 3BDBA 3TT1L 4ZTOH 1CFBA 1MAKA 1RZJL 5DSCB 4Q74A 4HXAL 2Y1VA 4LAQH 3B9AA 5I0ZA 2F54D 3MV7D 1KIUA 3OZ9L 4WJ5A 4Y2OA 3PP4H 5HYSG 3O6KH 5EO1B 4UOW1 3W5MA 3TH2T 5JW5A 1OAKL 2P46B 1MRCH 4WVRA 3MLRL 4XCCH 1AP2A 1VEMA 2NY4C 4H1LB 5DJ8A 4YK4C 1OLLA 1OHQA 1I9RL 5TDNB 5CP3H 5I18H 4KFZC 3ZE2F 5D2LE 2WINA 3N9GH 5IJKA 1KEGL 1WBZB 4N8PA 1F02I 4PRHA 3KDMA 3LMJH 4YFEA 4ZOEA 4M6ML 1EHXA 2A2QT 4XP1L 2ZNWA 5CWSB 2VXVH 5DVLA 3BVNA 3GM8A 2AV1A 3IFPB 1DLFH 3GMQB 3ALXA 3C6LA 3GSVA 3Q6GH 5EU3A 4U6VL 1OSPH 3MNVA 4XPBL 5HGBB 3HNVH 1GXEA 1BVZA 2C3GA 5SWSD 3UP1A 5F7DA 1JZ4A 1FPTL 1N6VA 5D6CA 5ECJE 1QTYT 5I2IA 3B5GA 2W1NA 4Z7NE 1PX4A 3WLWC 5L88L 3HE6D 3HR5A 4QF1B 4KC3B 3ZKXB 2ZKHH 1PZUB 2EDLA 5EBGA 2EICA 4JZOB 5I16A 1J8HA 4LKCA 1NCBL 4UDTA 2FJGA 3QSKB 5HTSA 3T0EE 1N2RA 2H9GB 5IMLA 2EYTA 3WN5A 1HI6A 5D1ZB 1BBDH 1DLHA 2FJHA 4PRHD 3VFUB 3SO5A 3VRLF 1G7LB 3O6LH 1I4FA 3GMRA 2DLIA 1DQTA 5BOPA 4LSVL 4U1MA 4JCMA 3ULVL 2VDRH 3MUGB 4NHCL 2R1YB 4J3TA 5BZDA 4KPHL 1VGEH 1YEDB 3OHXA 1SBBA 5FUOH 2IALB 4M9OA 1QSZA 5ISZA 2E9BA 3DX6B 5BV7L 3JWOC 3MOAH 1A7QL 3S4SA 5D7LE 1TQBB 1CU4L 1XR8B 2HTKC 3FB5B 2AEPH 3HAEH 3AB0B 4X6CF 2E7LA 4ALAH 2ADFL 2VXQL 4RIRA 2Y06H 4Z7QE 4X7TB 5HSFA 4PJFB 1BVLA 2A74A 1JZ2A 1FYTB 1VACA 4K7FB 4EI6B 2IAMA 3EYFA 2BY2A 1LNUA 4TSCL 3STBA 4GMTH 4X7SH 4RMTA 2YC1B 3TBWA 4CGTA 4LAJH 4OUUA 2R2CA 3RWHB 1BFTA 5IBUB 2CMRL 2CIIA 4HUUB 4ODTL 1FAIH 5EC1B 5KVEL 4KWUA 3MNWA 3EOYG 4PJFA 4UIMA 2B8OT 3HC4L 2EDXA 2X4TB 3CMOH 3GSRA 5D8JL 4OKVB 1I4FB 5EUOF 3QWRD 4JREC 1T7XA 5C6TL 1BZ7A 2D0GA 4CVZB 1YEDA 2F5BL 3OHXB 2Z8RA 3I9GL 4BFIB 3QFJB 2XYCA 5AD0B 2JJVA 4JZOA 2PW1B 1J87A 4G3YH 2DWDB 4PJAF 3F8UB 3AS1A 3MCKB 2CDGA 2EE6A 1SVCP 3MLTA 3HE7B 4Y5YA 1CFSB 3EOAA 4HWUA 3VFPA 4BZ2H 2J12B 5BW7A 4X4ME 4IRSA 4ZUTA 3QXVA 2VQTA 3L6FB 5DLMH 4XRCB 3THML 4D0CB 1HHGB 1JPSL 1CD9B 4JFDA 5FV2A 2FD6L 2IH3A 1IILE 1RJYB 4G5ZL 4HIJB 4FQXC 4XP9L 4GG8A 1YMHB 2D7TL 4M7LH 5TE6L 3P11L 4I9WD 4X6FB 2NZ9C 4HK0B 1FFRA 3NACH 2BRQA 4PJXE 2YPLB 2NY7L 1BJMA 4TVPH 3CVHH 2XN9D 3GEWB 4X80L 3CFDA 5FF6A 1DFBH 3L3KA 1CDYA 1WUNT 1HKLL 2WINB 3L5JA 4U1KB 4HS3A 2GFBA 5C0AB 4U05A 1FRGH 5JXEC 1LO5A 3I3DA 4LPVA 1AC0A 1GL4B 2DMBA 4YHOL 5J1AB 5D5MF 4C57C 4R0LB 5GZOC 4K2UH 1HE7A 5GS0D 4ZD3H 2BRRH 1XIWC 2R1WB 4BQBA 4FXKA 4QHKI 1AQDB 2CDFA 4QRRB 1FG2A 2R15A 2PCPB 2DI8A 3FO9B 4M3JA 4Z18A 3NFSH 5D5MB 3HE7A 3R0MA 3WUZA 4AEEA 4N0UB 3I85A 2X4SA 4E41B 1BZQK 3MRBA 2E9WA 1QKZL 2AQ3A 4BKLB 1J11A 4HF5H 4R96B 3U4AA 1I3GL 2VE6A 5E0QA 2Q7NA 3VCLB 3UMTA 4HLZG 4X5LA 3CX5J 1DUZA 5IM7B 5DSCA 3QUZC 4QOKD 4OT1L 5IV2A 4JPWL 3UTQB 5DJ6B 1CFNB 3IKKA 1AXTL 1EFXD 5EUOB 3D87B 4EUPH 1YECL 2A0LC 2HT2C 1DLHB 3BYTA 2P8LB 2VLRA 5I66B 4XBEL 5JR1H 4ZPVA 2ZUYA 2AJZB 1O5DT 3RWCA 2XN9A 4N90D 1A0QH 4JY5H 4HD9A 4I13B 2F8XC 3UYOD 4DKDC 4FFWC 3RWHA 1CXEA 1AGCB 2YD1A 3HPJB 5E94B 3RJQB 1A3RL 4Z7WA 2FJHB 5FO8A 3UPRA 2UWEB 1I1AC 4JO1L 4Y8DC 4XVTL 5T3ZH 1TVDA 1JRHH 2OI9C 4OLXL 1HH6A 3ULUE 3AMKA 2BP3A 4EXKA 4G8IA 5BVJB 3KXFA 1QLFA 3OR6A 4WDIA 4NN5B 4NFBA 5EG6C 4NQDD 3QDMA 3JWDL 3EZJB 4LLWB 4FQLL 3TZVC 4U3CA 1VPOL 4BSVA 4MNQA 5GS2H 4CKVX 2Y23A 2HJLB 5B4MC 5IVXB 4DAGL 3HE6B 4OM1L 1H8SA 3NCMA 3BO8A 4V1DA 1TJGL 4IOSD 2AQ1A 2IMMA 4ELKA 3RIFK 4MA3B 3GMRB 4KPHH 5I8KH 5BCAA 1A0QL 1MI5A 1LO4L 2RCSH 2J1KA 5GRZA 2R29H 3WJLC 2NTSP 4PRHB 1RJCA 2NY0C 4KJQD 1L6ZA 3T1WA 1PBYA 2FJFB 3VFVB 2F53B 3FT2A 1J8HB 2BMKB 2ZG1A 4QYOB 5IR1B 1T03H 1YEEH 3DJ9A 4GBXC 3HZMB 5CEZL 2EO1A 4W4OC 4P9HC 3D69A 3VJ6A 1MJ7L 2HJFB 3PGFH 1EA9C 4RRPG 4Y4HC 5F7NC 2L4OA 3HMXA 1JHTB 4PYHA 3ZHKA 1D5IL 4NNXB 5EO1A 1B4JH 3BDYH 5BQ7B 1JK8B 1BBJB 4PG2A 1LGVA 4FQIL 4DGYL 3DETC 3K2UH 3IVKB 5EORL 3KXFB 3WUWB 1CL7L 4N0FA 4Y2DA 1ZGLM 1EGJH 3SGEH 4F37K 2P8MA 3KPPB 1Y0LA 5FFLA 5J89A 5F7EL 2CPCA 3PDOB 4JZJB 5BOZG 1SYSA 1KJVA 4ONGH 1CGTA 3HNVL 4L3ED 1D6EA 1KSRA 4WW1B 2A73B 2QQKH 1M4KA 4YWGL 1RUKH 1DVFC 5DVOA 4G6FD 1QSEB 1RFDH 5DD1H 4MDJA 1A4JA 5EU4A 2NNAB 3UJIL 2BK8A 1QFUL 3V7AE 1NBVH 4M7ZC 3IJHB 5GGVY 1S9YB 4LSSH 1FRGL 4KKLD 5DUBA 4DZ8A 3L3IA 2ARJB 3ARZA 4DVBA 3QRFM 4I0PB 4Y1AA 3AUVA 3Q1SL 4KUZL 3ZE0E 3KJ4C 5C0AE 1G6VK 4GOSA 3MA9H 1BQHA 4TQEL 4PBVC 4A6YB 1RAMA 3O0RL 3VWKC 2XKUA 5EU6D 2ZUUA 3HAEG 4ISVB 4ZDHB 2UUDK 3F12B 5KSAD 4HH9A 2H45A 5B39G 3IDMB 5IT2H 3GBNH 3SKUD 5MP6H 3PWUB 1S9WB 2FO4B 5CKGA 1HXYB 5GJTH 2Z93B 5GRJL 3QFJE 2IWGA 4JKPL 3TT1H 4LDEB 1YYMH 3QIWD 4JE4B 5LGHL 1NBQA 1YYML 1A6ZB 1A7PH 1RURL 1Y6MR 3EDFA 5FHAH 4EN3A 3DSNA 5FK9A 5IFJB 1I1RA 5GRJH 5JDJA 3T04D 1D5ZA 2FJFA 4OLWL 1WGOA 4U1GC 2AK1H 2ED7A 8FABA 1IAOB 1NGQL 2LVEA 5EOQL 1ZANH 4TUKH 3C6LC 3HCVB 3T0WA 4JG1H 3MRLA 3IDNB 1KCSL 3ES6A 3ULVC 2VAAA 2EIBA 3SGEI 1UCBL 4Z95H 4O5LL 3A6CH 1S9YA 3SO3B 1FVDA 2XZQH 1CXFA 2Y6SC 3GM0A 4XPHH 1QHOA 5EU4B 3RVVC 4D3CH 3PUCA 3Q0HA 4R9HA 3DNKA 5C0NC 3DUSB 1KCVL 3BPCA 6FABL 3ARUA 4B7LA 4FFVC 5LWYL 3MLUL 4LAQL 2H3NA 3EDEA 1XGRB 4K9EH 3LVEA 1Q9OA 3INUH 1JV5B 3MGTB 4XNMA 5IHUH 4NUJB 1TDQA 1UG9A 4Q58C 5FDYA 5FKAB 5IW1A 5MERA 3QG7L 4JKPH 4H20L 1GZQA 3TNNA 3VFNA 4N0FB 4Y2DB 3C9NB 3QAZB 2C3WA 4FFYL 4IOIB 3O9WB 3RY4A 1JTTA 5DD3H 5BQ7A 5CINH 2Y6SD 3WHE1 3VWKB 2Q8BL 4GW5A 4HC1H 4MJIE 3LD8B 4OLYL 3I6KA 5KVFH 3CFJB 1XF3A 2A9NL 4R2GB 3LKNB 4NZTH 4WHTA 2VLRB 1CN4A 3PWPD 2KPNA 4WEMB 4P2YA 5FUOL 2E7LC 4XT1C 4HJ0D 1SQ2N 1J8HE 1T22B 4TNVK 2CO6B 2R29L 3ULVH 4ACPA 1C5BL 1KNOB 2V6HA 4QTIL 4WFHE 3HKFA 1CE6A 3EOTH 5J56B 4UIMB 5I8KL 3BQUD 4OZGB 4CW1A 5J13B 3MR9A 3T65A 2B5IB 3DX9A 1MFNA 4LIQL 4JM4L 4KKCC 4G9FA 5JMOC 4X0KB 2AJYL 2NY2B 3D1MC 1DZBA 1HWGB 3P77B 5LAXB 35C8L 4CU6A 4LNVA 4U1NB 4P23A 3ARPA 4Z7VE 3KYNB 1UB5A 2H2PD 1UKQA 4K7FA 1NDMA 2P42B 1YC8A 1UM4L 4Z7WE 1J0KA 4EBQL 3L7FA 3S5LB 3QWOB 4PJCA 2F74B 3LPWA 1J0ZA 4EUPB 4LDLB 1EVTC 3PWNA 1UXSB 2SEBA 3FB5A 1S9KC 3MLVH 4JFXB 1R5IB 2Z91B 1NCDL 1QNZL 5F70A 5JPNB 1CE1H 4FQ2H 2RIKA 5HHNA 2C3XA 5FYLH 4MMZC 3JVGC 3U79A 4HV8A 4PJEE 3D39E 4WI9A 3TCLB 4YQXH 4DOHB 1L7TH 4NQEB 1RUPH 1AGBB 3UPAA 2Z31B 2Y36L 3LMJL 1MSPA 5EU5B 3LKSA 4Y4KD 2VL5B 2J8UE 3C2SA 4HCRL 3Q2CA 1YMHA 5CCKH 3IFOA 5D1XB 3VD9A 3UTQA 2JB6A 5DS8B 5GS2D 4PB9H 3M17A 4HW6A 4PJXB 2CLZA 1JHKH 3FONA 5F1NA 3QULA 3SDXE 1FGNL 4R4FH 2H6PA 1VFBA 3DROB 5IVNA 1FAKT 2DL9A 3EJJX 1P5VA 3V4VL 1IC7H 1OPGL 4WY7L 3MLTB 4G9FD 4JN1H 4K7PL 2G75A 5HI5D 4RGMB 2A77L 4HF5L 4KJYA 3QDJA 2C26A 1BJ8A 5F1KC 3MJ9A 4IJ3C 4Z7VF 3R4DA 3MA7A 4JRXE 5H8DA 4P23D 4ZUWB 4OTXL 4HK3J 4XI5D 3TPUA 5SX4H 1YNKL 3L95B 3QUZB 3PGCB 4L4VB 3LKOB 1RUMH 1CFTB 3BVNB 2O5YH 3U0PB 2E3VA 3LOWA 3WFBH 3JWDC 4UNTA 4X6EA 4QTIH 1LO2H 3TLRA 1IAIL 2F19H 4JFFB 5KSVA 5CZVL 2CLRA 4L1DA 3QPQD 5FCUL 1D6VH 3V6FB 4JFPB 3E2HC 3DRTA 2F54E 3QHFL 1Q9KB 3WFCH 1SJVA 4L29A 4BSWB 3O8XD 5BO1H 1NLBH 1AXTH 2FSEA 4JPWH 1MCOL 5E6IA 1YNTB 3VFTA 4U1HA 4M1GL 3WSQL 1XGUB 3IDXH 2FHCA 1SMOA 4UV7H 5FCUH 1S5IL 4RAVB 3G5VB 2HG5B 4J8RB 2BVTA 2WWKT 3HUJF 4IDLA 3TA3D 1U6AH 3MROB 1CGUA 1QKZH 3TZVB 2XWTA 3UC0L 3H9ZA 1UZ8B 4NKDA 2F53E 1JCKA 1O0VA 4XPGH 3VD5A 1LDPL 4I2XB 4YBQD 4GG6E 2ERJB 1CR9L 2HP4A 1WIOA 1OP3K 4NRZB 1OM3L 1DBKL 5D2NC 2D9QB 1QEWB 4P49A 2NCMA 2WUCL 1K4CB 3OBAA 5LBSL 5ETUB 3O6FD 2IQAB 4LRIA 2FEDC 1WT5A 3TO2A 1ZLUH 4O51A 5DEFB 2YUZA 1NGYA 2R0LL 4YIQA 1HXMA 3RGVA 2HRPL 1BWMA 2CLVB 1S7WB 5K93A 1KJ2H 1I7ZB 2QKIA 4LQFL 5I30L 3DECA 1QBML 2BJML 3DVNB 4NRXB 4Q0XH 4LFHD 5E00B 2NY3B 2IPTL 2HVJB 3VFRA 2HT4C 3DI3B 4LSTH 3QAZC 1ZHKA 5D93C 2RFXB 5E2UL 4PGCA 1L7IH 2H9GA 5JOPD 4NM4H 4DUWA 4U7KA 4RFEB 3TO4A 3H3PL 5GGQL 1GYAA 4WHYH 4LF3B 4YR6B 2XWJA 3ZE2E 4MD0A 5I75B 3HR5B 4QF1A 1A14L 1T04B 1L7TL 4ZO6A 1D5XB 1JPFB 5FUZH 4PRAB 2Y7QA 5FYLL 2A6KA 2BVPB 3MPCA 43C9B 3L3HB 1RZFL 4PJDB 4NN7B 2OL3H 4R4NC 2ARJQ 2OJZL 1QFWM 5FO7B 5IF0B 5MP6L 5IHZA 5KVDH 2R0ZH 4EBQH 3OKOB 2AXGA 1PQZA 2ZUVA 3D3VB 5E6YA 1CXHA 2X05A 3T0EC 4KQ4L 2Q20A 3CVIL 1BOGB 3S35X 3O9WD 4HKJB 1G6RA 3K4ZA 2ESVD 4APQC 4LARL 5ISZB 1UYWH 1T2QL 1ZLSL 5C2BL 1XCQA 4H5SA 4Y4HA 1Q9WB 4J1UA 3MZGB 5C9JB 3PV6A 4CRPA 4YQXL 4GW4B 3CDYA 1INQB 3IAQA 3PWLB 4Y19D 4I0KA 5FM4A 2APVA 1UB6B 1VCAA 5DMYA 1IT9L 4UDTB 1IM3B 2AW2A 1MJ8H 4OBSA 3O2VH 1MEXH 1KBGH 5I15H 3QDGD 4KK5D 3MLSH 1PW3A 3N0PB 4CADA 2VABA 3LAFA 3GBMH 1KCLA 1MJJB 4RMRA 3LQAL 2Q8AH 4MZ2A 2DQTL 1MF2L 2DM2A 2NZ9D 3O4OB 3PHSA 2KDGA 3BDYL 4JDVB 1MIEH 4AH2B 3LSOB 3UJTH 5EN2A 3HFMH 4Y4FB 3RPIA 4OLVL 4X6DA 1J0IA 5DF0A 2ICWI 2QSCH 5GGSB 4NQCB 4H20H 4F15C 5IK3A 3TYFA 5D2LA 3EJZC 1QRNA 2J88H 1JGLH 4GH7B 2ZSWA 4JFDD 5EWIL 2PR4H 3MV7E 2V7NA 3EDJA 4N0RA 3GNML 2VDKL 3RAJH 1F90L 5DI8A 3EYUH 3OKKB 3MV11 2DQHH 3WFDH 4ZOCA 1IQDB 4JG0L 4C56A 3NN8A 5B8CA 3FZUD 1CF8H 1ZHLB 4EN3C 2Q76B 4R4ND 4M1CD 4U6XA 1NC2D 3A6CL 1ORQB 2E6PA 4XPFL 4Z95L 1GRWA 1T66D 1AJ7L 1CGSL 4Y16C 4MHHG 2MNUA 1R3IH 4P2OD 1S9VB 4OZIF 3T2NL 3FMGH 3SDAB 5A3IC 3T77B 2YPKA 3HA0A 4YAQB 3FQTB 3F58H 4NQCA 5EDXA 3GMNB 2YEZB 3QO1B 3WD5H 3BH9A 5I1IL 2GJZA 4NKQB 4OAWB 1R5VB 3LD8C 5IHUL 3LS5H 4JAMA 4NHUA 4HJJH 3LIZL 4OJFL 4YHKL 1QRND 1DEEB 4OI7A 3C87A 3P73B 5KG9B 2R1XB 1B6UA 3GBNL 3EFFB 1KV3A 5CZXD 4QRPD 3IXAB 3GGWB 5E8OA 5ADPH 3TM6A 1NLDL 5DK2B 5C07A 2PTTA 2XKNA 2VABB 1MIMH 1NMCC 4KUCD 2P45B 4XAKE 4C56D 4H25B 3QEGH 2ICEB 4LSTL 3GIVB 1E6OH 4Q6IB 3C2AL 1NLDH 3D39B 1MFEL 3RL1A 3OMZA 1NCCL 2AEQH 3HC3L 2F5AL 4LSSL 2R39A 1DQDH 3RIAF 1GGYA 4XHJD 3BP7A 2VLRE 1DN0B 2EXYC 2VLKD 4LRNH 3RL2A 5MENB 1NCAL 2APFA 2ZUTA 5IJVA 5LGHH 5DGRA 4WGVB 2EDFA 2D03H 1CYGA 3QJHA 5SV4A 1G9NL 5DMIH 4KKBC 4CMHB 4OZIE 3B9KB 2Q6WA 2BVEA 4WU7A 5EUKB 3VFOA 1KIPA 3F7PC 1CT8A 4PRPB 1J7VR 2PXYA 5J8OA 4A2LA 1BD2A 5IOPA 3QXDB 4J6RL 2X4RB 4JVUA 4JFEB 1PQZB 3D3VA 5DUML 2H2SC 2R23B 5HVGB 4PUBH 2W0FB 5I19L 1J18A 3ARWA 1D5IH 3KGRA 4YDKH 1CLCA 2H32H 4P5KA 4PJEA 3MV9B 4JFQA 4KV5E 3LEXA 5GRVK 1YMMA 4P5TB 4OZFA 1UXWB 5KS9B 4X6DF 4DJMA 5FYJD 3JTSB 4L4TD 5F89B 1MY5A 1L0XA 2FGZA 5CZVH 4MVBD 2VDOH 4FXGB 1LO4H 1OAZH 3DSFH 1KPRA 5JHDB 2IAMC 3SCMB 1WWBX 1N0LA 4RDQF 2DQJL 1WVZA 3Q3GB 4U1JB 4Z76A 2BNUA 1AIFA 1DBBH 5D6DA 4GAJL 4GRWH 1MHEB 5IEKB 1FL5B 3H7LA 5C6PB 4AEHL 3RA7H 1CLZL 4WTWA 2JCCA 5JOEA 1XF1A 1JGVH 1FNGB 1UKTA 1Q0XH 1WEJL 3HE6C 4PGDA 4AZ8A 4PJCE 1REIA 3ARGB 2GUOA 3VXPA 1FL3B 1INDL 3DGGB 1PG7L 4JJ5A 4XGZA 2Q86B 3RVWD 1WFTA 2D4DA 3ZKXC 4FQQB 4NYLB 2DQTH 4O4YH 4EJ1C 5GGRB 1OPGH 3S97C 2BY0A 5GRWA 4PJDE 3ZHLA 3TVMB 2Q7YA 4E41E 2FWOB 4QGTA 5DJYA 2HTKD 3U2SB 3X11B 3D3VD 2D2OA 4U3XA 5IEHA 4CVUA 3QUML 5FA4B 2FX9L 1A22B 5CCKL 3MCG1 1W0WA 3NCJH 4PRIA 3L3OA 5F9OL 1YEFL 5ILTL 4X7DC 2IF7A 3KLAA 5HD8D 3TP4A 3SKJL 1FE8H 2XTLA 1TIUA 3TFKD 1CK0H 1UFUA 1I8MA 4NQTA 4Z77A 1G84A 2DOCA 1KTDB 3CFEA 1OP9A 5IB5B 1GOFA 3CFBB 4NQSA 4O2EA 2VH5H 4WU5B 4FQ2L 5KW9L 2UY7A 4JKMA 5EBMB 4M6OH 3ARFA 4LARH 3OXSA 5I8EA 4HUKB 2QQNL 3P0VL 3EHBD 3U82B 2Z0BA 4JFFA 1ZMYA 2MHAA 4BQCA 1LMKA 3ECBA 4YDVA 4EOWH 2MSPA 2NY5C 5J6HB 1J05B 1J0HA 5FDWA 1HZHH 3BHBA 4WW2A 4JFYB 1ZT7A 2AEPL 2OL3L 1U8IA 4R3SA 4TOYL 4XVTH 2LU3A 1JWUA 3TJEH 3NFSL 3H8NA 4WWKA 5ID1A 4XC3L 3RBSA 3B6SB 4LIQH 5A16B 2QR0B 3BYYA 3ZL4L 5FYKE 4RFOL 5IWLA 4JQXC 2AK4D 3GRWA 1U0QA 4Z77B 1MI5E 4JKLA 4KZEH 5DO2C 1EHAA 3G04A 4NM4L 3VXUD 2FBOJ 4U33A 1KT2A 3T0BA 2VXTH 5FOBB 1R24A 3ETBF 3S88H 4IRZH 4GKOA 1C16B 4XPAH 5FA4A 5F8RC 4CJ1A 1WV7T 3O9WC 1A6TB 4NKMA 4U1IA 4MNGB 1CDIA 1MHHB 1U2HA 4OB5L 5A2LH 5EPMA 3STZB 1I7RB 4PD4J 1KN2H 2V2WA 2BNRE 2CDEA 3D18B 3VW3L 3PL6B 3G5ZA 3T8XA 2VLLB 1HH9B 3CVHB 1JYNA 3BRDA 1JTOA 5CINL 3QISA 1JNLH 4BQ6A 1VFMA 4Q9CA 4XVUC 4IMLA 5EU6E 4XCYB 3GSOA 5TDOB 4O58H 1G9NH 5I74C 4MZ3A 1MHHA 3MRIB 1FZKB 2BRRL 3TO4C 3LQAC 1F3JB 3LCYA 4M93C 4PR5A 2VLJD 5C0CB 2ZUXA 4AMKL 4LP4A 3MLZH 1KB5A 4XPTH 4PGEA 3H9YA 4V1DD 5I8EB 5T5FL 1KPRB 5TQ0L 1ONQB 1FL3A 3UYRH 3GSQA 5KBNC 3C2AH 4MXVE 2LU4A 3NFPB 1A6WL 3ROLA 5BJTB 5LQBH 1N7MH 1HHHA 1J1XL 3VD3A 1DFBL 2EDYA 5FIEA 1I9RH 5GIRB 1VFAA 4LVEA 4TVPL 3O3DB 2GK2A 5BXFB 2EIZB 3T65B 4MA8H 1AO7D 5C0CA 1F3JA 4PR5B 3SCMA 1U3ZA 3P11H 5HYSB 5K59F 1IGYA 3DUUA 1BQHG 3IJYB 1S9XA 4D9LL 3O6FC 5IEHB 1JYXA 1X5HA 4PG9B 2IPUG 1H5BA 3KJ6H 4I5BA 5AG9A 4RCAA 4V2BA 3LIZH 4HUXB 3RUGA 3E6HA 5F97E 4K55A 3KNBB 2V2XA 5IFAL 1KJMB 3I2CH 5D1XC 2GTWA 2Q6WB 4NNYA 1QFWI 4PGBB 2GY5A 3RQ3A 4L8CB 3UDWC 1IKFL 3V8OA 5IT2L 4FZEL 1KC5L 2CJUH 1CBVH 2EDBA 1MREL 3U1SL 3A6BH 3QDMD 1CGSH 1QLEL 4PGDB 2DD8H 2AEIT 3MV9E 5A40E 1FL5A 1Q1JH 2ADIA 2VN4A 3CPLA 3D39A 4RX4D 4ZQKB 3DXAD 4LCCC 4OZFG 3V5HB 1R24B 1IAII 1GGIL 1V3MA 3ESUF 4H0GA 4HWZA 3MOAL 2DQHL 3WFDL 5EH1A 3TESA 4XZUA 2LTQB 3GSXB 3CMOL 2R2HA 4S11A 4DGVL 1L9NA 5IBTH 3MV9D 3WIFA 2LV4A 5SV3A 3TVMA 4B41A 4XC1H 1TENA 3QEQA 4HZLA 4MWFA 4JQVA 5FECB 4LLVA 2HKFH 5DD5H 4G8EB 4BUHA 1RI8A 1F45A 4L3CB 5D96C 5F7EH 5JHDD 4JAMB 4XWGH 4PJ7F 3ARDC 5F3HB 5C2UB 1U9KA 3RVUC 5CP7B 3QBTB 3PGDB 5DYOB 2VDPL 5E8OB 1FSKC 4R90L 5INCA 1U8KB 1FC2D 3VFSB 1JF1A 4HWBA 2VSCA 1LEGA 3IDYC 4XP5H 5L88H 3ULUD 2VDPH 4DUVA 3WLBB 3G5YA 3VWJD 3GJFK 5B8CC 2Y72A 4NRYB 5IROC 4NZRL 5JQ6H 2AJYH 4WU5A 1FPTH 3ARQA 3KPOB 4ZFZA 3T3ME 2DLHA 3U46B 2YEZA 5FEBA 2NW2A 3QWQB 2MOVA 3IAGC 4HH8A 3SE8L 3MV9A 1MRFH 5F1SA 1NANI 1U8LA 5HJ3A 2V2TA 3OF6D 4UNVA 3RY6C 1W0WB 3O6LL 1GIGL 3IAPA 3NH7H 5FM8A 4AL8L 2R23A 3I75A 2FZ3A 4S1QL 3GK8L 3IGAA 4PTUB 4YGVA 1F11B 1FO0H 1TCMA 4M43L 5D2LB 1U8HA 4OFKA 4WU7B 5EUKA 5HYJB 1DQJB 1GVIA 4YHZH 5L8KB 2R0WH 4Y4KA 5JUEL 4H1LG 1S3KH 1GSMA 3LRGA 5E7FA 4I77L 2MQ0A 3JWNC 3B9DA 2EH8H 3GSUA 3QUYB 3BFOA 4KXZI 5K9OB 4M5ZL 7FABH 3HB3D 3ARVA 3TGXA 1DN0A 5KVDL 3SE4A 3BKCH 3H9HB 2IAMD 1G7HB 1V7NH 2QSTA 3HTLX 3V0AC 1IAIM 3T3PE 4BK4A 1KJVB 2VXSL 2AXJA 5DJ0B 5D4QA 1FZJA 1MHEA 3RUGE 3V79C 1IEAA 3GMLB 3PQYE 1F42A 3MRPA 5F9JB 3MLWH 5CUSH 4PS4H 1TCRB 2Z31C 4X6BB 4OQTA 1F3DJ 5J12B 1MFAH 4JY5L 4JPKH 5DWUL 3H9SD 3RTQB 2YPLE 3DV4B 1OAUH 3CK0H 4ODUA 4PV9A 1X9QA 4WI7A 1JN6A 3WLWD 4LKXB 4PJ8D 1RU9H 1N5AA 1XF2A 3W39B 4M7KH 1RULH 3VXUE 1NAKL 3QIUB 1IEAB 4RSVA 1T7VA 1IBGL 3BH9B 5GGVH 4KTEL 3U7AA 4P5MA 3CFKA 3FOMA 4AEIH 2K9UA 2R4RH 3H9HA 5HGDA 1U58A 4PRIE 5KS9E 5FA3A 2J4WH 1YNLL 1I3GH 4OFIA 3BKMH 1BHGA 1G7IB 2GCYA 5FKPB 3VWJC 2P43B 2WWMD 4F7TB 1OSZA 5IHZB 5IF0A 1NKOA 2W59A 3H7BB 2NY4D 4EDWH 5LBSH 4H5SB 1J9CT 4PJGF 1N5AB 1KJ2A 1U95A 3O3EB 4GAJH 1EH9A 3BW9A 1RIHL 1I8IB 5C0ND 4WUUE 3U4EB 1OT2A 2IPUK 3EO9H 3MCLH 3IT8D 2CGRH 1WWWX 1I1YB 5DI8B 5F1OB 3RL1B 5CSZB 3L5XL 4LLQA 3CDCA 2F8VA 3IDXL 3OKEA 1X5AA 3GMLA 2EIZA 5C0CD 1T1ZA 3CH1A 2AXFA 3ZTJG 1C08B 2VITA 3QRGH 4P4KD 4IRJD 3HNTL 4LGSB 4RMWA 1G7QA 1LK2A 2VISB 4PJBB 3CLEL 3NFPA 2NY7H 2VLMD 3L1OL 2GY7B 1FDLL 5HHXH 1C8PA 2V9TA 4Y4FA 4OZGF 2F54B 3MRPB 1JF1B 2OL3B 1IM9D 3V5HA 3VFGL 5LXGL 4M7ZB 1MWAH 1MHPH 3MYJB 1MJJA 2X40A 5T3XD 1ODAA 3VXOA 2X89A 1BOGA 1G7HA 3EYQC 1OCWL 1LVEA 1QEWA 1X5YA 3I3BA 1EVUA 2FZ3B 1SJEA 4X83A 4ZUUB 4GKSA 1D5MA 4K7PH 3HG1D 4UQ2A 1ES0B 4YLQT 4UINL 4L8CA 4PGBA 1HH9A 3DV6B 2H26B 2A6DB 3G5VA 3QDJD 1EJOL 2F5BH 3AAZA 4ZFGH 3KAAA 2R0KH 2NW3A 3SN6N 2YPVL 3LDBC 4KKLC 2BERA 3AM8C 3T1FB 5KW9H 4R2GC 3NFNB 5I1AA 3NAAH 4AQ1B 4Y5XA 2AGJL 2H2PC 4KVCH 3NIGF 1HHKB 1P4IH 4J4PC 1FE8L 4HKJA 5DGQA 3REVA 3ZDXF 1U8KA 5EFIA 3P0YH 5M94B 2HG5A 1OARL 1LO5B 2WBKA 2AABH 3B3IB 4U1HB 3U46A 5FYKU 5IMOB 1NUNB 1I3VA 4ODTH 3D85B 1NMCB 5EC2B 2VNCA 4MGXA 5FB8B 4Z7WF 3NPSB 1TNMA 5IVXE 2AJSH 3RUGB 1IEHA 3EZ8A 1N5YL 1T0NB 3KLDA 4JRYD 1UADC 3OXRB 2DLFL 2DM3A 1IGYB 2YR3A 3DUUB 5JUEH 4WFFE 4CN1A 4R97B 4X9FA 1CDUA 3L3JB 4PJ5B 1EHLH 3FN3A 2DQIH 4QRUA 5GS0C 5HD8C 2VYRE 2AI0L 4OFVA 4ZO8A 2GJ6D 3TT3H 1A9BB 4XNYH 5ALCH 4DCQB 3WIHL 4HIXH 4FZ8L 5CJXA 2V5SA 4P59L 1T1XB 2DBJA 4I2XE 3H42H 3VFPB 1HN1A 1KCUH 2ADJA 4LPTA 3VFRB 3ZDYF 3PV6B 5CSGA 1KLFA 1RIVH 3NIDF 2DWDA 2R2HB 3SE8H 2HMIC 1KB5B 4H8WL 3FTGB 5SWZB 3SDCB 4UQ3A 3TCLA 1X5FA 4LSDA 2R69H 2G9HA 2PO6D 4NBYB 3RGVB 1WFNA 3FONB 3CIQA 1A1NA 1XGTA 5HI5C 3X11A 2VC2H 4I18B 5C09A 1NGWB 2LE9A 4L1HA 4MAYD 1MLCA 4LCIL 2OBGA 3AS0A 5EIQA 2QJDA 3H0TB 3FOLB 1BD2E 2QR0A 5F96L 3MNWB 4UILH 4PP1C 3R8QA 5HYJD 1Y18A 5B38G 4KQ3L 5F88B 5IMMB 5HHNB 3N50A 3O3DA 1GC1L 1KJMA 1ZWIB 3BMVA 3ZKND 2YRPA 4X6DE 5KVMC 4JFXA 5I8OH 2NX5A 2YD7A 4UIKL 1CTOA 4R8WH 1NC4D 4JO4L 4Z7VA 1S9XB 4ETQB 2IAMB 3SCMC 1ZSDA 4W6WB 4PY8J 4LOUC 4JFPA 2OTWA 6FABH 1G7MA 5IBTL 2GJ6A 1ZSDB 1KNOA 5DK3A 1NBYA 4RZCA 5E2VL 5LAXA 3L7EA 1YA5A 5DHYA 1HNGA 4HIHB 4MCZB 2B4CC 2RHEA 3FB7A 4BFBD 4O5LH 3UXFA 5JMRA 1UCBH 1OTUD 2V17L 4QHUB 2DS4A 3RTQD 3WO4B 1QR1B 4OCRH 2IG2L 2X6MA 3VD7A 3BUYA 1QQDB 3CVHA 1KB5H 3D9AH 3BRGC 2PN5A 3SOBH 2B2XL 2AJXH 4HGWB 1PY4A 2WP3O 4AIZA 4APQA 1ITCA 5EZIH 3HHRB 2V7HA 2HWZH 1LO0H 1RURH 2W65A 2F74A 1S7XA 4M00A 1IC5H 3LH2L 2EEBA 2NY2C 3ZDXE 1VEPA 1QSVA 4UQ3B 3OKNB 3KYNA 1T5XB 3AS3A 4YHNB 5AYUL 2QV2A 4N9GA 3T2NH 2DL2A 5MENA 3PL6A 4NPYB 4WUKH 5SWSA 5MEPB 5KSUB 1U8PB 4L5FL 1AGBA 3TPKA 4NQEA 1E4XH 4OF3A 4YE4L 1ZKAA 2V5YA 4FNLL 4P3DB 2CUIA 1ADQL 4PIRF 3WO3B 5I73B 2F8OA 1A9BA 3DETD 3NPZB 2VDML 5J6GA 4R3SB 6CGTA 2ADGB 5KSVB 2EIDA 1BAFL 3EHBC 3JV6B 1Q9OB 5F3BA 1QACA 3QR2A 1F4WH 4L9LA 2XKNB 2E7HA 1NC2A 1TVBB 4J7RA 5KJRH 1QRNE 3PGCA 4ONFH 4Y2DC 1Z5LB 1IAOA 1FAIL 1QA9B 4KMTH 3T08A 4XP6H 1NDMB 3P9MB 4HPOH 2DBLL 2DM7A 4R26L 2X2YA 3NMEA 4MLIA 2QL1A 4KAQH 4EI5D 1F4YH 5I17B 3P4LA 2QSCL 1K2DB 4HKBB 3EJYD 4RISL 5B4MD 1DEDA 3CFBA 5FDWB 1OAYL 4MJ2A 4PJ5E 4XH2B 3HMWL 4GW5B 5L2KD 1OAQL 4X0KA 1FNHA 1AFVL 4ZFOL 3HZYB 4ZAKA 1U3HD 1RMFL 2X4RA 4G6JH 5ID0B 2O5XL 3EDKA 3SDAA 4MNGE 3UJJH 4N0CD 1CICB 3ARBB 4HH9B 2GT9A 1PSKH 2PYEB 5C0GA 2FX8H 3L3GB 4ODSH 4A6YA 1KIRB 4KTDL 4DN3L 1OP5K 4OD3L 4Z7NF 1HYSC 3CGTA 5DJYB 1MEXL 1KTDA 2MPAL 3QPXH 3P9LB 4H1LH 4PJGA 4AM0B 3S88L 3VI4E 1TPXB 3A0OA 2NMSA 4H8WH 5IP4A 2F19L 4JFDE 1QBLH 1S8DB 1D5MB 4UQ2B 3QUXC 4JJ5B 4F58L 4S2SB 3FRUB 3IDJA 1CQYA 2EC8A 4XXCC 3S96A 3B9KC 1BD2B 4XBGB 2O26U 1PZ5A 1LE9B 4QLRA 2JCCB 5C2BH 4JY4B 4NZJA 1Y0LB 3MYJA 1K5NA 4AENA 8FABB 5D7JA 1T20A 1NEZG 1QSFD 4OGZA 4D9QE 2X10A 1DEEA 3O45B 1N5YH 1SEBA 1YYLL 4NHUB 2VWEC 4R4FL 5F89A 3U30C 4OCSH 4G9DB 4LBEB 2R0WL 2W0PA 2NZIA 5IJKC 2F53D 2P5EA 1XGPA 4I18C 4ORGA 4X4XA 3WE6B 4K23H 1PKQE 1YEKL 4M43H 3QNXA 3MFGB 5HI3D 1J86A 1N8ZA 4G7YL 4AL8H 2Y9RT 4G7YH 4X5WB 3WBDA 4GT7A 5EULV 2DDQH 3J7HA 3RU8L 3C60C 3CUPB 3FQRB 3PDDA 1CICC 4LVHC 3IDGA 4Z7OF 3AXLA 4KI5F 3HZVB 5DJZB 4NQVB 4GS7C 5HYEA 5GGUB 4LNRB 2HJLA 1MCDA 4NZRH 5JQ6L 4G8GA 3VGFA 5SWZD 3SDCD 1B0GA 4NZUH 3M07A 2YD5A 2FB4H 1H0DA 1MCPL 4LU5L 2A73A 3W9EA 1B0RB 1EBPA 2HRPH 3TBYA 3OAUL 2FGWL 2BNQD 3MRNA 4PLKC 3OR6B 3RJDA 4HX1A 3QIUA 1DQQA 1GZQB 1OCWH 2D3VA 3DYOA 4CU7A 1I8LA 4H25A 4Z8FL 1BFOA 3MV8D 3GUTA 3QCVH 1A6PA 2X41A 3WYRA 4N9OB 4YHLL 4G9FE 4JFZH 4DVBB 1TTGA 2PTTB 2E8ZA 1H8NA 5EU7E 2WIIA 3BP7B 2QADC 4ZD3L 3RIFF 3HE7D 2ZWLT 3DSFL 3SDCC 2UY6A 3L1OH 1YEGL 1TVHA 1WZ1H 1NGPH 2XWJB 2I07B 5JW4M 1P7QA 4QYOA 4DKEH 1QPPA 1IMHC 4FTVE 4UT9L 2JJTA 1Q8MA 3U9UA 1NDGA 1RZKC 2VDMH 5BO1L 1N6UA 1MI5B 3QHFH 4KDWA 3WEXB 4U6HB 1PSKL 3LPGA 4YHYB 3CVHL 3GJEB 1UM5H 4KK6D 1U91B 2AJ3A 1RJLA 3BN3B 2YPLD 3A6BL 4QNPE 4HFUH 1FNFA 1MNUL 2XN9B 3EO9L 5FK9B 1Q9WA 2V9QA 1LEIB 5ITFB 2NY5L 4RISH 3GKZA 5H35B 3FJTA 4YHPB 4XMPH 3B9VA 2ICES 3PE9A 4K8RH 1XCTB 1G6RB 2JE8A 3MRKB 4KAQL 5A43C 5HGGS 4MB4A 4L8SC 4F7CA 4M6NH 2EYSA 1NGXB 1JBJA 4NRZA 2AXGB 3FRPA 3IFLH 4K9EL 3VGGA 2J4WL 2YBRB 5LWYH 1A2YA 3MBXL 5CD5D 2EEDA 3RDTA 2D7NA 3MROA 4DK6A 1ZS8B 4Y0GA 4POZD 4NKOA 5E4EC 4D2NA 1BAFH 1N6QL 5EOTA 1MRDL 3X3GH 2BHUA 3EO0A 5K59E 3QIWA 2F15A 3V52H 2OI9B 2IPKB 4J1UB 4Z7WB 3L5HA 2J8UA 5AAWA 5J11C 4NRYA 4JGUA 1CGWA 1MFBL 5C0CE 2NXZB 2OR8A 4W68A 5DWUH 4POYA 2V7NB 4HIEB 1EMTL 3HC4H 4Y5YC 4TRPL 4M8QA 2Z8WC 5F44A 1KCRH 1HQ4A 4NO2B 2XQBL 3BZ4A 5DDHB 4POZC 4L4VA 1WCBB 5J7CC 2IFGA 1Q72H 4NO5B 4P57B 4UNUA 3MRMA 1NBZB 4O58L 4XP4H 4FQXA 3GJFH 1JZ6A 1DBMH 4MXQD 2C9AA 3QUKB 2CKBH 3PWPB 3O8XC 4TSCH 3B8YA 4PV8A 4ZUTB 1ED3A 4W4NA 5ACZB 4UTBH 5ABDE 1R3JA 2IQAA 5GZND 5IBLD 1KULA 4G8FA 2QQLL 4Z9KB 3FO9A 1MCWW 4GLRH 1OW0A 4UAOC 1JE6A 2GITA 3BQUB 2H6PB 3FQXA 2XOTA 2QSVA 2BVQB 3SGDH 3CCHA 3DMMC 1BLNB 2WP3T 4PJHF 4ZQKA 4ELMA 4D0CA 2EH7L 2BDNL 3DVGB 5BRZD 2NY2D 3PWLA 5DC0A 2GQHA 4GW4A 4F58H 3SDYL 3V8CA 5BVPH 3U36A 1BF8A 1GC1C 4QY8A 3MRJA 3Q6FB 1FO0B 4P3CL 2Y4SA 2R4SL 2JB5L 4JHZA 1HCFX 3ULSA 4HDIA 3VXUA 2ZNXA 1FH5L 3GI8H 3ZHDA 4OV5A 4R96A 4BKLA 5IBLC 1NGYB 4FZ8H 4NCDA 2M1KA 4I0CC 4PJIF 1DBAH 2YPLA 4NZDA 5IESH 2A6JB 1R5IA 1B2WH 1HYRC 1UXSA 1QRKA 3SKOA 3I6LD 1RIUL 1DVFB 1LNUB 1FIGL 4WDIB 1U42A 3TC9A 4GLRI 3QUZA 5GHWL 4EOWL 3GBML 3PQYD 4J3XA 4HULB 4AK1A 3PGFL 1TXKA 5E8NB 2CIIB 1EBAA 2BVPA 3H3KA 4LL9A 3S35H 5J3HC 4CN6A 3UROR 1D5XA 4XNQA 3DVNA 4NRXA 4GAYB 1Z3GL 2VUOA 3M8OL 4JO2L 4L29B 4UAOB 4RWYL 2XACC 4MYWB 2WM0A 5HVHC 1I7ZA 3MLUH 3KLHD 2VZ3A 2GAZA 4TNVF 1TNNA 3QULB 4RGOL 3GI9L 4N0UE 4Q97A 4PGCB 4DGVH 4CVZA 5ISZE 5D96B 1MCEA 1F58L 1XF4B 5I1JH 1MFBH 4QY8B 5D1XA 1KEGH 2DQFB 3MNZA 3TIDB 1A21A 1VB9A 2XA8L 4BELD 5DJ6A 3SGDI 4U0RB 3F5WA 3WJJC 2X1PA 4JHAL 1JJUA 2ITDA 4LEXH 4G6FB 4ZUWA 1CXKA 3RZWA 1N6QH 3FHAA 3CLFL 4IRSB 1JFQL 5T1DH 2OTPA 4HWEH 4L4VD 3QCTH 4O51B 4HUUA 1IJ9A 4V1DE 4X4YA 5I1LA 2JK5A 5D5MA 4XP4L 5AZEL 5CS7A 2DKUA 4JFFD 4P2CG 4TSAH 1P4BL 4I0PD 4EVNA 3GJFA 4R4BB 4URTB 2OP4L 4W6YB 5IMLB 1F8TL 1X5ZA 4TPRH 3VFNB 3V6FA 2WBJC 5HYFA 3AY4A 3N1MC 1BVLB 2A74B 1Z9MA 5EU3B 1Y6KR 3F7VB 2FECI 4GKZB 2HA1A 3KWWB 2FECL 2WBJB 2PETA 2H3NB 2IG2H 3VFTB 3OJ2C 1J1OH 2X4UA 4M8QB 3DPBA 1MCWM 4HS3B 3TA3B 4U1KA 5HHVL 4XCFL 3I02A 3KPNB 2BSED 3DO3A 3ZMRA 3ET9F 5JDSA 4N0YL 1YECH 5HGHA 5D1QC 4FN0A 4YZFF 5GZOD 3MA7B 2V5MA 4MA7L 3KPNA 5GS1B 4AY0A 1ZT7B 3UYRL 3IFPA 4YBQC 1QO3A 3MRGB 4LQFH 1X4YA 1GAFH 3EO0B 3MLZL 4XPTL 1YDPA 4YUEH 1HDMB 4MQSB 5IGXL 1VACB 5DUMH 1MI5D 1MAMH 3S36L 1PEWA 1Q94A 1URLA 4GXVH 1QR4A 1KIQB 4OZHA 4ETYA 2FNBA 4R7NB 4HK3N 2NY6C 3V4PH 3BQUA 1W0YT 2V5TA 1NAMA 3NCYP 4X7EC 4XNZC 2JK5B 2XWBB 4GXVL 3EFDL 3QXUA 5ACZA 2HT4D 1SEQH 2YN3A 3VGAC 4O2FA 4XXDA 4YHOH 5D6CB 4GUPA 3RWDB 1S7VB 2YXMA 4AG4L 2NTFA 4KJPD 2JKXA 3C9NA 4P4RA 3S8WA 4Y2DD 1NUFA 3GRWH 2FHFA 4PP2B 4YHIB 1F6LL 1YJDL 1BFVL 2CK0L 1FJ1B 2SEBB 5T5NG 32C2A 2FWOA 1T7ZA 3L5XH 4QGYA 1CWVA 1OAUL 3CK0L 3VMNA 1T5WA 1T0PB 1DCLA 4QRSB 2ORBH 3ARSA 4UT7L 4RNRA 8CGTA 1CD0A 5DQDL 1LP9F 4FQ1H 4NUGL 3VH8B 4U6TA 3QYCA 3LRSB 1KN4H 5D7KE 5ISZD 4R7DB 1SYSB 1LO3L 3QWOA 5E8NA 4MQXD 5E1AB 3WD5L 1ETZA 4KZDL 2J3SA 4GJTB 3MR9B 4P4KC 1P53A 2CIKA 1UB5B 3RWGB 4GRLC 1LILA 1OTSC 3C60A 5CJOL 5T1DL 1NGXA 1UACH 3WS6A 1EK3A 2A6JA 4BQ8A 4Z0XB 1DL7H 2YSSB 4Q7DA 4MXVF 3LEYH 5D9SA 2BNRD 5EIIA 1WAAF 3KDMB 3HC0A 5T3ZL 4ODXB 2LFGA 3AREA 3RTQC 1EAPA 3F65A 1A3RH 3B8SA 5TDNA 3M1BB 1RUPL 2DYPA 4ODHH 3RVXD 1NC4A 3RVTD 5EU7C 5T3XL 1R3KB 2J5LC 3WS3B 5BRZB 3QIUC 4JR9H 3M8OH 2XY1A 4JO2H 4N8CH 4U1LB 4XBEH 4PJEF 1NJ9B 4Y4FD 4JVWA 2FJGB 4ZS7H 1GPOL 3X13A 5DMGC 3BZFB 1RK1A 1RSFA 3NCCB 1XGQA 3BD5A 3MGTA 2OZ4L 1B9ZA 2QBWA 4MDJB 1JL8A 3EYOA 2Z31D 1DANU 3REWA 4MCYA 4PY8I 4OF7A 1IGIL 1FORL 2EKSB 1A6UL 4N5UA 1FVDB 5L8JB 3P40A 3WUWA 1ETZB 3V6BR 5SWSE 4FRWA 4K3JH 1CS6A 4XBGA 3GHEL 2HT2D 3L5WB 3QDAA 3BPCB 5CZKA 4CBPA 4OCXH 2DQCH 2CXGA 5I1HL 3D69B 3VJ6B 1RY7B 2VDOL 3GKWH 4G8GB 4JPIB 1H3XA 1IFHL 4LEOB 4Z78A 2NR6C 3DBXB 1ZT1B 3MACH 2F53A 3FT2B 3AROA 5GPRA 2RJMA 2J6EH 5DFTA 4MJIB 4YDLB 4ODSL 3PF2A 2FEEL 4Y5VA 1U8JB 4KRLB 4OF8A 3FQTA 1SBSL 4NKOB 4PUBL 5CGTA 3PNWB 5J4MA 1T1YB 4IMKC 3MCLL 5D2NE 1AKJA 2J8HA 1ORSA 4JM2C 1AR1C 5DT1L 3ZT7A 1OAYH 5AYUH 5DQ9A 3VFMA 1NGZA 1TJHH 5SWQB 5L0QB 2C4FU 3VXNB 4ZNEA 5DMIL 1PYWA 1S7UA 4IRSD 1GGTA 4F37F 2FIKA 5HVWA 4E41A 1S9WA 4C56B 2VZSA 5M7QA 5IIEA 4C83B 1CXIA 4IRJC 4FA8A 3U7WH 2GTZB 5IVXF 3KJ6L 5EZLA 2VL4A 4PJ9A 1KCVH 4MNHA 2R4RL 3SOBL 1MWAB 1R5WA 4HMEA 4HWEL 1HH6B 3L5WA 3TV3L 2HVKB 3I9GH 4OI9A 4WO4A 2A6IB 3CSYA 5MEND 5FGBC 4DZ8B 1AXIB 4OF6A 1PG7X 2MCG1 5F7YC 4YE4H 5GS3A 2COQA 2F9BT 5LQBL 5J1TC 1W72A 2PO6A 2IPTH 3X12A 3P3YA 5TF1H 5FF6B 1CBVL 2ESVA 2NNAA 1I1FB 4LLMA 5CBAB 4BSVB 1VEOA 3BZEA 3SDXA 2AK4E 1AY1L 5FYKD 3JWOH 4Q6IC 2X1QA 4HK0A 3REWB 4G43A 4U4BA 1Y6NR 32C2B 1IAKA 3ULVE 5LJYH 5EOCL 3SDDA 3T3PF 2XNAB 4I3SL 2P8MB 1GGCH 2AP2A 1J5OL 3BZFA 4OZIA 1IM3A 2XV6B 4P5TD 5JW4Q 2FL5B 5C09D 2HFFB 3NCYS 1GC1H 3CSBA 1BBJA 4P2RE 1QOKA 3W11D 1JNLL 3QDGA 3NPSC 3QQ4B 4PPTA 4J4PD 1YDPB 2G2RB 3NGBC 2GW5A 3O2DA 5H37G 3MCKA 1FIGH 5DVNA 3MV8E 4ELMF 2R2BB 1SBSH 5CLTA 5D7LA 3HUJE 4I0PC 2ZUQC 4MQ7B 3E3QE 1WF5A 1FO0L 2I26N 1SY6L 2OJEB 3P4OB 4PLJD 2VB5A 3VXMD 4DKEL 1W72L 2EC9U 2HFGL 1TTUA 2BY3A 3GNMH 5B3JE 1NBYB 4RZCB 3T0AA 1TQCB 4HFWB 2DQCL 1MRFL 3F7VA 3FFDA 4FXLA 5GS1A 2H1PH 2GAZB 1X44A 2HN7A 4O2CA 4TNWF 4ODXA 5KSAC 1P84J 2XKSA 2EDWA 3HPLA 3P30L 4G80B 3CAFA 4IRSC 1OT1A 5EIIB 1GCFA 5L9DH 3VXRE 3TT3L 3WHXA 1I1CA 5IG7A 2Y25A 2ARWA 1NFIB 3VH8A 5FO8B 4NFCA 3UPRB 1S7QB 4P46C 2G5RA 1OQOA 5DRXB 4M62L 3MJ7A 1FG2B 5HHOE 1K8DA 4PJFF 3OAUH 1MF2H 4JN1L 4X7CC 1XAUA 3IF1B 4K3DH 2QQNH 5I66A 2HTLC 2K7PA 1IL1A 3RNQA 1JNJA 1NCWH 3IDJB 1WCQA 3S96B 4NKIH 5IV2B 4WTXA 4Z0BH 4JR9L 4D8PB 4PYGA 1QQDA 5T3XH 4YDIL 5JXEA 1CFVH 4KUCF 3GSNL 2P49B 4U31A 4WWID 4PRHE 2BCKA 2X4OA 4QHUA 1P1ZB 4KKAC 4WI5A 1AHWA 2OQJB 1YEFH 4XNQB 4PJGB 4FTVD 3T0ED 5CGYC 2CKBA 1T2QH 1ZLSH 4DEPB 5D1ZA 3VXRD 4PP1D 2VR9A 4K94L 2AK4A 4JFDB 5B3NA 4QTHA 3TO4D 4LQ1A 5C08A 3HI1A 2UV3A 4G8FB 3EOAB 3F7YA 2CKBL 4MJ4A 3SDXF 1WC7B 1C12B 5C0IB 1NCTA 3IFLL 35C8H 2O61A 4HAGA 4HKBA 1Q72L 1GGCL 4P2QA 3SO3C 4EQ3A 3WHE0 5L2KE 2UVFA 3ME0A 2DQDL 3EYVA 4K3HA 1CLOL 4HSQA 3L3KB 1E28A 2IQ9H 3RA7L 2DWEA 5KVGH 4WI4A 1U92A 5JXED 3ZSSA 2Z35B 3SDAD 3PL6D 3QPQC 4JM2B 5I71C 2X4TA 5GSVB 3NCJL 4Z7UB 2IH3B 4LSUL 5HGHB 2OJEA 3P4OA 1M7IA 4KDTC 4PBWD 4L3AA 3NFNA 3GBLA 2P44B 3V7MA 4ZAKC 4Y1AD 4EVNB 3MBEA 5KAQG 1T89A 1MFCH 3G9AB 5D71H 2HFEB 1V3KA 3NIFF 5E9DA 4BH8A 5IVZA 4NQUA 4JB9H 5DRWA 1VENA 2QHRH 1MCRA 3V5DB 2L0DA 5IROA 2EYTB 1HIML 5IB3B 1IGMH 3CJJA 1NKRA 4KI5D 4Q9BA 4PJ5A 1PKOA 3V4PL 4UI2A 3ULUL 2DBLH 1V05A 3GSRB 2I60H 4EIGB 4ZFFB 5K33A 5ACMA 4HKZB 1AO7B 2FLRT 3E8UH 1BMGA 5F7DB 3MJ9H 2V9RA 3OJMB 5C6WH 3ZT5A 1MQ8A 4F9PC 4XPHL 2AJUL 3ALWA 1LQSR 4TSBL 5DDHA 4X80H 3VE0A 3UBXG 4PJCB 3KPLA 1G7PA 2X42A 3ILPB 4OLZL 4ZUSB 1E6JH 1X5IA 2PTUA 3QHZH 1HK6A 4MAYC 3IYLW 4HAFA 3ZSTA 1ZGLP 1FCGA 3WNNA 1DR9A 2D9CA 1CLYL 4P9ML 3VFWB 1MCJA 4TVSa 1U3HC 5TE7L 5IVOA 4Y16B 2DTMH 4NNPL 3TN0B 3DMMB 3MRKA 1WWCA 1JNNL 2GSIA 1XCTA 3K2MC 5EOTB 5I8CB 3V5KB 3EYFB 3JXAA 4DFHA 2FGWH 5DQ9B 3VFMB 3BKML 5IQ7H 2HN7B 3SCMD 1DQQB 1MCPH 2VKWA 3C6LB 3GSVB 2FB4L 2KQNA 1DVFA 1OD9A 3VI3E 1T1YA 5HYJE 1R3IL 4JLRA 1EZVX 3MRJB 1E6OL 3GJEA 4MNQE 3MRHA 5C09B 2WQ8A 3OQ3B 4QKXB 1ZAGA 2X09A 3C5ZA 1R3HA 4X5XB 3FOMB 4NGHL 4PB0L 4YHZL 4P2RB 2OYPA 5EZJA 4EDXA 3BGAA 1KG0A 4OV5B 1MOEA 1F58H 1P7QB 5D7LB 3ULSB 2F54A 2X1XR 1FBIH 4U1MB 4K07A 4GRWF 1WFUA 3GI9H 3SKJH 5E9DE 3A67H 4HXBH 1ZLUK 1GIGH 3VWKA 2ITCA 2EEAA 3BKJL 3UTSD 1WTGT 4Y1AE 5KVEH 1JZ7A 4NC1E 3EAKA 1XEDA 2F58H 2PYFA 1EFQA 4PRNB 3TA3C 1U8NA 4X6BA 2FL5A 5AG8A 1ULVA 2P4AB 3QPXL 1NBZA 1CFQB 4GRWB 1DL7L 3UAJC 4G6KH 4F80A 3SJVD 4CVWA 4JGJA 2I07A 4R6UA 2PXYC 2YKLH 3FFCA 2GJ6E 5JXAH 3OXRA 1HOCA 4R97C 5I2IB 3BE1L 1ED3B 2FIRT 2Y06L 2YD9A 2YN5A 2NX5E 1AFVH 1HINH 5KSBB 1FV1A 1S5HA 5FO9B 4HC1A 4JG0H 5DJZA 5CEZH 2JJWA 3MLSL 1MVUB 3DYPA 4FQ1L 3SE3C 3U30B 1MFDH 5TGBA 2YZ1A 1JNHA 4RDQG 3DIFB 2XQYK 4DW2H 5JQHC 2CD0A 1H0DB 3TYGL 5EWIH 2I9TA 3EBAA 1EIBA 4WJ5B 3T4AA 4G6AD 2NXYB 3VGAB 2BSTA 2R9HD 1II4E 1JUFA 4NQVA 3RWEB 2BVOB 4LKXA 2EH7H 2JIXD 3BEVA 4H1LA 5DJ8B 2XRAL 4XMLH 3AFLA 3VXNA 3TH4T 3WIHA 4LLUB 5JOFB 4RGNB 5ITFA 3QCUL 1JPGB 1MCLA 4AT6A 1MREH 3F12A 1TCRA 3X3FL 5DVMA 4NQXA 1RJLB 2VQ1A 1T20B 1UJTA 4X4XB 4KJPC 2ZCLL 1BREA 2DB8A 3PHQB 2ZG2A 3TNMB 5DJ0A 4OFPA 4ZNCD 2J8UF 5CEZD 5GXBB 3AM8A 4E5XB 1E0OB 1IT9H 2BSRA 1EEUA 3E1F1 3NCBB 1WAAE 1CDCA 2OZ4A 3ZE1F 4ONFL 1J0YA 4BSJA 1T80A 1X6LA 5C8JB 2FR4B 3KPSA 2A1WL 4TRPH 5C0JA 5FECA 5HHOA 5C0DB 1X3DA 1TZGH 3B43A 4AENB 4GRLB 1MUJA 3DX8A 2P5ED 1TVBA 4OM0L 1P4LB 4I48B 2HLAB 5IB4A 2E7CA 15C8H 1D5BB 1NFDB 5I1DB 5D6DC 5I18L 4LVNB 2EXYD 3GUTB 4JM2D 2NY4B 1YQ2A 4JHWL 3NIGE 3CC5A 1KCSH 4L5FH 2IBZY 5KZCB 1BWWA 3SKNB 3MJ8A 5E2VH 4FP8L 4Z7OE 3WNOA 3VU2A 3IETA 2ERJC 4JANB 4XXDB 4YPGA 3QNZA 5ID0A 1BPVA 3IDIA 5CLWA 1FLRL 4KKBD 5IMKA 4ZXBB 4LSPL 3MV7B 4O02H 3LN5A 4HJGA 5AWNH 1LO0L 5CJXC 2DTML 4NNPH 2HWZL 5AZEH 4PJFE 2DLGA 3IDGB 1QBBA 1E4WH 1I9IH 2VTFA 5IQ9A 3F7QA 4JN2B 3HUJA 1R3KA 4NWTH 3WS3A 3UC0H 4KKNA 1H5BB 1HKFA 1HDMA 2IAND 1W8NA 4I4WA 1OB1B 4HUWA 5ICZA 2UZIL 4H26A 5CHNA 1EAPB 1KN2L 3WXWH 1IEBA 4YO0B 2WANA 3RHWK 3C60D 4ORGB 2EZ0D 4MVBC 4LDOB 1JZ3A 5L2JB 4P3DA 3O2DL 1AGDB 1AXSB 2D7MA 1SYVB 4PJ8C 3T2QA 1J8KA 4LLWA 1NGPL 1WBXA 3QDMB 4YDJA 3T3MF 3OKMB 4TNWK 4XBPB 5KSUA 5SWSB 1ONQA 2PR4L 4LCYA 1QFHA 1U93A 1JYWA 4KZEL 5E08L 3RWFA 2CIKB 3RWGA 2OS7A 3NZHL 4Y19A 5F93C 3RZCA 2R8SL 3DXAB 4NO0A 5I75C 3H3BC 1NSNL 4MDIA 4C54A 2I27N 4HIXL 4QCIA 5GGTA 4ZO9A 2HAZA 2ENYA 1CR9H 4Z8FH 1BEYH 5TE4L 4XPGL 4QRTA 1FLTX 3FQUB 4DK3A 5HY9A 3UJTL 1Q9LB 5E94A 3HPJA 4QOKE 4JGMA 3TN0D 1ACZA 1OLZA 4C55A 3ARGC 5I9QC 1TMCB 4ZO7A 5D7JB 3L3DB 4M1GH 2RGSA 5AUMA 3RWCB 4KROD 3OG6B 4NN5C 4JDTL 4NNYB 2HMID 3VG0H 2IH1A 4K8RC 4NC2B 5CBEB 3CH8A 1Z0MA 1A6VH 2GKIA 1J88A 2Z8VC 1JHKL 3DI2B 5DUPL 3RKDD 2DQFA 4PG9A 3MFFB 4HGWA 5DD6B 2ATPA 1KIRA 1A1NB 2M2DA 3W2DH 2VDNL 4WFHD 5K9KB 3JV5A 2BNRA 1UH3A 1DUYA 2ID5A 4KGLA 4JKKA 5I76B 1MFAL 4MD4A 5DMKB 1H5BC 4PRPE 4CDHA 1P4IL 4HCRA 4NBXB 3K80A 1TJGH 3FB7B 4HQQH 3MO1A 5MEOB 2W0KA 4MCZA 2MCPL 1AD0B 5JPMB 4OV6F 3WMSA 4QXUL 1CE1L 3OAYH 1UYWL 5A16A 4PJHA 2MMXA 3G5YB 3MLVL 2GJ6B 4G6MH 2CKNA 3GIZL 4KQ4H 3LHPH 4PGEB 3MMEB 5F6IB 1UWEH 3ROOA 2VERN 1QLRB 3PP3K 2EDTA 5EA0H 2R0ZL 4JY6B 5J1AA 4L9LB 3SJVB 4XX1E 3CFCH 3ECBB 4YDVB 4LCCB 1S3KL 3JV6A 4WV1A 5F3BB 1HQRA 2OJZH 3C8HA 5T3ZD 1TPXC 3LS4L 3UO1H 1HHIA 4LPWA 1KFAL 2IFFL 4LLVB 2ENSA 2CK2A 1YN7B 4JJHA 5T1KA 5EBMA 4HDIB 1KLUA 3QUXB 1AD9A 1P9MA 1U8PA 4M02A 1XH3B 1SM3L 3CFEB 4MAYB 3WIIH 3WIFB 3RVUD 1CDGA 1SJHA 3RPKA 5INDB 4GKZA 1ZV5A 4IHOB 1C5DB 1PKQB 3UBXB 1QNZH 4GO6B 5J6GB 3IU4L 1NCWL 2R0KL 3HNTH 4KHXH 4K9EC 2APTA 5FOBA 1LDSA 3K1KC 3ZZ1A 4KTDH 4DN3H 4I3RL 3QA3B 4ZSOE 2FCBA 4LCWA 1CFSA 3SDAC 4GRMB 5C71A 3NVQA 3H9SB 2ADJB 2H26A 1T5XA 5LGKA 2VXUH 4MX7A 4GG6A 3ZYZA 1BVKA 5DFWH 4FTVA 2I60L 1JPTL 5K9JH 2B1AH 4JZJC 3CMGA 3T0EA 1W2KT 1U8MA 3D2UB 1QR1A 4UUJA 3QIUD 2W9EL 2X70B 5FYLE 4YFLF 4HUXA 1DBBL 4F33A 3G6DH 4LCCA 4U1SB 1JP5A 5DHYB 4XPBH 5DD5L 4XTRC 5JW4N 2K1MA 2XG5A 3S36H 4XP6L 3MRFA 5F9WC 4JFHD 3RY6A 1HSBA 1INEL 2I9LA 3FHQA 3JBG7 2HFGH 5C0AD 5ICYA 3OAZH 4M1DL 1VFAB 5GIRA 1UEMA 4JQVC 4Y5XB 5DD0L 1EX0A 1B3JA 3BGMA 4HIHA 3DO7A 2NY6D 1AD0A 5JPMA 1SHMA 3MRRB 1EO8H 3FN0L 3QXAB 4Y4KC 5MHSD 1ZVSA 1G7JA 1YN6B 4J3WA 1JYVA 2DD8L 1G7MB 3LEXB 3S4SG 1A8JH 5EO0A 4HT1L 1IAIH 4HHAA 5GGTH 3SQOL 1EEQA 3QI9A 2XA3A 2WV3A 3OKEB 4NWTL 4X7TA 3VXMA 5DZNA 2R9HC 3OKDA 3LKQA 4LLDB 3SKMB 1P7KB 2YWZA 5HYIA 2FD6H 3RP1A 5KZCD 4YHKH 5BV7C 4G6AC 1XR8A 2JELH 2Y5EA 1KTLA 3GSWA 4YXHL 4PGZA 4S1SH 4P4KB 1VA9A 5L7XL 3WDJA 4D0BB 5CBEA 5J9PB 1UC6A 5L7XH 2N7AA 2K7QA 1I3RB 5C9KA 5H35A 1RZGA 1MCFA 3QJHB 2IADA 5GJTL 5BS0E 5FGRA 1EFXB 1HNFA 3BKCL 4LRNL 5DFVD 4ZUUA 4JFHE 3ARRA 1NCCH 2AEQL 4G3YL 4F7EA 1GGBL 5TJWK 3G08A 4OD2A 2WMPA 3FQUA 3TCXA 4I77H 3F7RA 1A1OA 4LEXL 3CSGA 4MJ6A 3IXTB 3PWJB 2VDQH 3FO2B 5TFSH 2EYRB 4PB9L 1NAML 1EO8L 3FN0H 4EI5B 5C6TH 1UZ6E 5TDPA 1AGFB 5LGJA 3BAEH 5C0RH 3W39A 2P8PA 5JW3H 5MEQA 1TZGL 5L2KB 5CSZA 4P9HH 1SJHB 4ZOAA 3NA4A 4YDJB 4F15B 1L6XA 3FFCE 2FLBT 3LB6C 3MODL 1W8OA 5C86A 3U4EA 1RZJC 3ARBD 1I8LC 2CMRH 2PYED 3C8DA 1F00I 3DARA 3C08L 2OK0L 3P73A 1A1MB 4NQDB 4Z7UE 3SJVE 1GJIA 3FO1B 3HR6A 1WCBA 1GHFH 3OPZL 2EDQA 4I4WB 3B3IA 3LN4B 4X6CA 4KY1L 2MQ3A 2ADFH 1OAXL 25C8L 3RWIA 3MA9L 3RVXC 3TH3T 4KUZH 3HZKB 3CDFA 1H3VA 1U8OB 5E8PA 3RBGA 2JJTC 2OSLA 4HS6A 2YXFA 1I1AB 4XWOC 1KB9J 5C7XH 1XR9A 4A6YL 4FQJH 5HYJA 5JIHA 5D7JD 1RZ7L 1AQKH 4M1CC 5D70H 4LHUB 4XCEA 1LEKA 3DV4A 5FA3B 4MB3A 4F7MB 1C5BH 4PRDB 2OTUB 2Z4QB 3O6ML 2V2TB 1U2CA 3H42L 3T1FA 4U49A 1U8LB 3GO1L 5HJ3B 5A3ID 1TETH 1UJ3B 1NMAH 1JN6B 1FN4A 4IRJA 5I1CL 3VXOB 5C07B 5ESAB 4NJ9L 4PJ9C 1T83A 1HZHL 1QLEH 5FV1L 3HB3C 5DRNA 1BX2A 3MRCA 3W0WD 1VHPA 3CXHK 4IDJL 4U2ZA 1UQSB 1N64L 3IJSB 2BXZA 5DZOA 1EO5A 1UWGL 4GQ9L 4DZBA 5C08D 4ZS7L 2BSSA 2HJKB 4OCLC 4DQOL 4MDIB 4F7PA 4U6VH 3U48A 4IS6B 3S37H 2OL3A 3IGAB 2DN7A 1EUTA 1T1WB 2XPGB 4WEUD 2CRIA 4UTAL 4UT6H 4LCYB 3DHMA 4LHUG 1AY1H 5IB2A 1A14H 2BHYA 4PREB 5JOFA 2EE2A 2RB8A 4GMSH 5F9OH 4BM7A 5ILTH 4F7MA 4L3EA 4ZODA 1NFDF 4GBXB 1LEKB 4OGAD 4XNXL 2BNQB 4K7PX 3W2DL 4K8RD 4WO4D 3BEVB 4KJQC 4WI3A 1BIIA 1Q1JL 2D31B 3UTPD 2DIAA 4FQCL 4XZUB 2AKRA 5ERWA 4FNLH 3RI5K 3RRQA 1J1XH 5T1MB 4C58B 1E4XL 3MV8B 1UH2A 5ANMB 4D9RE 3TV3H 3JWDH 4TUKL 5TH2A 1K8IB 1L9MA 2GCYB 4MQXC 3ARBA 5TQ0H 5E8EA 5I30H 2CRMA 5INCB 1B0RA 4M3KB 5KOVC 3KG5A 4OCNC 5H37H 1LD9A 4OCYH 4MA1C 3CFKB 3O3EA 3C5JB 1VGKB 2QADD 1Z9OA 5F3HA 4M03A 1OGAE 3JV4B 2DI9A 3GMOB 1U8OA 4F7TA 3PIQB 5IFHH 2D0HA 4BUGA 4QT5B 2P24A 4PJDA 1EDQA 3HLAA 1MWAL 3O3AB 2CUHA 3KNBA 3K74B 5GJSL 1LDPH 3D2UD 3OL2A 5B39B 2Y7QB 2O5ZL 1JWSB 1HOCB 3SQOH 2FBJH 2R56L 4BJLA 1CZ8H 4J4PA 4J3VA 3AU1B 4PJBF 3SKNA 3VXSB 5L2KA 5H94A 5M95B 5T1MA 3FCTA 3V0WL 2NYYC 1UKSA 2YD4A 4DGIL 3KVQA 3BP6A 2B0SL 4XHQA 2RFXA 2ZUQB 2PXYD 1CGYA 4MXQC 3NTCL 1BGXH 3WKML 5DMGD 5J3HD 2HLFD 1MVFA 1OGTA 2N7BA 1R0AL 4X7FC 5TE6H 1WWAX 3BGFC 1B0WA 2CLVA 3D3VE 4QXGL 3V2AR 5LVEA 5GJSH 1QVOB 2C3VB 1QYGH 3CSPA 3VWKD 1DQJA 5E2WH 1QYGL 5JIPA 3VRJB 1S7XB 3FRPG 3P4NA 4F2MB 4DKFH 2FYYB 3L5IA 1IZKA 2QHLA 3THMH 4I5BB 3DUHA 4R2GD 1QG3A 4F7EB 1BZ9A 3S3JA 1OP5H 3I75B 2ZUSA 1FORH 1YY8A 3QEUB 3MXVH 1S78C 2NXZD 1UVQA 2X89D 1S8DA 5HYSA 3VW3H 1IC4L 3T2PA 1FNAA 2X7LA 4KHTL 3V9FA 2DJSA 4MXWH 4NZUL 2GIYA 3D48R 3MC0A 4RAVA 2DQEH 1PFCA 3D18A 3P0VH 2I25N 3E6HB 1EUUA 3QEGL 1R6VA 4N0YH 4FQCH 3M45A 3VFWA 1JPFA 4LK4A 2W60A 2VH5L 3BKYL 3GSQB 3IJYA 3MUZ1 4OSUL 1IKNC 5HDOA 4HS8H 4N8VA 2DDQL 4ZUSA 5C07E 3PG2A 5F9DC 2A1WH 4IOFC 5E4EB 3HAEA 1S7TA 3ALPA 4I8DA 2FX9H 4U1SA 3HRPA 2DQIL 4W4OA 4RQQB 3W82A 3IJSA 1K2DA 3L95A 4Z5RA 5J1SC 4TSAL 5KSBA 3UZQA 3VG9B 2BFVL 1UJ3C 3MREA 4X7SL 4H0HB 4RFNC 1Z5LA 3I50H 1IC7L 4YIQB 4GG6B 4JVPA 1I7TA 3I50L 3X3FH 4BZYA 1UWEL 3S36X 4X9BA 3KS0H 2BFVH 5CEYA 1PG7H 4POUB 2X70A 1MLBB 3SPVB 1XGTB 3V95A 4YX2H 1OY3B 1DE4A 4JPVL 3K8KA 1LE5B 2PYFB 1CXLA 1QSFB 4GMSL 4AEHH 3FO2A 4JKWA 4HZLB 4MWFB 3QEQB 4JM2F 2HLFC 5E6ZA 2EC9T 1PGRB 3OB0K 3MJGX 4LVHB 1ZVYA 1JVKA 4NHCH 4B50A 4LSQH 3UPCA 4YFDB 4RWYH 3GSXA 3S37L 1NEUA 3NAAL 3OKNA 1C16A 1KG0B 2MPAH 3STLA 1I3RA 3CD4A 4TYUA 1A6AB 1T3FB 4QHMA 3JSSA 3VG0L 3W9DB 3MRHB 4MXWL 4U6YA 2E9JA 2A9NH 2Z92A 3KPRB 1JWMB 3BOVA 2D7PA 4O4YL 2ESVE 3W11C 2Q7YB 2DJUA 4WUUB 3MXVL 4QRPA 5T5NF 4OQTL 3PL6C 5T1KB 3BUYB 3IDUA 5C07D 2MKLC 3ZYOA 3LKRB 4UDUB 5SX5K 5EO0B 4NYLA 1YEJL 1A7QH 4FQQA 1Q0XL 1EEYA 1WEJH 3VH8G 1CLZH 5I15L 1DANT 4HUMB 1TETL 2DQUH 1FFPA 3GSWB 3BIAX 1GGUA 4KVNH 1C12A 5C0IA 3JZ7A 3QG7H 5IMOA 4IM8A 3MO1B 5MEOA 3QJFA 4ZAKD 1X5JA 4J23A 4MD0B 2VZOA 1KACB 1WZLA 5C08B 5A2KH 1A7RH 2VQUA 1QSEE 3PV7A 4QHLA 3UTTE 5CFHA 3B2UC 5IKCB 1I8KA 2UUDH 5EZOH 1M1SA 4XXCA 3R8BB 4J3UA 1RZ7H 2P48B 4PRIB 4NFDA 1UENA 5K9KA 4A6YH 2W9DH 2EYRA 4FXGA 1A1OB 4XVJH 4KI5C 4ZUVB 5BZWA 3V0WH 4YDKL 1I8MB 1MPAL 1B88A 1UXWA 4HBQA 1OAXH 25C8H 2VIRA 2VUYA 1MIML 4U3HA 5MI0B 1Y18B 4JG1L 5L6YH 3U1SH 5GGSY 3DVFA 5ADPL 1RZGB 2O5ZH 2Y5TB 4MX7B 2AXHA 2W0FA 1P2CA 1J1PL 4YEFA 1YC7A 3W0WE 3C5ZC 5JLZB 2L7UA 3TWCH 2LU7A 2CDEB 5ETUA 2Z92B 3KPRA 5IFHL 1G9MC 3STZA 1F8TH 4CMMB 1EZVY 4I18A 4QHKJ 5GISH 2D03L 2OK0H 3CX2A 2IEPA 3BGFB 4F2MA 3QIBD 3AREC 2X4QB 1H9VA 3R06B 1NCAH 5BV7B 2OR7A 3Q3GA 2NY3D 4U1JA 5IUSA 1KT2B 5IJVB 3NA9H 2Q86A 4XGZB 5IVZB 1TJIH 1BFSA 1U93B 4KTEH 1RD6A 2OMBA 1Z9LA 4S1DD 1IGFH 5EO9A 3VXSE 4ZTPH 4KKAD 5F9WB 1N0XL 3K7UA 4MNGA 3WN5C 1LK2B 2VISA 2YRZA 1FGVH 5EBWA 1IQWL 2GK0B 4DCQA 2YMXL 4EIZC 3FKUS 3OGCA 2Z8SA 4XVJL 5DO2D 4OZGA 4CW1B 1RV6X 4OM0H 3V6ZA 1CTNA 3QUMB 3MJ6A 4KK5C 4BZ1L 1MCQA 2A38A 3EKCA 2CXKA 1JWSA 4HWNA 2VRAA 4UV4L 1RZJH 5DD1L 1QFWL 2PXYB 5I71B 1RUKL 3QEHA 3BW9B 2R1XA 5FYJL 1KJ2B 1HHIB 5FB8A 4KRNA 4P5KB 2DQUL 1DBKH 5ANME 5B21A 2ZCLH 3QWRA 4WW2B 3KHQA 3UTPE 3C5JA 4JRXD 4KQ3H 4UILL 4FQIH 3LQMA 4DGYH 1WIUA 4D9RD 5MI0C 4JN2A 4OQTH 1H15A 2NPLX 5E8EB 3MMEA 1S9VA 1MCKA 5TF0A 2E6JA 1AI1H 3Q1SH 2VO5A 1JGDA 1DBAL 1AR1D 4LPXA 5BV7H 3LB6D 3DX7A 3O2VL 4OUOA 3AAZB 3UYPA 5EU5A 3GMMB 1WZ1L 2C1OA 1X6NA 1A47A 1QFUH 2CRYA 3G6AA 3KLAB 2EXWC 4D94A 3WFBL 3GHEH 5KTEH 4YHYC 4KVNL 3ZL4H 1UWXH 3MOBL 4FQJL 4OAWA 2GJZB 3R1GH 1D9KC 4NP4L 1FNGA 4LCUB 3HN3A 2IH1B 3QP3A 1JPTH 1P4LA 5DJAB 4WFGE 3S3SA 5K9JL 1EGJA 1QVOA 1IGIH 4LMQI 3CVIH 5C0JB 3ARTA 2ZZUT 4NM8L 3VI3F 1H8OA 2CO7B 4K71B 5BW7C 3LY6A 4JDVA 4OGXL 1OGTB 5DRXA 4OBRA 1G9NC 1FVEA 2FIKB 4EQ2A 4TTDD 4UOW0 3RGHA 4U0RC 3PHQA 3EJZD 2YPKB 4OLXH 4X8XA 5DMJB 3HZMA 4YGVB 1DVFD 4JO1H 4WENB 3OR7B 3BI9X 3OKKA 4OD1H 2AABL 1JUFB 1PX3A 2XXMB 3FFDB 1OGAB 4AT6B 4HXBL 3PJSA 1EV2E 3MLYL 4JFEA 1OP3H 3S3PA 4KVCL 2WLYA 3O3UN 1A5FH 1WICA 4K3EH 4RAUA 2FEEI 1ZTXH 2ARJA 4NBZB 2XZCH 1TITA 3B5HA 4JFQB 4P2OB 3KPOA 2WUBL 4YK4B 5DUPH 1JZ5A 3V52L 2BOBA 3L3DA 3HE6A 3H7BA 1EJOH 2DMKA 4X6DB 5E8PB 1U3YA 4LEOA 4OZHE 4TUOB 3B2VH 3BDXA 3BSZH 5IMKB 3E0GA 5CJOH 1J8HD 2EDRA 1Z2KA 3HI5H 4NN6B 1M7XA 4G6ML 5IK3B 1NEZB 4JANA 3BMWA 3ARDD 4DVRL 1IGJA 5DYOA 4G8GD 1INDH 3RZCD 4YHMH 3T4YA 3HE7C 2ICEA 5TE4H 3BT2H 3CX5K 4WUUD 3EYSL 3F6IA 4K8RL 5DR5L 4JM4H 2YD8A 4C4KT 4ZXBA 4CU8A 4J2XA 2CR6A 4MJID 4E9LA 4XNUH 2DLTA 4PRNA 2NY5H 1UH4A 4YXLL 2H1PL 2ORBL 3EOTL 4NNXA 3E2HB 4PJIE 4RWHA 3IXAA 1OAZL 1AGCA 4PREA 1F6AB 1NUGA 1EEZA 2YZ8A 5IB2B 1I1FA 1LP9E 2FR4A 1TLKA 5MEQB 4FMFA 3X13B 1LWRA 1BFVH 2CK0H 5D7IF 4Y4HB 1A6VL 2VLKB 2DQEL 1U8NB 4UT9H 4M61A 1VFOA 4MS8C 4HIIA 4Q0XL 3BWUC 2HLAA 3GMNA 5IB4B 3TIEB 5BRZA 2WW8A 5T5FH 4KH2A 4PRID 3LDBB 3LQZA 3EGSB 3E8UL 3HUJB 5I19H 1CFNA 3BH8B 4OLYH 4AMKH 3NABL 1ZLVK 1OL0A 3NACL 2ZP0T 3ARYA 2AERT 4EN3D 3CZFA 2KL6A 3EFDH 1YPZA 1AO7E 1XGYL 2VE6B 4M7LL 5GSRB 1A6ZA 4JFZL 5ENWA 2C7UB 5EU6B 5ACLA 1ORQA 1YNKH 4RX4A 3QO1A 3QH3B 1U41A 1EPFA 4L8DB 2GSIB 3EYSH 1F4YL 5KSAB 4N0UA 1N4XH 1HXYA 1HIMH 4P2OC 3H9SE 2A6KB 1WTLA 4WWKC 1X5GA 2B1AL 1LHZA 5I1EH 2BXYA 3O11A 2EO9A 3K46A 5TH2B 4FXKB 2W07A 4JQXA 4LU5H 2EIEA 5AEAA 3MV8A 3NTCH 3TZVA 2VZ1A 1UGNA 1JIBA 5CZXC 3SBWA 2HKHH 3KYAA 3P9WB 4D3CL 4KMLB 3V5KA 3NOIA 3KPLB 2B7DT 1FGNH 3KLSA 1RULL 3LRSA 1MCSA 1HHHB 2WUBH 1D6VL 1NL0H 2EDJA 5SX4I 5E00A 1ND0A 1CL7I 5I1GL 3DBXA 4P46D 1AE6L 2G60H 3OTTA 1ZANL 4E42B 5FYKL 1SM3H 1NGQH 3Q48A 5EOQH 3WIIL 1HSAA 3OB0H 3WJLA 3ARGD 3B2UD 3QFDA 4ESKA 3BP5A 4UU9B 1G7PB 4G5ZH 2H32A 3MRFB 2AV7B 2UWEE 2P8LA 1JNHB 1UWXK 4OJFH 1V3JA 5IHLB 1FJ1A 4CADB 1CFTA 4HJJL 3VD4A 4Q9QH 1A7PL 5FHAL 2HVJA 3LS4H 3WUWG 1XIWB 12E8L 5E03A 2J6EA 1RJYA 3WFEH 4Z7QF 1OTTD 4KROC 2LVCA 4UUJB 4OZ4A 3RVWC 3TPUB 4AJ0A 4GQ9H 1V7NL 5TPWH 5D1QD 2AJXL 5J12C 1AO7A 3L6FA 3S5LG 2WWMC 3QCTL 1WISA 5I1KL 5ESAA 3ZKSD 3G5ZB 3EYOB 5HHQB 4BH8B 1AJ7H 2H2SD 3X14A 3QQ9D 3G6JA 2W9LA 3PWVB 4G7VL 4S1RL 2X1WL 1MPAH 3DROA 4IOFD 4L4JA 5LCVL 4X4MA 3VDAA 4U1IB 1A6TA 4M6OL 4NKMB 4QRRA 5I1CH 3QFJA 3KR3H 2XRAH 1Q9KA 3M17B 1K4DA 1KYOJ 3GK8H 2JB6B 5DS8A 2DF3A 3OGOE 5DRWB 3ESVF 2WBWB 1IFHH 2DYPB 2V5RA 3DIFA 1XGUA 1V3LA 4PJIA 5C0AA 5JIIA 1JGLL 3MBEB 5DC9B 3GFUA 2QQKL 4F3FB 2DWEB 4NSKB 3BQUC 4OCMC 5ID1B 5ESQB 4GMTL 5JDSB 2BHZA 3V7AG 1Z6JT 4Z0XA 1Q0YH 3KYMB 1CL7H 4JFYA 4Y16A 3FFCD 1X4XA 3BHBB 2WBJA 4QHNB 4TVPE 1AI1L 4QOKA 3N85H 4OCWH 3GSNA 1X4ZA 1U92B 2QTEA 4EI6A 2LABA 2Y07H 1WK0A 3JTTB 1Q0YL 2VLJE 1G1CA 2PKDA 2AK4B 1O7SA 1NMAL 4NDMB 3VDCA 5ICXB 4XWGL 4FFYH 1ZVSB 3I84A 4NO3A 3TN0A 1ZHKB 3BN9C 3O6MH 1IE5A 4LOUD 1OSPL 1A4KA 3FAWA 5DTFA 2N56A 5HHPA 4ZYKA 4RMQA 1G9ML 2OR9L 1P69B 4RGNE 1VADB 3TO4B 2ZOLA 2YWYA 4QTHB 3V0VA 1AGFA 4QXTB 1JMXA 3A67L 5LGJB 3U0WL 4M6MH 1BECA 1HSBB 4EKXA 2HFTA 4BFEA 3ZKQD 5JW3L 4M48H 4NZTL 1R3HB 4X5XA 3SE9H 3TBSB 3VFUA 1NCBH 5T1LB 4F33B 2VL5A 1XF4A 2YMXH 4UBDC 3R0NA 1VKXA 2BCKB 2X4OB 2UZIH 5I9QB 1MRCL 4LKC<