3ZE0F

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze0F01
3RDTA 1KELL 4OJFL 1BVKB 3ZE1F 4DCQB 1FO0A 5GRJL 3BO8A 4JDZA 1FVCA 5ALBL 4PJAB 3VXMA 3VW3L 3OV6A 2XIDA 4N0UE 4OIBA 2FBJL 3I3BA 4Z6AT 4PGDB 1CFTA 4PJ8B 2ATKA 3G5YB 3OKEB 4HWEL 2B5IC 3QCUH 4MDJB 4N5UA 3JV5A 3C5SB 5HDQL 2NY4C 1UADC 2ADFL 4AG4H 2I26N 4WUUD 1GHFL 4N68A 4QT5B 4KUZH 2K1MA 1XGYH 1ZS8A 1G9NC 5HI4C 1JNNH 4E42B 3ETBF 1I3GH 4XAWL 3DUUA 3WFBL 2OP4H 3KPRB 3O9WD 5HYJE 4M61A 3FJTA 3DUSB 3KYNA 1RIHL 4TUJA 5HBBA 3QB7C 4UV4L 3BP5A 5DS8A 2UYLB 1M05A 1W0WB 3HG1E 2CIIB 3O4LE 3TO4B 2EDOA 3IKCB 4GW1A 2V5MA 4U6YB 3QUXD 5L2JB 3HFMH 4ONFL 3C5ZB 5I8OL 4U1MB 3C6LA 1JI1A 3I2CL 2X1XR 1FAIH 1TJHL 4YDJA 2MFNA 3VI4E 4NQEE 2JJVA 4P5KA 3QG7H 4HJGA 4NYLA 4GMTH 3VGEA 4OM0H 4LHUA 2WNGA 5EUOE 3IU3A 4LQFL 4OIIL 3ZDXE 1A21A 4EQ2A 1D5MB 1Z0NA 2DLTA 3E2HB 4ZMAT 1UXWB 1GH7A 4WHTB 1Y6NR 1QBLH 5D5MB 4RGNE 3ULSB 3PNWB 2A77L 3CVHB 1R0AL 4MNGB 3S5LA 3DYPA 3FT4B 3K1DA 5EFIB 1KNOB 1KIQB 3FONB 3ISWA 3SY0A 2RHEA 1JMZA 4PJIA 5IMMB 3DO3A 1MY5A 3VA6A 1FIGL 1SEQH 2B20A 4MNQB 4K7PH 4XBEH 4JG1L 3P30H 1NEUA 3QEUA 1H15A 1ACZA 3IDYC 5JMRA 3TBVB 2JB6A 2GI7A 3BKJH 5IWLA 12E8H 1MHHB 2GQHA 3BW9A 3WSQH 4GRWF 1O7SA 4N0RA 2Y36L 5GS2D 4LARL 1T1ZA 2NXYD 4M7JH 1DUYB 4ODSH 3AM8C 2RBLA 3OKYA 1PQZB 3GIZL 3P9MA 3C08L 4MYWB 2HT3D 3F7VB 4JKPL 1T04B 3I6KB 1NL0H 2RFXA 3UBXI 3ZTNH 4D0BA 4XP9H 4X7TA 3INUL 4H26B 1FFOA 2XT1B 2CLZA 5F6HJ 1VEMA 3ECBB 3LQMA 4WUUE 1S7SA 4BFIA 1AI1H 1JN6A 4I4WA 1D9KC 5H94A 1SEBA 4M48L 3QXUA 3PWUB 2IADB 3IDUA 2YSSB 4GW4B 4PJHF 1OP3K 1P7HL 1IEAB 1PKQE 1IC7H 3RVWC 2CJUH 3EO9H 3T2QA 1CN4A 3VXSB 1A1NA 4GKSB 1DLHA 4M8QB 2UWEB 5D7SH 5ALCH 3IVKA 2NMSA 5MEPB 3RUGF 1FCCA 1YEKH 4FQJH 2VDNH 4NJAH 1LO5A 1FGVH 4F9PC 3D0VA 3RNKA 1B0RB 2BHUA 1BFVH 3OJDA 3OKMA 4JZJC 4N90D 3MSPA 5ABDE 4RMTA 3H9HB 4Y89A 5K9KA 2XXCB 4HIXL 4EDWL 1NBVH 2V2TB 3PHSA 8FABA 4DVRL 4K8RD 4JPKL 4ZOBA 3IS0X 2IANE 1I7RB 3RVVD 4J12A 4OKDA 4XXCA 1UYWH 4P9MH 5D1XC 2VL5A 4TVPD 1CLZH 1FQ9C 1M6OA 1QR1B 5F9OL 1KC5L 1I3RA 4JY6A 3GMQA 4MD5B 5EC2B 1YEIL 2HFGL 5FYJD 1QA9A 1CBVH 3HE7C 1IAMA 1JGVL 1RK0A 3H9ZA 5DHXB 1K8DB 1NCBH 3L9RA 3MXWH 4UV7L 1TCRA 4YUEH 3WE6B 3LQZA 4D8PA 4PGBA 2O26U 4I3RH 4J6RH 3TA3A 2WW8A 1QRKA 1AD0B 1FL6B 3AB0C 1FL3A 4YO0B 4Y16B 1DLFH 3MLSL 4DTGH 4FQQB 1YEJH 5IVXE 3QZWB 3MGOB 4Z7QF 1QBBA 2ICEB 4GSDH 4O51A 3CFEA 1WT5A 1A7NL 4ZFGH 5IW1B 4IIQB 4XVSH 1JTPA 5HY9A 5D9SB 5KVEL 5HPMB 2H2SD 4OAWA 4Z7VE 4P5MB 2QQLL 4O00A 3DV6A 2GK2A 1UH3A 5CGMA 4Z9KB 1BZ9A 2BX5A 1AJ7L 3VD3A 2O5ZL 3FB5B 1DSFH 3REVB 1XFPA 1U42A 3LZFL 3OKOA 1QBAA 3LKRA 3RIFK 3LD8B 4S1SH 1NCDL 2YBRA 1QSEA 5AZEL 4RGNC 2AK4D 3TIDA 3NCEB 5TF1L 3TPKA 3VG0H 3RWDA 4KKAC 4ZSOE 4R0LB 5KSAD 4P4RB 1FLRH 3LRHA 5C0CD 4TYUA 3W0WB 3WHE1 1EX0A 4Z7OF 3S96B 4G8EA 4HGWB 3F7YA 1HWHB 3GHEL 5CZXD 4Y5XA 4N90E 5I1GL 5DD6A 1UM6L 1CXLA 5DDHA 2P43B 4LSTH 4JFEA 1OGTB 2AVGA 4NWUH 3PE9A 1QSFD 1JHLH 2NNAB 5FGBA 3D25B 4XC3L 5KSBF 3HE6A 3NFPB 3L7EB 4MNHB 3U4EB 1CD8A 4S1RH 2PW1B 4C59B 2CKBB 4TVPE 4YPGB 2FX8L 5ILTH 4PJDA 4ZUWA 3JWNC 1XAUA 3BIKB 3S4SA 2SEBA 4NNPL 3ZE0F 4KZEH 2AJYH 5DT1L 2XICA 4HZLB 2D7QA 3QPQD 5FYJE 1BVLA 3O6MH 4K3JH 3P4OA 3F58H 3C9NA 4JN2B 4PRHB 2X9XA 4UDUA 4X7SH 4NO2B 3QO1A 5DUBB 3GMOB 3TM6A 1FVEA 3OTTA 5DD3H 4Z7WB 5HGAB 3O9WC 5HGHA 1H8NA 1WLHA 4F2MA 2MHAB 2VXQL 3TH3T 1FV1B 1HINL 1PG7L 3L3GA 3CK0L 5EUKB 3LB6C 3HC3H 4NCC1 5SX5K 5BCAA 4RNRA 3BRGC 4OGXL 3HUJE 3QUXC 4Q6IB 3BN3B 5DD5H 1Q1JH 3BE1H 1ZK9A 4PJHB 4WCYL 1HI6B 4R97C 1S9VA 4FOMA 2CXKA 2ESVA 3QWRA 2O93L 5A2KH 3UZVB 3W39B 5HJ3B 2Z92B 1S7VB 1A7RH 1CXKA 4PJXF 3KGRA 4PJ8D 5EBLB 2M26A 2YOCA 3RUGB 2VLRD 4UMGA 4DAGL 3CJJA 2N7BA 2XZQL 1O5DT 3JWDL 1UKSA 2AK4E 3B5GA 3MRIA 1NGZA 1KT2B 2R8SH 5FO9A 5TE4H 4ZTOH 3QDMA 1BECA 3KDMA 5C0CE 1UB6A 1H0DB 4I2XA 4XPAH 4TULH 2Y5EA 3KPRD 4KVNL 2CMRL 1GIGH 4ZUVB 3VMPA 3DVGA 1XF3A 4LVOC 1PG7X 3GRWA 3T3PF 3CFJA 2EEAA 2BJML 3TO4D 4LPTA 1Q72H 2AQ3A 1QSFE 4PJBB 4DOHE 2F5BH 3H2WA 2QJDA 3C5ZD 2NXYC 4HPYL 3ZL4H 1GGYA 1RK1B 1IGML 3DX8B 3NBNA 2NTFB 3ULUD 4Q74A 1NJ9A 2BMKB 2HT3C 4LIQH 5IFJB 3P9LB 3MROA 2R4SH 4JY4B 5F96H 3P4NA 1MFAL 5C0AB 5E9DB 3SDXE 1DVFB 5TQ2H 5D7LB 3QI9A 3NCJL 5F7EL 2D2OA 2LAGB 4DKEH 1W72B 3MRMA 4KY1L 5AAMA 3QDJD 4RGMC 4MZ3A 1N64L 1QNZH 5KSUB 2YC1A 2L7JA 5DJYA 3K8MA 1NFDA 4YHOH 5D1ZB 4LF3B 5EZLA 3QYCA 4DZ8B 4NBYB 4M7ZC 4OUOA 3HRZA 3STZA 4Q0XL 4Y5VC 1I1FA 1JF1A 4PJAE 1EEYA 4PV8A 2PTVA 4Y4KB 3GMNB 4XVTH 4M43H 1XH3B 3EO0A 5LAXA 3OG4B 1QO3A 1MFEH 3MRPB 5AYQA 4QRQB 5J6HA 2VQ1B 4WU7A 5DJ8A 2VLRE 4CRPA 4Q2ZB 4I3GA 3B8SA 3T0VA 3WIIH 4AM0A 2X70B 3HNVL 3RVVC 4ESKA 3CXHK 1UXSB 2DBLL 2IFFH 2O5YL 1G7QA 2FYYB 3QDHA 1MJUH 3QXWA 2ZUYA 2PNDA 3BGFC 2V7HB 3WEXA 2HJLB 2FHBA 1U6AL 4OZHB 3KPRE 4P2OD 2AV1A 4N9GB 1KN4H 5J13B 1WV7T 1IQWH 3CSPA 4G8IA 4RMUA 3MRQA 3VXSD 2Y06H 1MLCA 1W8NA 1U8QB 2X4SB 3EOTH 3WYRA 1RZFL 4QTIL 3STLB 3TC9A 5KSBB 1FZOA 3KHOA 3IXTA 4PJIF 3VRLF 1SJHB 1F42A 4TUKH 1Q0YL 4LAQH 5AEAA 1IGFH 2Y7QB 4RBPK 1X6LA 5T5FL 5FYLH 3UBXA 1F6FB 1VADB 3QQ3A 4BZ1L 3ARYA 4OV5B 4WV1B 2J88H 1SYSB 5C0ND 4PTUB 1S9XB 1ADQH 2ZSVA 4U1GB 2JB5L 2R1YB 3MREB 3RL2B 1U8PA 3CXDH 3T0EA 5IB1B 3TIEA 1A7QL 2AXGA 3ULUE 2DQTH 3VFRB 4P49A 3NA4A 1AR1D 1HH9A 3D87B 2HRPH 5TDNB 3CAFA 4WO4D 4IJ3B 5CEXB 1EH9A 2H2SC 4EIZC 1DE4B 4MAUL 3UJTH 4BZYA 4MNGE 3MRNB 1JPGA 4FXLA 4NC2B 2DRUA 5DRZB 4ERSH 4RWYH 4I9WD 5ICXB 4ZAKA 3QDJE 4OLZL 3DRQB 4C54A 5IQ9A 4MA8L 2YD7A 3QHFH 43C9B 1UKQA 4W4OA 3ZYZA 3VGAC 1E6OH 2DLFH 5C0GA 4AEIL 1LEIB 2VITA 4QF1B 5KSAC 1RZIB 1ZLUK 1AGCB 5CIPB 1U2HA 1JHTA 3CMOH 4R96B 4ZFOB 4PJXB 4TTGA 3L3HA 1XF4A 5T5NF 5HHNB 7FABH 4Y16D 1TQCC 5CJXC 2F54A 5EDXA 3CSBA 4P9HC 1H8SA 2BVOB 4YX2L 4H25B 3SBWA 3WNPA 2WV3A 2WWKO 4HK3N 5AYUL 4HFUH 2EH8H 1MFCH 4WI4A 1U93B 1WZMA 4TVSa 5HGGS 5LJYH 5I1HL 1T89C 1IC5L 1YNTA 3UO1H 5H8DA 3RGVB 1MCIA 3PHOA 4G5ZL 5FYKD 4F37F 2G2RB 2MQ3A 4X9IA 5CBAA 1NEZA 3S34H 4R6UA 5LGJB 5TE6H 5C07A 3CH8A 5B38B 4P2QB 1FZKA 4BUGA 3QPQC 3WD5H 1OARH 3VXSE 1ZGLM 4Z7NF 4KDTC 2KKQA 4L1HA 1A64A 2KL6A 3BKCL 4UINL 4L8SC 4YDVA 3ARDB 3W0WD 1EMTL 3S6CA 3NABH 4XTRD 4ODXA 1AQKL 5DEFA 2Q7YA 4JB9L 3BWUC 2BNUB 2YD8A 3RDTB 5IFHH 1MJJA 3BHBB 1U3HA 3O4OB 2NY7H 4S2SB 4YPJA 5CP7B 3RZWA 5INDB 3OZ9H 3BO8B 5IG7B 2Q86A 4OCWL 4WU5B 1JPSL 1T7YA 4YZFE 4C83A 5TQ0L 4ZYKB 2PCPB 4HCRH 5IESH 1EHLH 4JDVB 4JFHD 4FG6D 3O3DA 3PHQB 3CXHJ 4TSCH 4XCFL 4PRIA 4C4KT 2EDWA 5I8KH 5JXAL 2M1KA 4TOYL 5I1EL 5GISL 5CINL 1J0ZA 1WEJL 4LFHG 1MQKH 1QUNA 2H8PB 4R8WH 1CLOL 5FM8A 4I9WE 5DLML 4PJ8C 1E4WH 3EO1B 4PGCA 5C0JA 3VFUA 1J10A 5MI0B 2HN7A 3R1GL 2ADGA 2D7MA 3A6BH 3OPZH 4LEXL 4QRUA 2A9NH 4DGYL 2XTJD 1XCQB 4PRHD 3KYNB 2CXGA 3SCMB 3SDYH 3ZE1E 4GQPH 5INCA 2D9CA 2UUDK 2YRZA 4JPVL 2R1WB 1ZHKA 5D7JD 5JMOC 5MEOA 1CGSH 1UCBL 1YUHA 3ARXA 5D70L 4ZXBB 3L5XL 3LSOA 4M5YH 4HX1B 4X9HA 3THML 4NN5B 4S0SD 4X83A 3MNZA 2V5TA 3EJJX 1J0HA 1IL1B 3GBML 4X6EB 5F8QC 2E9BA 1Y18A 4NYLB 1P2CB 3SDDA 2FX9L 3TO4C 4LHUB 3ARGA 3FMGH 4LMQI 3OAYH 1CD9B 1I4FB 3VFGL 4EN3A 4N0YL 1UG9A 5FOBB 3C5ZC 5FYKE 1BEYL 1MFDL 3CCHB 4PUBH 3D85D 4LCIH 3ULUC 3X11B 5EBWB 4ODTL 4LK4A 5K59F 1R24A 3BDYH 4YGVB 3F62A 5E2VH 2IPKA 3SDCB 4GJTB 4D0DB 3IDXH 4QXGH 1OGAA 1V3LA 3ROOA 1RQ5A 3W0WE 5JOFA 1YN6B 3OF6D 1PSKH 1TCMA 3VFTB 5JW3L 1ZLVK 3IDJB 3MLRH 1HH6A 5I71B 2NY5L 2VDLH 1TJIH 1OT1A 3SGJC 4JFHE 1I1CA 4GS7C 4K7FA 1KLUA 3MJ8B 4IRZH 2W65A 1I8LC 2HLAA 4Q9QH 1HILA 2LABA 4L8DB 4OUUB 3OR7B 3TH4T 1Q9LB 4OI7A 3WJJC 4R4FH 4WI7A 3O2DH 2CLZB 2YD9A 1AQDB 4H1LH 1IC4L 2X4PA 2YN3A 3VGDA 1IZJA 1P4BH 3MGTA 2ITCA 4UUJA 4EQ3A 1JN6B 4NQSB 4MQ7B 3GSXA 4Y5YA 3QPXH 4P4KA 3HPLA 1NCUA 1BQHG 5GGSB 5C71A 3FN0L 5EPMB 4X7DC 5C0AD 3LOWA 1DVFD 2XTJE 1A1NB 4PRHE 5D7LD 2Y07H 1DLHB 5KVFH 1JHKL 2XNAA 3IVKB 3WL9A 5GS3A 1I7TA 1KPUA 1MELA 1KJ2A 3BKML 1LO5B 2CGRH 4M6NH 1R3IL 4Z7WE 3RNKB 3QUML 2XWTB 4P2OC 1MREL 2Y6SD 1OCWL 2XXMB 1EUUA 3T77A 1AP2A 5SV4A 4YNYA 2L7UA 1QKZL 3LRSA 3LKPA 1EXUA 2P5ED 4AENA 5E24E 4I0PA 1G7JB 2D7PA 2ICWB 5LGHH 3I75B 1T2QL 2HFFB 3MBEA 3OHXB 4PJHE 2VDPL 3D1MC 1RUPH 3WDIA 2VL5B 4MA1B 3BZ4A 1Q94A 3FKUS 4Y4KD 3MRFB 3SPVB 2XWJB 3PWPB 1I3RB 4JY6B 2A83B 2RR3A 3GMQB 1P1ZA 2Z8WC 4KK8D 1K5NA 3RUGE 5AD0A 1A22B 4MXQD 4ODWA 4S1QH 1AR1C 2VXUH 3AY4A 4WO4C 4YHYC 3L9RB 1P4IL 2Z35B 3VFMB 3VXQA 5C0BA 1MVFA 4HDIB 2XKNA 4UILH 3KPSA 3SDAA 1NMCB 3PP4H 4Y2DB 3D3VA 1I75A 4J2XA 4JO2H 2F19H 4ONGH 4O5LL 4BSJA 4K23H 5DJ0B 3LHPH 4KRNA 4M6ML 3ALPA 3SN6N 1DQLL 5JPMA 2QV2A 4OCYH 2PW2B 3CSGA 2J4WL 2CO7B 3IGAA 4P57B 1RZGA 2WZPD 5HI5D 2YD3A 2VDOL 4PJBE 3TV3L 1PYWB 5IHUH 3UTSD 1NFDF 1BAFH 1FHGA 2YK1L 1PZ5A 1Q38A 4Y16C 4ZPVA 5KBNC 5I1KH 2ZCLL 5F93C 4DK3A 1PY4A 4JFDB 5C08B 4MSWA 4HQQL 2AW2A 1XF1A 1IARB 4WRLA 4OCXH 5ID0A 1MCOH 2XQYG 4IIQC 4YXHH 4ZD3H 4OLWL 5AWNL 3QIWB 1IEBB 5C0AE 4PTTA 1ZHBB 1J05A 5D7LE 2BDNL 3FO1B 3TIDB 5E6IB 5GS2H 3RWFA 5GJSH 1KJ3L 2BNRD 3HAEA 4HUWA 1CICC 3QXTA 5BMFH 4RZCA 3GEWB 4RAVA 1FNSL 1QLRB 4AT6A 4Z7QE 1VFBA 3PL6A 1R5IA 4G8EB 1WWCA 3AGVA 4L4VB 1YA5A 3LD8C 3ARBA 2CR3A 4QTHB 4KAQL 4X5XA 4Y5XB 3X13B 5HDOA 3HI5L 2QADB 4G42A 1OAYH 4LCYA 5TDPB 1F3RB 4NKOA 3FOMB 2P5EE 1S5IH 4YHIA 1A6UL 1QFHA 1JFQL 3WXVL 3HE6B 3P73B 5D6DC 2BOBA 5GS0H 4G3YH 1MNUL 5EOTA 4ZUWB 5T1KA 3JV0A 2VDQH 2JE8A 3GBLA 1F90H 1N6UA 5JZ7D 4FG6C 4OCMC 2VSDA 1ZGLA 4G7YL 2DLHA 3P11H 1INEL 3K4DA 3EYUH 2IEPA 3O3AB 4Z7OE 1FFNA 1NGPH 3QCUL 4LNRB 5ICZA 3RGVD 4FP8H 1AHWC 1MCJA 4N8VG 2QSQA 4PJCA 4HIIA 3UP1A 1G1YA 2B7DT 3BMVA 4AG4L 4KRMB 1GC1L 4NN6C 4GRLB 5JTWA 4YXLH 1TVHA 4NQDB 2E27H 1I3GL 2IAMA 5IJVA 4CU8A 5D7IA 2OP4L 2XTJC 5D72H 5KSBE 1IKFH 1H3TA 4NQVA 3HCVA 4TVPH 1O0VA 1I8IA 3ARDD 3FOLB 1LO0L 3R0NA 2P49B 5D7JC 1RUMH 3CDCA 4JKWA 1LVEA 3UTSE 3RDTD 5E1AA 3LKNA 4JGMA 1D5IH 5CEZL 2A6KB 1KLGB 3HFML 1XGTA 5FYJH 4OM1H 1S9VB 1ETZB 5JPNA 3QSKB 2X10A 3TVMA 2V2XA 3VFVA 4P46A 4F3FB 1QR4A 3QG7L 1R5WB 3DVIA 4GMTL 1U8LA 4M62L 1T0PB 2R9HC 4P2YA 3WUWG 4CBPA 5ECJE 1H5BB 4NZRL 3EBAA 4LHQB 2BNRE 3RVUD 3VCLA 2XFXA 3BX7C 1XF5A 3V5DA 5DO2C 3EUUA 4PJ7A 5KW9H 4HXAL 4JPWH 4LU5H 1C7SA 1I1YB 1SJVA 4OLVH 4JAMA 3MJ9A 3SCMD 3DMMB 4K7PL 5ITFB 1ND0A 4XBEL 5FKAB 2P8PB 1WVZA 1JTTA 1KPVA 1MH5B 4ZXBD 5JR1H 4PJXE 4LSRH 3BKJL 3FAXA 2AJUH 4F33B 3N1PC 3QG6A 5AUMA 4X5WA 4YHNA 2B4CL 4M7JL 4WDIA 4P23B 5DJDA 4ZUTB 2D0FA 3K8LA 5H37G 1RZKL 4LHUD 2I60H 4KUCD 1X44A 2FEDC 3CC5A 3BEWA 4PB9L 4FQXA 4XVJL 5C0IB 1NL0L 5JW4Q 5DZLA 3QI9B 4H1LG 4XP9L 3WV0A 2J8UA 3BGMA 2BSRB 3T3PE 4N1CA 1AI1L 1D6EA 3U4BH 5CJBA 1ITCA 4LLDA 2BY3A 3SDCD 2YC1B 5JA8B 3EO9L 1NFDB 4XZUB 2ZSWB 3I9GL 4CW1A 3FN3A 4KTDH 1JGDA 4P48A 5D7SL 4PLOB 1FC2D 3IRZA 1JIBA 4KTEL 2C3WA 1YEKL 4FQJL 2VDNL 3HRZB 1QFOA 4NJAL 2R1XB 1FGVL 5F1NA 2Y6SC 1G0XA 1I1FB 1JF1B 3DO7A 3UTZB 2EKSB 4NNXB 2X4RB 1BJ1H 4IRJA 3T0WA 4X0KA 1AGBA 2QSCL 1QO3B 5J6HB 1NCNA 2XTLA 2K7PA 3TEUA 5DJ8B 2DLIA 3O3UN 1Y6MR 1F2XK 1OD7A 1D5BB 2P42B 4HS3A 3X14B 2VDKH 4J3WA 1S7WB 1RZJH 3MRRB 4Y4KC 2Y1VA 4P9ML 5EN2B 4L9LA 1CLZL 4PBWD 3EAKA 4KK8C 3T1FB 2AV1B 4MXQC 4UIMA 4ZDHA 4YJZL 1FYHB 1CBVL 2X1WL 2CRYA 1G0YR 3IXTB 5FB8A 4HV8A 1ITBB 1CE1H 5IB3A 1NCBL 3UXFA 4F9LA 2Z93A 2VERN 4YUEL 4MS8C 3UBXB 1RJLA 3M17B 4I5BA 4J6RL 5J13C 4QHLB 2CIKA 1YQVL 3JTTA 2ZG3A 1WIPA 1X5LA 1ZEAL 4EVNB 3FQTA 2E7LC 1DLFL 4DTGL 1U8PB 5TPWH 4DJMA 1YEJL 3T0EB 3NCFB 5EU5A 2FGZA 5B4MD 5IQ7L 2AJSL 3GSNA 3ORJA 3TCLA 2AQ2A 4E41A 5HI5C 4ZS6D 1YECH 4AL8H 4XHJD 4ZFGL 3OX8B 5K93A 2ATPA 3NCYP 3SJVA 4AK1A 1KENH 5K9JL 4U1GC 2BNQA 1H3PL 1JPGB 1HQRB 5LVEA 4KMLB 3DSFL 2FECI 3PWPD 4OTXL 1OM3L 1WF5A 1A4JB 4YC2B 3F12A 4PJIE 1MRDH 3U6RA 3VRLE 6CGTA 3O6FA 3V5HA 1ZVYA 1DSFL 4IRSA 3LKSA 4ZPTA 3W9DA 5IGXH 2DWEA 4S1SL 3RX8A 2OX5A 5C0GB 4NPYA 5I15L 5BVPH 4H8WC 5EWIH 3EYSH 2R69H 4Y2DD 2KUTA 4GO6B 2J2ZA 3H3PH 3ULUH 4AEHH 2Y4SA 3DVNB 4X4MA 5HGBB 4LCUB 4TSAL 4OZFG 1TMCB 5E70A 3O6KH 1F3DH 1PVHA 1BP3B 1T1YB 2F74B 3F5WA 1MCHA 3C8KB 4HPOL 2APVA 3GSWA 4W6WB 4NWUL 4LLQB 2WIMA 4MDIB 3IF1B 5HYIA 4DWHA 4MQTB 5JHLH 3EHBD 2H3NB 4GBXB 5IB5A 4DN3H 2YKLH 4S1RL 5C08D 1LEGB 5J6GA 4NKIL 1ZHLB 5ANMA 3U7YL 2CLVB 1NEZB 5CBAB 5JZ7C 3ZYOA 1F4WL 2VNCA 1QSED 3QIWD 5TF0A 3LPFA 2AJYL 3MLTA 1HKLH 1T6VN 4ZQKA 4K3JL 5L7XH 3L6FA 4HWZB 3F58L 3QWOB 5A16A 1ZMYA 2VAAA 4R4BB 4R4ND 1DQMH 4PLJD 4X7SL 4ODXB 3UZQA 5DEFB 5F9JB 2X41A 4FQ1H 1HHKA 4V1DB 2G75B 1IBGH 1VGKA 3EYVA 1T21A 2R56H 3MJ6A 3HR6A 3LEVL 1NFKA 5HHPB 2QADD 4FQHB 4LAJH 5E2UL 4C83B 3CFCH 5HYQA 1BLNA 1YEFH 2BSSA 4O58H 1RZ7H 1JJUA 5IM7B 5T1MA 1I9JH 4MJ2A 3PGCB 3CZJA 4JZNA 3G08A 2C3GA 1RHHA 3RDTC 4GAGH 3HE6D 5I73B 3WLBB 5ELIA 3B2UD 5KVDL 4NC0B 1BQSA 5DD5L 4NBZB 1Q1JL 5EBMA 3QHZH 4Z7NE 3PWJA 4WJ5A 3PWPE 3ZKXB 4LQ1A 4ZODA 3L3JA 2VKXA 1FBIH 2D31A 1UCTA 5FCUL 4BSVB 2HN7B 5E8NA 3HC4H 2V17H 3QFDB 1TZIB 2X4OB 5F1IB 2P4AB 4NKQB 1MOEA 5INCB 4MD0A 1EJOH 4PRPA 4XCYA 5F9WB 2R8SL 5MEOB 1CE6B 4ZTOL 2A74A 3GSRA 1YUHB 4FXKA 4GRLD 3PWNB 4NP4H 4NQDD 4YWGH 5FF6A 2EYSB 5KAQF 1WIUA 4XPAL 4Z8FH 1A7PL 2FIKA 3MNZB 4HUUB 4D9LL 1T0NB 3WFDH 5E2WH 4XX1G 3SCMC 3U0PA 4EBQH 1MIMH 3T4YA 1NCWH 1Y18B 2H26B 5DHYA 1J8KA 2GFBA 3GSQA 2H32H 4YHPB 5DGQA 3RZCA 4ZXBC 1Q72L 1OHQA 5EOCL 4EN3B 5FK9A 3FAWA 1NH6A 4NN5C 3SKUD 1LNUB 2F5BL 3C6LC 3QWRD 2ESVD 5CEYB 5AG8A 3B9EA 5C08E 1QP1A 4QY8B 2DQGL 3PABA 2LTQB 2XZAL 1NLBH 5BW7A 3VMNA 4JG0H 1JCKA 1QSEE 2IGFH 3MNVA 3D69A 4LIQL 2R4SL 3WHE0 1A9EA 4OD2A 4XNYH 1VHPA 2R2BA 2AI0H 2WBWB 2IALA 3GNMH 3EYFA 5TQ2L 3QDMD 3ROOB 1U95B 4PJEA 4POUB 3GDBA 4LLVA 3PQYA 5F7FA 1VDGA 4XCEA 3HMXH 2GUOB 5DJ6B 1WZKA 4BELD 4PJCF 3DX6B 3IRPX 1BFOA 2GT9A 3DMMD 1I1AA 1HH6B 5F3BB 4UQ2B 1S9YA 3SGEI 2LAAA 5CSBA 4K3DH 2W65B 4G80A 5IWLC 2HLAB 4NZTH 5D7IF 1JL8A 1GGBH 3FHQA 4NT6A 4HWBL 5GGVY 5TGBA 4MX7A 3T2NL 3MGTB 5I71C 4P23D 3FFCA 4HWBA 1AR2A 5FDWB 5CJOH 3WKML 1OSPH 4CN6A 1YQ2A 4P4KB 4MGXA 4YH6A 2N1KA 3CH1A 4NGHH 3SE3A 4JREC 1ONQB 1A3LL 1UWGL 3QQ9D 3QI9D 4MQSB 3U0TB 1HDMB 3OKLA 4JJ5A 4UT7H 2Q6WA 1L6ZA 3WL9B 5JOEA 4JRXB 2IFFL 4TPRL 5IHZA 3TWCH 4F7CA 1KPUB 1MJUL 3N1MC 1WWAX 4YQXH 4NQDE 5HHQA 3GI8L 1NBZA 2E9IA 3AVEA 4QHUA 2C1OA 3KWWA 1KN4L 1IQWL 3QUMB 1G84A 1U8HA 3QDGA 2Y06L 5B3JF 3LRSB 3LKPB 3EOTL 4YBLB 3BKYL 1JYXA 2EXYD 1KBGH 2GITA 5J56B 3ZSSA 4AENB 4TQEH 4FNLH 4I0PB 2N7AA 1HNFA 5FYLL 5I1LA 5D2LB 3BGAA 5T1LB 3FCTB 3C2SA 2ESVE 1KJMA 3EFDH 1I7UA 4GRWH 1ADQL 1WBYA 5GGTH 5B4MC 3O45A 3CXDL 4LKCA 4RISL 1P1ZB 3OGOE 4MXWL 4WFFD 5AD0B 1KULA 4GXVH 1FGNH 4XHJC 2DQTL 1D3CA 4KMQA 3CLEH 2HRPL 1Q9OB 4XXCC 3RIAK 3L3KA 3QDME 1HKFA 1GOFA 4QYOB 3UJTL 3SDAB 1CTOA 4JFXA 4B7IA 3FQRB 2VISB 2G5RA 4ERSL 4I2XE 1M4KA 3EJZD 4NOFA 3D3VB 5D6CB 3U7WL 4RWYL 1IM3B 5DC4B 2J8UF 5E00B 1RUAH 3DLQR 4HIJB 5I1DA 5FKPA 3ZTJH 3QHFL 4XP1H 2VLLA 5IMOB 4QNPF 3BMWA 5GRVK 4NO0B 2DLFL 1NMCC 1B90A 3PGFL 3L3DA 4Y2DC 2NXZB 1FRGH 2X1PA 4NHUA 1EVUA 2OTPA 1V8HA 5IJKA 3T0ED 1GGIH 3IS1X 1OF2A 2NY0B 1PX4A 5MP6L 2A6DA 2FATH 3KYKL 5DRWB 1UZ8B 2Q8AH 5K9QG 2W9EH 2K9UA 3FHAA 3U48A 4HFUL 1J05B 1MFCL 1YEHH 2EH8L 1DQDH 2QKIB 3EHBC 3RWFB 5JQ6L 3HAEB 1UM5L 4XPFH 3UO1L 4PJFA 1AD9B 4WW2F 2P7TA 4AT6B 4EOWH 1OPGH 1UWXK 2OR9H 3QQ4A 4H5SB 1T3FB 3UYRL 4I48A 4DN4H 1YY8A 2GSIA 3S98A 5B39G 3GO1H 3MNWB 1NFDE 4LCYB 4G9DB 4MHHI 4M3JA 1C08B 3SOBH 4QHKJ 4YHIB 3FB8A 2AJXH 4R4NC 4UI2A 3M1BA 1S7UB 1R3LA 3UJJL 1ODAA 1A1MB 4Y5XC 2FECL 1F11B 1S7XA 2VYRE 2YWYA 2QADC 3B9AA 4NHCH 1QFWH 2DM3A 4MA3B 3OJVC 2OSLB 2IPTH 4HCRL 1ZGLB 4XRCA 1IC1A 4PD4J 2AXFA 4WFFE 4XNXH 1W72H 1J86A 3JTSA 3BSZL 4TSCL 5FGBC 4K07A 3D48R 1DUZA 3N1GC 1BOYA 3HE6C 4XWOC 3RHWF 1YYML 2YPVH 3FZUD 3MUGB 1IMHC 3OKNA 2R2CA 2WWKT 1MQKL 3L5IA 2DD8L 5IMKB 3REWA 5EH1A 1BF2A 3O3BA 3WIFB 5MHSD 4BUHA 3V79C 5GJTL 2AERT 5F3HA 1MVUA 1PLGL 5BV7L 2A9NL 1YY9D 5D93C 5GHWH 2X44D 2APWA 3N1FC 5GGQL 3RQ3A 3O2WH 4V1DD 5KS9F 4NZDA 5E1AB 2DF3A 3LKNB 3LKQB 3S8WA 3OB0H 1CGSL 5FA4B 1NGXB 1T03H 1DBKH 5FEBA 3VFWB 1XGUB 2VXVL 5JPNB 3T0EE 1CDJA 4EI5B 2VXTL 1UWEH 3B8YA 4RIRA 1K85A 4P46B 4P0DA 1XIWA 4M1GL 1YMMB 6FABL 5JORA 3FMGL 1YPZB 2E7HA 4XPHH 2FX7H 2YD5A 2A2QT 3T0XA 4Q6YA 4RFNB 4ZFFA 3H7LA 3VCLB 2PXYA 1MLBB 4JHWL 3CX2A 3N9GH 3NN8A 3O11B 5GGVH 5B8CA 2P44B 4X80L 4U1HA 3OKKB 1N4XH 3ZO0A 4LCIL 4JAMB 2F58L 4LLMB 3RU8H 4Y4HB 4OZ4A 3RTQA 1MHEB 5C8JA 1ERNA 1I3UA 5E2VL 4QRTB 4B7LA 3QZWG 1ND0B 4KWUA 3JWDC 3HMWL 3PP3H 2BRRH 1JF6A 4P3DA 2I07B 1A0QH 4G7VH 1O7VA 2AJZB 5DK2A 2F54E 4JHBA 1MF2L 1E27A 2BVUA 1CG9A 3DMMC 1DDHB 3D9AL 4YHNB 4U1KA 2ZCKL 3SKJH 3N0PB 1WSST 1II4E 4OCRL 2NY2B 2VDLL 3VXPB 1TJIL 4H8WH 1TZHA 3BEWB 5SWZA 4FQXB 2AEPL 2UZIL 4EN3D 4IRZL 1ZA6A 4WVRA 1HXYB 1QBMH 5BZWB 1MRFH 3FRPA 5DVNA 3BWAA 4HKJA 2J8UB 4R4FL 1JGUH 3O2DL 5I16B 5C0DA 5I9QB 5SWQB 1B9ZA 5C07E 3MRCA 3LIZH 5FO8B 5MHSE 4X6FA 5EO9A 3HPJA 4F7EB 1T1WA 3QQ9C 3QI9C 4XXDB 2YD1A 1T5XA 5FUZH 2Y07L 2FH6A 1IFHH 3DECA 5IBTL 3BVNA 4BQCA 4V1DE 3GJEB 1LE5A 1R3KA 25C8L 3B3IA 5MEQB 2HH0L 1QACA 3DO7B 1ZOXA 1NANH 3LCYA 5KVGH 1N26A 1QLEH 4O4YL 3RJQB 4YBHA 2X4UA 1MRCH 5EO0A 2EXYC 4JFYB 5DJCB 3PDOA 4WW2B 1A1OA 3ABZA 4FQ2H 2IPUG 4X5LA 5CCKH 3DXAA 5LGHL 1JUFA 1AKJA 5LCVH 1IGIH 3QEQB 1INDH 3WUZA 3RI5F 1RUPL 1UVQB 3V7AG 1F58H 4L9LB 4P4KD 3GSOB 1CK0H 1H3GA 1YEEH 2COQA 3BAEH 5C92A 4YHLL 2HVJB 2WM0A 1UJ3A 3QEGL 2OL3L 4S1QL 1FO0H 2EICA 2O5XL 3G6AB 2VMFA 3UTTB 3S35X 4IDJH 1F3JB 4ZO9A 2VQUA 2OL3A 4JRXD 4OJFH 5T1DH 4LVNB 4X6DA 5F44A 4R3SB 3EJZC 3A67L 2DWDB 4FTVA 3VW3H 2ID5A 3PP4L 2CIKB 2F19L 1IVLA 5IBUB 2PTTA 4NRYB 1M7IA 1CZ8H 3IYLW 3M8OL 3EDDA 4G8GA 5EU5B 4NQCA 3TT1H 4Z76B 4PRBB 5ICYA 3O3EB 1RAMA 5HDQH 1KB5L 2ADFH 2RQ8A 4I0PD 5C7XH 4X4XA 1CDHA 1GHFH 1FNEA 1KB5A 1NCTA 1U8KB 5IHUL 1KXQE 5T1LD 1PBYA 1KFAL 2B1HL 2C3HA 2OQJA 3MRLB 3WFBH 3T0EC 2DBJA 2VC2L 3BH9B 1G7MA 1EO8H 1RIHH 1RUQL 1MCKA 1M1SA 4OCXL 4P3CL 3V6ZB 4ZPTB 2OTWA 4ZD3L 3W9DB 2DWEB 5KS9B 4QRPB 3S3SA 4WEUD 2OXGA 5ID1A 4D9QD 1A2YA 3GSUB 3KPSD 3SDAD 5GJSL 3ULVH 1J1XL 5DQ9A 3VRIB 2R39A 5BMFL 4QO1A 3D3VD 4ONFH 3H7BB 1TJHH 2D3VA 4PV9A 1DZBA 5C0EA 1JGLH 3JV4B 3C60B 4OIIH 1ZA3A 3F5WB 1BD2A 5EU3B 1OLZA 1UEYA 2NXZD 1R0AH 1CFVH 2DM7A 5HPOA 2VZTA 1RULL 1EUTA 1UB5A 3BT2H 3I6LE 1TVBB 5J6GB 4HZAA 5GS0L 4G3YL 3P4MB 1HSAB 1ORQA 4HC1L 3SBWC 4LPXA 3BJLA 2VDQL 2PF6A 2ADJA 1F90L 5ISZB 1U8IB 3LDBB 1HXMA 4JG1H 5I6XC 4HC1A 1I8MA 3DYOA 4W6XB 1U36A 4J3SA 3M45A 3MLTB 4M5ZL 1KTDB 3RWJA 3FZUC 3L6FB 4WI6A 3O8XB 5IR1A 4M9OA 4JRXE 4FP8L 5IF0A 2Y36H 5J1SC 4LEOB 5TJWK 4ELMB 1R3HB 4F80A 3RNQA 4PRNA 4U2YA 1DBBL 5E56A 3EYVB 1T21B 4YGAB 3GIZH 1OP5H 1VGEH 3C08H 4YXLL 1OSZB 2Y5TA 5TDOA 2BVQA 2E27L 5HHOB 2BSSB 4GKNB 2DQCL 1QRNA 3DRTA 4JZNB 3IB4A 2XG4A 5CSZA 2I5YH 5L2KA 4X6CB 5HVHC 4JANB 2W60B 2WBJB 4LPUA 2VLKA 3NCYS 1D5IL 1N59A 2YPKB 5EBMB 3AMKA 5ESQB 5BJTA 4WJ5B 4OM1L 4FZEH 1TZGL 4X6BB 3TT3L 2D31B 3L3JB 4AH2A 1KPRB 5E8NB 1X5FA 4HHAA 4HS6A 5I73C 3T8XB 1X5ZA 2ZOKA 2YEZB 4NNYA 2IQAA 1K4CB 4D9QE 2HKHH 3KPSE 3K0WA 3ZKXC 1PDKA 3D3VE 1NUDA 2A74B 4CJ1A 2OM5A 4HAFA 5FF6B 1EVTC 4HIXH 2L4OA 4QHNA 2IAMD 3MLYH 2VE6B 4PJFF 5KW9L 1RHFA 3BYTA 3QWQB 4LU5L 3TYFB 4OLVL 5I2IA 5SWSB 2LV4A 4XNQB 4BQ6A 1U92A 5F9WC 3GSQB 3DBXA 2DN7A 1MCCA 4ISVB 3OR6A 3I02A 3FFDA 4JKLA 3N85H 5F9OH 5JNYB 1T20A 4L5FL 2LU4A 2X09A 1K4DA 5CEZD 4EI5D 2AJUL 1YEIH 3KYMB 4XMKH 2EIZA 4P46D 4DZBA 4JQXA 4PLNC 2F15A 3PUCA 4ZUUA 1AXSA 4RAHA 3VE0B 2I60L 3ALWA 3I84A 3MNVB 5IV2B 4EN3C 1CDYA 4UAOB 1A9EB 5FXCH 5CD3A 1K2DB 4I3SL 5DEZA 1NCCL 2IALB 4WTWA 3P40A 3CLFH 4FXGA 4GKZA 4EXPX 4U6XA 1TJGL 2V7NA 1DTUA 2DIBA 2LTQC 2XPGA 3MLSH 4F7TA 1IGYB 3SGKC 4M9PA 3U4BL 5JDSB 3WO4B 1TDQA 1A7NH 2PO6A 3MR9B 5I1CL 5FO7A 4AIZB 3DROA 1LE9A 4G80B 1S9WA 2QQLH 5DXWA 1WAAA 4NT6B 3WIHL 3H9SB 3QUZA 1CF8L 2OR7A 2DYPB 4IOFD 4OZGB 3WNOA 4RDQF 3NPSB 1H3XA 3WIHA 3FFCB 2NY2D 3GMLB 3QR2A 4LCCA 4LSPL 2NY5C 4Y8DC 5TF1H 4FQXD 1MY7A 3ZT7A 2FL5A 1MAKA 5DQJA 5M95B 5B38G 3MRKB 4X99B 1RJCA 1AE6H 1Q0XL 2R15A 4PJCE 2Q6WB 4NWTH 1U3YA 2BHZA 3GHEH 2VDKL 5IHZB 4F7CB 2AKRB 4Y5YC 1RZJL 4P4KC 2MMXA 4HKZA 5HHQB 1HQ4B 1S8DA 5HXMA 1U41A 4QHUB 3KWWB 2VAJA 2BY2A 1ES0A 4DVBB 4LPWA 1NGYA 4XI5D 4XC3H 4W81A 2GITB 4F57L 2JKXA 1C5DA 3MUY1 1IQDA 2FX8H 4LDEB 2EYRB 5IB2B 1IAOB 2XY1A 4KKBD 1IZKA 1C12A 3TPUA 4NNPH 1BZ7A 5CEZE 2BSTA 5HDLA 2ICES 3NMEA 1GOGA 3VXRB 5DT1H 1SMAA 1WBYB 1E4KC 3CUPB 4ALAL 3WFHB 4Z0BH 2OXHA 4I0PC 4DGIL 1PEWA 2ARJA 1YPZE 4AL8L 3MBEC 2DTSA 3L3KB 3QEQD 4C56A 4F7MA 3BPCB 3S3JA 1JBJA 1IAKB 4BSWA 2DQEL 4WWKB 5B3JE 2XN9A 5HVGB 1HINH 1PG7H 2IBZY 5F7YC 1MRDL 2AK1H 3CK0H 3PWLA 2ED8A 5FKPB 2LVEA 3TFKD 4Z78A 3UTTD 4QLRA 2VLLB 1HHIB 4JZOB 3V6OA 4OGXH 5IGXL 1OAKL 3TP4A 1KYOK 3CMGA 1KTRL 2NR6C 3SDAC 1WCQA 4OT1H 1F4XH 3L3DB 4QWWD 5I1AB 4LHUG 4UZGA 3EYSL 4NHUB 3FO9A 3EDEA 3KAAA 3PWVB 3H3PL 3H6JA 1G6VK 4G43A 5C6TH 3BP7B 1SJEB 1OF2B 2N56A 3S5LG 2GYSA 3HI6H 3VRJA 3JWDH 5DTFA 3AS3A 5I19L 2NXZC 1A6ZB 5ACMA 4CDGC 3NIGF 2J8UE 3UJIH 1A14L 4PJFB 3BP4A 2C7UA 3GRWH 3MRHB 3KJ4C 5EU4A 2EC8A 4QNPE 3QQ4B 3O6FD 3MYJA 3MA7A 3CDYA 3BZEB 1DBAL 4G6KH 4HIEA 2GSIB 2WUBL 3UROR 4A2LA 2PETA 2XZCL 5DJ2A 2H1PL 5IB4A 4JRYB 4HIHA 5KJRL 3VDBA 4MMXC 1X7QB 5F89B 4LMQE 3PL6C 5A3ID 4HPYH 4QCIA 3M1BB 5EBGA 3AXLA 1UGNA 2DM4A 3VFSB 1S7XB 3MRDB 3R4DA 4HF5L 2R56L 3C60D 4X6DF 4XPTL 3HS0A 1JWSB 4NCC2 4ODVL 4KJQC 4PP1D 3G6JB 3NCJH 3QXAA 3JTSB 1I9JL 4S1DC 1OB1B 1DUZB 3TH2T 1CGVA 4KY1H 1J12A 1SYVB 3TBYA 4KDVA 5JHDA 3BDXA 3GMMA 4JHAL 3CDGA 5T5NG 1F2QA 1OY3B 1XZ0A 1GL4B 3GMRB 1I8KA 4GT7A 5ISZD 4IMKC 4JZJB 1FBIL 1J18A 2FHFA 3NTCL 1NLDL 5F3HB 3UTTE 5ACLA 1NDGA 3HC4L 2ARWA 2V17L 3O8XD 3B9KA 2K3TA 1KACB 2BRQA 5BV7B 1EJOL 4CVWA 4OBSA 2M2DA 4UDTB 5GSRA 1BBJB 1OAXL 5DRNB 3DI3B 1GC1C 5C09B 2IAMC 4Q9RH 3ES6B 4IS6A 4NP4L 4MQXC 3EYOA 4Z8FL 5C0FA 1BX2B 3WFDL 1FG2B 1Z0MA 1NCWL 2KZWA 2WBKA 3HNVH 1HCFX 3HE7B 2VR9A 1X5YA 2DBLH 4QKXB 5ESAB 1KTKE 1C16B 4NIKB 3MFGB 2WBJD 3Q3GA 4PBXA 4KH2A 5KG9A 2E5EA 3MV9A 1I9EA 4U7SA 1U6AH 4Z7UA 4EI5C 1D6VH 3CZFA 3TVMC 3NN8B 4P46C 3WUWB 2FSEA 1JZ6A 1RZFH 4M7LL 5HYJB 5E03A 1NANI 1CFSA 1OQXA 1Q0YH 5KS9E 4O2FB 1NSNH 3LN5A 4RFNC 4XNYL 3O4LB 4PRPD 4EJ1C 3LKOA 2OZ4L 3GNML 4GW5A 4MD4A 5KZCB 1HCVA 5C0RH 3IJSA 2Z31A 1VACA 3OAYK 2OZ4A 4X4ME 1A7QH 3TBWA 1E27B 3DIFB 1CG9B 5SWSD 1NUNB 4NQEB 1LDSA 3RFZC 2RGSA 3G5XA 3HZMB 1BBDH 1RJZA 3SE4A 2ADIA 4K3DL 5EZJA 4NZTL 3H3KA 3EYQD 4HUVA 4NKDB 3FN9A 1D5XB 3BWAB 4IOFC 5GRXG 1A3RH 4OLZH 2X89A 5C0DB 2AJ3B 3T4AB 2NY2C 2CO6B 5BRZB 5ISZE 1N0XL 2B4CC 4CVZB 3MLVH 1OSPL 4FQXC 3OGCA 2X4QA 4N0CC 4AEIH 1ROWA 1RZKC 4U2ZA 2BXZA 3VJ6A 3MPCA 2F5AL 2X7LA 1T5XB 3MCG1 15C8L 1XGQA 1HE7A 4M7KH 4UT7L 3U36A 4A6YA 1NQBA 1T83A 5KSVA 2V5YA 4YQXL 2HG5B 1R3KB 3RWGA 2W07A 4R7DA 4YX2H 4Z77A 2I9TB 2OTUA 3OMZA 5AYUH 5ITBH 1CFBA 2JIXA 1X4XA 2Q8BL 3OAUH 4XI5C 4WNQA 1ZLWH 5I1HH 1U8JB 3S4SG 4QXWA 1XF2A 3QIBB 3VWJA 3MRBA 3DX7A 2PYFB 3QFJB 4FNLL 3H9SD 4KKBC 2DYPD 4K94H 2HP4A 4WEBH 5D4QA 1D5ZA 3QNXA 3FFCD 3HZVB 5F8RC 3QXDB 4Y4FA 3CFDB 4KFZC 4WW2C 3BKCH 4JFOA 4UINH 1BIIA 2MQ0A 5A43C 4GG8A 4GXVL 2P8MB 3CU7A 1AQKH 4MCZA 1FN4A 1I9RL 2C1PA 3CLEL 4ONOA 4CNIB 4PRPE 1ZT4A 3PV6B 3P77B 3QUXB 4L9LC 2DQFB 4GLRI 1AO7A 3IJYA 4JQVC 5TQ0H 4FTVB 2Z9TA 1NKOA 4PY7A 1JYVA 2W0FB 2ZG1A 5LXGL 4XCFH 1C7TA 5SWSE 3TFKC 1IM9A 1CU4L 2NW2B 2BSED 1M7IB 2AP2A 5JXAH 5GPRA 4TOYH 5F71A 7CGTA 5I1EH 2VZ1A 1ZV5A 1CDUA 1WEJH 4GXUM 3U9UB 4QWWC 3BXNA 2IANB 1CD1B 3RA7L 3MOAH 3Q1SH 3W81A 1KB5B 1CLOH 1ZT1B 2OQJB 4JO1H 3KYAA 5FYLD 3VXRD 5FIEA 3K81A 3IAGC 1NAML 4OF7A 4J3UA 1WAAF 2NY1B 2FDBP 1T6WA 2VDML 3VD7A 4JPVH 1NAMA 4M1CD 4HH8A 2OTWB 3E6FA 1KIPB 4M6OL 2Q8AL 1LO2L 1Q9KA 2W9EL 2JK5A 4MWFB 4LIQE 1UCBH 2YUXA 3F65A 2GKIA 3IJHB 1A2YB 1KV3A 3L5XH 2JELL 5DQ9B 3THMH 3LAFA 4UT9L 4WWKD 4BQ9A 1BHGA 3O6FC 2HKFH 2W0PA 3GBMH 2OR9L 4IRSC 4PV9B 2X4TA 5IVXB 4QRRA 1R6VA 5A40E 3UYPA 5C3TA 4XCCH 3VFPA 1FVDA 2EECA 4XGZB 4GRMB 3VFGH 4N0YH 2MSPA 5I75C 5A3IC 5L0QC 3SOBL 4V2BA 2AJXL 1BEYH 3H9SE 2E9WA 4J3VA 3RL1B 2DOCA 4ODTH 1TXKA 3KXFA 3FFCE 3UDWC 4NHCL 1WCBA 5CHNA 1EBPA 2ADJB 4Z5RA 1G7LA 1HXMB 1VEOA 4ZO6A 3GBNH 2IPTL 4OGAC 5IROC 1CT8A 3W11D 1NMAL 5IR1B 4O2CA 5JW3H 3SO3C 4M7ZB 5KN5A 4Y5VB 1BFTA 5DFTA 2NY5H 3H0TA 5IHBA 3NZHL 1GCFA 2Y5TB 3KYOA 4YFEA 4ZO7A 2BVQB 3V52H 4HSQA 4JRYD 5HYSA 2J12B 2G60H 3O8XC 4XPBH 5DJAA 3D18A 1QRNB 2P5WA 3MZTA 1KJVA 3QULB 1IC4H 5GHWL 1TETL 3SQOL 2R0KH 4PJGA 4FQLH 3IDNA 3O2WL 5E8OA 4MJ5A 4LGSB 3T04D 1YEDA 2VLKB 1N59B 3BGFB 5FYLE 1DBKL 4HKXA 3VXRE 1V05A 1ZSDB 3FN0H 1LK2B 1KN2H 4JO3H 1UWEL 3TNMB 1KEGL 1K8IA 3GB7A 3I6GA 1KJ2H 5MENA 1EHAA 1CXFA 1UC6A 4D0CA 5I1JL 5C9JA 1CFQB 1R3JB 2WBJC 4NNYB 2IQAB 2MCG1 3BKMH 4JVUA 4NDMA 1EAPB 4DKDC 3QO0A 1MREH 3QH3B 3QJHA 2EDNA 3CSYA 3OKDA 2EDLA 1OCWH 4U1IA 2VN7A 4IBLT 43CAA 2Z0BA 3UBXG 4J4PD 5IK3B 5BQ7A 2XWBA 2X2YA 2CH8A 1ZANL 1AGEB 5GGUB 5IFAL 5T33H 1WK0A 5C70A 2E3VA 2A1WL 5J1AA 4JFPB 2W92A 3DBXB 2VDPH 2C5DC 3D0LB 3LN4B 3HUJB 2BOCA 5CMAB 2BRRL 2PKDA 3FFDB 3V5KB 4I18A 5DHVA 5FV2A 5C09D 1VB9A 1A0QL 4G7VL 1Q9WA 1S7TA 4OF6A 3UPRA 5IW6A 4DZBB 3HZKA 4IHOA 1VPOH 1FH5H 1Z3GH 4KZDH 3HE7D 1P4IH 3RZCC 1S7QB 4X7FC 1GGTA 3VGAB 1A6TB 3BI9X 1VFOA 3X12A 3EYQC 3VGHA 4X8JB 4PJFE 4FXGB 4GKZB 3CPLB 1QBML 1MRFL 4GAYA 2V7NB 1DQTA 1JGUL 3LV3A 1WIOA 2XI9A 4M6MH 4F7TB 3PXJA 4U6HB 4MXVF 3H42L 4CU6A 4X4YA 4FQIH 4UAOC 3LIZL 3RTQD 2PO6B 5IEKA 3RWEB 2VDOH 4JRYE 3LH2L 4CDHA 2YK1H 4UNUA 5FUZL 4KI5F 5DA0B 4Y1AB 1IFHL 2ZCLH 4HAGA 3VFNA 3WO4C 2E7MA 3D39A 3BD4A 3IFOA 1RIUL 4N8VA 3S37L 2CLRA 1MEXH 4PRAA 3HAEH 4HEME 1QLEL 1ZWIA 2A6IB 1NEZG 2GK0B 1MRCL 5SWZD 1FNGB 1KJ3H 2FL5B 5DQJB 1CCZA 3BQUB 3SDXB 4KKAD 1FNSH 1XR9A 4R2GB 4OV6F 5EC1B 5CCKL 2GJZB 3NH7L 4JM2A 1IGIL 5J06A 3MQIA 1INDL 4KAQH 5BRZD 1NC2B 3B9DA 4HKZB 3U4AA 2H9GB 3SE3C 5JDJA 5IVZA 4Z7UF 4UNTA 2UV3A 1QPPA 3KPOB 1A6UH 1FO0L 2JJSA 3WXVH 5F6HI 4IDJL 5T1DL 2VKWA 5D2NB 4LRNH 1GYAA 4XWGH 3KLAA 1MNUH 1L0QA 3KPPB 5C09E 4BZ2H 2MKWA 1CFNB 3TPUB 1NDMA 3ROLB 1XGPA 2IG2L 3O0RH 2PN5A 3EKCA 3S37X 4G7YH 1DN0A 1INEH 3EFFB 5JLZB 1CZ8L 3TT1L 2VLRB 1S3KL 3QIBD 5F1SA 3QFJD 4NRZA 1SBBA 4JR9H 3C6SA 5C7XL 3DXAD 1T22B 1CR9L 2V6HA 1AKJD 2BVPA 3S88H 3C8DA 1GC1H 4HH9B 4C56B 1JGEA 2FJHA 3WS3B 5CBEA 4LKXA 5ADPH 1Z5LA 5T3XH 5DZNA 5HYEA 2FIRT 3MCLL 1ZLUH 1KEML 1KTLA 5ENWB 1EO8L 4M1CC 3PWLB 1U3ZA 4FRWA 1LO0H 3HR5B 4Z78B 4Y0GA 4HGKC 3LB6D 2FJFB 4CMMA 3VXOB 3KNBA 4OB5H 5CEZH 4OZIA 2VZOA 2DMBA 2P48B 4WWKC 3ULVL 3MO1B 4FTVD 4L3AA 1P6AB 1HIMH 3TO2B 4RWHA 3MMEA 4ETYA 1JGLL 4G8GD 4M62H 4NQCD 3VXTA 1OP9A 3NFSH 4YHML 2DIJA 1NFIA 2BCKA 4NZRH 5DTFB 5SWZE 3R06A 4N0FA 4P5TA 2IAND 1YNKH 2L0DA 1CFVL 5CUSH 1IAIM 3RPIA 1UH4A 5K9OB 4WHDA 4K3HA 3MJ9H 5IJKC 3P0YL 3BT2L 3BP4B 4HXAH 4U1JA 1GOHA 4RA3A 1GGCL 1D7FA 5BRZE 3QDJB 4HW6A 5EU4B 1A6AA 2ZOLB 2NY1D 1L9MA 3BH8B 2R0ZH 3BUYA 2VR4A 4F7PB 2E9JA 3W11C 1QLFA 4TUOB 4E0RA 4GS7B 3WLWD 5I8EA 3MODL 4HIHB 1MCLA 3AMLA 4G6FB 3AS1A 4WUUA 2WLZA 3PGDA 5B39B 2B4CH 1KXVC 2ZP0T 3GUTA 5DMIL 1KCUL 1K3ZA 1BVZA 1RZKH 1PKQA 1MHPL 3QCTL 4UQ3B 3FQXA 4YAQA 1XR8A 1VGEL 4PB9H 3NIGE 3OG6B 4XVJH 4ZOAA 1TNNA 3ARFA 1T1XA 4BFBD 2BVYA 2DL2A 3TN0B 2PR4L 4ODHH 3QFJE 2Q76A 2IH1A 4UBDD 2I5YL 3DXAE 4ZOEA 2GTWA 4HLZG 2J1KA 3DTXB 1PD6A 2JCCA 3GMMB 1E4JA 1KXTB 2WANA 2FD6H 4ZO8A 3QA3A 2RIKA 1I8KB 4P2OB 2G5BB 5GS0D 4FZEL 5E5MA 3GJFA 3I9GH 3G9VA 4LDOB 1U8OB 2BK8A 1BJ1J 1JPFA 4K9EC 5J11B 3CFKA 1BWMA 5FGRA 4KTEH 3QEHB 4X6DE 2HKHL 3IXAB 4YIQA 1WTGT 4KKLD 5EZOL 5CJ8A 4KU1A 1CGYA 4FTVE 1EEZA 4GG6A 3MJ7B 4J4PC 3HRPA 2QSCH 3OXSA 4K3EL 2D4DA 3MLYL 1YNLH 4G8GE 4NQCE 3S3PA 3CVIL 1TNMA 1QRND 5BV7C 1F8TL 2DLEA 4WO4B 5L2KD 3VH8A 3K4ZA 1LO3H 4YHYB 1J1PL 1S9KC 4LPCA 1P4LA 3Q3GB 4APQB 4KK6D 2VLKD 2YZ1A 1EPFA 3N85L 2H32B 3MV9B 1F00I 3C5JA 3QP3A 4YDKL 1CDCA 4Z7UB 3S36L 1MJ7L 3CZFB 2CDEA 3DX9B 3IDIA 2OI9C 4ODUA 4XMKL 1XIWC 1CIDA 3B4NA 1CFSB 2B1AL 1B2WH 2YHGA 2R23A 5DD1L 5DJXA 5D7KD 4OZFA 4LNVA 4IOSD 3LN5B 2UZYB 3V4VH 2PXYC 4KRLB 3HC0A 4BH7A 1YQVH 3CLFL 1Y0LA 4ZTPL 5B8CC 4PS4H 3KPNB 3GSNH 1CXEA 1ZEAH 4IMLB 5IQ7H 3TBWB 2AJSH 3RTQC 1DQJA 1W0VB 1ZKAA 2DAVA 4LSQL 4PG2A 4QHMA 4UOJA 4OFIA 4FFWD 4XCNA 4OSUL 2KQNA 5K9JH 1G6RL 1CDIA 1H3PH 1ZVSA 3QUYB 1ZLSH 5L9DL 4AIOA 3FT2A 4XBPA 3DSFH 3FQNA 4RFEB 4OTXH 1OM3H 4Q9BA 1CICB 1G6RA 2XQBL 4OKVB 3L3OA 4NO5B 3DUHA 5HDBE 3S36X 3HAEG 5KAQG 5DK0A 1WC7A 1IGCH 3KPQA 1JTOA 4HBCL 1JK8A 4NUJB 1LO4H 3NZ8B 5I15H 5FYJU 32C2B 5GRZA 3EOBB 4N8CH 5AZ2L 3BP6B 1RZ8A 1XGQB 5F9DC 1P7QA 1AE6L 4Y88A 4L3EA 1PX3A 4ONHB 3U36B 4HS8H 4NWTL 1GZQA 2YD2A 4TSAH 3H9YA 5DI8B 1G7HB 4J23A 5E2JA 5JO5A 1ED3A 3ME0A 1H3UA 4RAUA 1YDPA 3QJFA 3E8UL 3RWGB 1JV5A 2HJFB 2MJWA 4L3CA 5DYOB 2PO6D 5JIPA 4HPOH 1DQQA 4G8FA 4GFTB 1QRNE 4QOKB 4Y1AD 5L2KE 3MRBB 1IEHA 2HTLC 1AHWB 4HK0B 4NKIH 3QUZD 2VLKE 3U7YH 4H20H 5LQBH 1BGXH 1OAZH 1D5ZB 1F4WH 3KPMA 4NN6B 3TNNA 1WTLA 4NKMA 1QVOB 3O2VL 3QIBC 3BQUD 1AFVL 4JFOB 1A6VL 2FZ3B 2XTJB 1V7ML 4GRWB 4Z0BL 3DOSA 3E6HA 3PJSB 5D7KE 2P24B 4R2GD 3TJHD 3EOAB 2C1PB 2BC4A 2ZZUT 4R9HA 3QQNA 5D7JB 3U30B 2KH2B 1NC2D 3LEVH 3U2SA 1AO7B 3TESA 4N9OB 5E2UH 4ORGA 4HWNA 4JFZL 1AIFB 1ZE3C 4HT1L 4Y19B 4GOSA 1UJ3C 4WW1A 2IPUK 2CR6A 3TYGL 2AK1L 4U1LB 1BPVA 2HLFC 1A3QA 2AK4A 3BPNB 3SKMA 4PFEA 5CZVH 5KVDH 2YXFA 3BPOC 4I1NB 5DEGB 5C0CA 2I9LA 3IFNL 4XX1E 5IT2L 4OT1L 3ZKSD 4HKBB 1F4XL 2EDDA 2Z4QB 4ZUSA 3JUYA 3HKFA 2WINB 4KHXL 5FCUH 2WLYA 1IT9H 1EFXA 1Z9MA 3D85B 4O2EA 5C6TL 1H8OA 2DDQL 4CN4A 4CL7A 1CLYH 2CDGB 3UTOA 5I18H 1EJ6A 5F88B 5TE7H 3HI6L 1YJDL 1HOCB 3BEVB 1NAMB 2NLJB 4NQTA 4IOIA 3HZYA 4KQ4L 1Q9KB 4FS0A 4C56D 4LSSH 4BH8B 4K2UH 3JWOL 1Z9OA 3UJIL 1A7PH 2XN9D 4JHZA 2D7TL 3GRWL 1N2RA 4D9LH 3EZ8A 3GM8A 2NY1C 2FNBA 2X42A 4JM2F 4HMCA 3FL7A 1P7KB 4G6KL 4HMDA 1JNHA 3WLWC 5EOCH 5F7MC 2GAZB 1VEPA 5E99L 4Y1AE 5E5RB 4L8SA 4J8RA 1U58A 3U0WH 1MAJA 3L7FA 1HEZB 5LKNA 1WAAE 2DQGH 3MFFA 3KPTA 2ZWLT 3DV4A 2XZAH 4WI8A 3V0VA 1U8NB 2GIYA 3LEXA 4XNZB 3SKOB 1CXIA 2C9AA 5CHNB 1OAUL 4UNVA 1NAKL 4HUXB 1GAFH 1OTTD 3SO5A 4UBDC 1BVKA 2CSPA 4H88L 3K46A 4O2CB 1MCPH 4NFDA 3OAZH 1ZVHA 1UA6L 1OAQH 1PJ9A 3GSVA 4QXTB 1LEKB 1E6JH 5GS0C 4PGDA 3G5YA 4FA8A 2NW3B 5GGRY 3KYOB 3C5SA 3K1KC 2X40A 2R29L 4UTAL 3BUTA 2P5EB 2X1OA 4G6FD 2PYEB 2P5WB 3ZDXF 5D2NE 4HWBH 4KKLC 1YN7B 3T2NH 4E42A 3DHJA 2H6PB 1A9BB 2NX5B 1KCRL 4M3KB 3TJEH 5F7DB 3WKMH 4OZIF 3KPRA 4HKXB 2OJZL 1E28A 4Q9RL 3ZDZE 3DUSA 4LBEA 1K6QH 1A3LH 1UWGH 2FGWL 4RRPA 2DM2A 1W0WA 2CIIA 1CGXA 3TN0D 5A2IH 3ULVF 35C8L 3GB7B 5MENB 1T4KB 3CX5K 3CIQA 2VABB 4U6YA 1FPTH 5FM4A 1HZHL 1EGJL 4TPRH 5L2JA 4KK6C 4C56E 3EGSB 3C5ZA 4U1MA 1EGJA 3GI8H 2C3VB 5DMKA 2XN9E 5TH2A 2NZIA 5DFVC 1D6VL 2QHLA 4MJ4A 2E6JA 3RWIB 43CAB 5BQ7B 2CUHA 4FQCL 1LDPH 1D5MA 3OB0K 2W9LA 3CVHL 3BKYH 3HLAB 5BVJB 3V6OE 5D5MA 3BOVA 2AEQH 5IBUG 3V6FB 3PNWA 5J1AB 3CVHA 1NSNL 1KCSH 3F6LA 4MNGA 4PP2B 3FT4A 3RY4A 2BOCB 1KNOA 4M1DH 3UTSB 3FONA 3IFPB 4OFKA 5I1IL 3FTGB 5C0RL 4I18B 3BRFA 4TNWF 4K3GA 4RISH 2VUYA 4MNQA 4MXWH 5E94A 4L8BB 4WTZG 3HZKB 4FFWC 4U3HA 2DI7A 2XA3A 1QTYT 2R2EB 4N5ED 5DWUH 3WS6A 4APQD 1BBDL 2BNRB 3X12B 2KDGA 4L29B 3MV9D 3V4PL 3U7WH 3DPBA 5GZOD 3GIVB 4OLUH 1CVRA 1A3RL 1J0YA 1KIRB 3LV3B 4JQXC 3ILPB 3PP3K 3WN5B 1B0GB 1MI5B 3F7VA 4MVBC 3FO2A 3KPLB 2P1YA 2WIIA 4X4YB 2JCCF 3SKNB 3MLVL 3VD9A 3PGFH 4H26A 4LLAA 3G5ZB 3DARA 4N1HB 2LFGA 4G6JH 5DUML 3SGDH 1MUJB 4M7KL 5KTEH 3PWUA 3MLZL 1LD9A 4GW4A 4XMPH 2CDFB 1NUGA 5MP6H 2DMCA 2PO6C 1R5VB 3KYKH 5H2BB 2P46B 4LLWB 4GKSA 2CLRB 4M8QA 2UWEA 2BY0A 4PGEB 3UX9B 5ITBL 4GG6F 2B39A 5JQHC 5MEPA 4KQ3H 3OAUL 5JQ6H 2WMPA 3QUYD 1UM5H 2CK0L 3U9PL 1OT2A 5T3ZH 1CICD 4MXVE 3QUZC 1B0RA 1XR9B 2QSTA 3UYRH 2VR5A 2MTPA 4K94L 1SM3L 4OLEA 3LQAC 4WEBL 4CADB 5ESVB 2V2TA 1OW0A 1CQYA 3BQUC 4Y2OA 2QLVB 1I7ZB 3PF2A 4R2GC 2FJGA 3TJHC 2C26A 3UJJH 2APTA 1QR1A 1BFSA 1FO0B 1L9NA 4JDZB 1FVCB 2J5LB 1MFNA 5EC2A 2WSKA 1RZJC 3VXMB 3UC0H 1XGPB 4K9EH 3CX5J 4DEPC 4NFCA 1G7IA 3BSZH 5E5UB 1CFTB 2IBZX 2ATKB 4QOKD 4U33A 5IVOA 1YYMH 3PG2A 5D2NC 5CKAA 4LSVL 3AUVA 2DD8H 3C6SB 4LCWA 1AD0A 1L7TH 1FL6A 3MOAL 3Q1SL 4OQTA 3MUJA 3MV9E 1BM3H 4YO0A 2FJHB 4Z7UE 3VD5A 4OFPA 5CBEB 4LKXB 1ZS8B 4FQQA 5C6PB 5FYKU 1Z5LB 3MGOA 4JO1L 1WZ1L 2ICEA 3DUUB 5GJTH 1AXIB 2QQKL 4Y4FD 2E8ZA 1KTLB 4M61B 3MOBL 1PLGH 5BV7H 5IW1A 3HA0A 4IIQA 5CJQL 4TUJB 2OJEA 3UAJC 3BP5B 5D9SA 5DS8B 5HPMA 1M05B 5GGQH 4ZNCD 1OLLA 2FB4L 2NY6B 1FFRA 4GW1B 4ZS7L 2VN4A 4OZIB 3QUKA 5JW4M 2D03L 4XC1L 1AO7D 4U0QB 1I9IL 3REVA 1DEEA 2VXVH 1EO5A 5IVNA 1T7VA 4U6VH 2E6PA 2KQMA 2VXTH 2YWZA 1C5BL 3C6LB 2HKFL 2I25N 3D6GA 3EJYD 4Y19D 3G6DL 4YDJB 4KJWD 2DL9A 4P5KB 4M1GH 4HJGB 3V6OC 3VXTB 3V0WH 6FABH 3C2AH 3IU3B 1LGVA 4XCCL 1VA9A 1NFIB 4R0LA 4GXUN 4P4RA 2R9HD 3RJDA 4XAKD 3S96A 3NACL 1EAJA 4JHWH 1A4KA 2BP3A 3S5LB 1Z6JT 3HN3A 4X80H 1UEMA 5E8EA 4KKNA 1RV6X 4U1JB 3SY0B 5DO2D 3V4UH 4PJIB 2F58H 1F6LL 3FB6A 3VG9C 3UMTA 4PJDF 1P84K 2NNAA 3HMWH 3QEUB 1H15B 3D25A 3GBNL 1OTTC 5J3HD 5DUPL 3NFPA 3L7EA 2A9MH 2V5SA 4MNHA 4YLQT 2JB6B 2CKBA 3GM0A 4HJJL 5EA0H 4YPGA 3BW9B 1RJYA 4ZNEA 4XT1C 1MF2H 5FCSH 3BIKA 1N0LA 3BRDA 1T1ZB 3D9AH 2ZCKH 3GUTB 4WFHD 4IDLA 3SQBA 4HZLA 4OCRH 3FQXB 4YAQB 2ZUSA 3S97C 3P9MB 4G9FA 4JN2A 2AEPH 4PRHA 2UZIH 2FEDD 4QOKE 3ARFB 2RFXB 3V52L 4DUWA 2G60L 3SE8L 3VGGA 1QZ1A 4JREB 4D0BB 3MXVH 4XPBL 5DUBA 3GMOA 3L3IA 3V7MA 3T2PA 4X7TB 1FFOB 3BPLC 4M00A 4OD1H 2GTWB 4Z7WA 1S7SB 4BFIB 2R0KL 5HGAA 4I4WB 4FQLL 5H94B 1SEBB 5ERWA 2MHAA 2XA8L 4AIXA 4F8TA 5EUKA 4JDTH 1KN2L 5DURB 3TN0C 4JO3L 3WDHA 3S35H 4GRWE 3OJMB 3V7AE 4KK9C 4Q6IA 1KJ2L 5IBTH 1OP5K 3CFKB 4GH7B 4MMZC 1V5JA 4JN1L 1HI6A 25C8H 1AO7E 2HH0H 2UY7A 3D0VB 1TLKA 5HJ3A 4YIQB 2Z92A 3W39A 3OJDB 3OKMB 4LLUA 3WNNA 2D4FA 5EBLA 4O4YH 4GG6B 4Y19E 4KI5C 3RUGA 5K9KB 3OXSB 5DQDL 5J11C 4FZ8L 3O41A 3B9KC 3BZDA 4DUVA 8FABB 2PYED 5T33L 1KT2A 2P5WD 3GI9H 4PY8J 1KG0A 3LMJL 4XAKE 2NX5D 1H0DA 1P4LB 3AU1A 5IUSA 1FYTA 1M6OB 4ZUVA 3C5JB 4W6YB 4YHLH 1RU9L 3QEGH 2OL3H 4I0CC 4U3CA 3SGEH 1QA9B 2O5XH 3GGWA 5MEND 1BQUA 1RK0B 1VPOL 1FH5L 1Z3GL 2OCFD 2R23B 4KZDL 4TNVK 4N5EC 1TCRB 4PJBA 5DJXB 4APQC 2ZUVA 1UACH 2WK2A 3W9EA 3LQZB 4D8PB 4PGBB 3A67H 3DURA 4MS8D 3TA3B 1RK1A 1S5HA 5GZOC 4BH7B 2GEEA 3OB8A 1Y0LB 4GAFB 2NTFA 1FL3B 1JPST 2BMKA 1E4XI 3M8OH 4WFHE 4YFLF 5IFJA 3P9LA 2ICWI 4O51B 1MWAL 1KB5H 1XMWA 4FQIL 3CFEB 5E9DA 1DVFA 4LPYA 5D7LA 3RP1A 4BK4A 1MWAA 4XCNB 5HY9B 1KFAH 1IKNC 2B1HH 4OAWB 2MOVA 4U7KA 4XBPB 4UTBL 3DV6B 2AXHA 3L3OB 1BZ9B 2VC2H 1P84J 3ARSA 5KSUA 2OS7A 1RUQH 5DVLA 5A1AA 4P3CH 3OKOB 5D1ZA 2AEWA 3LKRB 2VZ3A 1MEXL 3OWEA 2YBRB 1QSEB 1LILA 2CUMA 1JK8B 3SE4C 3QUYC 4QRSA 3RWDB 1J1XH 4OCLC 3ILQD 1GRWA 1RZ8B 4L3EB 1DN2A 4Y4KA 3BN9C 3GMNA 3F7YB 4MJIA 1XH3A 1MI5D 3MRPA 3T09A 1YDPB 4QRQA 3ARRA 4ETQA 2VQ1A 3QJFB 5DD6B 1JV5B 3LPWA 4L3CB 5DDHB 4NM8L 1DQQB 4JFEB 2X70A 1UXSA 2PYEE 2P5WE 1RULH 2FYYA 4WWID 2V7HA 2HJLA 2NX5E 5D5MF 1T83C 4LRNL 4XWGL 4HC1H 1GPOH 4RX4A 4OZHA 4N9GA 4PJDB 2VIRA 4BZ2L 3S4SB 1MCDA 2HWZL 2SEBB 1U8QA 1OVZA 2X4SA 3IETA 3TNNB 3O0RL 3STLA 5EB9A 1SJHA 4M5ZH 1CI5A 3K4AA 1BVLB 5MENE 3QIUA 2Y7QA 2IMMA 3VWJC 3P4OB 3C9NB 1F6AA 2ZG2A 1VADA 3E6HB 3D2UA 3QAZC 5ADOH 1VFAA 4UDUB 2EIBA 3QO1B 4JR9L 4WV1A 1HWGB 1SYSA 5D93B 1S9XA 1PEZA 4JM2D 1DBBH 4HXBH 5IOPA 2R1YA 3MREA 3B5HA 3S88L 1FVEB 5D8JL 5ADPL 5IB1A 2MPAL 4HGMA 5T3XL 4Y4FC 2Z8VC 4RDQG 5HGHB 1RSFA 3VFRA 3K80A 4F2MB 2NZ9D 4X98A 2DQCH 5TDNA 2X5PA 3L3GB 2HT2D 4LASL 2FEEI 1WFTA 1NC4A 3SKMB 4RNRB 5HVFB 3U30C 3MRNA 3MA9L 3MRJA 5DRZA 3E3QE 1F02I 4OB5L 3ZE0E 4GQ9H 5ICXA 3SHSA 3IT8D 3VXMD 2ESVB 3EJYC 1TZGH 3GKZA 3TT3H 4KJWC 3HI1A 1HIML 2DKUA 3BPNC 4YE4H 1LEIA 3IKKA 2ICWJ 1VCAA 4QF1A 1RZIA 3NFSL 1TTUA 1AGCA 5CIPA 3B6SA 4IOIB 2J6EA 3HZYB 3MRIB 3Q6FA 3P0GB 1NGZB 3I50L 2UWEF 4ZFOA 3VDCA 4PJXA 1YNKL 2A0LD 5FO9B 5HHNA 4N8PA 3QDMB 4HG4K 3KDMB 5CUSL 1LK3L 4DFHA 1YC7A 1UB6B 3G5VA 1XGRA 4I2XB 4NM4H 1G9ML 3MJ9L 2BVOA 1MI5E 1N2RB 3DVGB 1MCSA 1XF3B 3MACH 3NAAH 1U93A 2R0ZL 3CFJB 1L7IL 4UOW1 5J3HC 2NPLX 4FMKA 2NY6D 1DANT 3RGVA 4L5FH 2G2RA 2UZXB 3C6LD 5B38A 4EKXA 2AQ1A 4P2QA 3DV4B 3ULVD 3D39E 2DQJH 3HB3C 1NJ9B 2ERJC 3MROB 1N5AA 3P2TA 3P4NB 3Q2CA 4I3SH 3ARDA 1NCCH 5GRWA 2BNUA 3ZSTA 1TJGH 2DICA 4JRWA 4L1DA 4ODHL 3BHBA 4S2SA 3H8NA 5E2TH 5CP7A 1EHNA 5INDA 1X5AA 4LL9A 5IG7A 1J1OH 3B83A 2YR3A 4WU5A 3MRMB 3LPGA 4XNZC 4ZYKA 2PCPA 3VA2C 4JDVA 1H3WM 1INQA 5I1CH 3GSVB 4KI1A 3PHQA 2FD6L 2EE3A 1J0KA 3VGBA 5DJYB 4KGLA 3RIFF 5EZLB 8CGTA 4C55A 1JZ7A 2RAMA 2EDXA 2H8PA 4KMTL 4XP6L 3LQAH 3WIHH 4YFDB 1CF8H 2R2HA 3STZB 5F72S 3EO1A 3VXME 1EEYB 4PV8B 1CGTA 4LSPH 1E28B 3EO0B 5LAXB 1XCQA 2OBGA 4LBEB 4NSKA 3U46A 1IGTA 3SCMA 1N6VA 1JRHH 3HTLX 3ARFD 1MAMH 1YNLL 4WU7B 2R1WA 4MAYA 3GZKA 5TFSH 4AM0B 1Q0XH 3LS4L 4ZXBA 1JYNA 1LO3L 5DD0L 1G7QB 1MCEA 4HX1A 2EDQA 3SGDI 3KHQA 3WEXB 3OXRA 1IL1A 5DMKB 3NFNA 4X6EA 5TH2B 2E7BA 3T1WA 1G7PA 4NJ9H 5DURD 1P2CA 4G8IB 3MRQB 3AC0A 5BOZG 1MLCB 1A7OL 1FZOB 1I4FA 4F57H 1B2WL 5FOBA 4OZIE 5EORH 3QQ3B 3V4VL 3F7RA 3CCHA 5LWYL 3X11A 2ZSVB 4PS4L 5EBWA 2FR4A 4WEMB 3GSNL 3ULVE 4YGVA 4ALAH 2CRMA 2ZNWA 3TIEB 2AXGB 3SDCA 5E94B 3OQ3B 2H41A 4DGIH 4DKAA 5E8DH 4HEPG 4D0DA 1HH9B 3ELAT 2D7NA 4HG4J 1TTGA 3E3QC 1VKXA 4Z18A 1YN6A 3BJ91 4PGJA 4RGOH 2YN5A 3VFTA 4I18C 4OFVA 1ZLSL 5DFWH 2DQEH 3TZVA 3IDJA 3LS5L 3RKDD 5EG6C 4ZAKB 2DJUA 2DQUH 3X3GH 5IQ9B 4Z7WF 2VB5A 3FO2B 3MJ8A 1IGCL 1OAKH 3WKNA 1JZ2A 2WIIB 1EERB 1IJ9A 4L8DA 4OUUA 1QEWA 3OR7A 3ZKMD 4HUKB 1Q9LA 2VITB 1LO4L 3ILQC 1MJ8L 2MCPH 5DK3A 1AQDA 3TA3D 1C1EL 4N8CL 3BIBX 4RQQA 3GKWL 1JHTB 4NQSA 2ZUXA 3L3HB 1XF4B 3WN5C 4MQ7A 4HS8L 1LD9B 4POZD 2F54B 1U8MA 2DIAA 1CL7H 5GGSA 2ORBH 5EPMA 1FORH 5I19H 1EEUA 1EK3A 1WWWX 3S7GA 1EDQA 5I6XB 2VOTA 1T80A 3MLPA 1YNTB 1A14H 4XH2A 1MHCA 3QNZA 3PHOB 1MPAH 2XWTA 4D3CL 3MZGB 3A0OA 2JCCE 1DBAH 4H20L 5LQBL 2WUBH 1BGXL 1E4XL 1LHZA 1OAZL 3IDMA 4XP4H 5C07B 1FZKB 3NCBB 2DTML 4M8VA 2XZCH 2H1PH 3G04A 4JPIA 4PYHA 2HVKA 5IIEA 5KJRH 5FDYA 1G7JA 2ICWA 3MBXH 3I75A 4YDVB 2FJGB 2HFFA 3OHXA 3WCYA 4YBQD 1P7QD 4JM2C 4L3ED 3KLSA 3EDKA 2Q7YB 5I0ZA 3MRFA 1MJJB 4PJBF 1U3HB 3HNSH 2XWJA 3PWPA 4HF5H 1ZLWK 3SPVA 5HVHB 4XPTH 1BZQK 2A83A 1A6PA 2J8HA 4GG6E 2Q86B 3MLWL 2NZ9C 4YXKL 4ODVH 2R4RL 4JFED 2AS5M 2HT2C 1G7IB 3O3DB 4L4TA 3D5OF 4O9HL 3VFMA 2JJSC 2Z35A 4PRIB 3NIFF 4HDIA 2BXYA 4H0IA 4XWOD 2ZCHL 5FHBH 5CZVL 5IP4A 2WQRA 4Y2DA 2J5LC 4JHAH 4LCWB 4JM4H 2XKUA 4XPGL 1CYGA 5DJ0A 3V0AC 3RAJL 1TPXB 3NTCH 4PGCB 1NLDH 4MHHG 3QISA 4NBXB 3VFUB 5C0JB 1IT9L 2PW2A 2ADGB 4P57A 3QRGH 4PREA 4QRUB 1CLYL 5I18L 4NZUL 2OJEB 5TE7L 1PYWA 4DFIA 1J9CT 1ZHKB 5FM5M 2A0LC 4EUPA 4CN1A 2VLJA 4R26H 4W70A 1OAXH 4JFDA 4LSSL 1JPTL 3QUKB 3AS2A 5C08A 5EIVA 4JFFA 3LSOB 4O02L 4K2UL 1U0QA 1DEEB 3QIWA 1IEBA 4S11A 2EYTA 1ZHBA 3FO1A 3SDDB 2VXSL 2NY6C 3ARGB 5E6IA 2ZKHH 3QT2A 3VD4A 3WFCL 1QLRA 3U0WL 4XBGA 1QG3A 1A4KB 4L4VA 3X3FH 2HMID 2B2XH 4V2CB 1HNGA 3ULVC 4QTHA 3X13A 2AV7A 3VXUA 5DR5H 5E8EB 4M7LH 1EFXD 4EI6A 4NN7C 1R24B 5TDPA 4AMKL 3FB6B 4OZHF 3LY6A 1FE8L 3FOMA 4P5TC 2IPKB 1QSVA 2FEEL 1P5UA 5KANG 1BWWA 3CGTA 5D96B 2OZ4H 1V7NH 3B9VA 3P73A 5F6IB 1OGAB 1GAFL 2E8YA 5E6ZA 5JOFB 2ZUQB 4L3EE 3P0VH 1RJYB 2H2PD 1MCPL 1DBJL 4JLRA 1OTUD 5FUOH 5JUEH 3Q0HA 2DQIH 1UM4L 1OAQL 1E6JL 4JFEE 1FL5A 2W9DH 3O3AA 4G9FB 4LNRA 4K7FB 1KLUB 1YEGL 3KLHD 3E1F1 1HILB 4TTDD 1Q8MA 3L3IB 1EIBA 5K59E 4GRLA 1FNFA 5IBLD 2X4PB 3V9FA 4PJDE 1YYLH 4PJ5A 4NQDA 2ITCB 4UUJB 4YK4B 1N0XH 3K2MC 3TJEL 3GSXB 5ERWB 3QBTB 4Y5YB 2EDEA 3HPLB 4OD3H 4WI2A 3ARFC 4J3OC 3FOLA 5ETUA 2F5AH 1K6QL 4QHKI 5KOMC 5L8KB 15C8H 4A6YH 2XNAB 1QHPA 2W0LA 3MV7A 5C86A 1I7TB 1FPTL 2A6KA 1KLGA 2YMXH 2GY7B 1KJ2B 1ETZA 4B50A 2AJVL 4BM7A 5JW4R 4LLUB 1WQVT 5SX4I 4F3FA 5M94B 3T77B 1R5WA 1AP2B 4LP4A 1JWMA 2Q8BH 4YNYB 1LDPL 1EXUB 3O41B 1H5BA 4KXZI 4PJ7F 4YHKH 1I3VA 2VDRH 5K33A 1XT5A 2AEQL 5CGTA 1KCSL 3DI2B 1KG0B 3MBEB 1YMHA 3HNTL 4M1DL 4D2NA 3BZ4B 1Q94B 3AU1B 3Q48A 1I1YA 1FYTB 5CLTA 3PXHA 1IGJA 3DMMA 1EA9C 1K5NB 4ODWB 5ITFA 5FKAA 2P8PA 3GGWB 5FECA 1I9RH 2YD4A 5EU6A 1MH5A 3KR3L 1BREA 3VXQB 1WFUA 5C0BB 2HTKD 5E08H 3W9EB 2XKNB 3KPSB 5DRXA 1WITA 5DWUL 3RKDC 4F33A 3DURB 3N50A 1S5HB 1AY1H 2V2WA 2YZ8A 3MOQA 5LXGH 4P23A 4ZUTA 4OLUL 5LBSH 1CU4H 2EDTA 2EDHA 4LDLB 2CD0A 1FCGA 3KJ6L 5C0IA 3ZKMC 3V8OA 5JPMB 1F45A 3IGAB 3RA7H 1RZGB 3TA3C 2NTSP 1MWAB 4DQOL 4F58H 2BSRA 4KHTH 3K2UH 1PZ5B 4G6JL 4OFYA 4ZPVB 4POZC 4YR6A 4I77L 5KTEL 1NAMH 4MSWB 4XMPL 3F7PC 3L95A 4MNQD 3KJ4B 3VMOA 4OBRA 1WT5C 4PG2C 2VDMH 5ID0B 4OCSL 4XZUA 2ZSWA 4M6OH 5JIIA 1LO2H 1J5OL 2YA2A 4PTTB 4R7NA 3ZT5A 4U0RB 4X9GA 4QRSB 4KQ3L 1HHGA 2VZUA 4WY7H 1Z9LA 2JELH 4HUWB 1U9KA 4RZCB 4RAVB 4P2CG 4UT9H 2R1XA 5T3ZL 2BVEA 5M7QA 4G6AD 1VFBB 3PL6B 4ZAKD 3UTZA 1R5IB 2EKSA 4NNXA 2X4RA 4MJIB 1RY7B 3ARBB 4X5XB 4ETQB 3SE9L 4G42B 3E0GA 4J3XA 4K8RC 4JEGB 1UENA 1I85A 4JE4B 5GZND 4NKOB 1D5BA 4YBQC 3X14A 3WMSA 1AGDA 4KUCF 1S7WA 3MRRA 3W5MA 5HYFA 1X4YA 1NUFA 4OGYH 5EN2A