3ZE1F

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze1F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze1F01
2N7BA 1IAKB 3IDJB 3V7MA 1YEIL 5LQBH 3SQBA 1G7LA 4R90H 4PB9H 3H9HA 4FFZL 1EEQA 1OTSD 4PG9A 4JFHD 1P4LA 1AI1H 1FFOA 1FORL 1U3YA 5JR1H 2LTQB 1RJZB 2AW2A 1CZ8L 3OKOA 4P49A 3FN9A 1UA6H 1XF2A 4NOBA 4ZAKB 4JRXA 4JO4H 5AUMA 4ONFH 4HT1L 3HI1B 4V1DD 1I9JL 1E0OB 3MODL 5GS1A 2F53B 4Z7VF 3V0WH 4J2XA 1KB5B 3T08A 3MZGB 1WC7A 5F9WB 1F3JB 2WMPA 4OFDA 5ACMA 1P7QD 5B39A 5HI5D 2UZYB 4LVHC 5K9QI 2X70A 3I02B 1MFDL 3NFSL 4F7TB 4E41B 2W60B 4JHWH 4GUPB 4ZTOL 4PJCE 2ARJA 3U48A 4YXLH 3NZHH 4JKPL 4S0TD 3PWPD 3LKPB 1P2CA 4LHJB 4MAYA 3TESA 4NHUA 1Y6MR 3SE8L 1E6JL 3QHZH 3QDAA 2P24B 2X1XR 4P5KB 1X4XA 1KUMA 5EU4B 1JK8A 2H6PB 2Z91A 4Y5YA 5E9DB 5E2WH 5GS1C 3TPUA 3O3BA 4Y8DC 3UPRA 2ATPB 5TGBA 1WAAF 4U7SA 1S9VB 2APTA 4HWEL 5J13C 4I0KA 4PJGF 4WUUB 1EZVX 5BZWB 1TZGL 1P7HL 5E7BA 1A4JA 2Q8BH 2CIKA 4G9FD 1NMBL 1DR9A 1J18A 3AVEA 4R0LA 5F7WC 2F9BT 4DCQB 2GCYB 3T77B 3V5KA 4RQQB 2VLLB 5HDOA 4FQ2H 4D9RD 1IE5A 3HC4L 1NLDH 3VFMB 4LOUD 5I1HH 4NC0B 5LXGL 2NY1C 1EGJH 4XH2A 1JPFB 2VE6A 4NRXB 1INQB 1U3HB 2UWEE 3MBED 3BZDA 1QACA 1TCRA 3HG1A 2EDLA 5IW3A 3W81A 4NN6B 4R0LC 1EO8H 3KPPB 3TA3A 3CH1A 2LU3A 1CN4A 4XC1H 4XCNA 4ZYKB 1FNGA 3SQOH 2GITA 1NAKH 3B4NA 5CD3B 3QI9B 3UJIL 1CGWA 4MDJA 1NBVH 2DAVA 3SJVD 2EE9A 3PIQA 5DUPL 2Z31D 2OJEB 3WO4B 2IFFL 3HI6L 1WIPA 3FT2A 4FOMA 2ZKHH 1A3RH 2FX8H 4XXCA 1FO0L 1PD6A 3UTTE 3CVHL 4OQTH 1M05B 3FO1B 4ZO9A 1PG7X 3SGDH 5JOFA 3X12A 3ARZA 1EAPA 4OTXH 3S97C 5CILH 1QFOA 3WFEH 4N0CC 4KK5D 2FRGP 3MYJA 1L7IL 4TUOA 3WNOA 3B9AA 3WHXB 2JLLA 1J0HA 3GSNA 3IS0X 5A16A 2C9AA 1G9NH 3ZE2E 4KTDH 3W9EB 5KSBE 4IHOB 3QUML 1INDH 35C8L 3TIEB 3GSOA 3LRHA 4XPTH 3ARSA 1ED3A 1HZHH 5FA3A 4UT6H 1XGQA 2DQDH 1RK0A 1XGPB 1MCLA 4JVPA 2ENYA 1ND0A 2UUDH 3VXSE 4Y4HB 3MLRL 4JG1L 4M5YH 3MCLH 3PGDB 2RCSH 5DLMH 5ADOL 5B8CA 2K7QA 4DFIA 1FZKB 4GH7B 2HTKC 4HMEA 2XFXA 3M07A 3RIAK 3GSRB 2D0FA 1QSEA 3WUZA 1FDLL 1TNMA 3H42L 4PGZA 4YZFE 3ARXA 5EO0B 5E0QA 1T21A 2O93L 3PABB 5FDWA 1R24B 3GSVA 4GKZB 3LKRA 4P2RA 3CMOL 3M1BA 1GAFH 4YDKL 5F1NB 2FEEL 4QTIH 5C0JB 4OZHA 1GGUA 3U9PH 4YXHL 1T20B 1OLZA 1FAIL 1PLGL 2WUCL 3CPLA 5E8PA 4X6FA 1JZ8A 4Z7OF 2DWDB 2WBJB 4P5TC 4X7CC 5L88H 2AJ3A 2A6IB 3HHRB 3DUUA 3QEGL 3PWVA 1U6AH 4OZ4A 4LSRL 1T3FB 2IGFH 3QXVA 1AP2A 1MI5D 3SCMD 3TYGH 5J8OA 4GRWF 5DJ2B 5E1AA 1CFSA 1GGBH 3QEUB 3N0PB 4JDVB 4MJIE 1RZFL 4PUBL 4HUMB 3W9DA 2MKWA 3VFVB 4PJDF 2RIKA 4L8DA 2FO4B 3NBNA 4HFWB 1NANI 3RVVD 5IHUL 3L3OA 1QLRB 3W82A 4H20H 3TNNB 1SYVA 1U8QB 4HJ0D 4MVBC 5FYJE 5I9QB 2ZNWA 3KXFB 2ADIB 4P2OD 5C0BA 1CF8L 1JBJA 3LZFH 4LMQI 1CYGA 5HHVL 4P9HH 1RZGA 3WLWD 1DQDL 5FKAA 3WMSA 4Q2ZA 2HRPH 5D1ZD 4TVPH 5HHOA 3GKWL 3JWOC 2B4CC 2RAMA 1NGWA 3F58L 5FO9B 5JDJA 1XIWD 3BGFB 4YE4L 4JDZB 3ZDXF 3DYOA 5C08B 5KBNC 4QOKE 3GRWL 4HWBH 1MREL 5IB3B 2O5YL 5IQ9B 5KANG 2XQYK 4JFZH 4RWYH 3V5DB 3QWRA 3OBAA 2VDNH 1EXUB 3QUKA 4JRYB 5DDHA 4TOYL 3VFPB 4PGJA 2IF7A 2JJVA 4QRPA 5EU5B 3PWLB 1ONQA 4L5FL 3P4OA 1CD0A 1T2QL 3HR5B 3DVFA 5I1GH 1EFXA 5MP6H 2XXMB 2B1HL 5TE7H 1KLFA 2G75A 3EYFA 4FQJL 2FATH 4F33A 3FL7A 1RULL 5I1AB 2BVEA 4PJ5A 4X5WB 4U33A 5I8CB 5JPMA 5ILTH 2CXGA 2MTPA 5DMGD 3W5MA 1V7NL 5CINH 2BDNH 4ELKB 2GTWB 4ONHA 4KK8C 2ZUTA 1CD8A 2BY0A 3E6FB 5LBSH 1F6AA 3WFBL 2YD5A 1W0WB 1QLEL 4QRTB 1GGCH 3SY0A 4YDIH 1HWGB 3IXTB 1WLHA 5A2LH 1IM9A 3EOYG 2QR0B 3CZFB 3OKMA 4KK6D 1PSKL 4PS4L 2GJ6B 2FSEB 3HPJA 5D70L 1RIHH 4HWNA 4ZPVB 4MQXD 3RL1B 3VXNB 4P57B 5IROA 1AFVH 4QT5B 5I1IL 5M94B 2DQGH 1MCDA 2HJLA 3JV4A 3KYKH 4ZDHA 1YN6A 5EOCJ 4UBDD 3TBSA 3ARTA 3VW3H 2IPTH 1INEL 4KUCD 3PP3K 3QFDB 3MMEA 5C2BH 1BLNB 5IMLB 5EUOE 4YEFA 3OX8B 1WWCA 4X4XB 3DXAB 5DVMA 3T3ME 4KHXH 4NKDB 2CMRL 4H25A 4XWOC 3ZKND 3UBXA 1J86A 5CFHA 5IB1B 5ICZB 4OZIF 1KACB 4JFFE 1FP5A 2I60H 2XOTA 5MEOB 2DM3A 1SJXA 1XR8B 3KNBB 5AZEH 2NY4D 4LLMB 1YEEH 4HIIB 5D8JL 1G7MA 4XNMB 5ANME 2WUBL 1YEGH 4B0MM 3NCJH 4GAYA 3B6SA 1A6ZB 4EI6A 5GS3A 4OGXL 4LHUA 1XCQA 4OZGF 3D39D 1IAKA 3IDJA 3BMVA 1CU4H 5DJCB 4I0CC 4NJAH 3QBTB 2R2HB 1UWGH 4UB0L 2EYRB 4JDTH 1LO5B 4GMTL 1R6VA 3NIGF 4OLZH 4N0YL 2P44B 3PJSB 3JTTB 1J8KA 3MA7B 5T5FH 2FYYB 3QUXB 4EDXB 3O4LB 1U8PB 1JTPA 2GK0B 1RJZA 3N06B 5JA9A 2OMBA 2X41A 3SGJA 2E8ZA 4PJBA 3HI1A 4JFOB 1R5VA 2F53A 5EIIB 4WV1B 1KB5A 3SKJH 2Z93B 2BVTA 1GC1H 2OCFD 1F3JA 3KPRB 5BRZD 2BXZA 5GZNC 1UYWH 3I02A 2XY1A 4F7TA 4E41A 4GUPA 5I66B 5D7SH 5F6HJ 1T03H 1J9CT 4ONGH 3LKPA 4N1EA 1OTSC 1I7ZB 5J9PB 3O3DB 4EDWH 4NC1E 5T3XD 2P24A 4P5KA 1A7RH 5EU4A 2H6PA 5E9DA 4YEEA 4KKCD 2LE9A 1TMCB 3QEQE 3BFOA 1IGYB 2ATPA 3GNML 2VO5A 1NBYB 4HPOH 2IG2L 3T2NL 4WUUA 4NN5B 3FO2B 4YPGB 1PQZB 1SYSB 5JMRA 5FYJL 5BZWA 4AQ1B 2IAND 4I0PD 4NO2A 2VLJD 5FO8B 1PJ9A 1S78C 4MXQD 4DCQA 2GCYA 4PJEE 4K2UL 1I3VA 3VRLE 4RQQA 2VLLA 4CRPA 1J1XH 1P84J 3QXAB 2D7TL 3VFMA 2AKRB 2X4PB 4JN1H 3SDXF 5F8QC 3EZ8A 3K2UL 2DLFL 4YPJA 3TVMD 1JPFA 4NRXA 1INQA 4POZC 1U3HA 2CXKA 3VXUB 3PV6B 1P4IH 4YGVB 4PPTA 4KJWD 3HE6D 1KXQE 4QKXB 4ZTPH 5FGCB 4UTAH 2QKIB 4RNRA 2NX5D 4Y2DD 3ARUA 3KPPA 1MHPL 1CFVH 2V9RA 3JBG7 1NBQA 3OZ9H 3RPKA 4ZYKA 1A6UL 4PP1D 1F58H 4F9PA 1WBYB 4GRWH 5HHME 5CD3A 3QI9A 2FNBA 2YD2A 4JZJB 5D9SB 3U2SB 1PG7H 1VA9A 2OJEA 5E4EC 4DVBB 2XQBL 1FO0B 1TJGH 2CK0L 4RISH 4PJAE 3CVHB 1XGRB 1F3DJ 2P46B 5KSUB 1OGTB 1GOFA 5EOQH 1K6QH 3G9VA 3UZQA 5E6ZA 4IRZH 3FKUS 1M05A 3FO1A 1TDQA 4AMKH 5FECB 3U4BL 1NGQL 5BV7H 1JHKL 4NQED 4P4RB 3VCLA 4XP5H 3C8DA 2JJWA 4YK4B 3L5XL 1JF5A 3WHXA 1E4XL 1XGYH 1ZT1B 5HI4D 4NQUA 3L7EB 3G08A 1Q38A 4MS8C 3W9EA 4IHOA 3MUHL 2OS7A 3H9SD 3MV11 5DK0B 3CJJA 4XWGH 3TIEA 2Z31C 2VZTA 1A7QH 3KR3L 4JFED 5CGMA 1XGPA 1A21A 2YUXA 3EZJB 4Y4HA 2GY7B 4RFOH 3B8YA 3PGDA 4RDQF 4M5ZH 1FZKA 3ULUD 3WBDA 2VH5H 3GSRA 4CADB 5EBMB 4X8JB 5TF1L 1HI6B 1RZIB 5EO0A 1RUQL 3PABA 3DLQR 1D5MB 1R24A 2DTMH 4GKZA 3EDDA 1P6AB 5C0AE 4H8WL 5F1NA 5C0JA 5TQ2H 5ESAB 1OW0A 4TQEH 4WRLA 3GM0A 3FT3B 2DWDA 2ICES 2WBJA 4JZOB 1MCPL 1OTUC 1VEOA 4Y4HC 3MRKB 1MEXH 2VQ1B 2A6IA 2VDPH 3E6HB 2DQIL 1XZ0B 1N64H 1T3FA 1KYOJ 5HDLA 1OAZL 1PX3A 5DJ2A 2XWTB 3QEUA 3UPAA 3D25B 3NCYS 1U91B 1RUAL 3VFVA 3EOTH 3X3FL 2FO4A 4Q6YA 4HFWA 3LS4L 1QLRA 5KG9B 9CGTA 5T3ZD 1FYTD 3TNNA 1U8QA 1JGVL 3PV7A 1OW0C 3KXFA 2AI0H 5K9KB 1I1AD 3TPKA 2EEAA 5DWUL 2H3NA 3CDGB 2YOCA 4PJCB 3C5JB 4LL9A 5F7YC 2EE3A 3NH7H 2ZOLB 3RZCD 3O9WB 5MEPA 1GRWA 5EPMB 5FO9A 2KKQA 4MJ2A 2KDGA 3QFJD 4JDZA 3HZMB 3SKOA 4R90L 2AV7B 4PB9L 5C08A 4BQ9A 2VKXA 2YK1H 3K4DA 3C60D 4NWTH 4WWID 5IB3A 1AI1L 5E7FA 3RUGF 5IQ9A 2XI9A 5JR1L 3V5DA 1MJ7H 1EXUA 3VFPA 4EVNB 2YD3A 4RX4D 5EU5A 3PWLA 4DGVH 4HJ0C 5EBWB 3SGKC 4ONFL 3HR5A 4P2OC 1PG7W 3V0WL 3ZTNH 2GFBB 3EOBB 3QDME 5GHWH 3IAQA 1P5VA 3BZ4B 1JZ4A 4GG6F 5KZCD 3HC3H 4P59H 3BGFC 2YPVH 4ODHH 4JHWL 5I1AA 1OAUH 4TVPE 1PEWA 1EHXA 1OT1A 4X5WA 5I8CA 5DFWH 4DUXA 3LQZB 3MXVH 3NZHL 4HZAA 2EDFA 3VMNA 4ELKA 2GTWA 1X44A 3ZHLA 3E6FA 5JXEA 3QHZL 1JTOA 3G6JF 5TFSH 1FSKB 1W0WA 4QRTA 1C7SA 3IXTA 4JRXD 5C86A 4G5ZL 5E2WL 2UWEB 5F1SA 2QR0A 5BXFB 3CZFA 3VXQB 2XIDA 4AZ8A 3EHBD 2GJ6A 2FSEA 4ZPVA 2ZUUA 4HHAB 2VLKD 3RL1A 3VXNA 4P57A 4R9HA 1F2XK 2JCCF 5ITFB 1DJSA 1A9EB 4QT5A 5SWZE 1CDBA 2FH6A 2Q7YB 1YY9D 2Q8BL 5D2LE 3Q6FB 3AFLA 1G0YR 4LARH 3UO1H 4MAYD 5DD1H 5C3LD 3QFDA 4J8RB 1BLNA 5GGSY 3OX8A 4X4XA 1KOAA 3DXAA 25C8H 5FV1L 5FUCC 1EEUA 2ZG3A 4NKDA 4FQ2L 3WCYA 1NLDL 4L8BB 4IRJB 4QY8B 3UTTB 4LNRB 5I1HL 1ROWA 1YNTB 4Z7VE 5ICZA 3HAEB 4KKNA 5IB1A 3WFCH 1EGJL 1HIMH 4L4TD 4DGIH 1Z5LB 4G8GB 4LU5H 2XNAB 3C6SB 4KK6C 3F8UB 5EO9B 5MEOA 4HUUB 1JPST 1XR8A 5CZXD 4LLMA 4HIIA 3PL6B 4XNMA 3MRQB 4ZUUB 1AE6H 2VABB 1A6ZA 3QUYB 2SEBA 4UBDC 4LPXA 5KSBB 1UKQA 2D9CA 3O6FA 1B9ZA 5D7JD 5EIVA 5IGXH 5DJCA 3SQOL 2R2HA 1NAKL 2EYRA 1A6WH 5MENE 1LO5A 2WINB 4Q6IB 2ZCHH 4FQIH 3SDCD 5FYLH 3VXSB 1PZ5B 5IUSA 3PJSA 3JTTA 1WAAE 3MA7A 5D7IF 2FYYA 4PD4K 1QG3A 3QUXA 4X4ME 4EDXA 4ELMF 4EI5B 3O4LA 2ZKHL 1U8PA 1A3RL 2GK0A 3TCLB 5T1KB 4OQTL 3TEUA 4X9BA 4PJHE 4WI8A 3R0NA 1DDHB 2NY4C 3MNVB 4OTXL 1G6RH 4JFOA 1BJ1H 1DQMH 3G5YB 3LKSB 5CILL 2MQ3A 4WV1A 4BH8B 3WFEL 3O6FC 2Z93A 1NUFA 4MB4A 5INCB 1RVFH 1U8OA 5IJKA 3KPRA 1NJ9B 3TH2T 1PY9A 3QDJB 5B22A 4P23C 4WWKD 5I66A 3O8XB 2WWKO 5EU6E 1G9NL 4YQXH 4R4ND 4KJPD 3O6LH 3LD8C 1BPVA 5DUBB 3Q1SH 2MOVA 4OCNC 3MRGB 4KDVA 2EE2A 1I7ZA 4XPBH 5J9PA 2VXVH 3O3DA 2FD6H 3OAYH 3RY6A 1JYNA 1DBMH 2DQDL 4MJIB 5IBTH 3ZKSD 5FHBH 1SY6H 4M5YL 3MCLL 1QPPA 2RCSL 4M1DH 2R8SH 5DLML 4WV1C 2NY3D 3EJYC 3O3EA 1IGYA 4JPVH 3D6GA 3JWDC 4HIXH 1NBYA 2EDNA 1MHHB 2X1WL 2BY3A 3FO2A 4YPGA 1PQZA 1SYSA 1QVOA 2UY6A 3KWWA 2AQ3A 3FB8B 5E24E 2NYYC 4DAGL 3CFJB 5FO8A 4JZNB 4U3HA 5EZOH 4OZFH 1MQKH 3U9PL 5I71B 4JY6B 1JFQL 1DQJA 1FZOA 4WI3A 4KK9C 3VMOA 1MAMH 2PXYD 4QOKB 4ZFOL 3QXAA 1A7PL 2ICWJ 5F3BB 1T2JA 2AKRA 3TYGL 2ID5A 1B4JH 1SVZA 2X4PA 5MEQB 4LCWD 1GGBL 4Y1AB 5HGHB 5F96L 1QSED 4FQCL 3I2CL 3SKNB 3TV3L 4YNYB 3WNPA 2HLFC 1OAYH 4LIQH 3VXUA 3PV6A 4P2RD 4YGVA 2YHGA 4LVNB 4KH2A 5D7KD 2QKIA 3FAXA 4I0PC 1X5GA 4DKEH 5JTWA 4PGBB 3VGAB 1IVLA 3HAEG 4LLVB 1YEHH 4LDLB 4MXQC 2VDRH 4P9HL 4OV5B 3LV3B 2C1PB 5IW6B 4GRLD 1NFDF 5CIPH 1WBYA 2XTJE 1QFUH 3KLHD 4HKZB 1CT8B 2HRPL 4TVPL 4JZJA 5D9SA 3U2SA 3U7YH 5ISZE 5K9OB 4GXVH 5J7CC 4DVBA 2IH1B 1FO0A 3CVHA 1XGRA 1FVDB 5KSUA 1OGTA 3QCTH 4HWBL 3TVMC 4WO4A 5FECA 1UEMA 1WSST 5E99H 4JFZL 4RWYL 1UCTA 2VDNL 4IOFC 4LKCB 2C3HA 2F5AL 5IFAH 1TVHB 3HE6C 4OB5L 1T2XA 4P4RA 4ZQKB 2WLZA 1NEZB 3QNYB 4Y2DC 4Z7OE 5DD0H 5I1GL 4PGEB 5CZVH 3PHQB 5MP6L 3QUMA 3RWGB 3V6BR 5TE7L 4XVJH 4GG8B 1J0KA 5DK0A 4FQ1L 5EUOB 5LCVH 3BPNC 1EMTH 4HC1H 1BBDL 4J3VA 4U2YA 3GMRB 4WO4C 5AYQA 2GI7A 4LSVH 5CINL 3DECA 1UZ8B 2C4XA 3STBA 3RIFK 4JFFB 4M8QA 3U30B 4I9WD 2GJJA 4YK4C 4CADA 5EBMA 1N0LA 4X8JA 1CR9L 4YBHA 1HI6A 5ANMB 1RZIA 4HK3N 2ZUYA 4YBLB 1UM6L 1D5MA 2Z8RA 4XTRC 4BSVA 5EZJB 5DJYB 5HI4C 2ADFL 5GGRY 1AFVL 4K07A 1N2RB 3KYKL 5ESAA 4QO1A 4G3YH 4HWUA 3FT3A 3T0AA 5EIQA 4JZOA 3VW3L 4MB3A 2IPTL 3X11B 2VQ1A 1I8MB 1N26A 4XVSH 3TBTB 3E6HA 2QADD 4PJXF 1XZ0A 4GAFB 4OGAC 2VZVA 1J1PH 1RZJC 3DV4A 4OF6A 3UX9B 2XWTA 4KHXL 1X4ZA 3BE1H 3D25A 3ULUC 4I5BB 1U91A 3H9ZA 1AGBB 5GJSH 2I60L 1MY5A 1UJ3C 2MSPA 5KG9A 2AK1L 4UTBH 1DZBA 2DKMA 2GAZA 2R1WB 4BFGA 3CSBA 5AZEL 1WK0A 3QP3A 1YEEL 3MRLB 5K9KA 1YEGL 1CL7I 3NCJL 4X83A 4HUNB 5BW7A 1QTYT 4PJCA 4RAHA 3C5JA 3MTRA 5EZIL 1BIIA 1CICB 2ZOLA 5A2KH 1CU4L 3O9WA 3VGDA 3GMMB 5EPMA 1RAMA 1UWGL 3HZMA 3GRWA 1QP1A 2EDEA 1HXYB 4ZFFB 3HNTH 2AV7A 2NNAB 4LRNH 3FN3A 4XMKH 4Y5XC 4G42A 4OLZL 4YAQB 1BVLB 4U1NB 5BOPA 3QEQB 1S5IH 2AJVL 4X7EC 4TTGA 2IMMA 1Z6JT 3T2OA 4TTDD 1ZSDB 4KZDH 1UZ6E 1J7VR 1SJEB 3GM8A 3LQAC 1KPVB 3RI5K 2GFBA 3EOBA 3DI2B 4LHUD 2DQTL 3BZ4A 1GC1L 3QWQB 5DYOB 2ORBH 3V4VH 1A3LH 3RZCC 3P0VH 1QYGH 4PJEB 4KQ4H 3LH2H 5JXAL 5D7SL 2P5EE 4PFEA 1UJTA 1T03L 3P11L 4KXZI 1NUDA 1IL1B 1V7MH 3LQZA 3KPLB 3ARYA 4HCRH 4OZIE 4ONGL 3C60C 1CWVA 3WDHA 4EDWL 3BMWA 3BIKB 4RFNB 4HIJB 1B3JA 1A7RL 4HS8H 4ZAKD 3EDFA 2UWEA 5BXFA 3VXQA 4M6AA 5EZLB 4HPOL 5A2IH 2K7PA 1JMXA 4HHAA 1KLGB 3KJ4C 2ZG1A 4X8XA 1KXVC 1A9EA 4HJJH 4E41D 1OGAE 3OMZA 5EORL 5GS0D 2Q7YA 3BHBB 2HWZH 2O5ZH 4YHPB 5HHMB 3C2SA 1A64A 4P4KD 3PWNB 5JW3H 2VXTH 4UIKH 4J8RA 4LPYA 3I3DA 4M9PA 3ZHKA 4PJAB 1KV3A 4WY7H 3ELAT 3P4NB 1LK3H 1J1XL 2NXZB 4UDTB 4L8BA 1W8OA 4IRJA 4QY8A 4LNRA 4XB7A 3UTTA 4S1DD 1YNTA 1OF2B 2YEZB 3HAEA 4K7PL 4JN1L 4ODBD 4PRBB 4CGTA 1CXIA 2BC4B 1KELL 3BGMB 1Z5LA 4G8GA 2XNAA 3C6SA 2DQUH 4HUUA 1MCOH 2IMNA 4X7SH 3KPSD 4EZMA 4WEUD 1I85C 3PL6A 4YHZL 3MRQA 1A6PA 4ZUUA 1Y18B 5IP4A 2AJSH 2VABA 3ZDZF 3BWAB 5C0DA 2DLIA 4UTAL 3QUYA 4K8RH 4GFTB 3MLWH 5KSBA 3QIWC 2YBRB 1CFVL 3OZ9L 3WNNA 5FUZL 1F58L 3BPLC 2WINA 2CK2A 4Q6IA 2OTUB 3VXSA 1PZ5A 3GJFH 4Y4FD 1BQHB 1X7QB 4RISL 4N5EC 4BK4A 3CFCH 4A6YL 1MAKA 1I8IB 4EI5A 1F02I 3TCLA 5EOQL 1B2WH 4MHHI 1K6QL 1U3HD 2WBKA 4IRZL 5T1KA 3ZE0F 3EFFB 4AMKL 2EEBA 1DDHA 4XBGB 3QUYC 3MNVA 2HTLD 2AEQH 3LKSA 3G5YA 5D1XD 5BV7L 2A6JB 4BH8A 1YYMH 4JQXA 5INCA 3X13A 4XP5L 4LHQB 1NJ9A 1A2YB 1T1WB 4X6DF 2XKNB 3QDJA 4WW2B 4IDJH 5D7JC 3HB3C 1Z9LA 3HE7B 3O8XA 2CDFB 2IPUG 3H2WA 1BOYA 2DTSA 1AO7E 1E6OH 4GW5B 5L8JB 1V05A 5DUBA 4XWGL 2ILLA 5FYLE 1A7QL 1SBBA 1A9BB 1UFUA 4MJIA 4OF5A 1DEEB 5EO1B 1KEMH 1FIGH 4RFOL 3MBXL 5SWSD 5B4MC 3GSUB 4M5ZL 4JQXC 3ILPB 1QOKA 4LEXH 3G04B 1AXSB 1OOAA 3CLEH 2P8PB 4XC3L 2QBWA 3ZKXB 1MHHA 3V0VA 4C58B 4JFDE 1BFVH 3KYMB 1B0WA 3FB8A 1N5YH 1OM3H 3RA7H 2DTML 1AGCB 2VZUA 3CFJA 5C1MB 4WWKC 4OZHF 4D9LH 5K33A 2Y07H 3MV9E 3OKEB 4JY6A 4JHBA 3LEYH 4ZFOB 3E2HB 3EO9L 3UTSD 3I85A 4QOKA 2VDPL 1WEJL 2DF3A 1JPGB 1QBBA 5F3BA 1T0MA 3HNSL 5MEQA 2NY3C 4G8EB 5HGHA 1OL0A 4OF7A 4ESKA 3P0YL 1ES0B 3SKNA 2DJUA 2MQCA 3S88L 4YNYA 1ADQH 5DMYA 3SO3B 2A2QT 4NCC1 5F7LB 3QDMB 5FB8B 2AEPL 2F5BH 4HXAH 4NNYA 4N90D 3MSPA 5I71C 1N7MH 2FIKB 2F8XC 4PGBA 2AI0L 3OAUH 1TQBB 4LLVA 1QSFB 1HHIB 4OV5A 8FABB 3LV3A 2C1PA 5IW6A 3DX7B 3S36L 4MA1B 4HKZA 1CT8A 3NH7L 5I18L 5I1JL 3RTQB 5K9OA 2PXYC 1WISA 1QQDB 3BXNB 1F42A 3LIZH 5E8NA 1WZ1H 1XMWA 2IH1A 4Y19E 2IH3B 2QQLL 3TCXA 3BD3A 2YK1L 4NWTL 3VGGA 3RQ3A 3ZKMC 4C83B 3WJJA 1ORQB 4LCYB 4OGYH 1MJ7L 1F4AA 4FFVC 3ZT7A 4LKCA 1ZE3C 4LIQE 4OCWH 4KKAD 1TVHA 2IEPA 3VGAC 3GEWB 1K85A 4JPIB 4MQ7B 4ZQKA 1BQHG 5SWZB 4LVOC 3QNYA 5I6XB 4NKMB 4PD4J 4PGEA 3L1OH 3PHQA 5GHWL 5D2LB 5CJQH 3RWGA 4E42B 1X6NA 4GRLC 3ARRA 4GG8A 2A9MH 3HC3L 4P59L 2YPVL 3WD5H 5EUOA 1I9EA 1HDMB 2PN5A 4POYA 1OAUL 4I1NB 1T0NB 4E0RB 3EDKA 3SDYH 3GMRA 3MXVL 5SX4I 3WJJC 3RX5A 2BVOB 1BIHA 1OVZA 1TZIB 1A4KB 1UZ8A 3I6LD 3QDGE 4Z7VB 3VFWB 4JFFA 4XHQA 2Y23A 5TFSL 4JRYD 4WHYH 5JQ6L 4MXVE 1B90A 2VDLH 3CFEB 4AL8H 3GMNB 4YUEH 4HDIB 1NEUA 5ANMA 2ZJSL 4J7RA 4YHYB 2VR9A 2H2SD 3IYLW 4WFEE 3OB0K 5EZJA 5DJYA 5IFJB 4OFKA 3QIBD 1JNLH 1HINL 3WN5B 1N2RA 4C56E 4KQ3H 1U3JA 1TZHB 1DQTA 5E56A 2XYCA 3IDIA 2IAMD 3R4DA 3U4EA 5MENB 3BAEL 3X11A 1I8MA 4LARL 3UO1L 5DD1L 3TBTA 3T0EE 1A6VH 3RUGE 4X4ZA 25C8L 2BNQD 2ERJB 3QRGH 4PJGB 4FXKB 4NHCH 4I5BA 4PJHB 3KPNB 1AGBA 4JFQB 3WFCL 4BQCA 1HIML 1WFOA 4NQDB 4AEEA 4Z7NE 4GG6E 1YC7A 2R1WA 4PRPE 5L7XH 3JZ7A 2QTEA 3MRLA 5E6ID 3G6DH 1AE6L 3T0VA 1BFSA 5CEYB 3MRRB 4M6NH 5EU6B 4U1HB 2J6EH 2X4OB 1NANH 2HKHH 4HBCH 4XX1E 1CICA 3VXMB 1KIPB 4KHTL 3G6JE 3GMMA 3CH8A 3IT8D 4OGZA 3VWJD 2NZ9C 3DX8B 4OLWH 3K46A 1A6WL 1DEDA 2R0LL 1HXYA 4ZFFA 1EJ6A 2NNAA 2ITDB 3WS6A 5FYLL 1M71B 5IB2B 4Z78B 3AREA 4YAQA 1BVLA 5J11B 3QEQA 4YBQD 5GSRB 1ZSDA 4G6KH 2FGZA 4LCCB 2JCCE 3WDJA 5MI0B 3WSQH 3VFGH 1SJEA 4PJBF 1B6UA 1NKRA 3U4AA 2PR4H 3CFKB 1GPOH 3Q6GH 4TULH 1DQML 1KPVA 5JO5B 1CXKA 3HPLB 1HYSD 3FTGA 4IRSD 1CICC 1U95B 3N85H 1RVFL 3U82B 2VC2H 5DYOA 3MRPB 1SEQL 4NC1C 3MQIA 3BP4B 4PJEA 4F57H 1T7ZA 1AD0B 3AREC 4YQXL 3EYUH 2X4UB 1IL1A 1GGYA 3KPLA 3E0GA 3D2UB 3C6LD 1JGEA 3WXVH 4XPBL 1TQCC 2FD6L 3BIKA 4HIJA 2XQYG 5IBTL 5FHBL 4TTDC 1SY6L 1BX2B 2Q8AH 1FNLA 4M1DL 2R8SL 2FBJH 1JHLH 3F12B 5AZ2H 5EZLA 4HIXL 1E4WL 2LAGB 1KTRL 1KLGA 1CGUA 3WIIH 1ZA3B 3BHBA 4YHPA 3V6OC 2XTJB 4LCIL 1CK0H 5ISZB 4RGMB 5EZOL 1RIVH 5D7IE 3DOSA 1FGNH 3GSQB 4RFNC 2C5DC 4O4YH 3H0TB 4PJAA 3P9MB 3P4NA 4UDTA 3ALWA 3RVWD 1EGJA 3ZO0A 4NZRH 4WHDA 3DX9A 2NY7H 1OF2A 4X6EB 2YEZA 4NNPH 1B4JL 4PRBA 2BC4A 1AD9B 1S7VB 1UB6B 3BGMA 4DZ8B 4YXKH 3HA0A 5GRWA 2DMKA 3GHEH 1JV5B 5DMIL 4K3HA 3L95B 1NCBH 2OP4H 2AK4E 3P73B 4LIQL 2ED8A 1Y18A 3DYMA 1OP3H 5IBUB 4NQSB 3BWAA 4WEMB 4XAKD 2YUVA 5GS0C 3BH8B 2OZ4H 1AQKH 3MRCB 4F8TA 2YBRA 2GUOB 4JJ5B 5AWNH 4GRWB 4P4KC 1UXSB 1YEHL 2JJTA 2B4CH 2VDRL 2Z0BA 3RWFB 1ZGLM 4IJ3C 4UILH 2BHZA 2FL5B 4PRHD 1YECH 1QFUL 4CJ0A 4M43L 4Z7QF 2OTUA 3U7YL 1X5FA 4A6YB 4GXVL 1ZHBB 3ARDD 1I9RL 2ARWA 5GQBA 2KH2B 3BRGC 1BQHA 1X7QA 2CLRB 2DD8H 4OQTA 3K2MC 3NCBB 3OAZK 1I8IA 2CGRH 3QCTL 4LQ1A 5HYQA 2WK2A 1F00I 3T3PF 5BV7B 1IBGH 3EFFA 2ZUQC 4JVWA 4ZFGH 4KI5F 3NCCB 4XBGA 5E99L 3Q48A 1UWXK 2A6JA 3KHQA 2AABL 5CMAB 5IFAL 2JJTC 3FONB 3QCVH 3UBXI 2EYTB 3SE4C 1A2YA 2XKNA 4WW2A 3RX8A 4PY8J 5DD0L 4BA8A 5CZVL 4PV8B 3HE7A 2CDFA 3FO0H 3L3JA 1IGJB 3CNKA 4XVJL 3UYRL 5E08H 4GW5A 3TJEH 5LCVL 4Y8AA 4CU6A 2ZCLH 4Y4FC 3GIVB 4PP2B 3P4MB 1KCSH 2X9XA 1QKZH 1A9BA 3K74B 1DEEA 1F4HA 1VB9A 5EO1A 1LK2B 4N1HB 3C2AH 3AXLB 5E8OA 2EC8A 3S98A 3GSUA 3ILPA 3WFZA 3BDYH 4MCYB 1DUYB 3G04A 3VGBA 1AXSA 2DKSA 5D1XC 1YEFL 2P8PA 4OI9A 1G9NC 4M62H 1MFBH 4RA0C 4MJ5B 3KYMA 3DYPA 4ZOAA 1MFEH 2PYED 2FEDD 1AGCA 3DVGB 3B5GA 2V6HA 3KDMA 4X99B 3IETB 5GPRA 5FM8A 3HMXH 4UI2A 3OKEA 2APFA 5C0CE 1EJOH 4ZFOA 1H15B 2FR4B 5D7LD 4XVSL 1JPGA 3WFDL 4H1LH 1J1PL 4PLNC 4JE4B 5JHDE 2VUOA 1VFBB 2V17L 4Y4KB 3GI8H 4G8EA 1ZVHA 1A5FH 3BE1L 1J05B 4EEEA 1ES0A 2H26B 5DJXB 5JW4N 2X9WA 5GJSL 4HPYH 4WJ5B 4GJTB 3QDMA 5FB8A 4UTBL 4Y16B 1T1YB 3MA9H 2FIKA 4WGVB 4O5LH 1FYHB 2N1KA 1S7QB 1HHIA 2UYLB 3BD5A 4HLZG 2WQRA 8FABA 2P5EB 3DX7A 2QQNH 5DD3H 4OZIB 3RTQA 5I0ZA 1QQDA 3BXNA 5HVWA 2FJFB 3HUJE 4KDTA 3P3YA 4HWBA 4PLKC 2IH3A 3HNTL 4BZ1L 4LRNL 1WITA 4XMKL 3SO3C 5BO1H 3ZL4H 4C83A 4W70A 1CQKA 3MJ9H 2YSSB 4XHJC 5FUOH 1WCBB 5GGVY 4LCYA 4Q74A 3SO5A 4JPIA 1CDJA 4MQ7A 3QUZD 3W5NA 5CEZL 3MV01 5SWZA 4F80A 5IT2H 1OGAB 4NKMA 3HMWH 4DK6A 2P45B 5D2LA 5C0GB 4E42A 3RTQC 1N59B 1LP9E 4QHNB 5FYKU 3I3BA 5KVFH 3V4VL 1A3LL 4CN1A 3P0VL 1QYGL 2CDEB 4KQ4L 3LH2L 1HDMA 4UOJA 1T0NA 3QXWA 4E0RA 1EUUA 1V7ML 4HCRL 2YKLH 4O00A 2BVOA 3DMMD 4KKBD 1TZIA 4XP9H 1A4KA 4Z7VA 1Z9OA 1KIUA 4R2GD 3CFEA 4KKAC 4HDIA 1R0AH 4D3CH 1X5HA 1RUKH 2FBOJ 4IOIB 1WBZA 4HLJA 5ESVB 4CKVX 2A1WH 3HFMH 5F9AC 3WN5A 4XMLH 4UNTA 1TZHA 3ESUF 5DA0B 5HYEA 1MHEA 2O5ZL 5MENA 1R5WB 3W2DH 5JW3L 1CGVA 1OTTC 2AJZA 1MFCL 2F54E 4YX2H 1WAAA 3H7BB 4QRRE 2PUQT 4X4MA 1HHKB 4M61B 1IT9L 5KN5B 4HS3B 5J12B 4PJHA 1QNZL 4WFFE 3KPNA 4GAGH 3DO3A 4PV9B 4JFQA 5CGYC 3BKCH 4Z0BH 3T65B 5JHLH 4TVSa 1DLFH 1P9MC 4NQDA 4CVXB 4NQXA 2DQUL 2FECI 2G5BB 4K71C 4X7SL 4NWUH 1TENA 3QIBC 4O9HH 1AHWB 1A22B 1IILE 3LSOB 2AJSL 1RPQA 4N68A 5CEYA 5EU6A 4K8RL 4U1HA 4XCYB 2X4OA 2IAMC 3QNZB 1AO7B 4NFDA 5IB5B 2ESVD 3VXMA 5K93A 1KIPA 4IDLA 4FABH 4KGJA 2ERJC 3SDAB 4U1SB 4AYFA 5DMKB 3DX8A 1IQWH 3IDGA 2N56A 1G7PB 5TDNB 4XRCB 2ITDA 1M71A 3CAFA 4JM2B 4ODXB 4QXTB 2YXFA 4Z78A 5IB2A 2Q20A 4NZUH 4G8GD 5GSRA 3CFCL 1WTLA 1YY8B 3VI3F 1B2WL 1OPGH 4LCCA 1G6RB 4JFDB 5CJOH 1U8IB 2AEQL 5E6IC 5JO5A 3HPLA 2FO1A 3O2VH 4PJIE 1YYML 1U95A 2LV4A 3RNKB 2VDOL 2VZSA 3K8KA 3MV9B 3PQYD 1TNNA 3MRPA 3BP4A 4Q0XH 2H8PB 4LPCA 3RNQB 4K3JH 3LAFA 3LPFA 1IARB 1WV7T 3VWJC 1AD0A 4IBLT 2NY6B 2X4UA 1E6OL 3D2UA 4L9DA 1E4JA 2DQEL 4RMVA 4YDLB 4LMQE 5SX5K 4NBZB 5LGHH 2BRRL 3DWTA 3TNMB 3KYNB 4WCYH 1FIGL 1BX2A 1IC4H 4I48B 2YN5A 4FTVD 3F62A 1YNLH 3GHBH 4U2ZA 5C2UB 3ARQA 3F12A 3G5ZB 4LEXL 1OD7A 4LLDB 1JWMB 4ZD3L 3CLEL 1LD9B 5I8OH 3IJYB 4IRSC 4LSPH 3QDJD 1BFVL 2X1OA 3B5TA 2C1OB 3OKYA 4PRIE 1N5YL 5HYIA 2CLVB 1ZA3A 4K3EH 1OM3L 3IS1X 4OZFB 3RWIB 2DLHA 2AS5M 1VENA 5FGSA 1YN7B 4OKVB 5AAMA 4D9LL 3NZ8B 5KS9E 5ISZA 2Y6SD 3WS3B 3GSQA 4FRWA 1YUHB 3TN0B 4M93B 4XMPH 3H0TA 4Y19B 4MJID 3P9MA 4OIAA 2EXWD 1U0QA 1D6VH 1K3IA 3T0DA 3OL2A 4X6EA 1OSPH 3BOVA 2X4QB 4EIGB 1AD9A 1S7VA 1UB6A 4DZ8A 3O81A 5J6HB 1JV5A 5GRUL 4X6DE 2HT3D 2P5WE 1BREA 1FFRA 4EN3B 1ADQL 4I3GA 3P73A 4NQCD 4BQ6A 5FEBA 4OLXH 2QSQA 4NQSA 1KCKA 2F5BL 4RGMC 4HXAL 3BH8A 1N7ML 1MIMH 1PKQB 3MRCA 4ENED 2GUOA 1A6TA 2FGWH 4JJ5A 5CIPB 3RBGA 1UXSA 1L0YA 3S96B 4HULB 1KJ2L 1D5BB 1QSVA 5DJ6B 3RWFA 3P4LA 2FL5A 3FFCE 4GW4A 4QOKD 4PGDB 4WTXA 4G7VH 4O58H 5L8LB 2FH8A 4KY1H 3U0TB 1IAMA 2YC1B 1CD1B 4A6YA 5IHLB 5DD6B 1ZHBA 3AS2A 3RVWC 3X14B 1PW3A 1WZ1L 2X7LB 4Y1AD 2CLRA 4UNVA 5CJXA 2MPAH 4UAOC 3GBMH 2X4TB 1RZKC 5ICXB 1XAUA 1OWWA 1G84A 4OGYL 1RURH 1JTTA 1R3IH 1JVKA 5CMAA 3LN5A 5ACZB 3FONA 4HKJB 4EBQH 2EYTA 2Y5TB 3MRNB 4C56B 5DHXB 5DS8B 4PV8A 4X4YB 4KC3B 4JKKA 3SPVB 1P4BH 1IGJA 3KLDA 4WEBL 2A9ML 3T0EB 3RUGB 3LKOB 3WD5L 1KIRB 1CGSH 4U6YB 2DYPB 3GIVA 3KJ6H 3ARDC 4PP2A 3P4MA 5D72H 3OQ3B 3SDYL 4MB5A 5BV7C 1XF3B 1G7JB 2OQJB 3AXLA 4P3CL 4W4OA 3FZUC 1FL5B 3I50H 2IPKB 4NKIL 4MCYA 1DUYA 4GG6B 4ZNCD 4PRPB 1R3JB 3IRZA 2VDLL 3CC5B 2YUWA 4YUEL 4AL8L 4MJ5A 5ID0B 2KQMA 4XBPB 4DGYH 4NM4L 1RMFH 3DVGA 4IMKA 3IETA 4X99A 3N1PC 3BIBX 3D18B 2OTWB 3DBXB 1DSFH 4KQ3L 3G6JB 1H15A 4CMHB 4KTEH 2FR4A 1NCDH 1ZLUK 1BD2E 2EDBA 4PG2A 3U46B 1A6VL 2DMCA 4IIQB 1W72L 4TUKH 3UJTH 3IDXH 4HKBB 4G6FB 1VFBA 4OZFG 4W6YB 2LFGA 2VITB 5BCAA 3QRGL 3SE3A 4RDQG 2JCCB 1J05A 3PGCB 4CAGA 5DJXA 1NC2D 4IMKC 4WJ5A 1IGIH 3V0AC 3VXPB 3IDYB 5E03A 3IFNH 4Y16A 5F6IB 5D6DA 3TJHC 5L7XL 2FHBA 5CHNB 3VFOB 5E2TH 4KAQH 1FNEB 2PTTB 3G6DL 1S7QA 4XP4L 3T4AB 2P5EA 4PG2C 4QHMB 2J6EL 1QRND 1CXLA 1QBMH 2HKHL 4HBCL 4HF5H 4OZIA 1NCTA 2FJFA 3STZB 3SE3C 2JB5L 3MV8E 2YZ8A 3H3PH 1JPSH 3ULVE 5GGQH 3HRPA 1QBLH 2H45A 3KPTA 5CUSH 2YSSA 1F6LL 1WCBA 1AQDB 2YD4A 3DETC 4J3XA 4OQ1A 1WUNT 3WSQL 5MHSD 2PR4L 1OQOA 3Q6GL 4MLSA 2LABA 3RRQA 1D5IH 4TULL 4D0DB 4EQ3A 1OGAA 2VLMD 3NACH 4GBXB 4KVNH 4M3JA 5C0GA 1MUJB 1N59A 3UYPA 4PRAB 2E7LA 2VC2L 3SDDB 2A0LD 5D7IB 4BQ8A 1CZ8H 2CDEA 3DHMA 4QTHB 4LSSL 5E2VH 5D1QB 3RKDD 4NFBA 4GSDH 2VL4A 2ATKA 1OY3B 3FJTA 5DF0A 2R4RL 3CUPA 4MJ4A 1FH5H 1VHPA 3OV6A 1MFDH 3NFSH 1BVKB 3JWDH 2Q8AL 2FBJL 1CDUA 2AK4B 3BDBA 1NFIB 4JKPH 3MLUH 4IOIA 2E7LC 2EXYC 5ESVA 3QIUD 4NCC2 1E6JH 4WHTB 3RZWA 3K3QA 2MCG1 3TM6A 5K59F 4IMLB 3WIIL 1QBAA 3EO1B 3VA6A 3BRFA 4UOW1 1WVZA 4RBPK 1EBPA 1KCVL 4XAWL 1R5WA 1CK0L 3OPZH 1F3RB 1RIVL 3QEHA 5T3XH 1FGNL 4JFHE 4WUKH 4KI1A 4R4BB 4P2QD 2XZCH 3H7BA 4O4YL 4HWEH 5F7FA 2GTZB 2VQUA 4YLQT 1HHKA 4PJ8D 4M61A 3OXRB 4Z9KB 4XX1G 5J1AB 3U6RB 5KN5A 3UAJD 4NZRL 4HS3A 2DIAA 3MLYL 2NY7L 4PV9A 2DQHH 4L29A 4R2GC 3T65A 4NNPL 2DL2A 4V1DE 2V7HB 4YXKL 4CVXA 1WTGT 3SHSA 5A3ID 1O5DT 2G5BA 3IAGC 3RY5A 1W0VA 1NCBL 3MNZB 2OP4L 5C7XH 3HC4H 1AHWA 4HH9B 2V9TA 3LSOA 2XN9D 3QO1B 4RMWA 5KSBF 3DJ9A 4XCYA 1DBKH 2OZ4L 1AQKL 3C5SB 3TO4D 3QNZA 2KBGA 1AO7A 3BZFB 5IB5A 2X6MA 2YPLD 2D7OA 5AWNL 3PWPE 4QXWA 3F6LA 5E95B 3SDAA 4U1SA 4RMQA 5DMKA 4UILL 4J23A 2OSLB 1YECL 5J12C 1ZVYA 2M2DA 4N8CH 5TDNA 1CL7H 3NA4A 3WKMH 3OB8A 4JM2A 4ODXA 4QXTA 1FVEB 4D8PB 3PDGA 3QH3B 4FQXB 2DD8L 1KNOB 2ZZUT 5C0NC 5F8RC 1YY8A 2CGRL 5IMMB 4YZFF 2O61B 1G6RA 3RVUC 3NABH 1O0VA 3P9WB 4ZFGL 4JFDA 3UJIH 4L8SC 1U8IA 4NRZA 1BP3B 1C5DB 4IEFB 4G9FE 2YA1A 3ARGD 3HI6H 3MFFB 3RNKA 2PO6B 3QCVL 2HH0H 3MV9A 4BZYA 5C0CB 4UINL 1YMMD 2H8PA 3RNQA 3FO0L 4D9RE 4YJZL 4I18B 3TJEL 4ZXBB 1J87A 2ZCLL 5JHDB 1MCHA 1SY6A 2H2PD 3B83A 4G6JH 3W39A 1TPXB 1KCSL 1QKZL 2A6DB 5CKGA 1DBJH 3FQTB 3TNMA 3KYNA 5K9JH 4R97C 4I48A 3C2AL 1RHHA 3PGFL 1KN4H 4LFHG 2B2XH 3G5ZA 3QUMH 1JWMA 1ITCA 1ZOXA 1LD9A 5D71H 3IJYA 2BY2A 4M6OH 2C1OA 1MFEL 4KRPB 2CLVA 4JG1H 2NY6C 4OZFA 3RWIA 1H5BA 4Z7QE 5ADOH 3HMXL 3MLVH 1YN7A 1ULVA 4OKVA 3NZ8A 4U0RC 3SJVE 1NQBA 3ARFB 3WS3A 1LMKA 3TN0A 1YUHA 3HUJB 1EJOL 1FDLH 4Y19A 1RZJH 3BQUD 4GT7A 4Z7WE 4XNXL 1NUNB 4DWHA 4NQVB 1MCWM 3ULUH 2J5LC 1KENH 1KCLA 3ULVL 4CVZB 2X4QA 1A5FL 4ODUA 2XV6B 4JKWA 5FKPB 2X89A 5J6HA 3EYOB 5F93C 1T89C 3BP7B 5KSAB 3O4OC 4NGHL 3C5ZB 2Q1EA 3QJHB 4EN3A 1MRDL 4HPYL 1H5BC 3W0WD 3QA3B 3A67H 1D6EB 4OFYA 4LLYB 3TN0C 4O5LL 1OHQA 5CIPA 1MCKA 3V2AR 1RZFH 4PUBH 3S96A 3VG0L 2Y6SC 5IB4B 4JN2B 1D5BA 5DJ6A 4PREB 4PGDA 1JYVA 5C09E 1OCWH 2QQNL 3VD7A 5DD3L 2CR6A 2WP3T 3U0TA 2YC1A 1CD1A 4WTZG 5DD6A 2EXWC 2I07B 2X7LA 3RGVB 4AT6B 2D9QB 1CF8H 4EN3C 5FO7B 2X4TA 5FV2A 5ICXA 3ZL4L 2ED7A 5T3ZH 3QXDB 1DQDH 3LQAH 3MJ9L 2V5YA 5FUOL 2PW1B 1K5NB 1NGYB 4AK1A 3F7PC 4N9OB 3BP6B 4QHLB 3F58H 4BFIB 5ACZA 4HKJA 4J3TA 3MRNA 2Y5TA 1QSFD 4C56A 5IT2L 1TVBB 3GRWH 2VSCA 5DS8A 1TJIL 1MREH 4X4YA 5DUMH 2O5YH 1MPAH 3SPVA 4JO1L 3S9DB 1U42A 3CLFH 3T0EA 3RUGA 5KVFL 3LKOA 1VFUA 4HC1A 1KIRA 1KB9K 2F54B 4QRRB 1MI5E 4POUB 4U6YA 2DYPA 4XVUD 5I8KH 5DZNA 4KJYA 3QG6B 1XF3A 2YKLL 1G7JA 2OQJA 1TLKA 4RRPG 4XP9L 1FL5A 5L6YH 2IPKA 4GG6A 5J13B 1RULH 4PRPA 1R3JA 3CC5A 5K9QG 5ID0A 1R0AL 2ZUSA 1CXFA 2ARJB 4XBPA 4UDUB 5GRJH 1I4FB 3T0EC 2IBZX 3L3DB 3HFML 3D18A 2OTWA 1VDGA 2W9EH 3DBXA 3TWCH 4XMLL 3G6JA 4RMSA 2I25N 3QQ4B 3MUJA 2Q3ZA 1W72B 2R0KL 2WV3A 1NSNH 1WFNA 3W2DL 4PS4H 1MWAL 3U46A 2NY1B 4IIQA 4YX2L 4HKBA 4PJFE 4LCUB 2VITA 4U05A 2VXUH 2JCCA 1OP5H 4QHKI 4GS7B 3PGCA 2Z8WC 4GAGL 4Z0BL 5JHLL 2Q86B 3D0LB 4R0LB 3VXPA 4PJIB 1Z2KA 3OJMB 1QFWI 3ARWA 5DEGA 3D69B 4NWUL 5CHNA 3V5KB 3VFOA 5IFHL 5LGJB 1FNEA 2PTTA 2CMRH 5IHZB 2E9JA 1MQ8A 2X4RB 2CD0A 3T4AA 1WBXB 4QHMA 1UVQB 2A77L 4PLJD 4XNUL 1DN2A 5A2JH 1FN4B 3UTOA 4D2NA 5DXWA 1FRGH 3L3IB 4LP4A 5FUCE 3STZA 2JJUA 4BZ2L 1IQWL 2OI9B 2J7LA 1WIOA 5FYJU 4OGXH 5INDB 1ZLWK 5L2KD 5BS0D 3IDYC 4NQDD 1I7RB 1AQDA 1HE7A 1OPGL 4YR6B 5ID1B 4PYGA 2D03L 4UB0H 5C07D 5IBLD 4XNZC 1MVFA 4KV5E 4GMTH 4PRIB 4D0DA 3FOMB 3FFDA 4N0YH 4GBXA 3O2VL 1MUJA 2MKLC 3LEVH 1EO7A 5KS9B 4PRAA 1MJ8H 3F65A 4JEGB 1EAJA 3VXMD 3SDDA 2XWBB 5D7IA 4QTHA 2K1MA 1KXTB 4HCRA 4M7JL 4XPAH 2DQFB 1NL0H 1FCGA 3UTPD 4I77L 3OJ2C 5D1QA 5GRXG 1EFQA 4MYWB 32C2B 5DZOA 3R1GH 2NY0D 5LGHL 3SBWA 1NLBH 4I3RL 4JFXB 4WCYL 4P3WA 4X6DB 2P5WB 3LEXB 1BVKA 5A16B 3JV5A 1YNLL 2AK4A 3GHBL 3KYAA 5SX4H 1NFIA 4OCMC 2E6PA 3FAWA 3P30H 2X9YA 3SDDC 5I8OL 2EH8H 2A74B 4LSPL 4WHTA 3D39E 4O2FB 3BGAA 4IMLA 2A0LC 4K3EL 4U6TA 2DI8A 4P5TB 5D1QC 3DROB 3D2UD 3MRBB 1XGTB 4NBYB 4NO5B 4PJAF 4R4BA 3SBWC 3QSKB 5T1MA 4XMPL 2GTZA 2BK8A 1CLZL 3OXRA 4M4PA 3GSVB 3U6RA 5JIHA 1FLTX 4PBVC 2I9LB 1RSFA 2VLRD 4K3DL 2LU4A 2DMBA 1JE6A 4I3SL 4WNQB 1XEDA 4K2UH 5BRZE 3QIUC 3MNZA 1UADC 3IGAB 1VCAA 4G8IB 4WTZA 4HH9A 4OLXL 4QRUB 3QO1A 2XTJD 3TH4T 4A2LA 3K1KC 3VXRD 3C5SA 4YHMH 1MIML 3BZFA 2FGWL 5CD5C 5DVOA 3NAAL 3H8NA 3K2UH 1EHLH 2OSLA 5T3XE 4FG6D 1A7NH 4G7VL 3L3OB 4O58L 2HMIC 1FZMB 4PJ8C 1X5IA 5CLWA 1N8ZB 4C55A 1FVEA 4D8PA 3QH3A 3UAJC 4FQXA 1KNOA 3IRPX 3CZJA 1MHPH 2E6JA 1ZHKB 5IMMA 2O61A 1MCSA 1RZGB 2YPKB 2H41A 4YFDB 2BVQB 2IANE 1PY4A 1C5DA 1RURL 3MCG1 5JZ7D 3AM8C 2XQBH 3GMLB 3MFFA 2CK0H 2PO6A 4M7KH 1VSCA 3V4UH 3QULB 4NO0D 1CVRA 5C0CA 4APQB 4QYOB 1AKJB 2HP4A 2QQKH 1P4BL 4Z7UE 4FMFA 1NGQH 2PTVA 4I18A 2Z8SA 2C26A 3OHXB 4ZXBA 1C1EL 3QUKB 4D0CB 4LLQB 1CGSL 4FA8A 3KJ6L 3KPOA 5JHDA 2JB6B 3GSWB 5D72L 4K3GA 5E5MB 1NFKA 2A6DA 4HG4K 1J5OL 4NN7C 1IKFH 1E4XH 3NIDE 2BNRD 3EKCA 2G75B 3I50L 3DUHA 2C3GA 2WP3O 4F33B 2NX5E 1D9KD 4LLUB 2X1PA 2ADJB 5DJDB 2APBA 4DGYL 6FABL 1RMFL 4I18C 4DTGH 3ZSSA 3RIAF 4XT1C 3T1WA 3ARFA 1O7VA 3SY0B 3BP5B 4ZG1A 5SV4A 3HUJA 5TF1H 3WHE1 3NN8B 1IM9B 4BM7A 5KAQG 1NPUA 3MV8B 2A6KB 1NCDL 4OD3H 4H1LB 4YO0B 5GRZA 4NQVA 4TUKL 2JIXB 3UJTL 1UCBH 1MRFL 3IDXL 4NRYB 4CVZA 4FFWD 1ADQA 2H9GB 4NQEE 5FKPA 3EYOA 2YRLA 3BP7A 1VERA 3C5ZA 3QJHA 3IFLH 4XI5D 5B38B 1MCPH 5I73C 5ALBL 4NM8H 4GXUM 1NAML 3QA3A 3MMEB 1D6EA 2XA3A 3IFNL 4ORGB 2J88H 1KJ2A 4OCLC 5GGSB 2OL3H 4LLYA 3H9SE 4KAQL 1P53A 5IB4A 4JN2A 3BISA 3BPOC 3X3FH 5ECJE 4J3OC 4B7LA 4PREA 4JFEE 1QBML 1H3VA 4S1QL 3BQUC 4HF5L 4LLAA 1EV2E 2I07A 4Y4KD 1KT2B 3IFOB 3RGVA 4AT6A 1DTUA 3ULUE 3H3PL 1JPSL 4TNWK 5CSGA 5FO7A 4G8FB 5GGQL 1S8DB 3NGBC 1QBLL 4LASH 3QXDA 1AY1H 1HHJB 5CUSL 3LMJL 4DFHA 1U8NB 1K5NA 2PW1A 1NGYA 4X5LA 5F9JB 3BP6A 3ARBD 3D3VD 4QHLA 1VADB 1E28B 4S1RH 4BFIA 3ZYOA 4J4PD 1Y6NR 1CDCA 1D5IL 5D2LF 4G6MH 3NACL 1TVBA 4KVNL 4ODWB 5DTFB 4MNQD 4JREC 1F3DH 2BXYA 2EDWA 1JI1A 2YA2A 2BSED 3RGVC 2F54A 3FO9B 5I17B 3HR6A 4QRRA 2V7NB 1RHFA 2CLZB 5E2VL 1XR9B 2C7UB 4PJBB 3QG6A 1R5VB 5J89A 1V3LA 4GSDL 5F7HA 3OJVC 5I19H 1YNKL 4V1DB 1FH5L 1UACH 5I74C 5T3ZE 1FYTE 1WF5A 2BVUA 1LEGA 2IQ9H 3JWDL 1LE5B 1P7QB 1P1ZB 2BX5A 2NMSA 4UDUA 1I4FA 1F13A 4ODTH 3MLUL 5FA4B 3MACH 5HI3D 4NQTA 1G7QB 3L3DA 1F11B 5B3NA 4LF3B 1AR1D 3PWPB 3QFJE 2F8VA 3K81A 1ZS8B 3QQ4A 4G5ZH 5HPOA 4N8VB 4XB8A 1W72A 4XVUC 3QR2A 3OPZL 1IZKA 5T3XL 1Q0YL 4FQHB 4WUKL 2XZCL 3UMTA 4RSVA 1JZ2A 4LCUA 5E8DH 1FL3B 5BOZG 4WI5A 2R9HC 4PJHF 1ZT7A 4NO2B 3Q5TA 2DQHL 3S34L 1X5ZA 3WIHH 1NKOA 2Q86A 3D0LA 4Q97A 5FM5O 4UUJB 4H1LG 4PJIA 3QQ9C 4G9FB 3MCKB 5GS0H 3D69A 4YHNB 1T66D 5C7XL 5LGJA 2AXJA 2J6EA 5IHZA 2X4RA 4XZUB 1NCAH 3QQNA 1T4KB 1REIA 1WBXA 2DS4A 1UVQA 4P46D 1DBKL 3TP4A 2KL6A 1GGIL 5B38G 5E4EB 2EICA 3QPQD 1FN4A 4YHLH 4LSDA 1IKNA 3L3IA 3GI9L 4JFYB 2GHWB 4GS7C 4N8CL 1CL7L 4KZEL 4K7PX 3WKML 4DJMA 5INDA 3MBEB 3MRIB 1KGCE 1AJ7H 2MFNA 4RNRB 1I7RA 2XPGB 5DFVD 4YR6A 5ID1A 4PBWD 5K59E 3G6AB 2VLKE 3NABL 1DN0A 4GOSA 1H0DB 4PRIA 3FOMA 3ARVA 3H3BC 4B41A 1B0GB 4LBEB 5HVHC 3CD4A 3KS0H 5KS9A 1F4WL 1IKNC 4PLJC 4BSWB 3SJVB 2HH0L 2Z31B 2XWBA 4U1GB 5H2BB 2OI9C 2DQFA 4Z7WB 2W0FB 1Z9SA 32C2A 3PNWB 3ZT5A 3VCLB 1S9XB 2NXYD 4L4TE 2QSCH 4G6JL 3W11D 1I7UB 2GSGB 1ZLVK 4EXPX 4YGAB 2ZP0T 5ENWB 1DBJL 4JFXA 4UT7H 5K9JL 4X6DA 3R06B 2NTSP 2P5WA 3LEXA 1IAOB 5H8DA 3G08B 4G7YL 1F8TH 1KN4L 1KB9J 4X9FA 2B2XL 3MO1B 4BH7B 5CS7A 3CCHB 5D71L 2A74A 4M6OL 4O2FA 2EDRA 5GS2D 2W91A 1LGVA 5CSBA 4C4KT 4P5TA 1T1XB 1U58B 2PTUA 3FFCA 3VD4A 3DROA 3MLVL 1DANU 5C09B 3TC9A 1N6VA 3MRBA 1XGTA 4NO5A 1II4E 3N1MC 1VFAB 3LQMA 1G0XA 1RZJL 2NTFB 4NZTL 4AENB 3ULUL 4DAGH 3CXHJ 5LAXB 1KENL 3AB0C 2AJUH 4K94H 4N8VG 2I9LA 2J8UE 4P0DA 5DI8A 4B7IA 5TDOB 5GGRB 1JFQH 4WNQA 1UH3A 2ZSVB 3BDXA 4U6VL 3IGAA 4G8IA 2OZ4A 3BWUC 1J88A 3A67L 1EHAA 1A7PH 4QRUA 1SEBB 3KVQA 2CJUH 3RVXD 2C3XA 3MNWB 4M00A 5F96H 4FQCH 1MI5B 4Y19D 3I2CH 3TV3H 5CLTA 5GGUB 1OCWL 2ZOKB 2BFVL 1FZMA 3GSXB 1N5AB 1N8ZA 1DQLH 1ZANH 5HYJD 2R2EA 1NH6A 4R7DB 2X4NB 1QHPA 1ZHKA 2P8MB 2F19H 1JGUH 3KPMB 2HJFB 2H3NB 1NMCC 2YPKA 4P2OB 3VD5A 5T3ZL 2Q87A 3LQAL 2BVQA 3L5JA 5MEPB 1WZKA 3BN9D 3GMLA 4K7FB 1I1FB 4R96B 3DIFB 5D1ZB 3SKOB 3QULA 3N9GH 3S36X 4APQA 1XIWB 3S3JA 4QYOA 3WLBB 5DUML 1AKJA 1MPAL 3NCEB 1BD2A 3CLFL 3OHXA 4FG6C 3MXWH 5LWYH 2F5AH 1QUNA 4D0CA 4LLQA 3MLZH 4OB5H 1YQ2A 4PJFB 5I8KL 2JB6A 3CSGA 3GSWA 4LCWE 5E5MA 3OTTA 4BFEA 3JV6B 4WFGD 1MFAH 2EDKA 2DI7A 4M7LL 4X5XB 4YHOL 3FB7B 4Z18A 2WM0A 3F7QA 5L6YL 5EWIH 4WFED 4FQ1H 4RA3A 5D7KE 4NIKB 2A9NL 3BKYH 3DVIA 3O6MH 1IAIM 5ALCH 4LLUA 4APQC 1BBDH 2IADB 3GGWB 2ADJA 5DJDA 1CQYA 4C54A 3HMXA 4KROD 5GRJL 3UTZB 1GL4B 3O0RH 5MERA 1ETZB 3ILQD 2W9EL 2YN3A 3TWCL 4I4WB 1SMOA 4ZPTA 3BP5A 5HTSA 5D5ME 1CR9H 3NN8A 2HT2C 2EC9U 3MV8A 3VRIB 2A6KA 1NSNL 4H1LA 4CU7A 4YO0A 1UM6H 1FIEA 4LSQH 2JIXA 4NRYA 3GB7B 4OT1L 1JNNH 2ADFH 3P77B 1UZ6F 2VXUL 2AJXH 3A6OA 4PRPD 5DC4B 5FGBA 2H9GA 1GZQB 1U2HA 3L5IA 4MLIA 3MLXL 5B38A 1D9KC 2LVCA 4DN4L 3OF6D 2HKFH 4ORGA 1RD6A 3LKNB 1HKFA 3VFRB 1ORSB 5GGSA 3FT4B 4ZS7L 1D5XB 2V2XB 1MAJA 2NY5C 2O5XH 3BKJL 2GT9B 3D5OF 2E27H 5EBLB 3ULVC 2CUMA 3QYCA 5F44A 3IJSB 1GH7A 1TTUA 2KZ1B 2AK1H 1FRGL 3PP3H 1F97A 1KT2A 3IFOA 5FGBC 1YQVH 2D7MA 1D3CA 4I9WE 2HJKB 4FFWC 1DVFD 3MJ9A 4G8FA 1S8DA 2NY4B 3IDUA 3R8BB 2SEBB 1HHJA 4X98B 1LO2H 1U8NA 3O6FB 5EZIH 5F9JA 4LPWA 2ITCB 5IVNA 2CRZA 1VADA 1E28A 4P99A 3D39B 3GO1H 4LRIA 4P23B 2HLAB 4ODWA 4FFYH 5DTFA 5GRVK 1SQ2N 3LEVL 3VWKD 2AJVH 3LD8B 1IGMH 1MJ8L 2D4DA 3FO9A 1FNSH 2X10A 5I17A 2YRPA 2V7NA 4XPAL 1FGVH 2CLZA 4XNYH 1NL0L 5JW4R 1HXMB 1XR9A 2C7UA 4R3SB 4M48L 2DQCH 3OGOE 3R1GL 4NZJA 2HFEB 2YS4A 2DQTH 1U8OB 4WDIB 4V1DA 1E4KC 2R0ZH 4EOWH 4LRIC 1NLBL 3THMH 5JXAH 1LE5A 1T6VN 3RAJH 5BRZB 43C9B 1P7QA 3P11H 4W6WB 1P1ZA 4J4PC 2IC2A 5FA4A 3O2WH 3P30L 4MNGB 2D7QA 1KCUL 2EH8L 4HG4J 1G7QA 2JK5B 1F11A 4LF3A 3PWPA 2VAAB 2YMXH 5ITBH 1ZS8A 1H3TA 4N8VA 5FM4A 3O3EB 4MQSB 3T0XA 4FQHA 3HZVA 4PJ9D 3R8QA 1FL3A 4CMMB 1CG9B 1NC4D 1QVOB 3CDFA 3KWWB 5HI5C 5EORH 1F2QA 3T2PA 2DBLH 2G60H 2ZG2A 3GDBA 1JUFB 5DQ9B 4Y7MA 4I0PB 4UUJA 1M1SA 3BEVB 5HI3C 1DQJB 4G9FA 4MWFB 5IVXF 1FZOB 3MCKA 1AGDB 1U36A 4YHNA 3VI4F 5T1LD 4OLVH 1HN1A 5C0RH 2AEIT 3T04D 1AR1C 4XZUA 3V6OE 3VMPA 1T4KA 5DHVH 2X4SB 3MOQA 4Z7UB 4K7PH 5DC0A 2OBGA 4YHML 4YWGH 1CLCA 1KELH 2VISB 1EHLL 5TDPB 5L9DH 1T7WA 4E9LA 3RHWK 4HLZH 4JFYA 5DURD 4JM2F 4QNPE 4YHZH 2OXHA 1A7NL 3TVMB 5IF0B 4C4KO 2E7BA 2ZSWB 1CFNB 1FZJB 1RZKH 3MBEA 3MRIA 3BSZH 4LDOB 3HE6B 2XPGA 3DHJA 2VYRE 5FUZH 2Z9TA 3G6AA 2NX5B 3RDTD 4Y2DB 4MA8L 1JF1B 1H0DA 3EO0B 1EH9A 1IQDB 1B0GA 4LBEA 3P9LB 5JW4Q 4JCLA 4LOUC 4M7KL 4BSWA 4A6YH 3FB6B 3SJVA 3V4UL 2Z31A 3BPNB 1XF1A 2OK0L 1TTFA 5H2BA 4DKDC 5CP3H 2QQKL 4ZOBA 4WO4B 1J8HD 1OAXL 4Z7WA 2W0FA 3MBEC 3B9KD 3FMGH 1G6VK 4AIOA 2J12B 3PNWA 4NNXA 1BQLH 3OG6B 1A47A 1S9YB 2OXGA 1S9XA 1IEBB 3TZVD 3BVNB 4QXGH 5C92A 1I7UA 2GSGA 2JJSC 1S9WB 3AAZB 5ENWA 2VDQH 1IKFL 5DFVC 3R06A 3KPSE 1IAOA 3QUMB 1K8DB 2R0WH 5DT1L 4NYLB 1AC0A 4UMGA 3MO1A 4BH7A 3CCHA 4KUZH 4U1GC 4W4NA 1K2DB 3H9SB 5C0CD 3I9GH 4KFZC 5F88B 1T1XA 1U58A 3MBXH 3VFNB 4DTGL 4YC2B 5TF0A 4M8QB 2AGJH 1FV1B 3D85D 3F7RA 5C09A 1H3UA 1CD9B 3QPXH 4YFLI 4XC3H 4OM1L 1VFAA 1LHZA 4KK5C 2NXYC 4OD3L 2NTFA 3DUSB 4ODSL 4AENA 4H0HB 4BSVB 5LAXA 1UCBL 2XKUA 1UJ3B 4PR5B 4MSWB 4Q9BA 4TSAL 5GGRA 1H3XA 5TDOA 3MROB 1C12B 2HYMA 2MCPH 3NCMA 3IFLL 2ZSVA 3EO9H 3B9EA 4NM8L 1WEJH 5ABDE 1SEBA 3ZTJG 2ZCKH 2J88L 5FIEA 3REWB 3DV4B 3ARFD 2OL3L 3HNSH 5TJWK 3MNWA 5DC9B 5L0QC 3RWJB 3PXHA 1YC8A 2HRLA 3P0YH 2GSIB 7CGTA 1MI5A 4F37F 3S88H 4Y5XB 1RUPH 3VDCA 2I9TB 5GGUA 1WQVT 5BVJB 2ZOKA 4EUPG 3GSXA 2AEPH 4OF0A 1N5AA 2GAZB 5SWSE 4ZUSB 1IC7H 4R7DA 1YMHB 1SHMA 2RBLA 4URTB 4MXVF 2YD9A 2X4NA 2P8MA 5KSAD 3JVGA 3MR9B 1S7XB 3SGKA 43CAB 3KPMA 2HJFA 4LASL 4LPTA 5HD8D 3NA9L 4P2OA 4U49A 3S36H 2P4AB 1AY1L 1JIBA 1I1AB 5IEKB 1BIIB 5I18H 5AYUL 5I1JH 4EKXA 1KN2H 1P5UA 2B1AL 3WIFB 3CK0L 4S1RL 4K7FA 1I1FA 3KS0J 4R96A 3DIFA 5D1ZA 3RZCB 4DW2H 3SCMC 2QQLH 3STLB 3K1DA 4G6ML 5E5UB 3QFJB 4OJFH 1XIWA 4G42B 3WLBA 1IGTB 3FQRB 4O2CB 3UTSE 5HXMA 5GRYA 1XGUB 3C60B 3RVVC 4R7NB 4G80B 4CNIB 1U8JB 4HUWB 4PJFA 3JVGC 2Q7NA 5C6PB 4RGND 5FXCH 2DBJA 4PY7B 3JV6A 4X5XA 2CUHA 3FB7A 5I19L 3VG9B 5HDQH 4Z7NF 1J0IA 4LSTH 3WLWC 3IKKA 2W0PA 3VH8B 1UACL 5D1ZC 5FCSH 1LO0H 3I84A 2IQ9L 3KJ4B 3QHTC 5KZCB 2VXSH 1XIWC 2IADA 3GGWA 5F72S 1MCJA 3RIFF 3QNXB 1H8SA 3UTZA 4ODTL 3MACL 4HEPG 3FB5B 3OKKB 1GXEA 1ETZA 4Z6AT 4FXLA 3HRZB 2APVA 5JQ6H 4I4WA 1TXKA 2JTDA 3HNVL 3VRIA 2ZJSH 3RJQB 3ROLB 4QF1B 2JF1A 2DJSA 4Q9CA 3GB7A 5E8DL 1HINH 3P77A 3BX7C 1GZQA 2VLKB 5DQDH 1NAMA 1JRHI 3BAEH 3WIHL 1BECA 1T7VA 3VE0B 5DMGC 3QIWB 3LKNA 3VFRA 1ORSA 5GS0L 3FT4A 1D5XA 2V2XA 4MQTB 4P2YA 4UZGA 1KIQB 2GT9A 1NCAL 4LPVA 3BPLB 4BSJA 2FWOA 2D0GA 5EBLA 3LS5L 1JYXA 2NY1D 3IJSA 3EYSL 4E5XB 4YHLL 1MH5B 1QD0A 1OAQH 3I6LE 1HHGB 4L4TB 4OFVA 1G9MH 4MQXC 4JRYE 4MA7H 2HJKA 5C0DB 1FE8H 2JE8A 5TQ0H 1AJ7L 3FRPG 4X98A 4L4VE 2AEWA 2C4FU 3N50A 4KHTH 2ITCA 5I16B 2XZQH 3D39A 2R0LH 4P23A 5D7JB 2HLAA 3KAAA 2E7MA 1WICA 3S5LB 3ZKNC 3SDCB 4AJ0A 4Z76B 3UROR 5C8JB 4GQ9L 4DUVA 3U83A 1XCTB 2BNQE 3RI5F 1URLA 4FP8H 4MHHG 1HXMA 3HG1D 4R3SA 3B8SA 4GRMB 5F7KC 2HFEA 3X13B 4S1SL 3TA3D 4WDIA 4N0CD 2QSCL 3V79C 1SEQH 3DGCR 4UT7L 5BRZA 43C9A 1KBGL 1F8TL 4Z5RB 1CLYH 2A83B 2DQJL 5I75B 4WWKB 5DGRA 4MNGA 4M1GH 1HSBB 2JK5A 5J56B 2MNUA 1ZV5A 3VWKC 1H3WM 1VACB 5HHXL 4CBPA 1BWMA 4PRNB 4OI7A 3U7WH 2VAAA 2H1PL 2X1QA 3VH8G 3ZZ1A 2M26A 4U1JB 2BP3A 2Y9RT 4CUCA 1MCQA 5A43C 4X6CF 5EA0L 2AVGA 3S3PA 4R26H 2HTKD 1WWBX 2NY3B 1E4WH 4OCYL 3V0VB 4KRLB 1HH6B 5JORB 4CMMA 1CG9A 3K80A 3L5HA 2D3VA 2AJUL 4K94L 1FL6B 1JUFA 4LCIH 2IANA 5DQ9A 4I0PA 3SE9H 3BEVA 3I3EA 4MWFA 1NDMB 1AGDA 3C08H 5FOBB 1H9VA 2ZPKH 3MYZA 4BQBA 2CJUL 2X4SA 2F8OA 4Z7UA 1T0MB 3QAZC 4KKCC 2PXYB 4TSBL 2VISA 5DHYB 1QFWH 2FECL 5TDPA 5DMIH 3TO2B 3Q3GB 3HI5H 4LCWB 1C5CH 5HPMB 4Y5VA 3TVMA 5IF0A 5C0IB 5JQHC 2ZSWA 4W6XB 4MMXC 1CFNA 1DQLL 1FZJA 1ZANL 1I9IL 4NNYB 1RZ7L 4CJ1A 3HE6A 1ACYL 2P7TB 4B5EA 2F19L 1JYWA 1JGUL 5IMKB 3U9UB 2NX5A 4LVOB 4Y2DA 1JF1A 3DGGB 1T0PB 3EO0A 4M43H 1IQDA 2UY7A 2P49B 1WJ3A 4GRLB 3P9LA 1I9RH 3V6FB 5E8NB 1CS6A 5KOMC 1WFTA 3FB6A 2WBWB 1W8NA 1W2KT 3N9GL 2CDGB 4DVRH 4NJ9H 4UOW0 5D5MB 1UB5B 4KKLD 4Y5VC 1PKOA 2A73B 3D48R 5H37H 1KLUB 3MXWL 5LWYL 1H8OA 2AABH 1S9YA 2Q76B 3ABZA 3MLZL 4KJWC 3TT1L 5C0BD 1IEBA 1UEYA 3BVNA 2B5IC 3S5LG 1S9WA 3AAZA 1MFAL 4NQEA 4UQ2B 1K8DA 4PP1C 8CGTA 3RDTC 5I76B 5HHOD 5EWIL 3UYRH 4NYLA 1T5XB 3QG7H 4BK5A 4MCZB 1R5IB 1QPXA 3BKYL 5F9DC 3O6ML 1K2DA 5ALCL 3H9SA 4Y0GA 4WHCA 1MVUB 1JNHA 3CDCA 4HIHB 3PE9A 5JDSB 3O0RL 3GUTA 5F88A 5C0EB 4PRHE 3VFNA 4JFEA 5DZLA 4KK8D 3QWRD 1FV1A 4G9DB 3TYFB 3VGHA 1YEJH 1C08B 3HUJF 1VGKB 5H35B 1G0DA 1YEFH 4QRPD 1RJCA 1LE9A 1T7XA 1JF6A 3MREB 4RIRB 4HV8B 1EFXD 3DUSA 4LSQL 3E3QC 1UJ3A 2G9HB 4PR5A 2XG4A 1JNNL 5DVNA 4WGWB 4D9QD 1XT5A 4MSWA 5FGCE 2I5YL 3OKNB 3FQUB 2AJXL 4PJ5D 3MROA 1C12A 1J12A 3IDIB 1DBAH 1KJMB 3U4EB 2ZNXA 4N0UE 2YD1A 5BMFH 2OL3B 4YC2C 1LP9F 2HKFL 3WFDH 3REWA 3QXTA 2V17H 5J4MA 4PGCB 2QADB 4EXKA 2FIRT 3RWJA 2R29H 3K4AA 2O5XL 1IM9D 2AV1B 2GSIA 4XWOD 2E27L 3L7FB 3FRPA 1HEZA 3KLAB 2LVEA 4JLRB 3EDEA 4OIBA 4Y5XA 2I9TA 3VA2C 5BVJA 5HHNB 4MDIB 1X5JA 3JSSA 4ZUSA 5LVEA 1YQVL 1YMHA 2RGSA 2BERA 4RFEB 1FYTA 1P84K 3MR9A 1S7XA 1Q9LA 43CAA 4CN6A 5EH1A 1I1AA 1LO2L 2PYEE 4QCIB 5IEKA 4D0BA 1F90H 4KMQA 3WIFA 4S10A 2QSVA 3GO1L 5BJTB 3RZCA 3RWDB 4X0KB 4BZ1H 1JL8A 3STLA 2V2TB 3QFJA 1K3ZA 3AREB 3AY4A 5D7LE 4FFYL 2EIBA 1IGTA 3FQRA 4O2CA 4JY4B 5DEFA 1IGML 1T80A 2HFFB 1XGUA 3C60A 1FG2B 1KTKE 1WZLA 1TQCB 4LLWB 4R7NA 1FNSL 4G80A 4CNIA 1N6UA 4M7LT 1U8JA 4HUWA 1FGVL 4XNYL 4JGJA 5CEZH 1UH4A 3NFPB 2NY2D 4PY7A 2DQCL 4RX4A 5DRWB 3FTGB 1I1AC 1U2CA 1LILA 5HD8C 5GRVL 3VH8A 2R0ZL 4EOWL 2W38A 4R8WL 3THML 5GZND 4NBXB 3ZT6A 5HGBB 3RAJL 5I0DA 3AY4C 5IHBA 2LQRA 4GLRI 5C71A 1MCNA 2IPUK 3QNXA 3INUL 3O2WL 3FB5A 3OKKA 1JGEB 5DRZB 3WUWB 3ECBB 1PDKA 5F7MC 1ZMYA 3WL9B 5JIPA 1I3RB 4TRPH 3HRZA 3DSNA 4CDGC 5DJ0B 2YMXL 5ITBL 3BJLA 3CU7A 2F53D 3ROLA 3PF2A 4QF1A 3VG9C 4RGNC 4ZS6D 4JR9H 1LO3L 3OG4B 1FBIH 3CFDA 2DJ4A 1I85A 2VLKA 2APWA 2GJZB 2DBLL 2G60L 4PJIF 2WWMD 3VE0A 1MFCH 1S78D 5D93B 3QIWA 3V8OA 4Q9QH 4P4KB 2FJHB 3S4SG 1JWUB 4ZOCA 4OLVL 5C0RL 4IJ3B 5E9DD 5M95B 1KIQA 1IT9H 1QNZH 3DX9B 2VR5A 3D9AH 3RP1A 3F5WB 4YWGL 2XZZA 3EJZD 4XP1H 5CBEB 4E5XA 1MH5A 3EHBC 3LRSB 5L9DL 3FCTA 4WUUD 1HHGA 4L4TA 1YEKH 2DM7A 4POZD 2Y06H 4GW1B 3RFZC 2ZUQB 3KPSB 1KYOK 1RZKL 4LNVA 1YY9C 3NPSC 4NKOA 3BSZL 1GOGA 1BAFL 4XGZA 4MAYC 4ETQB 4M7ZC 1UGNA 1VFOA 2W9DH 5I16A 2FLRT 5D7JA 1E27B 5FYKD 4Y5YC 5CKAA 5KS9F 1J1OH 5GJTH 3U79A 3S5LA 3SDCA 4Z76A 4K23H 4Y4FB 2CR3A 5C8JA 5HYQB 1P69B 1DUZB 1XCTA 2MQ0A 5CZXC 1NCUA 3FMGL 1I1CA 4GRMA 1BQLL 1EERB 5C0AB 2M1KA 4HSQA 2VDOH 4QXGL 5D1XB 5IVXE 3KYOB 2J8UA 5IESL 2N7AA 2VDQL 3UBXG 3VI4E 3BD4A 1BF2A 3QI9D 2ENSA 2R0WL 3L3JB 4Z5RA 2A83A 5KAQF 4MS8D 3LRGA 1ZHLB 1QFPA 3PDDA 2J4WH 4WWKA 3SDCC 2DQEH 1BEYL 4KUZL 1HSBA 1NGZB 2ESVE 1JCKA 1VACA 2BRRH 3I9GL 3O2DH 1RIUL 4PRNA 3ETBF 5E8OB 4LHUG 1V3JA 4LQFH 4U1JA 3UP1A 4XCEA 5DRNB 2LAAA 2AGJL 4KI5D 4FZEL 4ZD3H 4HW6A 1HCVA 3QPXL 5SWSB 1MSPA 5DJAB 3C8KB 3QWOB 4G8GE 5GISH 3WUWG 1HH6A 1TCMA 5JORA 3TA3C 3Q5YA 1M7DB 2UUDK 3KDMB 5D96C 5I75C 1FL6A 3MRDB 4R4NC 4KJPC 1NDMA 3M45A 1OP9A 2MCPL 5FOBA 3PQYE 3DSFH 3JTSB 1OTUD 4Y4HD 3ZYIA 4OM0H 4XXCC 3AS3A 1ACZA 1C16B 1G1CA 2VMFA 2ZCKL 5C09D 3UTSB 4ZFZB 2PXYA 3V9FA 5T1DL 2E9WA 5DHYA 3AGVA 1F4XL 2HAZA 5GRUH 4X9GA 3TO2A 3Q3GA 5M7QA 3AS0A 4LCWA 1EEZB 1RUPL 4AQOA 5HPMA 5DO2D 1L7TH 5C0IA 4FTVE 5F1KC 1IC7L 4WU5B 4YHKH 1IC1A 5F7UA 2G2RB 2P7TA 2DLGA 3HLAB 2RFXB 3RU8L 5IQ7H 1KJ2H 5IMKA 3U9UA 2WBJD 3QDJE 3DGGA 4AM0A 4UU9B 5ICYB 1HKLH 2G5RA 4S11A 5JOPD 4GRLA 1KN2L 2NPLX 3V8CA 3V6FA 2DDQH 5B8CC 1L0QA 3BUTA 1A7OL 1U8KB 4DW2L 1NGPL 3BPCB 2E6QA 3RPIB 2CDGA 5D6CB 3T0BA 4OJFL 5D5MA 1UB5A 4WFHD 4NUGH 3CU1A 2A73A 1MF2L 1T6WA 4F9LA 3IFPA 3MX0A 3A0OA 1OWRM 2XG5A 1DBBH 1FLRH 1KLUA 2YRZA 2V5SA 1GVIA 2Q76A 3MPCA 2M8XA 3KXFD 1YJDL 3OKDB 1KJ3L 2EDXA 2VDMH 4UQ2A 2A38A 3BI9X 2V9QA 5HDQL 4NQCE 5I76A 4WEBH 4LSTL 3UEZA 3KLHC 1T5XA 1BWWA 4MCZA 1R5IA 1LO0L 5IEHB 5EFIB 1ZTXH 5AD0B 5C08D 2VXSL 2XRAH 4AH2B 4JANB 1MVUA 4HIHA 2D31B 5JDSA 3E8UH 2NLJB 4F9LC 4ZSOE 4P3CH 5C0EA 1KCRH 4KKLC 3LPWA 4NKIH 4G9DA 3TYFA 1C08A 1Y0LB 1K8IB 4L3AA 1VGKA 5H35A 1RUMH 4Y1AE 3ULVF 3MREA 4RIRA 4HV8A 3MUZ1 4NM4H 4P9MH 4FNLH 3TGXA 1ZEAL 1WBZB 4I13B 5BZDB 3S4SA 2G9HA 4L4VB 4X80L 4K71B 2VXQH 3FQUA 3OKNA 4U1KB 3DURA 5DQDL 4ZMAT 3QIBB 1MHEB 1KJMA 5DD5H 3UYOD 2NCMA 1AIFB 4OUUB 2OL3A 1K4DB 2AJZB 4MAUH 4QHKJ 1W72H 5IW1B 5JXED 2IAMB 4FQQB 2PYFB 2JELH 2XZAH 3OB0H 2ICWB 4ZOEA 3WNLA 1UENA 4PGCA 1YA5A 2OJZH 1YYLH 2OR9L 3MV7E 2AV1A 2WNGA 2BNQB 3L7FA 3MJ8B 3KLAA 5B3JE 4JLRA 1MCWW 2GJ6D 2F15A 5HHNA 4MDIA 4NQXB 1F6FB 1OAQL 5JUEL 2DLTA 1FPTH 1G9ML 1B4RA 4RFEA 4MA7L 4XP4H 3N1FC 4MXWH 3K7UA 1FE8L 2WSKA 1T5WB 5TQ0L 2AAVA 4M03A 5E6IB 1BJMA 3IJHB 3GK8H 4QCIA 3AMKA 2VN7A 3DXAD 1DP0A 2QADC 1KPRB 5CBAB 2HA1A 2XZQL 5BJTA 2JB5H 5HGAA 3FHQA 4UV4H 3IDGB 3QRFM 3RWDA 4X0KA 2V2TA 3VRJB 3VWJB 1S9KC 4KU1A 5KSVB 1OARH 1HSAA 2JKXA 3V52L 1J0JA 4JY4A 2F58H 2AQ2A 2K9UA 1D7FA 1QLFB 2HFFA 1I3GH 1FG2A 3BESR 4LLWA 4B50A 4DN3H 4U1IA 3WHE0 5IROC 4FP8L 1QRKA 1GJIA 2QLVB 3NCYP 3NFPA 5ACLA 5EUKB 2L7JA 5DRWA 3DPBA 2CKBH 1T1ZB 3H3KA 3O6FD 3OXSB 3SOBH 5IK3B 3ZYZA 1ZVSB 3ZSTA 4IRSB 4J6RH 1RFDL 1VGEL 4YFEA 5HGBA 2W0LA 4LSSH 4P23D 4U7MA 5CSZB 4RCAA 1CLYL 1M6OB 3V6OA 4OCXH 4YFLF 5DRZA 3WUWA 4JCMA 4M1GL