3ZE2E

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 42
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E02
4CJ0A 3IDYC 2UY6A 3IDGB 3T0EB 3HE7A 4XPGH 1ZA3A 1NUNB 2J88H 4TNVF 4XP4L 3SQOL 1JGVH 3MO1A 3RPKA 3NFPB 3WS6C 3MROA 3FQTA 3TIEA 3LN5A 1ZVSA 2A9NL 4IMLA 5I15L 4S2SB 4EBQH 3D25A 5CBEB 1CQKA 1YY9C 3B9EA 1IEHA 2R1XA 4PY7A 4TSCH 3MQIA 2Z35A 2NY4D 2ZJSH 4WEMB 2ZPKL 2Z8SA 2XNAA 5HYEA 2D3VA 1JNJA 1T0NB 4YPGB 5HI5C 2EIBA 1A14L 4NQCE 4Z77B 1KTLB 1I1YA 2CSPA 3ORJA 4WFGD 4WRLA 1IGCL 3OGCA 4NZJA 3EYQD 32C2A 1NGWB 1INQA 4MD5A 5FF6A 1A9BA 3OR6A 3R06A 5GZOD 1NGZB 1FLRH 4QRRD 4HT1L 5ICXB 4PJBE 1T1XB 3DX9B 4NQDA 4WV1C 1S5HA 3GSRB 4HH8A 1F02I 4UILH 4MNGA 4PJDA 3U0TB 1OP5K 2EYSA 2B4CL 3OJDA 1FG2B 3CCHB 1RPQA 4KAQH 4N0UE 3MLUH 4XNYL 3T1WA 3BIBX 4QTIL 4XNZB 3FZUC 4PGBB 5F89B 1WV7T 1TMCB 2BCKB 4UAOB 3FZUD 2BRQA 5ILTH 5EPMA 3UYOD 3IXTB 2EXYD 3O6KL 1I3RA 5I1AB 3IT8D 3VXQB 2BNRB 3DXAD 1RZGA 2MJWA 3ARDA 4FXKB 1AXIB 4LLVB 4TULL 3KVQA 1Z3GH 1CIDA 1LO2L 3UO1H 4LAQL 5KTEH 4YX2L 3GGWB 1X3DA 1OPGL 3MC0A 4DEPC 4IRJA 4LARL 4NJ9L 4UBDD 2DQDH 4K8RC 1GSMA 2H3NA 1ZHBB 2AJSH 4PRHA 2OX5A 2X41A 1JRHI 4LSPH 1NGQH 5GGVY 1MI5E 4GFTB 3C5JA 4ERSL 5D4QA 3TT1L 3EDKA 2DQEL 3TBYB 4EUPA 4GRLD 1CGSH 5A1AA 2D0FA 4ODBD 5GRXG 3UMTA 2ADJB 2A83B 4XP9L 2HAZA 4KJYA 1FFRA 1I9RL 1HILA 4YHOL 1HOCA 1BWMA 3MACL 3KPRB 1F3RB 1UG9A 1QLEH 3DLQR 2F5BL 3HAEB 4MJ2A 3IS1X 4ONGL 4Q6IA 3DO3A 4UU9A 4NZUL 4M6NL 4NDMA 5D9SB 1QSFE 2NCMA 3QQ4B 4JHAH 1RIUH 2XQBL 3QXDB 2JE8A 2LVCA 2VDOL 1V3KA 3SDDB 3D0LB 3QAZB 3L5WA 4L3EE 2ZP0T 5CP3A 5L2KA 5IWLC 4XBGA 1DLHA 3BJLA 3HMXH 4G7YH 4UBDC 3MLZH 4JQVA 3HMXA 3S5LA 3IS0X 4QHUB 3WFEH 4N8CL 4CN4A 3QWOA 3B3IA 2X4OA 3O3EA 4HF5L 3CLEH 4KKAC 3MRMB 5B3JE 3KG5A 4XCFH 3Q1SH 3WFZA 1IC4H 1T2JA 1LO0H 2R0WH 2EXYC 3HPLB 5LG1A 1FNFA 4O9HL 3HZVB 1JPFB 3UPRB 3IJHA 5AZEL 3RUGF 2XYCA 1OP9A 2YXMA 3QUMA 4N0UB 4XPFL 3V4UL 5IJVB 1XMWA 1EX0A 4NQVB 3OAZH 5F1KC 1DN0B 4HWBA 2XZAL 4XP6L 4GG6F 3GKWL 5J3HD 4M5YL 2QADD 3NCMA 1TZIA 2F53B 1N3NA 4HIXH 4YXHH 1TPXB 2WQ8A 2DKMA 5ANME 3GMPA 1TVBA 1MQKH 1JF6A 4RFOL 3GSVA 3ZL4L 1DEDA 5FCSH 5AYUH 2BSRA 1U2CA 3P77B 2MCPL 1H5BB 1LEKB 3BYTA 3TBTB 4AYFA 4LMQE 2ENYA 4X98B 1OTUD 1KJ2H 3N1QC 1JRHL 1OCWL 1MIML 2FB4H 4DVRL 5E08H 5IBLC 4OZFA 1IGYA 4N5EC 2P4AB 3A6BL 5C09A 5DJAB 4Q0XH 5EFIA 4JFFA 5KG9A 1UWGH 3OG6B 4KROB 1ADQH 4XP6H 2W9EH 1A7NH 1NCWH 3CFBB 2BSRB 3KPRE 2J88L 2HJKB 5I8EA 1WUNT 3PWUA 5F3HA 4CU8A 3VU2A 4DGYH 3TT1H 3SDAA 5L9DL 2R1YA 5C07B 1XGRA 1XF2B 1G1YA 1RZJH 3MJ9H 5IESH 1CU4H 3QEUB 1EDQA 4J4PD 4PJEE 2E27H 2ILLA 2YD9A 1CFNA 2UZXB 5JO5A 1NCAH 4HD9A 1AJ7L 1A22B 4FQQA 4YE4L 3KYOB 4LBEB 2B4CC 3NFNB 4DN3H 2SEBB 4MA3A 4EIGB 3WIHA 1AKJA 3D18A 2ZOKA 2X44D 3HRZA 4QRTA 1P1ZA 3VFNB 4U3CA 2APFA 4U6VH 5C0ND 1AIFA 1Q1JH 5EULV 1XZ0A 1YDPA 1RI8A 1NGXA 3CLFL 5EH1A 3TV3H 4B50A 3VWJD 3IXAB 4LHUB 2GY7B 3AB0B 2A6IB 2IG2H 3CGTA 3MLYL 1ZTXL 2EYRB 4UILL 3VXME 3WIHL 4G6MH 4TNVK 4OI9A 5J89A 2BNUA 1G7PA 1KFAL 3LKPB 4MQXD 5K33A 4JRXA 4XVUC 4EKXA 1ND0B 3HZYB 3WD5H 2AW2A 3WNNA 5E2VH 4UB0L 2Q3AA 3IYLW 4ODVL 4Q58C 2F5AL 2C26A 4NUGL 4PJEF 1LE9A 4MAUH 1GGCL 2LAGB 2PXYC 5SWZA 5T33L 5J06A 2DJ4A 3MNZB 3KPRA 2WZPD 5IMLB 4MXQC 4NKMA 2PCPA 2ADJA 1BD2B 2BVYA 3GNMH 2W59A 3GM0A 2WWKO 1KXVC 4ZPTB 4LNRB 2CKBH 3S36H 4QRUB 5F9OL 2CQVA 1G7QA 4F15C 3DRQA 3VDCA 4RFOH 4KK5C 1ZHBA 4PRHB 2JELH 2Y06L 3F7YA 3WUWA 4YHYC 2VYRE 1PJ9A 3ZDYF 5F7NC 5B3JF 1HH9A 3RVVD 4NNYA 3V6FA 1IC7H 1JK8B 1FRGL 1BBJA 4I48A 5GPRA 4HV8B 1G9NC 1JRHH 1TQBC 1ZHLB 2AQ3A 4RZCA 5FKPB 5J1SC 4YHKL 5GGUB 1MCSA 4R4BB 5HYJD 2OQJA 1FC1A 5HI3D 5KVMC 1T1YA 3I3DA 5FA4A 2F19L 2FRGP 2I5YL 2FCBA 1URLA 2Y5EA 3BKJH 5LCVL 2AGJH 2KUTA 1N64H 4NKOB 1D5XB 1A6AB 2E9WA 2QSVA 2FJGA 2XKNA 4XPBL 5JTWA 2NX5D 4C4KO 1IL1A 3DYMA 3ZKQD 2W0FB 3QEQD 3FQUB 5I8OH 3HC0A 1GGCH 3CFCH 1ERNA 4JO4H 4Y4KA 1HDMB 1MFDL 1BM3H 4F9PA 3QDGB 3B9KC 4KTDL 1XGPA 2DIAA 5D8JL 4DW2L 3JWDC 3KNBA 4WI9A 4K3EL 4JRYA 1WGOA 3S8WA 4U1NB 4DGIL 5HJ3B 1IC7L 3BQUD 5FKAA 3TIDB 5DR5L 3DMMA 2HP4A 2C3VA 4NKQB 5BCAA 1ZA6B 5BRZD 2H2PC 3OGCB 4LEOA 4Y4HA 4XCEA 1KTLA 5E95B 2VLRA 4TRPL 5INCB 3SCMC 1HNFA 4FXKA 4LEOB 4NGHH 2OL3H 1OAKH 3WFBL 1MHEB 1UH4A 1BX2A 3VXQA 2WK2A 4LQ1A 1QSED 1C08B 3SDXB 3GMNB 4MXQD 3QHFH 1S7VB 5D1XB 2R1XB 1V7MH 1PEWA 2VXTL 4YDIL 3RP1A 4JRYB 1GXEA 1MCFA 3MRRA 4PJFB 2DWEA 5GSRB 4FS0A 4AJ0A 1M7IA 4X8JA 3LV3B 3PGCA 3C60A 1ZVSB 2AABH 4IMLB 4DFIA 1EERB 1XGPB 1PVHA 4QHMB 1KF9B 3F6LA 4LSQL 2GEEA 1A9EB 2IMMA 4EI5C 1N2RB 3KPSD 3V7MA 1FBIH 5DD6B 4BELD 3IFPB 5HDQH 4MZ2A 1D9KB 4DGIH 1S5HB 1R5VB 1IKNA 3T0EA 5IR1A 2HKFH 2GCYA 3EFDH 2VC2H 4NKOA 3H9SE 3BP4B 5EBLB 3JVGA 4G9FB 5EZOH 1K8DA 4HBCH 3GSQA 3QDJB 4KK8D 4RWYH 4N90D 3TWCL 5IBLD 2AK1L 4JGUA 4QNPE 4X9FA 4ZFGH 3ETBF 1BWWA 1EEYA 2OL3L 5C6WH 4A2MA 4LFHD 5D5ME 1IM3B 2CLVB 3V6BR 1JK8A 4P49A 1T7VA 3M45A 4M1DL 5D7IB 5CP7B 5E6YA 3DO7A 2DI8A 4F7PA 3V0VA 5I1KH 4YDKL 2YPLA 2BSED 3ZT5A 3DV6B 1II4E 5D5MB 1B6UA 1KIQB 4P9MH 1QYGL 1J1XL 4B5EA 1QBBA 1T03H 4NZRH 4ODUA 1JZ6A 5E7FA 4B0MM 4I4WA 1AD0B 3IFNL 2WWKT 3LN5B 4X5WB 4X7TB 1S7TA 5IGXH 1TFHA 3SE8H 2WBJC 4P46D 4XX1E 3UTQA 4LVHC 4QWWD 1UM6H 2NXYC 4LHUG 1F6AB 5LJYH 2C3HA 4ONGH 2P43B 4J4PC 4LCWD 1PG7X 3B2VH 4JN2B 4FQ2L 1Z2KA 5ADPL 5ID0B 3FO2B 3HAEH 5B8CB 3TA3B 3O3BB 4CAGA 1IZJA 1YYMH 3ZDZF 3HTLX 2ADGB 2CMRH 3WFCL 5SWSA 1Q9WA 4JM2B 3I75A 3ROOB 2Y5TB 3O3UN 5JOPD 4IIQB 3O2WH 3UTZB 1OGTB 5D6CB 5IB5A 5IMMA 1UH3A 2DLFH 4JZNA 5EA0L 3U0WL 5C70A 3MLXL 4NQCD 1BECA 5E2TL 3VDBA 2SEBA 4MA3B 3QULA 3NCJH 3UJIL 4D8PB 1I8IA 1KXTB 1P84J 2UWEE 3CFCL 5IQ9B 3HG1A 2BJMH 5GRYA 3SDXF 3TT3L 4WFHD 3VWJB 5D70L 3DX6A 2ID5A 3NZ8A 4LKXA 3PWNA 3RWFA 4MXVF 2W0KA 3T0VA 4D9RD 3DSNA 5K9OA 3CPLA 4NWUL 1A6UL 5E9DB 3EO1A 3C6SB 3ZYZA 1AE6H 2AAVA 2X1PA 2X4SA 3A6OA 4L8SA 4HX1B 4LIQL 3S35L 1EUTA 3RWIB 2VMFA 3ARGD 3QP3A 5EZLB 5C0EA 1NEUA 2DB8A 3TVMD 4AT6A 2Q6WA 3ULUC 5FYLH 1XCQB 1SJXA 3EDDA 1HINH 2EO1A 3QIWA 5C0AD 4HDIA 4GKZB 2E6JA 3BZDA 3SDCB 1JGEB 1Z0NA 4S1SL 4MS8C 4LGSB 4L4VB 1P4LA 4OZIB 3VMPA 2XPGB 1DEEA 5EORH 5JXEA 1IZKA 2OR9H 5CBAB 5TQ2L 4JFFB 5SWZD 3W0WA 1BJ1H 2IAMA 1CT8A 3MRHA 3QUYC 4XZUB 1HYSD 4OV5A 4UINL 5EWIL 1T0MA 2CLRA 2XA8H 4LSRL 3RUGE 5J9PA 4F7TA 1J1XH 2VITB 1RULL 3KWWB 4JHAL 4GH7B 5FA3B 4BSWB 1WBXA 2H8PB 4KRLB 1PGRB 1RFDH 2RJMA 1H8SA 2AEPL 3PHOB 4N0FB 5C08D 1TVBB 3V4VL 5DS8A 3QH3B 1IAOA 3DVFA 5EIQA 2AK1H 3T4AA 3VXSD 4XXCA 3PWLB 1P6AB 4PUBL 5JHLH 4JFYA 1WWWX 3JTTB 4HKXA 2IWGA 3MRCA 1GH7A 1F3DJ 2G5BB 1I7RB 3IETB 3OR7A 5DLML 3PWPE 1DLFL 5T1LB 1EVUA 1J9CT 4OLZH 3QUMB 1T4KB 4WUUE 3RIAF 4YHMH 4CVXB 4WWKC 3TNNA 3KXFB 4S11A 3RTQD 1LNUB 3MRMA 2X1XR 2P7TB 4BZ2L 1R3HB 2MCG1 2X4OB 3O3EB 1P69B 3O6ML 1CZ8H 4OLWH 3MLXH 2PYEE 1CFSA 3MUZ1 2GTZA 1I7UA 1JPGB 4Z8FL 1DFBL 1QVOB 3ZHLA 1A47A 2XTLA 2APBA 3MZGB 4PJHF 4PJHA 4YUEL 2ED9A 1FVDA 4MNQD 3PWVA 7CGTA 5MERB 4R2GC 4PLJD 1YNKH 2OZ4A 3VFUB 1JZ2A 1SBSL 1ZSDA 1UWEH 2VXQH 4GW1A 3EFFB 4KK6C 3ESVF 1MH5B 4RFNB 2F58H 5F44A 3G04B 4WI4A 1F2QA 3SGJA 1WBZA 4EDWH 2H9GA 3V2AR 1NCCL 4IDJH 5IV2B 2ZSWA 3G5ZA 2NY5C 3INUH 2FL5B 3HI1A 5EZOL 5HYIA 1RUML 3T4YB 4EDXB 2IPUK 1OTTC 1T89C 3F7QA 2H45A 4PB9H 2VSCA 1EEZA 3TH3T 1Q9LB 3RNQB 4H8WC 4NOBA 5F7KC 1WZ1L 3HNTL 5BMFL 4EDXA 3HB3D 1U8IA 1BQSA 2DI9A 3HI1B 5HPOA 3V5KB 3BKJL 3G5ZB 2Z91A 5H35B 1F5WA 2O5XH 1TNMA 3TO4D 4KTYA 3BT2H 3G04A 3PGDA 1LVEA 4XNQA 4YNYA 5DTFB 1KLUA 3BKYH 3N1MC 1IEBB 4JPIA 3BGFB 3S35H 3RA7L 5BOZG 4KI5E 4U1MA 2XQYK 4CMMA 3RVVC 4HIXL 4P4KA 5HHQA 5IM7A 4UUJB 1CXFA 2DQTL 4LMQI 4CBPA 1OSZB 4RDQG 1MAMH 1PKOA 4LU5H 5JA8B 5I1HL 2GITB 4BZYA 4HUVA 5C8JB 4XCYA 3W39A 5BS0E 3X17A 2BDNL 1X4YA 4G42B 1E4JA 4QF1A 2YD1A 3FFDB 1QSFD 1F97A 1P84K 2Z31D 3U79A 5CMAB 4HWZA 1EFXB 3D2UB 2DMKA 2Q7NA 4JKKA 4Z7VA 1UM4L 3HUJA 4J23A 3OAUH 5JPNB 2XTJC 4CW1B 3TNNB 4URTB 2HMIC 1T4KA 2EKJA 2FEDC 3QCTL 3WLBB 4O4YL 1E0OB 1M05A 3IETA 1KBGL 5FM4A 1JNHA 3C8DA 4HWNA 5TF1H 3AU1B 4OLXH 2QSQA 4LCIH 3MODL 3MCG1 1V8HA 5DJYA 3EJYD 5BQ7A 3UAJC 3TO2B 2MKLC 4DVBA 35C8L 4Z7UE 1JZ5A 1MCNA 4OB5L 1L4IA 1I1CA 4OV6F 3GSXB 1G9MH 1KB5H 3G5VB 3H3PH 5EBMB 1PX3A 3VXSA 2VLRD 1J88A 3VFVB 4M5YH 4LASL 3KPMA 4OCSL 3D2UD 4RMQA 4OLUL 1NBVL 3FQRA 4FXGB 1KYOJ 3RVWD 1BZ9B 2DLHA 1UVQB 5CILL 5HHOE 2BK8A 4ZO8A 3DGCR 3EOAA 2DQCL 3O9WB 2VE6B 2J4WH 1KJVB 4YR6A 2J3SA 4OZ4B 2XPGA 4M1DH 4BSJA 1QSEB 2YN3A 1B4RA 3ARFA 1MFBL 3WJJC 3HS0A 5H2BA 2H6PB 2DQIH 5F7EH 4LARH 2FHFA 3SJVB 3O3AB 3P0GB 2A1WL 5HDBE 4HFWA 4CVWA 2I5YH 2O26U 3W0WD 4RMWA 3RBSA 1YNKL 3DETC 3VXNA 5LQBH 2R0ZH 6FABL 3QIBC 1TDQA 1FIGH 4XPGL 4ALAL 1DBML 3RGVB 2HLAA 3QQ3A 4ONOA 1UACL 5EU6A 1SYSB 4LNVA 4XVSL 2EEDA 4JDZA 1R5IB 4G6FB 3SKNB 3IGAA 4RAVB 4F37F 1ORQB 3B6SA 4OGXL 3ARGA 5DJDA 4CRPA 1BEYL 1BVLB 3T3ME 3W9DB 5HYJE 3CH8A 2A9ML 2GT9A 5IEKB 1S78D 1MHCB 2NNAB 3NA9L 4U1SA 4DCQA 1VDGA 5B21A 3H3BC 1E4XL 2NY7L 1B4JL 5IMKB 3L3KA 1TLKA 3VFTB 3D85D 2F54B 3OKMB 2XFXB 4M4RA 3T65A 1QBAA 4F7MA 3MMEA 1QHPA 1T21A 5FCUH 1R5WB 2R4RH 5FHAL 5MHSD 2XY2A 1KENL 5D1XD 4EN3C 3DETD 4OCRH 3L95A 3FFCD 3MGTA 1N6QH 2I25N 3O11A 3BGAA 4MB4A 3U30B 4F9PC 3KXFD 3FB8A 2E8ZA 3QZWB 1FIGL 2NY6D 5AZEH 2E7BA 1NJ9B 4P23B 3FOLA 1UACH 2E7CA 3UYRH 3ROLA 4NQSA 1EO7A 1X7QB 1LEGA 1P7QA 4RISL 3SGJC 1FPTL 1FO0H 4WTZA 2F58L 4JKWA 1UC6A 5A2LH 3RZCD 1XF5A 4M9PA 4X80H 4MAYD 4YWGH 5HVGB 4HKBB 4WCYL 2G5RA 3MV9D 1FNSL 2M2DA 2ERJC 3B8SA 2XWBA 3DVGA 5F1NA 1EHLL 5FXCH 4IMKC 4P46A 4OM1L 1MI5A 3V0VB 3TZVA 1DBBH 2DQCH 3OKDA 4HULB 5TF1L 5E5UB 3UTTB 3BD4A 3FFCB 1KCRL 5FCUL 4LPWA 4HPOH 4KUCD 3ULVD 4KDWA 5EUKB 3QHFL 4G8GE 4PJGA 3SY0B 3S4SB 4JHZA 4FFWC 3C87A 1D5ZA 3MLSL 1ULVA 1ADQL 1NAMB 2FBJL 2DS4A 5C0FA 4KKLC 3TGXA 4PJ7F 4GO6B 4G8EA 4E5XA 1WJ3A 4R0LB 1CXEA 4Y5YC 5DURD 4EBQL 1CLYL 1XGYH 1M7IB 1YEFH 2HG5A 4ZQKA 3QEGH 4RMTA 4RISH 4LP4A 5DMKB 2ZKHL 4WVRA 5CGYD 3RWDA 3B5GA 1D7FA 1FAKT 4KXZH 5EIIB 5TE6H 1UJ3B 4ZFZA 5KS9E 3KLAB 3PQYD 4YFLI 2UYLB 4NM4L 3NIGF 1KCUH 2VLRB 5I73C 2JJTC 4ZXBB 1W0WB 4U2ZA 5DRZB 4XMPL 1OQXA 5ERWA 2VLJD 4OD3H 5KS9A 5I66B 2C3VB 2AJZA 2DJSA 2Z0BA 3MV9A 2ZUXA 2HTKD 1OGAB 1GZQB 5KSAB 3ULUL 1S9XB 2HMID 5SX5H 5HHMD 1SJEA 4DN3L 4UV4L 2P5WD 4L29A 2FX7L 4A6YH 4JY4A 1U3ZA 1HIML 3MJGX 3VFSB 4NQCA 5KN5B 4JFZL 4L3CA 2EDEA 2VR5A 4NZRL 1CLZH 5F1IB 3MRDA 3MBEB 3HC0B 3BQUA 1CICB 2BVPB 3H9SD 3KHQA 2K3TA 3VG0H 5KVGH 1RMFL 1OVZA 1Q94A 4TUOA 1RUKL 1ZVYA 4I5BB 2W0FA 4OZGE 3LIZL 3BESR 4E41D 4NKDA 2FJGB 2J5LB 1NGPH 3QB7C 4LKCA 5ETUA 3OKOA 1LDPH 5ESAA 2W0PA 1XR8B 1X5ZA 1FJ1B 5ESVA 3U7YH 3W81A 3H9HB 4PV8B 4ELMB 3HPJA 3UYRL 5I9QB 1ZLSH 3S97C 4HV8A 4PY8I 4U1IB 3MRKA 4R2GD 4AIXA 5EO1B 5GRJL 1ZLWH 2W1NA 1SHMA 2WINB 4HJ0D 2JF1A 2D7TH 5J1AA 1MCRA 4OZHB 2Z4QA 3G5XB 4UIKL 4HK0B 5E0QA 1MOEA 3N85H 5IIEB 3GBLA 3EYQC 1NSNH 4HKZB 4ZPTA 5C07E 4N8CH 1YUHA 1NCBL 2R0LL 5DFTA 1BOGB 1G84A 3QIWC 3QJFA 2R9HD 4IIQC 1RUPH 3T2PA 4PP2A 2IH3A 4JO3L 4QY8A 3NIFE 5TDOA 2N7AA 1U8KB 1C1EL 2IADA 4K8RL 1SVZA 1NMCB 3MYJB 2MHAA 1TVDA 4Z8FH 3EIFA 4EOWH 3VGEA 4P57B 5FO9B 3RVUD 3MV7B 1D9KD 4LLWA 4NWUH 2YD6A 3DIFA 2ZUSA 2AXFB 3BZFA 3NABL 4FQXC 4JZOB 3WXWH 2XZZA 3ULSB 2AEWA 1J18A 4WI2A 1F4XH 3FB7A 5KSUA 5BZWA 3TP4A 4NCC2 1JGDA 1DQDL 1NCNA 2CK0H 2EIZA 2AXHA 2A6KA 1RJYB 1Y18A 3WYRA 2A6JB 2IPTL 3K7UA 4FOMA 5LWYL 2W9DL 1X5YA 2FGWH 4MWFA 2D4DA 2LE9A 3CFIC 1BJMA 2YA2A 4UTAL 5HGGS 4HLJA 4NN7B 5TQ2H 1IMHC 4G43B 1QD0A 4L4TD 1DJSA 3NFNA 3ULUH 1RZ8B 3QUYD 3LMJL 1F3JB 1F42A 4GKNA 1WAAF 5I1LB 3GK8L 5EC2A 3EO9L 4ZXBC 1ZHKB 1BVZA 3NA4A 1IM9B 4OUUB 1UH2A 4OCWH 4QXTA 3OKNA 4HW6A 4PR5A 3WSQL 4GLRH 5HI3C 4Q0XL 5IKCB 1YEJL 3TPKA 2X4TB 3MCLL 4HG4J 5C07A 3FQXA 2GAZB 1VA9A 3FT4A 4IMKA 4WWKA 5BZDB 3BW9B 4X9IA 5IVNA 1AGDB 4D9RE 5AEAA 1VEOA 2JLLA 4NFBA 5E8OA 1DTUA 4D3CL 3DV4B 3ULVE 1P7HL 4JCMA 3BAEH 1QLRA 5FGSA 4OZFH 3IF1A 3QUMH 3IU4L 3UZQA 2FJFA 4Y19B 5D1XC 2D7TL 4HWBL 3QUKA 5MEQB 3RVXD 5I18L 3EOBA 4GAJL 2VLLA 1AXTL 2R2EA 5HYSA 3ECBB 3U9UA 2FIRT 4KPHL 5DHYB 2R23A 5D1ZA 3BO8A 2R8SL 5SWZE 1OGAD 1YEIH 4E41E 3HE6D 1J8HA 3PP4H 3BWUC 4P2CG 3UZVB 3MRNB 3W82A 1DBMH 4U1HA 3N85L 3CXDL 4LP5A 4EI5D 3DUSA 5JW4R 1AO7B 4X6EB 3ILQD 3CDGA 5HHVL 1Q72H 4WI7A 3VXMA 1CVSC 3AUVA 1JWMB 3I9GH 4QTHB 3BEVA 3MV01 3QHZL 4OT1L 4Z6AT 1A6ZB 3QUML 5E2VL 4GAFB 1IGFH 4XP4H 4LDEB 4RMVA 3SDCD 4FA8A 5BJTA 2K7QA 2YBRB 1U91B 2W07A 1P7QD 3O0RH 3FRUB 3VI3F 3ZSTA 4KJPD 2W0LA 1HSBB 5T3XD 3TEUA 5GRUL 5T1DH 4I77H 1W72H 2AJ3B 1UXSA 4YBLC 4YGVA 1JNLL 4MJ6A 4KMTH 3BDXA 5TQ0H 4PJFE 3MBXH 1OQOA 1JN6B 2PTTB 3BH8B 1FL3B 4I3RH 4JRXD 3O8XD 5ACZA 5DFVD 2V9TA 3HNSL 3V6ZB 3ALWA 5A16A 1T1WA 1WWBX 1CR9H 1GZPB 2VDQL 4PJ7E 5K9QG 2DYPA 1RUQL 1Z9SA 4X7DC 1P5VA 2UZIH 5C0CA 3GIZH 4HZAA 2OTUA 4JFEE 4X5XB 5AWNL 1ZGLA 4BKLB 1X6LA 1B0GA 2Z31B 3IU3A 3L6FB 4V2CB 1FO0L 1P9MA 1KIPB 2WIIB 1SEBB 3QJHA 4WHCA 3H3KA 2P5WE 1BF8A 5I1GL 4RIRB 4F3FB 5C2BL 2ARJB 2UZYB 2P24A 3Q5TA 1YN7B 1VGKB 3DHJA 2VDLL 3WS3B 4KZDL 3QNXB 4HXAH 3QIUD 3SKMB 5DRXA 4PBXA 1JYXA 1EEQA 1YEGH 4L4TE 4U6YA 3I6KA 1MELA 1LILA 2Q7YB 3MGAA 1KJMA 4JQIH 1M4KA 1U8JB 4O51A 3IU4H 1H15A 3TNMA 5I74C 3C08H 1UCTA 4L4TB 5C0DB 2I9LA 1QBML 4ZFOB 1OAKL 4L4VE 3WFBH 2O5XL 1PSKL 2NZ9D 3GMMB 4TRPH 4JFDE 1D5BA 2YXFA 5FUZL 4KHTL 4OGAD 1EH9A 5HGBB 4U1KA 1NCTA 4E42A 4PJ9D 5GHWH 3OJDB 4DUXA 4WJ5B 4YC2B 4Y5VB 4GKOA 1UFUA 1WFNA 4X4MA 3DHMA 4LVOB 5GS1C 5B39B 1Q9KA 3DGGB 4KXZI 4Y4FC 4FXLA 4DEPB 3RX8A 1GVIA 3H7BA 4BH7A 4DGVL 2G2RB 1E6JL 3UPCA 3WV0A 5DJ6B 2DLGA 2W9EL 1NGWA 4HC1L 2P42B 2EKSA 1GJIA 4NQEB 3C9NB 3ZDXE 5IFHH 4R4FH 3C60D 2X6MA 2UWEB 5D5MF 2IANB 2Y06H 5INDB 5AUMB 3EUUA 1T89A 3Q5OA 1AHWA 3PL6A 2Y7QA 3A6BH 3GO1H 5BRZB 4OD2A 2FWOB 3SDYH 4PLNC 1UKSA 3F6IA 4HQQH 2NW3A 3IDNA 4I18C 3MLSH 4JQIL 2YPVH 3X11B 4FMFA 3C8KB 1I1AD 4OKDA 4HHAA 4M7LT 1QRKA 4J12A 3HI6H 1ONQB 1WBYB 5IHLB 1LP9F 1J05A 2M1KA 3UX9B 2GQHA 3D85B 3WIIL 2IGFL 3GMOB 2BXZA 4I0CC 4CKVX 5E5RB 2VLJB 1KB5L 2A74B 1XF1A 2R29L 3NVQA 3FRPA 2CKBB 4L4JA 1U8OA 2VNCA 4AK1A 4FQHA 1NCAL 5C0BE 5BS0B 3EGSA 3PIQB 3CZFB 3UYPA 3QNZA 4YBHA 5JQHC 3CAFA 5I18H 5I73B 3RWHA 4XP1L 3LRHA 4FQXD 3VH8G 5IVXA 1RK0A 5T1MA 3T2QA 4PB9L 3AMKA 4PJXB 1NKRA 2IPUG 3H42H 3C6LB 2ED7A 5IBUB 4HH9A 4C83A 2LAAA 2IQ9L 4Z7UF 2F9BT 3SBWA 3WIHH 4K94H 4YBQD 3TYGL 5FOJA 1PY9A 1FFOA 3OKEA 3VXRE 5KAQG 5A2IH 4I3GA 3QAZC 1QLFA 3DXAB 5HHPB 2J8UA 4RWHA 1TTUA 3OJ2C 2B0SH 3BKCH 5BV7H 5I1CL 3EBAA 4ZUVA 4GUPA 5FGCE 3T0EC 1DE4A 5KVFH 3HI5H 5DDHB 1NMBL 4G8FB 3FQNA 2A2QT 1HZHL 2ICWB 4P3DA 2EE6A 5LGHL 4XC1H 3ARYA 1FNGA 2M26A 4PJIF 1RHHA 4YDJA 1ADQA 1GGBL 1NFIA 3BWAB 1NC2D 2ZG2A 3DRTA 2DLTA 5CJXA 2ZUUA 5GGSB 4HF5H 5T5NG 5M94B 4LSSH 3CX2A 4L3EA 4XPTH 5DVOA 2W91A 5FB8A 3TN0A 5GXBB 4D0DA 4PJAB 5E8DH 4WFGE 4YAQB 1FORH 3DVNA 3D3VB 1CDIA 3BXNA 4MNHA 4LCYB 3VMNA 2O5ZH 5HDOA 3U4EA 2X4NA 1F6FB 4ETQA 3NPZB 3DVIA 1FQ9C 2B39A 5GGQL 4KUZH 3WNKA 4MHHI 1UM5L 4ZSOA 4U33A 3CX5J 1HQRB 4KQ4H 2ZUTA 5DRNB 3KPPA 3BN9D 4Z95L 1Y0LB 4TUKL 3LPWA 1UJ3C 3VCLA 2X89D 3GHEL 3WXWL 3QA3A 3EZJB 3VFGH 1FL5A 5A3IC 2D0GA 4Z76A 3GI9L 5B22A 1KFAH 5E94B 2RR3A 2CXKA 1R3LB 5CIPB 2DBJA 4ZS6D 3MLRL 3FN0H 1PKQB 1XGQA 2Z8WC 1GPOL 1KLGB 3LCYA 4XNUH 1PYWB 2A6DB 2ITCB 3LHPL 3D39D 5LKNA 4NQUA 3D0VA 3VXTB 3EYSH 1KUMA 4ZO9A 3LSOA 4HJ0C 4NBZB 4TQEL 1HYRC 2C7UB 5IEHB 2NY0C 3VRIB 4M00A 2XV6B 1S7QB 1YEHH 4I3SH 4JFQA 2NLJA 1WAAE 3T0XA 3DJ9A 5D7JC 1Z0MA 5CCKL 1RD6A 5CEZL 2NY2D 4QEGA 3S36L 3GBML 2AJVH 1EA9C 5FDYA 5FYJD 5CSBA 4D0CA 3U0WH 4DOHB 3HR5B 4GKSA 5IT2H 1RK1B 2EO9A 4JFFD 2D03H 4L3ED 4HGMA 3BP5A 2GTWA 2HKHL 3MRBA 4FTVD 3RVUC 1CFQA 2GSIB 3P11L 1CXIA 1G9EA 3ZE0F 3D69B 3QCVL 5DO2D 1LDPL 4LCCB 4P2QA 5BV7L 3ARQA 3BEWA 5JDSA 3M8OH 5KW9H 3LQAH 4JN1H 3U2SA 2GJ6A 1DQJA 3E6FA 1OWRM 2H1PL 4ODSH 1D6EA 1HXMA 4HK3N 4PJ9B 2MNUA 5C9JB 2ZNXA 1U93A 4QRRA 1AC6A 4MAYA 3QDHA 1OP3K 5IMOA 3MRLB 5EZIL 4F57H 1VFOA 2NW2A 4JO1L 3P0YL 4XTRC 4WI3A 4FQPA 4PRDA 4QRPA 5F8QC 4UOW1 5KVFL 3PNWA 3UTOA 4KY1H 4NRYA 1EGJH 1NMCC 4HWBH 5F7FA 1OF2B 3I6GB 3I85A 3ARBC 3P4NA 3ZKND 4HAGA 1J0JA 5DJZA 2O61B 5SWQB 5DUML 3L3OB 4PBVC 1E4KC 1P7KB 3RRQA 3T77B 1NFDF 3TJEH 1PAMA 1GIGH 2NTSP 4Y1AB 3TJHD 5D1ZD 1OOAA 4K9EL 5FGCB 2PW2A 3U6RB 35C8H 2VDRH 3FCTA 3JBG7 4HS6B 2D4FA 1QFOA 4NO2B 4JO2H 5FECB 2XN9E 4XI5C 4FHBD 4PJ8B 2HVKA 2R2HB 3PQYE 3RL2B 4NO0A 3BKMH 3V0WH 5K59F 1ZT4B 3ARRA 3G6DL 15C8L 2DOCA 1A7BA 2CD0A 3OG4B 3ES6A 2IGFH 4YHZH 2GIYA 1Q72L 3BMWA 3RX5A 3D48R 4M6NH 5ICYA 1JIBA 4QHLA 2I24N 1HKLH 1QOKA 1C5DA 4M6OL 3T3MF 2AXGB 1A1NB 1Q0XL 3M17A 3ILPB 2BSSA 1IBGH 4GW4B 1A14H 5B3NA 3C5ZA 4DKEH 4PUBH 2NPLX 4QCIB 2E7HA 1XF4A 3JV4B 5DJCB 3ZE1E 1Z9LA 4ZODA 2A0LC 3MRGA 4AENA 2HH0H 4UDTB 3LAFA 5E8EB 2JJSC 4KPHH 4FQJL 1INEH 4J3XA 5ALBH 5DQDL 4QYOB 4TVPH 2EECA 1Z6JT 1U6AH 4P3WA 3HE6B 4ZNCD 3EAKA 3O6LH 2AJUL 4OSUL 2ZUVA 3H9SB 5MENE 1A6TA 1HINL 2EDJA 2HVJB 1QBMH 3OAYH 5JIKA 1VENA 4PJ8D 1G9MC 4LCUA 4LLQA 3GM8A 3OKYA 4OLYL 5HHOB 1PBYA 5JQ6L 3MLUL 4XNYH 3ESUF 4J1UB 3QXUA 4FQXB 1KPUA 4ZNEA 5IW6B 1MFAH 1WC7A 3U46A 3BH9B 3KYMA 4QRQB 1T04A 1RHFA 3GJFA 1QRNE 2BOBB 4JLRB 4P2QD 4W68A 5JUEH 1IGFL 2XTJE 3O6FC 5F72S 3HFML 4OKVB 1S7WB 2YD7A 3GMRB 5L8JB 4KHTH 4XP5H 5GRVL 3CH1A 4HZLB 1WITA 5GS0H 3NCYP 4WDIB 4JPVL 4NNXA 4P5TC 4DQOH 2ZJSL 1BM3L 1QEWA 3DWTA 4NPYA 4XVTL 3P9MA 4BH8A 2EDBA 3QPQD 2QJDA 4V1DD 1ORSA 4JN1L 1I8LC 1UZ6F 3Q48A 5TJWK 3QWRD 5HYJB 1AXSA 2FO4B 4MCYB 5EOTB 5HGHB 5IJKC 3QR2A 4N1EA 4EI6B 5HD8D 3TH2T 4F80A 1GRWA 1MJ7H 4QNPF 4RGOL 5DZLA 3SCMD 5C0BB 1IKFL 4E41B 2VL4A 2EYTA 3BHBB 1JCKA 3MR9A 2F54E 4V2BA 1R24B 1L7IH 4M61A 5D71H 4W4NA 4OLYH 2D7MA 3A0OA 2R4SH 4NT6A 4NQXB 1G7LA 5KBNC 1C7TA 4DJMA 5KANI 1EHAA 3TZVD 3OF6D 5GS0L 3ZE2E 4JQXA 1GIGL 1FO0B 1WTLA 1VFBB 4WO4B 1FCCA 4QXGH 3O0RL 1IC1A 5FYLL 4G7VH 5I6XC 4J3UA 4L8BB 3Q3GB 4PREB 3SOBL 1N5YL 1CE6A 4ZDHB 1AJ7H 5KVEH 4OAWB 3NAAH 3TN0D 3VRJB 4JREC 4D3CH 3HZMA 3UXFA 2YOCA 4AMKL 3SGKC 2VR4A 3EO9H 5IFHL 2EXWC 4CJ1A 1BLNB 2P8MA 2VXSH 2OJEA 5DFVC 1K4CB 5IVZA 4NFCA 4HUUB 3RU8H 1V3LA 1WFTA 2ADIA 3DX8B 4Y16A 1JP5A 2NTFB 4ZOCA 4GLRI 2VUOA 2R2BA 4CGTA 1WEJH 1HKLL 3VG9C 4KK9D 2BRRL 4U1LA 1AGBA 2VISB 4KV5F 3MRIA 3W5MA 4MVBD 2VJXA 2NY4B 2Y25A 4PTTA 2DQJL 4GBXC 4HMEA 4PJCA 4WIQA 1TQCC 12E8H 1F4XL 3BKYL 3U1SL 1H3UA 5L8LB 5DQDH 2F74B 4PP1D 5JOFA 3TESA 1RIHH 2MWCA 1FYTA 3FQWB 1KTDB 4JVWA 2DQGH 5IFJA 1KELH 1FZMB 1E6OH 5F3BB 4XVTH 3MRPB 1JPTL 1CF8L 3KYNB 3IKCB 3AB0C 4X7SL 4N0YL 3PV6A 1JZ3A 2CK0L 5EBWB 1G7HA 3WUZA 3SKUD 1KEGL 2HFGH 2I9TB 4H1LG 4XGZB 4Q74A 2JKXA 3RGVC 1UB5B 3PABA 4CNIB 4Y19E 4F7EB 2BRRH 4Z78A 1K6QH 2PO6A 1MWAL 2PXYB 4U1JB 3LQZB 2VKXA 4DUVA 1CFBA 5F96H 3RL1A 3C5SA 3ET9F 5C09D 1UZ8A 2JCCF 3LKSB 4G8IB 2A77L 4M43H 2B1HL 3TBVA 2W60A 2CLZA 2BNQB 1DQTA 2DQTH 5I1JL 5F7DA 4NKIL 2NY5H 3ZKMD 3VI4E 1JWSA 3BN3B 2HRPH 3KPLB 4DUWA 1U3JA 2W9LA 4N1HB 1DFBH 3SGDI 3WFEL 1AHWC 1YEDB 2BVTA 4LLDA 4KVCH 3P73A 1RUMH 1WISA 2MCPH 4NP4L 4O2FB 4G7YL 1CXHA 2E6PA 4M8QB 1LGVA 3SDAD 1FFPB 1A4JB 3QFDA 5IVXE 3QCUH 2QADC 1KB9J 4LASH 1I3GL 1ROWA 2VQUA 3WJLC 1CYGA 1AQDB 4ZUSB 2OLDA 3P73B 5BMFH 3RKPA 2HWZH 4H1LB 4K7FA 1AO7E 1I85A 5IB4A 3N1PC 2VB5A 4X0KA 5C0CE 1MCHA 3KYAA 4ZS7H 5C7XL 4O2EA 1ZV5A 1ZLWK 1ZHNB 4O2CB 4DZBB 2BNQA 4JPKL 4GBXB 4BUGA 4MQXC 1AD9B 1TJIL 3RA7H 5I2IB 1G7MA 2B1AL 2OTWA 2DF3A 1OTTD 4UTBL 2VWEC 3T0AA 5TDNB 1UCBL 3U0PB 4R6UA 3LQZA 4QXUL 3B9DA 3LQAL 1O7SA 4XCNA 1HXYB 1GOHA 3RJDA 4TUKH 3TYFA 4FFZH 2ERJB 4HWUA 2V5YA 1ZGLM 5TH2B 2CDFA 2VXVH 3MJ9L 3L1OH 1SJHA 2X10A 1FVEB 2DTML 4OCNC 3UCRA 3VGHA 1I7ZB 1BQLL 25C8L 1KJ2L 3A67L 4NUJB 4PJAF 3SKOB 1ZS8A 5CJQL 4XBPB 5IUSA 2FH8A 3L3GA 4MJIA 3IDJB 4ODXA 3UBXB 3V5HB 6FABH 1I4FB 3RU8L 1MAML 4LU5L 5DJ8B 4Q7DA 3R1GH 3GDBA 2JK5A 5L2KE 3K2UL 4U6VL 1J0ZA 4K23H 1ES0B 1H0DA 1KB5A 4Z5RA 3OHXA 2ICEA 4AEEA 2BC4A 4U3XA 1DVFA 4RA0C 5IB2B 1T22B 1U8PB 3D9AH 3S9DB 1C5CH 2AQ1A 2FX8L 3ZLQC 3NIDF 4WEBH 4OJFH 4L8CA 3LY6A 1CVRA 4U6XB 4YO0B 1V3MA 4RSVA 1YJDL 4ERSH 1E4XH 2NY7H 3IDXL 3N9GL 4L9LB 4HQQL 1A6VH 2X4PB 4YHPA 3QDMD 5C0BD 5E2JA 4Y16B 5I1DA 2JCCA 1S9YA 4X99B 4FFVC 1N8ZA 1EXUA 3MREA 3KJ4C 3LKRA 5DHVA 5JW4N 4YDVB 2APWA 1HH6B 3QG6B 2F5BH 4HK3J 5DD1H 5AD0A 2H32A 1OP5H 5E1AA 2G75B 3QXAA 4UT6H 3RVTC 5HHME 1I1RA 4ACPA 2R29H 3A67H 2RFXA 5IG7B 4ELMF 5GS1A 5CKAA 5FGBA 4D0BA 4HFUL 4HIJA 4Y5VC 5ENWB 4MNQE 2QR0B 1LEIB 4ZUWB 2E8YA 2FSEA 5ACMA 2DLIA 1A1OA 3VFMA 4N8PA 4TVPL 3WFHA 1R3JA 2D03L 4OF6A 2EH8H 4FQ1L 4WNQB 2IPTH 3UP1A 5T3XH 4IM8A 3ME0A 4HSQA 1OAUH 2W65A 2Y07L 1KN4H 4O5LL 4YHLL 1TJIH 4PJCF 1MCJA 3EYOA 4XB7A 5E6IA 4K8RD 3IJSA 2OJZH 3WE6B 1MCIA 1KTKE 2IC2A 5JW4M 4FZ8H 4ISVB 3JWOL 3EYFB 5GGRY 3RX7A 1MHHA 4MJ5A 4MDIB 1C12A 4QRSB 3C2SA 3HCVB 3L7FA 3EDFA 4N8VG 1W8NA 3LHPH 1JF1A 1U8NA 5F9OH 1TVHB 3MJ7B 1FNSH 1VPOL 3RNKB 4WFED 4Y2DB 3VD5A 3O2DH 4FQIL 4BH8B 1SYVB 2V5MA 3H0TA 5B38A 3Q1SL 2ATKA 1J0YA 3GSUB 3T2NL 3CK0H 1NC4A 4FP8L 1JL8A 1UQSA 3B2UC 5ESQA 5ID1B 5I9QC 3NTCL 4JANB 5IROC 3RWGA 3IVKA 1U6AL 3TO4B 4P2RA 2CGRL 2Y6SD 4YZFF 1S7UA 5I16B 1CG9B 2Q76A 1DDHB 4BSVB 5MEOB 3MLWL 1T5XA 4GS7C 4P2OB 2FBJH 2VL5B 2Z92A 5JDJA 1TZHA 1ZTXH 2BVUA 1WC7B 3U46B 1BGXL 2D0HA 1MRCH 4OLVH 4OQTH 5FYKL 1A6PA 3P9LB 5C0IA 2XWJA 4NN6C 4X80L 2A73A 4EJ1C 4M7KH 1KT2B 3VFOB 5IW1B 1XGUB 3VG0L 5KVGL 1MFCL 2APTA 1ZT1A 1VFMA 3MJ8A 1J11A 2ATPB 1M6OB 2ITDB 2FJHA 5KSBB 3GSWB 1VADA 5F71A 3G9AB 2IALA 2F53D 4P4KC 3FKUS 1T3FB 3PWJB 3F65A 5ALCL 5D7LA 3JV4A 5DJCA 5J6GB 1EIBA 1SJVA 5GIRB 1SY6A 5FK9B 5LBSH 4FG6D 4O00A 4OCXH 1MUJA 4F2MA 5ICYB 1FV1A 1CDYA 1YMMB 2CIKB 1NCDH 3FB5A 1I1FA 1NC2A 2CXGA 2NXZC 4QOKA 4XVUD 1HHHB 2VABA 4P5MB 2AEQH 4Y1AE 4NSKB 1U41A 5F9AC 3FHQA 3QIBB 3FCTB 3EDEA 2IMNA 1FBIL 1I1AC 5HYQA 5ADOL 1NDGB 5J11C 5JHDA 3AY4C 4XH2B 3LS4H 3W11C 4M6OH 4LPUA 5E7BA 2V2TB 5F88A 3NPSC 2IFFL 4R9HA 2GFBA 4BFGA 3CFEB 3U4BH 2DQJH 2OR8A 1EZVX 3MOBH 2AK4E 1K2DB 4KVNH 1FFNA 4UDUA 4RX4A 4HBCL 1CK0H 1U95B 1I9JL 1E6JH 3EJYC 1INDH 4LVHB 5D7JB 3MRLA 5CEXB 3ARUA 3BPCB 3GMQA 4FFYL 3NN8B 5AYUL 1DQDH 3CDYA 4RBPK 4XVJL 3LN4B 1CXLA 1D6EB 1HXMB 2EDWA 4GG8B 5I8KH 5ISZE 1FN4B 3DROA 3K4AA 3G5YB 2X40A 5D7SH 3C6LD 3O6FA 4MD4B 4C56B 3DX7B 4S0SD 3QI9A 4E0RA 4KJWC 3AREB 4EN3D 4P2QB 5CD3A 4FZ8L 2Q86B 2VN4A 4QT5B 4KH2A 5BV7C 2HFFB 5CLTA 1FCGA 3RVWC 2NY3D 1CFQB 2RQ8A 3GJFH 4HIHB 3MV8A 1ZWIB 3QEQA 3PHQB 4JDVA 3CIQA 4ZAKA 2QSCL 4HUKB 1PZ5B 3O6FD 5IJKA 1L6ZA 5EZJB 2Z93B 4WI8A 4X6CA 3R8BB 1YECH 3RZCC 2F54D 4PGEB 2YC1A 4UIMA 2J7LA 4U31A 4MX7A 4A6YB 1NMAH 3CC5A 4RQQA 3Q6FA 5IB3A 4NJAL 1RZFL 3TVMA 3O81A 2P8LB 1C16A 1BOYA 4OLVL 3GSWA 1NFDA 3FO9B 5C0JA 5C2BH 2C3WA 2OZ4L 5JZ7D 4G3YL 5LWYH 1IEAA 3TPUB 4X4XB 1ED3A 2ZWLT 4Q9QL 3T0EE 5IW1A 3HA0A 4YHIB 4OZIE 2BY0A 5D2LA 3LKNB 3GMLA 3B9KB 4KJPC 4MDJB 3BGMB 4RDQF 4X6DE 1XCTA 4MXWL 1KV3A 5EORL 1SY6L 3QEHB 1HHJB 1Z9OA 3SPVA 4NHUB 4XMLL 4PJ9C 5DI8B 1SM3L 1B2WL 1QFWI 4DZ8A 2R56L 1PD6A 4P2OA 5CP3H 5CZXD 3VFRB 3STZA 3RY6C 1KTRL 3GO1L 3KS0J 4LCWB 4QHNA 1G7IB 1QFWM 4MMXC 4PJBA 1E4WL 5T5FL 1RZ7L 2OL3A 2NQCA 4K71C 1BIIB 5IGXL 2VZVA 1DSFH 1I8MA 4GSDH 1A0QL 5EU5A 4D0DB 4PJXE 3TN0B 2F53E 3WHXB 4OZGF 2QQLH 3CXDH 3ISWA 1QR4A 4HIEA 3X3FH 3MV7D 4MGXA 1OTUC 4DW2H 4G80A 4S1DD 1A8JH 1QG3A 4Z7OF 5D1QC 3PDOB 2H2SC 2A38A 1UYWL 1OT1A 3D39A 4MA1C 5I1IH 1U8MA 4UINH 2WMPA 1AKJD 1WFOA 3PP3H 4HWEL 3CU1A 3GB7A 4JAMA 1MFBH 2ZUYA 1RZIB 5IF0B 5ITFB 1HCVA 4Z7UB 5CEYA 5EU7E 5C92A 1YNLL 1QLFB 2FGWL 2AKRB 1MFNA 4AH2A 2X4UB 2ICCA 5JW4Q 2GK0A 3ZT7A 4UZGA 2J8OA 3WUWG 4BZ2H 3QFJA 3QPQC 1E27A 3VD3A 2FSEB 2I60L 1MLBA 3M07A 2AKRA 3GK8H 3GHEH 2QR0A 1HK6A 4HC1A 3HC3H 4R90H 5ENWA 1F4WH 5FO7A 3T8XB 3ZE0E 3LS5L 5EOCH 3VGAC 3U9PH 5HHNA 4JB9H 1A6UH 1Q9OB 3OX8B 3P4OB 4MNQB 3FHAA 15C8H 5JOPE 4PRHE 1WLHA 2G75A 4D9QE 4GRMA 1BZ7B 3P4LA 2Z31C 4Y5YA 3MFFA 5D7IE 3MOAL 4NQEE 3KPSB 4XXDB 4OBSA 5HHMB 1DBKL 2YMXH 3MREB 5DHVB 2APVA 4P5TA 4HKJA 4KQ3L 2J6EL 4PLJC 3U83A 1S9YB 5CSZB 2XRAL 3KDMB 3MUGA 3P4OA 5BVJB 1UADC 4PJIA 1GHFH 3TJHC 1A7OL 1CDGA 2IPKB 4AIZB 2UWEF 1CE1H 1AFVH 3T1FB 5C3TA 2DRUA 5I8CA 4R7DB 2EE2A 2MMXA 1DCLA 2AEQL 2J6EA 4HPYL 1NGYB 1TCRA 2GY5A 5H94A 2GK0B 4S10A 2C5DC 3UTSE 2WBJA 1YY8B 2KDGA 4OFVA 3D3VD 1W72A 4NZUH 4ORGA 4OD2B 1O5DT 2G9HA 1L9MA 5CWSB 4WW2A 1N0LA 4Z7UA 5DJ8A 1FLTX 2HTKC 3GIZL 1DSFL 1RZIA 4OCYL 4P59H 4XMPH 5E99L 5IF0A 4GXVH 5D2NC 3MTRA 1JVKA 4G9DA 1DZBA 2DBLL 4EI5B 3NAAL 2QHRL 2CMRL 3WFCH 2R0KH 1RV6X 2Q8BL 1N5AB 5D2LB 5IVXF 1SEQL 1BJ8A 1QSFA 4PJ7B 5EU4B 4MS8D 4TUJA 3ZKXC 4HIEB 1CL7L 1HXYA 5IHUL 4HGKC 8CGTA 2BXYA 4XAWH 2AI0H 2EC9T 2OL3B 3MLZL 4Y8DC 3FT3A 4X6FB 5E2TH 3S96A 1JZ7A 3UPAA 3STLA 3VGAB 1ZHNA 2YR3A 5TPWL 1PZ5A 4C56D 4F9LA 3VXRB 4X0KB 1NAKH 2EIDA 1CBVH 1IKFH 3CSYB 4DN4L 1EMTL 1OB1B 1YEFL 3O8XB 2C3GA 4BZ1H 4Y2DD 4TTGA 4PRPA 1HHJA 1JYWA 3RUGB 3DUUB 4OCLC 2EDXA 5HI4D 5IP4A 2VERN 1E6OL 1VB9A 4JG1H 3I2CH 3LN4A 3UJJH 1A7RL 2ZCKH 4U1GB 4YHIA 1NAMH 2DQFA 4YHNB 3MXWH 4XCCH 1M71B 2GJZA 4X9GA 4H8WL 5DK0B 2XWTA 3RIAK 2QQKL 2OP4L 5I75B 4MD0A 1QFPA 43C9A 2YPKB 3P4MB 1U95A 4JB9L 3MLPA 4G7VL 1RIVL 2BHZA 4K07A 2VDKL 4O58L 3Q6FB 3CFDA 4JFHE 5DO2C 5JPMA 2YC1B 1GHFL 3QUYA 3RY4A 1JPSL 1U42A 2IFGA 3PXJA 4Z0BH 1G0DA 2OJZL 2ARWA 4PJHE 1R0AH 5C0AB 1AGEB 3RIFF 1FC2D 3EOTH 1RMFH 5DEGB 5ANMA 3MV8B 4RNRA 4C55A 1YN6A 3F12B 5HXMA 3HMWL 1CLZL 4XGZA 2EDRA 1HQ4B 1CD1B 1N6UA 4WCYH 2E6QA 5DEFA 3AREA 3OXSB 5L0QC 2WBJD 4NM8H 4PRNA 3GI8H 2JIXA 1D6VL 2X4QA 3WNLA 5HHVH 1A7QL 3LH2L 4PRPD 2DTSA 5T1KA 5IFJB 3PWPA 4W70A 4APQA 3J8F7 2AXJA 1AGFA 4R0LC 2AK4B 4PGCB 2AJ3A 1DP0A 1RY7B 3SCMA 3RPIB 4TULH 2VSDA 2MSPA 1XGTA 3MLWH 1U58A 1JGLH 2FJHB 3O6KH 4AM0A 3CFEA 2GFBB 3MRIB 4TTDD 2VXUL 5FHAH 1EAPB 1HHKB 4HS3A 3H6JA 3W2DH 5HDBF 1ZGLP 1U8HB 1E28B 1IGMH 1R3KB 2WUCH 4LVEA 1A1MB 4UQ3B 3QXVA 1T03L 4X6EA 3JZ7A 1JFQL 3K74B 1FE8L 3O2VH 4GW5B 5GS0C 5IROA 4OCRL 4ZG1A 2X9XA 2Z92B 1NGQL 3QBTB 4X4YB 4QLRA 1PFCA 4LRNL 4PRAB 2A9MH 4KFZC 4NO0D 5C0GB 3ECBA 3NABH 1S7SA 1KACB 1MUJB 5MEPB 4F2MB 4OAWA 1CFVH 4KHXL 4JFOB 4YX2H 1UM6L 1I1AB 1T5WB 1UM5H 3V6OE 5FOBA 1MIEL 5MEPA 1AGCA 4KTDH 5D8JH 1IAIH 5JMRA 2CUIA 2VUYA 5D7LB 5I0DA 5ITBH 1XIWD 4N9GA 1CK0L 1PW3A 2APXA 3WMSA 5J6HB 4S1QL 4BYHA 1QRND 2ZG1A 2IALB 4UT6L 2OZ4H 4KGJA 1FO0A 1N0XL 4YJZL 5KSBA 2R8SH 2R69L 5HY9A 2G60L 3MCKA 2BDNH 3B83A 4PRIB 5F6HJ 2OM5A 3SDDC 3TBSB 2DQIL 5F7EL 4CADA 5CIPH 1XIWA 1FFQA 5AG9A 4WWKB 3FT4B 4JFEA 5FUCC 1EAPA 1HHKA 3HZKB 2H26A 2V9QA 1A5FL 3W9EB 1TTGA 3IDXH 5DURB 2R39A 1OHQA 2AEIT 4JFEB 1K4DA 5IKCA 3NIDE 5CHNA 1U58B 3TH4T 4ALAH 4CADB 4OT1H 2JB6B 2ZOLA 5C08A 8FABA 4GSDL 1VKXA 1EJOL 5CCKH 5CEZH 3GSNA 4I1NB 4OTXH 5HHOD 1MLCB 4NC2B 1MCWM 4KRPC 3MCKB 4XP5L 1H3PH 5KJRH 4OCYH 4P59L 4GAGL 4WNQA 3NCEB 1FZOA 3GUTA 2WIMA 5I1LA 2K7PA 1OY3B 1KNOB 4MJ4A 4BK5A 1U8LB 1NC4B 1MCPH 4JRXE 5ABDE 4XVJH 2DQGL 3VA2C 4IS6B 4U05A 4LVNB 4XNMB 4XAKE 3AY4A 3T0BA 4LVOC 5EUOA 5GS1B 3MLRH 3ZE1F 2E7LA 1S7WA 1TVHA 5CZKA 1A7QH 1LP9B 2C1OB 2BY1A 4I0PC 5E1AB 4JE4B 3OV6A 3QISA 4OCXL 4X6DF 1C12B 2HT2C 1JGDB 1NH6A 2VXUH 3O9WC 1MCQA 2EDQA 3SQOH 1W0VA 3BH9A 4QGTA 1JWUA 1MCWW 3QIBD 3R1GL 1YC8A 3SDCC 4J1UA 2H26B 5D1QD 1FL6A 4DVRH 1V3JA 5IK3B 2X4PA 4ORZC 5HGDA 5C3LD 1NLDL 4N5UA 5E2UH 1UB6B 1KG0A 2YPKA 4PRIA 5J57B 3PV7A 5ELIA 1B0RB 2XG5A 2HJLB 4JGMA 2VAAB 5EU6E 1FP5A 1BOGA 5DJ0A 3TA3C 1H3GA 5FV2A 3VWKB 3MRGB 2ICEB 4PJXF 4JY6B 4XWGL 5ICZA 5F9WC 4KDVA 4ONHA 4M6AA 2XXCB 3SOBH 4N0CD 1EJ6A 4F8QA 1OARL 1WAAA 2BSSB 3M17B 4M48L 4PJAE 3O8XA 3DURA 1FGNL 4OM1H 5EO1A 1GGYA 4A6YL 1ZS8B 3RDTA 3U1SH 1S8DB 4U6TA 4NUJA 4C56E 1QKZH 1BF2A 2CO6B 4H88H 4P2OD 4ZFFB 4PG9A 4OGAC 5D1QB 4WEUD 1WWAX 5EOCJ 1EXUB 4NRXB 3ZKXB 2GJJA 3SN6N 4YZFE 4Q6YA 1CGWA 5ESAB 4XVSH 4S1QH 3BZEB 1MWAA 1PEZA 3KPTA 3L7EA 4OQTL 1F45A 3AROA 4RRPA 3E2HC 3AREC 4O5LH 4YHLH 4K71B 2BVPA 3G6JA 3BD3A 1FNAA 3BYYA 3I6LE 4NQDE 1G7MB 4MZ3A 1G9NH 5JXEC 2NY2B 1MFCH 3QDGD 3LH2H 4JFDB 3V52H 1TZGL 1H0DB 4ZD3L 3PQYA 4YBLB 1WT5C 5CLWA 1J1PL 4NZTL 1S3KL 2HFTA 5IB4B 3LZFH 2J5LC 4Z0XB 1FAIH 4YHYB 5L7XL 3WHE1 1MFEL 2WW8A 3GJEA 1F8TH 3EHBD 1X5IA 4MJIB 4ODXB 3UBXA 4I18A 4Z7WE 5E00B 2JJVA 3SKOA 4M8QA 1YNTB 3C09C 4XP9H 1TCRB 4UI2A 3D69A 1YEDA 2YRPA 2HT4C 1IM9D 3MRBB 5DWUH 3L3IA 5JORB 5TH2A 5IHUH 3VXRA 1KIRA 1SMAA 1OTSD 2NX5A 2LVEA 1VHPA 3ARFD 2PYED 1VGEH 3S96B 5GZNC 5BVJA 5DA0B 4PRID 1YJDH 4I0PB 2O5ZL 4OCWL 2BJML 1T2XA 1RZJC 4NC1E 2Y36L 2R1WA 3MA9H 2P5EB 5DC9B 2R0ZL 3CFDB 4HKJB 1CFTB 4J3TA 4JFPB 4N9OB 1MJ7L 1GGIH 4WWKD 3KPSA 5J3HC 4NYLB 4TUJB 1IGJA 1IFHH 2EDDA 1UA6H 4H25B 1QRNA 1N5AA 2FGZA 2ZNWA 4C57C 5EB9A 5FO7B 2HJFA 4DFHA 4IJ3C 5E00A 3OKDB 3EFDL 4WFFD 2BOCB 2JIXD 3GJEB 1X5GA 3ZTNL 5LAXA 1D5MB 3IDMB 4HCRA 2G9HB 4OGYH 5F1NB 4IEFB 4CN1A 2X4RA 4RCAA 1YY8A 4LOUC 1MJJA 2VOTA 3LDBC 1DUYA 4K94L 1OL0A 3S37L 5D72H 5F7DB 1F4AA 1X5AA 1YPZB 3QG7L 2NY2C 4N0CC 2BERA 4BFIB 1RULH 3GB7B 1LK3L 3C5SB 3RL1B 2XZCH 4HS8L 1U8MB 4O9HH 2YPVL 3HLAB 1A2YB 1NFDE 1QYGH 4U1JA 1HZHH 2OI9B 2PR4H 2N56A 2QLVB 4NO3A 1QSFB 4PJ7A 4CMHC 4G80B 3LPFA 3VI4F 4XXDA 3PGFH 4PJGF 4P4KD 1I8MB 1M7XA 1KPRB 3MRJB 3I2CL 1A6WH 3MOAH 1FZKA 3MRPA 3KR3L 3OWEA 3BX7C 4JCLA 1MJUL 1KTDA 2F54A 3KJ4B 3T8XA 1MSPA 5K93A 2FH6A 1W72B 4ONFH 4TSAL 1JMZA 2X4RB 1BAFH 1GOFA 4LDOB 4YDLC 5LAXB 3GHBH 1IRAY 3THMH 1P2CA 1FHGA 4N1CA 1G9NL 1PX4A 3KPOB 4PFEA 3UTSA 3OMZA 1U0QA 4Y16D 3LOWA 1EV2E 4PJXA 5T3XE 2IQAA 1GC1H 2EE3A 1WIUA 4NRZB 4FN0A 1PLGH 2CRMA 3BVNA 3LZFL 4KRPD 4R4ND 5GGTL 1WK0A 3TPUA 2YSSB 1DL7L 1F90H 2VDOH 1BFOA 3VW3L 1X5HA 4LLYB 4TTDC 4H0GA 1K4CA 3K1KC 4NYLA 5J12C 3D39B 4BQ8A 4EEEA 3U7YL 2F15A 1C16B 1BEYH 5HI4C 4MX7B 4A6YA 4MCYA 1CICD 1F4WL 2P5EA 4NC1C 4UIMB 1QBLH 4YE4H 4OB5H 2C1OA 4QO1A 2YZ1A 3BI9X 4Z7NF 4MNQA 2C9AA 1QA9B 1FGNH 1EO8L 4UQ2A 3WNMA 5ADPH 2YN5A 2V7NA 5EU5B 3LPGA 3OB0K 3JTSB 4X6DA 4RA3A 1KIRB 4LAJH 1T6VN 3NOIA 1JI1A 4APQD 4FXGA 1YYLL 1AI1L 2BVQB 2HFGL 5EUOF 1VFBA 4YXKL 4NWTL 4ELKA 5A3ID 1FNEB 2A77H 4M43L 3C8KA 4NN5B 3MA7B 4FP8H 5IBTH 1WVZA 1WZLA 4PGDB 3STBA 3O6FB 4MD4A 4C56A 1B90A 5BRZA 4R96B 1LE5A 1QR1B 4W6XB 3DROB 1JV5B 2ICWJ 4LHJB 5TPWH 1DN2A 2GW5A 1A7NL 1T04B 3DXAE 5FYKE 5L2JA 2EDKA 4NT6B 4UT9L 4FQXA 3BPCA 4NP4H 4UOW0 3WDJA 2D31B 5DSCB 1HHIA 3NACL 3UC0H 3BGMA 3QWRA 1ITCA 5I0ZA 3UJTH 1DQML 1XIWB 3C60C 1IAKB 2EC8A 1NEZA 1WCBA 1RJZA 5GHWL 5DJ6A 3ARDC 3HFMH 5I1JH 1KCVL 2C4FU 1Q0YH 3ZE2F 1RZ7H 3B9VA 3SGKA 1F8TL 5EDXA 5BW7C 4LCWE 5CZVL 4N0YH 3HUJB 5DJXB 1CGTA 4OQTA 5TE7H 4EN3A 4DWHA 1BIIA 4ZO6A 5EO9A 2UVFA 3RZCB 3B8YA 4XXCC 2V17H 2X9YA 5FGRA 1T1ZA 5I71C 5KSBF 1L0XA 1HHHA 2Z93A 4PG9B 4LCWA 3CH1B 1A1NA 1EVTC 3A6CH 5MI0B 1BAFL 3MOQA 1S8DA 4ZAKB 3VJ6B 3M1BA 4PP1C 3STZB 5C0GA 1GAFL 5BVPH 5D96C 3DURB 2X89A 3ZMRA 1U8JA 4NC0B 2VDPL 4CMMB 1MRCL 5CD3B 2DM7A 4WI6A 3HC4H 5E03A 4WFFE 1PG7H 3NIFF 3SPVB 3PJSA 3B4NA 5CGMA 4ONHB 2VQ1A 5EO9B 3SDYL 1UJTA 4M1CC 3G5YA 2DD8H 5FYJU 1VGKA 2Q20A 4Y1AA 5KW9L 3TV3L 2VAAA 1A6TB 3WFDL 4GAYB 2AK4D 3MRFA 4G8GD 1HKFA 2O61A 1UWEL 1KIUA 1KG0B 1MAKA 3MRFB 3FOMB 4U7SA 1IILE 3WO4C 4Z7OE 5K9JL 3KS0H 1NEZG 1ITBB 1XGTB 5IB3B 2A73B 1U3HA 5DSCA 4R7NB 1WFUA 1VPOH 3T4YA 5IMOB 3PJSB 5CJBA 2QV2A 9CGTA 1RJLA 5T33H 5L2JB 4RAUB 1Q38A 4WGWB 5D6DC 3AS2A 3GBNH 1TENA 4ODTL 5TF0A 4LOUD 5A2FA 2OMNA 1ZMYA 4GRWE 1CGYA 2X4QB 1KENH 1PDKA 3E2HB 3MA7A 3ZZ1A 5JUEL 1JNLH 4H20H 3QCUL 4C4KT 4PRPE 5A16B 3E3QC 1W8OA 3SEPA 4IS6A 1A02N 2R2HA 4ZPVB 4CDHA 2GTWB 1KXQE 2VDPH 5EU3A 4KU1A 1I7UB 3BE1L 3MV11 4YHZL 3GUTB 4RAUA 3ULVH 3NN8A 3E3QE 4IRSC 3G6DH 1MEXH 1MQ8A 4M7KL 3I6GA 2NLJB 5GJSH 4O02L 3HCVA 5TGBB 3QZWG 5F7UA 1NEZB 1CWVA 4K7PX 4Q2ZB 1T20B 3BPLC 4QRPB 4ZFOL 4WUUD 3MJ8B 4ETYA 5F88B 4V1DA 4NJAH 1RJCA 5E6IB 4BUHA 1KT2A 1PYWA 2A6DA 2VDNL 1IJ9A 4XNXH 5CINH 3CDGB 2R4RL 3TBSA 1FYTE 1N6VA 4R96A 1LE5B 3FO0H 1QR1A 4EVNB 1KEGH 4OD1L 3U48A 1KCRH 3DUSB 1KGCD 4AIOA 1HWHB 3QQNA 4V1DE 4N0FA 1I1FB 1NC2B 1YQVL 5JNYB 1QFHA 5DK3A 4NHCL 3VCLB 4N9GB 2BVQA 1KCSL 3EHBC 4EQ3A 4Y2OA 2VDQH 4Z7WB 3MODH 3HR6A 3MUY1 5E5MB 3JTSA 4JO3H 1I1AA 1T5WA 4D0CB 1X5JA 2X4NB 5M95B 2RFXB 5C2UB 5IG7A 3NBNA 1H9VA 5GIRA 5D96B 4BQ9A 2NY1C 5T3ZH 2DWDB 3D3VA 4OIBA 2KZWA 1CTNA 3TA3D 1MNUL 1T3FA 4JREB 4NKIH 1NAKL 3WIFB 1CBVL 4YFEA 1PKQE 2MQ3A 4YDVA 5HPMA 2C7UA 5DK2B 5IEHA 1JF1B 4LLYA 4JDTH 3SDCA 2PTUA 1N26A 1C5BL 5K9KA 1DANU 2EDYA 4HS3B 1HHIB 4U6XA 3VD4A 4P3DB 2GJ6D 4FZEH 1FORL 3WE6A 1A7OH 2VDKH 4O58H 1TZHB 1T22A 1U8PA 5DVMA 3EYOB 4IRSD 2CR3A 1YPZA 5I19L 5ALCH 1JV5A 3EO1B 3NTCH 5JMOC 1FE8H 1QACA 4QXTB 3OHXB 4EUPG 3W5NA 3CVHL 5K59E 3R4DA 1QO3A 5EO0A 2DL9A 4Y4FD 4ZAKC 3PWPB 1D5MA 3IDMA 4JQVC 2CPCA 1JF5A 3S5LG 2B1AH 3MGOA 1I4FA 3CVIL 4C83B 2VLRE 2J12B 3QULB 2GYSA 3VFGL 1CU4L 4HGWB 2HJFB 3H0TB 4N5ED 5B38B 4HIJB 4TOYH 1C7SA 3RQ3A 5FYJH 4HEPG 1QRNB 2B0SL 3BKCL 4WU5B 4IIQA 5DF0A 4TQEH 3KDMA 5IHZB 3IJYA 4K3EH 3QNZB 4RX4D 4HEME 4DGVH 5B8CA 3LKRB 3UAJD 1ZXQA 1CFTA 1MCLA 2AJUH 5TDNA 4ELME 1Y6NR 3QPXH 4HAFA 3BRFA 2YSSA 2IBGA 4LGPB 5I1DB 1LQSR 3X12B 2A74A 2VLJA 2GSGA 5CEZD 2YA1A 3TCXA 5AAMA 4R97B 3P3YA 4G9FD 5IBUG 3BE1H 4PRHD 5F97E 3VDAA 3O2DL 4OM0L 5DK0A 1DQLL 1PG7L 1JGUL 2MKWA 4OZHE 1NUDA 2NY3C 2YUWA 4H1LA 3MUHL 1DVFB 3GIVA 1LK3H 3VRLF 3N0PB 2ZUQB 1I85C 5EWIH 1V05A 3EYUH 1MRFL 3KPQA 4BQ6A 3DECA 2H1PH 1H5BC 4ODSL 1U2HA 2YRZA 3GZKA 1XH3B 2WINA 5GS2H 3BKML 2RBLA 1OB1A 4Z0XA 3V0WL 1I3GH 2MQ0A 4YHML 4NCC1 3IDJA 4N8VA 4XMKH 3PUCA 5I8KL 1F13A 4X7FC 3QRGH 1NAML 2FD6H 1OP3H 1AY1H 5DD0L 4OZGB 3R0NA 2W60B 4XB8A 3GSQB 1BVKA 1HYSC 1U8OB 2BMKB 5DJ2A 2R1WB 3ZO0A 2IJ0C 5CD5C 1MREH 4JPKH 4OLWL 4LHUD 3KAAA 4NKDB 2VIRA 1TNNA 4HWEH 2P5WA 2NYYC 5JXAH 3HB3C 1MRDH 4WJ5A 3BQUB 3D85A 1F00I 2DQDL 3DI2B 4NRXA 1AO7D 1WBYA 1J12A 5E2WL 1G7IA 2OI9C 2MQCA 4OZGA 3IAGC 4HHAB 4WW2F 1VCAA 2LTQC 1DUYB 4G9DB 4EI5A 1EEUA 1KB5B 3X11A 2C3XA 3BN9C 2W38A 2YA0A 4PJBF 2PYFA 3BPOC 5DUBA 5ILTL 5I66A 5I1CH 2PYFB 5E56A 3HC3L 3V5HA 4MHHG 1BBDH 1T80A 3SDXE 3VFPB 5ICZB 2VTFA 1YECL 4EXKA 2UWEA 5TE4L 4CDGC 3VG9B 4HMCA 2ADFH 4KQ4L 2PW1A 3GMLB 4PJ5D 4WY7H 4KJWD 3TIDA 2ARJA 2NY4C 2X1WL 4RGMC 4X4XA 1FGVH 3H7BB 1ZLUK 3K1DA 2YD5A 4M7LH 1OLLA 2P5WB 1LO3H 3OGOE 2P8LA 4OD1H 4LSPL 4M1CD 5F6HI 3V7AE 3QIWD 2CDEA 4U7KA 5IVZB 3SO3C 5HGBA 2Z8RA 2P8MB 4M7JL 4LGRB 4KMQA 5FYKU 3S4SA 3WSQH 3DSFL 4QXWA 2D2OA 1JGUH 3NCJL 3LDBB 3S37X 2QL1A 1A6AA 1D5XA 4L4VD 5IHZA 3L3IB 5JORA 4N8VB 1UB5A 5CFHA 4WU5A 1Q9OA 3OX8A 1RZKH 2YUVA 5HHNB 1QSEE 4M02A 5DD3L 5AAWA 4AQOA 5GGUA 1XH3A 3Q3GA 4JHWL 4PREA 1J8HE 1IC5H 5TFSL 1BD2D 1AE6L 1TJGH 3KYNA 1FFPA 3HG1D 2KQNA 4NNYB 1FN4A 2HKHH 3TZVB 1JGVL 5CJQH 2P24B 5E70A 2FECL 3MXVL 1J1OL 1QO3B 2X4UA 3GMQB 2F74A 1G7QB 5LGKA 1C5BH 2ZCHL 3GSNB 4NM4H 2GKIA 2ZOLB 5C08B 3S6CA 5HGDB 1FFNB 4NQXA 4HG4K 4XMKL 2WIIA 2VLME 1OT2A 4JAMB 4P9HH 4AEHH 1RQ5A 2AV1A 2RIKA 1IARB 5CUSL 2V2TA 5C0BA 1GGBH 1RURH 2FATL 4X5XA 2DM4A 3PDOA 4XH2A 2PXYA 4LPYA 2R4SL 1CLYH 4XX1G 1RSFA 3ARTA 2P49B 4F9LC 4Q9QH 4F15B 2FBOJ 4NN7C 3NPSB 4PB0H 2FO1A 1C5CL 5HY9B 2EDFA 1F4YH 1ND0A 4P3CH 4LCCC 5GS3A 2BHUA 1BLNA 5EUOB 4QOKB 3V6OA 3DYPA 2NY0D 3OXRB 5DHYA 4L1DA 3I9GL 2YKLL 3IAQA 4WFHE 4LDLB 3MUJA 3MGOB 1CE6B 2DLEA 5TFSH 4I2XB 1FZOB 4B53A 4L8BA 2DQHH 5FK9A 4Z7WA 5DVLA 1P1ZB 3MV9E 3VFNA 5CINL 3SE3A 1DBAH 4PRAA 4U1SB 4DCQB 4KKNA 3D6GA 1VKXB 4WO4C 2OR7A 4FQQB 4PJCB 5D2LF 5I1EH 1CFVL 4KHXH 2P8PA 3MBXL 3QEHA 4GRLA 1AGBB 2VISA 4U1LB 4EVNA 5IQ7H 3AGVA 4Q9CA 1AGDA 5C0AE 5DMIH 1JWMA 4KAQL 2ENSA 1R5IA 5T1DL 5D7KD 5BZDA 2AJXH 1CD8A 3CXHJ 4M61B 5C0IB 3HE6A 4V1DB 1XGRB 1MWAH 5C0JB 2PF6A 1GL4B 3K0WA 2PO6C 4NHCH 3S3SA 4QYOA 1T20A 4Q9BA 5TGBA 4K3JH 4UDTA 5DHXB 1EK3A 3ARPA 3SCMB 5J1TC 1NCBH 2R0LH 3U9PL 1MF2H 4Y1AD 4ZNEE 4OZ4A 5GZOC 4I2XA 5T1KB 1CS6A 3L5XL 4JFOA 5L88L 3ZYIA 1C5DB 2NXYD 4QHLB 1KELL 1PZUB 1OM3H 1RUAL 3FQRB 4X4YA 1UZ6E 2YUZA 5DFWH 2BFVL 4KI5C 4TPRL 1ZT4A 1CGSL 4M4PA 3VGBA 2ICWI 3DX7A 3E8UL 6CGTA 4KRMB 3QUXC 2JJTA 3JSSA 3P77A 2NYYD 3R0MA 2PW2B 4J6RH 3VD7A 1E28A 1R3KA 4MJ5B 1YZZA 2XQYG 3KLHD 3GMPB 1RJLB 3FAWA 5BO1H 1WCQA 1F6LL 3DPBA 5ADOH 1GC1C 4OLEA 3OL2A 4AM0B 4NRYB 3AU1A 4Q2ZA 1MY7A 1ZKAA 2DMBA 2GI7A 5E1HB 4TVPD 4HT1H 4RGNC 5FEBA 43C9B 3BQUC 2XWTB 5B4MC 1RURL 1CD0A 4QRRB 4U7MA 4OF8A 1J10A 5DD1L 3QJFB 5E4EC 4Z7VB 5FUCE 3VFMB 4OBRA 3UC0L 5F7YC 5IIEA 5EIVA 5JW3H 2VQ1B 3ELAT 4BK4A 2JIXB 1JI2A 3KLDA 1MCDA 3UTTD 3N06B 4ZSOE 2X42A 3QWOB 3VXUE 5F1SA 2P44B 3TN0C 1CD1A 3QFJD 2A6JA 1LWRA 4OI7A 3T0WA 5FV1L 5CJOL 1EHLH 3B9AA 1I8LA 3AVEA 4ZOEA 4LSDA 4M6MH 2YWZA 4RNRB 3ZTJH 4XWGH 2R2CA 3CX5K 5HHQB 4MCZA 1AGEA 2K9UA 4ELMA 2MTPA 1T1ZB 1MJUH 5ESVB 1AR1D 1BQHG 3PGDB 5TQ0L 3RZCA 1XGYL 1UWXH 3K2UH 4TNWK 4ONFL 4TSAH 5JPMB 4LLWB 5HSFA 1LO2H 2FX9L 1L7IL 2Z91B 4Q6IB 4PS4L 1U8HA 3PG2A 1WZMA 4POZD 3MLYH 2UUDH 2Y9RT 3P4MA 4PYGA 3L3OA 4YO0A 3ZL4H 4DK6A 1HOCB 3GRWL 4PP2B 4DAGH 1M71A 1Q9LA 3RNQA 1UWGL 2ZKHH 3PNWB 3W0WE 1E4XI 4YXHL 4JGJA 5E8EA 3T04D 4JR9H 4P2OC 3RPIA 5C1MB 3VFPA 3RUGA 4MAUL 2VZ3A 5HVHC 1S9XA 1TETL 2H3NB 4PJ9A 5KVEL 4K3JL 5D93C 2AJZB 2ZSWB 2AP2A 3CD4A 2AXGA 1QLEL 1DQJB 3E6FB 3BRDA 5F21B 3M1BB 1DDHA 1AY1L 1NL0H 5DD0H 2EDOA 1TXKA 3OXSA 1CG9A 3P0VH 4JFFE 5DEFB 4KTEH 4GJTB 4ELKB 1HQ4A 3EJJX 4X5LA 1NBQA 3V95A 2K1MA 7FABL 1JGLL 1YN6B 3GSUA 2C4XA 3CJJA 1SMOA 4P9HC 3U4AA 5A2JH 5L6YH 3LD8B 4PJAA 4X6DB 2HG5B 3DI3B 3UTPE 3EYSL 4Y2DA 5FYJE 4JM2D 4UQ2B 4JVUA 1QA9A 3I50H 5DEZA 5CD5D 3U7WH 2IQ9H 5JZ7C 1JNNH 5HTSA 3P4NB 5CSZA 3MRDB 5E2WH 1LNUA 4JFQB 4M62H 1AD9A 4L3CB 1BVKB 2DKUA 1RJZB 3VRIA 4GBXA 4NBXB 5ICXA 3MFFB 4O2EB 4L5FH 1BZ7A 4GRMB 5IVOA 5AWNH 3V7AG 1BFOB 2WV3A 4CUCA 1GGIL 2FEDD 4M5ZL 1I9IL 3KPSE 2R69H 4MJID 3OR7B 3ULVL 3BVNB 1OGAA 3WD5L 4Z18A 5SWSE 2ITCA 2DAVA 4FQLH 3MRCB 2FLBT 5KS9B 1AQDA 1YMME 4ZUSA 4Q9RH 1RVFL 1CIUA 5C0CD 3TM6A 4YIQB 3L5HA 3DUUA 5GGVH 2QQNH 3BEWB 1NBVH 1ZLSL 1FNEA 1FL5B 5GS0D 1P2CB 3GIVB 4FQ2H 2X2YA 3KPLA 2W92A 4NJ9H 3OB8A 4I3SL 4W4OA 5GQBA 2GSGB 1SY6H 5LVEA 1G6RL 4KI5F 1U3HD 3RI5K 3NZHL 4EOWL 5IVXB 1V7NH 3MA9L 3MUGB 1ODAA 4GRWH 4G8EB 3BXNB 4MNHB 4E5XB 2IAMB 5T3ZD 1X5FA 1KPRA 1O0VA 4KI1A 3TO4C 5BS0A 1IQWH 4Z78B 3P30H 1N8ZB 1UA6L 4NQDD 5GGSA 3PABB 4YWGL 3WFDH 4M6ML 3ILQC 5F93C 1KLGA 3HLAA 1B0WA 3GMOA 4DAGL 1I9EA 4HGWA 2CH8A 1X6NA 3IKCA 2NXZD 3SHSA 3AS3A 3UROR 5F3BA 3BSZH 3QA3B 3NCFB 4QHNB 4WW2B 3T0DA 1D5IH 5DQ9A 1VACA 4ZS7L 5DRNA 1BQLH 25C8H 1KJ2B 3DARA 3OKEB 4NWTH 3VFRA 1VACB 5KVDH 2XTJD 5DQ9B 3RVXC 4NOFA 2VKWA 4DZ8B 1RZKC 2Y7QB 2BOCA 5DJDB 3LQMA 3UBXI 1NL0L 4HH9B 3L3GB 3LIZH 2PO6D 5HVWA 4IOFD 2VDRL 5K9KB 1J5OH 3ZTJG 2AV7B 5FB8B 4PJIB 4XPAL 4H25A 1ZAGA 4UV7L 3RWHB 5CSGA 1LP9E 5HYFA 4XBEH 1QNZH 1LMKA 4U49A 2EE9A 3NA9H 4P5TB 3TYFB 3CZFA 5HPMB 3V4PL 2NXZB 4XCNB 5B39A 3TVMB 1A2YA 2DJUA 5DC4B 3WIFA 4JFPA 3MX0A 3CC5B 4RQQB 4Y5YB 1GYAA 4IRZL 4KKBC 1EFXD 1SBBA 1R5WA 1T83C 1OAXH 1Z9MA 4BFIA 3IFOA 2CKBL 4U1KB 5DDHA 4FNLL 1MY5A 4RAHA 5EZJA 1D9KC 4WUKH 1ZANH 5HHPA 3I3EA 4YK4B 3HHRB 1MLBB 1S7TB 5LXGH 1KSRA 5IEKA 2XRAH 3I02B 3PE9A 5JNYA 2FYYA 5FYLD 2NY3B 4LQFL 3HN3A 4P2RD 2EDNA 5DI8A 5CJ8A 1A3RL 3VFVA 4R2GB 4DN4H 4E0RB 1KCKA 3ZKSD 4AH2B 4TYUA 4YIQA 1XCTB 5DD3H 5DVKA 4U6YB 1OAQH 5GGSY 3SKNA 3QSKB 3JWOC 3LKNA 5FM5M 5E6ZA 5DT1L 4MLSA 4HCRL 1U3YA 1RIUL 3LVEA 3SE4C 2HLAB 1JFQH 3UJIH 4F3FA 4ZTOH 4PJGE 1G6RH 4IRZH 1EAJA 4E41A 3FO9A 3X3FL 1EEYB 2I26N 3PIQA 4EI6A 4ODWA 3QDAA 3TBVB 1M05B 4G9FA 1HWGB 1FNHA 1MF2L 1Y6MR 1DQMH 4I0PA 1B0GB 3IFLL 5IR1B 1SEQH 5MI0C 5ITBL 3WHXA 4IOSD 5JHDB 3O9WA 2EDLA 5B39G 1FAIL 1MWAB 4NPYB 4Y5VA 4KRNA 2AJYL 3IRPX 1YEKH 1BZ9A 2ZZUT 1JHKH 3BMVA 1JYNA 4ZFFA 4UIKH 4Y2DC 3PGCB 5IBTL 2G60H 3LV3A 3CLEL 4EUPH 3W39B 1YNTA 5C8JA 4ESKA 2CIKA 3FB5B 1DBJL 4L9DA 2FWOA 1IQWL 3GEWB 5AYQA 3CK0L 1MHEA 1F2XK 3FQWA 4F58H 2R9HC 2ZUWA 1CDJA 3JWNC 2PN5A 3VRLE 1XF3B 4LSRH 5INCA 4KDTC 3PP4L 4YNYB 1EBAA 2IANA 4N68A 5DJYB 1U3HB 3SKMA 3Q5YA 5FHBH 2DQHL 4J3WA 3VWKA 3H3PL 1YN7A 4UDUB 4YPJA 4R4NC 2HJLA 4JG0H 5FKAB 1B0RA 4HXBL 1H3PL 1IEAB 2OYPA 2HYMA 3BEVB 4MB3A 3JUYA 2R2BB 3CNKA 3L7EB 2UUDK 1HDMA 3OF6A 4AENB 3KYKL 3BZEA 4FQIH 4WO4D 4TSBH 1SM3H 1DANT 4U1HB 4XC3L 1JWUB 4WTXA 5D1QA 5FYKD 4MCZB 4AEFA 3RDTB 5CUSH 1YMMA 2I9LB 4HIHA 1UM4H 1MH5A 3VJ6A 2D7PA 2Q76B 5FA4B 3VRJA 5I16A 5ISZA 2VLLB 2HFFA 3ULVC 4CU6A 3TO4A 1KJMB 1R3IH 5GRUH 3V6ZA 4YXLH 3TFKD 1I3UA 1IEBA 4Y88A 4PJ8A 4GRLC 3WDIA 5F9WB 1FNLA 1MJ8L 2FX9H 4PG2A 1YNLH 2H2SD 2PTTA 5KOVC 1MIEH 1YMMD 3IF1B 4LCIL 1TJHH 3WS3A 4OM0H 3ARED 5DJXA 4EN3B 3RNKA 3GI8L 2ZG3A 1YEEH 3MYZA 1P7KA 2CK2A 4MJ6B 1UXSB 4P23D 4FFZL 4NM8L 1UB6A 3K80A 2ICES 4JG0L 1EEZB 8FABB 2LV4A 4QRSA 1WCBB 4XRCB 3VFOA 1FGVL 5CHNB 4LIQE 3LRSB 5CZVH 3HZKA 4MAYB 4K2UH 2Z31A 5T1LA 1MCOL 1W0VB 1NDGA 2G5BA 2IG2L 4XWOC 1QBLL 2AJVL 2FD6L 5IV2A 5L6YL 2B20A 4JJHA 5EOTA 3ARZA 2DYPB 4OUUA 2OR9L 4Z7WF 3HZYA 3PHOA 1CDBA 3I3BA 1T1WB 3VW3H 1P53A 1NUFA 2I60H 3F62A 5E8PA 2E7LC 3VFUA 5ESQB 3PWVB 3SDAC 1FV1B 3D3VE 1YEIL 4G6KL 2YE