3ZE2E

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 42
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E02
4K7FB 5I8EB 5C6WH 3VU2A 3BUYA 4U1NB 1VEPA 1XZ0B 4GG6B 1ZS8B 3HE7C 4FTVB 1OM3L 1RZKH 4OUOA 1FL6A 1QNZL 1VFBA 2LU3A 5F6IB 5LG1A 3FO0H 4DN3H 2XY2A 5DR5L 1J1PH 4YXKH 3BDBA 2V5MA 1BZ7A 3K2MC 3QUYA 1QSZA 5AYUL 4DKFL 4OGAD 4LU5L 5HDBE 2VLRA 3MUGA 4M8QA 1EV2E 1BQSA 4P3DA 1A7OH 2JELL 4UILH 3MGTB 2O5XL 1I9JH 1AO7B 3P9MB 4PTTA 3U30C 4R0LB 1GSMA 2OZ4A 1GOFA 1QQDB 4F7MB 3BZ4A 4ZFGH 3QCUL 2VDMH 4OCRL 2R23A 1NCDL 4CN6A 3K3QA 2W91A 2WLYA 1IAKB 4HJGB 4JGJA 4BM7A 1GZQB 2KL6A 4L9LB 3S4SB 5D2LB 3CFCL 5TQ0H 5D7KE 5D1XA 5IM7B 3MNVA 4XP1H 4CADA 2DD8H 1DQML 4HJ0D 3E0GA 1CICC 5T3XH 1RURH 1GL4B 3HC0A 4Q9BA 5FYKU 3VXRA 1XGTA 3GMNA 1WF5A 3L3DA 1FFPA 2BVOB 1GC1C 1U92B 2L7JA 4P2OA 3KJ4B 5ABDE 2PO6D 2A77H 4YE4H 2V9QA 4LQFH 4KVCH 4WTWA 3OXSA 3SKJH 4RRPA 43C9B 3V79C 4HC1A 3ARTA 4IRJD 1OB1B 3VW3H 1F6AA 2LAAA 5GGTA 1EVTC 2HJKB 3RWFB 5JOFB 4D9QE 3MLUL 4B50A 3SGDI 3JTSA 1BPVA 4M6OH 4OT1H 4K07A 4KK8C 5ITBL 2NQCA 3GGWB 1H3VA 4PP1D 2J6EH 3WS3A 1ZKAA 2JB5H 1SMAA 4OZHE 5D93C 4U1JB 4LGRB 4PP1C 4KI5C 4DGYL 4ZUUB 3EJJX 1X4XA 1NSNL 2NXZC 3C5ZD 1VB9A 4H88L 3MODH 4JDVA 3AREC 1S5HA 3P4NB 2ITDB 2HVJB 2AJYH 1JN6B 4XVJL 1I8MA 4HKBB 2R9HD 1S9WA 3EO0B 3AMKA 3GJEA 4GKZA 3STZB 4C4KT 1IC4L 5I66A 2BXYA 1ZT7B 3BAEH 3DXAB 1ORSB 3OPZH 4MSWB 5JHLH 5E94A 1ZSDB 3BH9A 4HKBA 3ZDXF 1MJJB 1ZANL 2NZIA 5IFHL 2L7UA 1NFDE 4HIXH 3DX9A 1RUMH 4F7EB 4UDUB 4EXKA 3QXDB 3TN0D 1L4IA 2FIKB 4RAHA 1O5DT 1KFAH 2DWEB 3NH7L 5TGBB 3DGCR 3N1MC 4XWOC 1V3MA 2JKXA 2F53D 3VH8A 5FF6B 4HUVA 4TPRH 3QPQC 2R0LH 3WLWC 2A1WH 1KPRB 3V9FA 3B9KB 3AROA 4HDIA 3HUJF 3KLDA 1YEIH 4FS0A 3WUWA 3GEWB 1N6VA 3PL6D 5AD0B 1LO4L 4QRPA 1H5BA 2NY6B 2DLFL 3MLTB 3GMNB 5EWIH 2FHCA 3QAZC 4MXQD 3IU4L 3D39B 1VPOH 1MLBA 4DK3A 1FYHB 4IDJH 1MIMH 3ULUD 1F58H 1U95A 1S78C 4UNVA 1MAMH 1FO0H 4PGCA 1DQDH 1U8HB 1UM5H 1ZLVH 3BXNB 5JW3L 2NPLX 3SQOL 2XTLA 3WD5H 2DQDL 3MA9H 1XGYH 4OV6F 1RY7B 1N8ZB 4L3ED 1AO7A 5E8OB 3PXJA 1J8HB 3GK8H 3OAUH 4LEOB 1KC5H 2CRIA 5HHOD 1W72H 1KSRA 1VEMA 3ARBD 1I9RH 2BVTA 4K8RL 2UVEA 1UZ8B 1S7SB 3E1F1 3QEQE 4KJQD 1KC5L 2JJSC 3OKYA 4GRLA 3TLRA 3HNSL 1EPFA 3S5LB 1UCTA 3MROA 4ZUSB 3SY0A 1MCEA 1IGMH 2VLME 1MCDA 4RGMB 1DVFB 1BJ1H 5D1ZB 4YHIB 1F2XK 3GBLA 1U91B 2VDLL 1AD9A 4XNUH 4NCC1 4U0RC 1X5ZA 4YXHL 3IDYC 3GJFB 4X4XA 3TN0B 1JF6A 3L3JA 5B39G 4KHTL 5DLML 4PJFE 2BCKB 4GAFB 1IQDB 3BUTA 5DK2A 5DMIH 2NY1C 4MNGB 5GRYA 3WNNA 4P4KC 5CZVL 1G6VK 5IGXL 3BXNA 3P11L 4TUJB 1T0NB 3WJJC 2ENSA 1FGVL 3HC4L 1KCRH 2YUVA 3B9KD 1NC4A 5BVPH 4PJ8D 4Z78A 1NFDB 2NY3C 5JORB 3VI4F 1IEAB 4ZTOL 3INUH 1FHGA 3OWEA 4GMTL 1AGFB 3WL9B 3KYMB 3T2PA 4C56E 5DUPH 1DUZA 3HNVL 4UQ3B 1CXKA 5MI0C 2YD3A 3BJLA 2YKLH 2XTJB 3WUWB 5C0FA 5C0CD 2HLFC 1BD2E 4A6YA 4JFHE 3B9VA 1EFXA 2BOCB 2DKMA 3L3OA 5T5FL 1QFHA 3MLWL 1MCBA 3SBWC 3Q3GA 2QQQA 5TQ2L 3OKMB 3T65A 1RZGB 3DURA 4PJEB 5E6IA 1BVLB 4LSPH 1I1AA 2XT1B 4LOUD 4DKAA 1C1EL 3NA9L 5IOPA 3EYOB 3ROOA 3MYZA 1D5IL 3F7VB 1W72B 4F15C 3W0WE 4MD0B 4S1RL 4WW2C 3GMQB 4Y5XA 1WWWX 3UJIH 1TZIA 5ICXB 1RZ7H 3N9GL 2GTZB 3D0VA 4LSUL 3NTCH 2DQFA 2V2TA 1W0VB 3QIWA 5EPMA 2AAVA 1BJ1J 4U05A 3NCJL 1KTKE 2HRPL 4EI5D 1G6RH 5EIQA 3IYLW 3EJZC 5DD0H 1QYGH 2B2XL 3LH2H 1ZV5A 3L3GA 1G7LA 5BVJB 1NCUA 3FRPA 1EHNA 2Y06H 3FONA 4R26L 3B2VL 4PRDB 5JXAL 3B83A 1JPTH 2I07A 3X12B 3KPLB 3QAZB 4OD1H 3TP4A 4LHQB 5ANMA 1J0IA 5JMRA 5ESAB 3MRDA 4IRJA 4OGXH 4AM0A 2HFEA 1KEML 4OLUH 2N4IA 1OGTB 3NOIA 5E8PB 4EVNA 3DROB 3VXUB 1Q9OB 4X7FC 1U92A 2YS4A 4PJ8B 3WLBA 1U8QA 2BNRD 4WFHD 3TIDA 1U3JA 4JG1H 2DJ4A 4HCRA 3B2UD 4FQ2H 3IFNH 5DYOA 4O02H 4HIJB 3S9DB 5IF0B 2YRZA 4GG6E 2BVEA 3O4LA 1H8SA 2X4NB 3QDMD 4XP5H 4UAOB 1NDMA 3VD7A 5ISZE 3MNZA 5I2IB 2PR4L 4D9LH 2KBGA 4WV1B 1JNJA 4PRHA 3V6ZA 3FONB 2EE9A 2GFBB 1WT5C 4S1QL 5JHDE 5DO2C 4NM4H 3WSQH 3ZYZA 5T3ZH 4QNPF 3PJSB 1JE6A 1X7QA 3PWJB 1PSKH 4RGOL 1LP9F 4RGNB 1BOGA 1J12A 2HWZH 4YHNA 1RK0A 5DXWA 3UZQA 3BD3A 1W0VA 1CD9B 2PYEA 4L8SC 4JY6B 2FH8A 3T09A 3WFHA 2AW2A 1U58A 5I1LB 1G7MB 4LARL 3HLAA 3QWOA 1EEZA 1D9KD 2CPCA 4PRHD 4R4NC 4XCNA 5D71H 2C7UA 3MV11 1IGCL 4HF5L 1SM3H 2EEAA 5GGUB 1RU9H 2G5BB 3ROOB 3D25B 5ESQA 5MENA 1II4E 3CUPA 5BO1L 1T4KB 2VXTH 4MVBD 4PFEA 4BSJA 1BJ8A 1XF1A 4ZXBC 4POUB 5KVGL 5MHSD 5TF1L 1OP5K 4KJWD 3IU4H 4Z7QF 1BF2A 1C12B 4M5ZH 3VXSE 4NQSA 3REVA 2PO6B 4WCYL 5T1MB 1PAMA 1DTUA 4O58L 4Y4KA 3CZJA 1R6VA 2FD6L 2D3VA 3DRTA 4LVNC 5KSAB 1C08B 1ZVHA 4DEPC 5E1AA 5TDPB 5I19H 2GK0B 4GAJL 1J05A 4ZFZA 2CRYA 3ULVE 3WD5L 3ZTJG 5JA9A 1CICB 4YUEH 4X5XA 1N26A 1A1MB 1BWMA 2FD6H 3RPIA 3VXPB 3KYOB 1EUUA 3QP3A 2P7TA 4X0KB 2VISB 4G6KH 2GHWB 1SJXA 1TTGA 2RFXB 1MI5B 4NNXA 1NC4B 2LQRA 1T20B 3UTQB 1U8NA 2XN9E 4W68A 1OT1A 1RUKL 5DJYB 2ZUUA 4I18C 1E4XH 3L3KA 3UJTH 1IEHA 3VD3A 4WHDA 4FQXC 3DVGA 1MHHA 4KK6C 1OGAA 2FEEI 2AV1A 3LEVL 4YGVA 1NEUA 2BHYA 1RUKH 4R96A 1K8DA 3SKNA 3QXAB 5L7XH 2AJZB 1AD9B 4GAYA 2IPKB 3CUPB 1BLNA 3KNBA 3FB5A 1KIPB 3MXWH 4P46D 4YDJA 5E95B 4QOKB 4CMHC 2CUHA 3KPQB 1P6AB 5IGXH 1FNAA 2ZSVA 4M7JH 4FMKA 2GT9A 2NY0C 4N8VG 2H8PB 1K4CA 4JPIA 4M1GL 4W70A 4Y1AD 3DI3B 2BOBA 3JVGC 3QR2A 2MNUA 4JO3H 2FJHA 3U82B 5CILL 5EIIB 1AP2B 3LKPA 1JWMB 3T3MF 1BOGB 4P5TA 1ORQA 5JW5B 3ILPB 4UV7L 1LK3L 3F12A 1RFDL 2VDPH 3P73A 3UPRA 1TETH 3ARFC 5DVLA 1KJMB 1URLA 1CK0H 3V5DB 3VRJA 2EO1A 1ZGLM 2EYSB 3H9SB 2VYRE 4LASL 5JW4Q 1FGNL 4ZNEA 1JBJA 4NZRH 1XF4A 8FABA 4XZUA 1MCSA 4E41B 4AMKH 3QNYA 4YDIH 1NGXA 4XXCA 2J4WH 2V5TA 1CICD 5E0QA 3CDYA 1U8QB 2VXVL 3MACL 4L8BA 1RJZB 3QFDA 3UDWA 1FVCB 3ZKXC 5E99H 1A0QH 1MAJA 3MRPA 1FNSL 4OFVA 4Z95L 4U1GC 4JE4B 1YN6B 2A6DA 1MY7A 4Y4HB 4KKNA 4OCRH 3O9WC 4PRDA 2AXGB 4YPGA 3RX8A 3O2WL 4TSCL 4JRYA 4DN3L 2XKUA 4I4WB 4ODBD 4EDXB 4TSBL 4N0UA 5KW9L 1G0XA 3IXAB 3S36X 4RISL 2EZ0D 5FYLE 3W11C 5E5RB 5J89A 4P2OD 5IVNA 5AYQA 5E6IC 3TBYA 3HG1A 1EXUB 3W0WD 1XF3B 3CSYB 1QSEE 3BPNC 4GRWB 5TH2B 4KXZI 2UZIL 1K85A 3TO4C 2IFGA 4IIQC 4U0RB 1YPZE 4G3YH 5BZDA 3BO8A 4KK6D 4U6YA 1KLUA 3C6LD 3OGCB 4NOBA 5EC2B 5EOQH 4M6OL 4OT1L 3EYOA 1XR9B 2DTMH 4Y1AB 3QH3A 4KY1L 5ALCL 4I48A 3V52H 1I1AB 2W1NA 4D2NA 4V2CB 5B21A 3RZCD 1T1YB 5EFIB 1A9EB 1KENL 1PFCA 2VLJB 3MODL 3MOQA 3QNZB 1HQRA 1KF9B 1S9VA 3QIUD 4PG2C 4HK3N 4QXWA 4CNIB 4LCWA 3V6BR 5LCVL 1ZLUK 3UTSB 4JO1L 3BZEB 3M07A 4HXBH 1XF2A 4NQDB 4MNQD 1BZ9B 1O7SA 1AGFA 2QLVB 1CXEA 2FDBP 4RZCA 5INCB 4Y16A 3IFPA 1UCBL 3QUKA 4ODSL 3BWAB 2XZAH 5IHLB 1CDBA 3SGJA 4H5SA 1CS6A 3CX2A 1R5IB 3G5XB 4V1DD 4WDIB 4FQJL 4MB5A 4LPVA 2ADFL 2BNQD 1HNFA 4NGHL 2X4SA 1EIBA 3BMWA 4FFWD 3QQ4B 3O9WB 4ZMAT 3PP3K 4OZIB 4NQXB 5CGMA 3N85H 1JYNA 2H6PB 5JW5A 5E9DE 4EQ2A 3FQRA 2OJEB 3A6BL 1OAUL 2OTUA 3FFCA 3KHQA 2FX9L 1JNLH 5EC1A 2HKHL 4U6HA 2VLRD 3BIKA 3QUYB 5J12B 3MROB 3LKRB 4F58H 2R8SH 4LCIH 2BNUB 1UEMA 3S37X 3O3UN 1F5WA 4U6HB 5JW3H 4X9BA 4DFHA 3FOLA 4HQQH 4YX2L 3HE7D 5KVMC 1WWCA 3SCMD 3HI5H 3BDXA 2BNRB 4I0PA 4AT6A 2UWEA 2BSRA 3DLQR 3CVHH 1S7UA 1BX2B 4WEBH 3THML 3QDMB 1F58L 3C60C 4KMQA 3UTTA 2GJJA 2VABA 1CQYA 4XAKD 5JQHC 2F74B 4URTB 4R4ND 4CMMA 1ZHLB 4JANB 5DD5H 2VISA 2EDQA 3LN5B 2AVGA 4OZ4A 1A6ZA 1ERNA 1YNTA 2IADA 1N0XH 2WQ8A 1KXVC 4BQ9A 3RPKA 3C5JB 2ZSWA 1TZHB 4K7PY 4OV5A 4WUKL 1F4WH 2OR9L 2HT2C 1C08A 1LNUB 1EO7A 3S34H 2H3NA 4RFOL 2IGFH 3W11D 3GKWH 4WHYG 1FIGL 1T1YA 5EZJB 3UTSE 3I6GA 4OLEA 1GPOH 1VADB 2YC1A 1U93A 1Q1JH 3MFFA 3FQUB 1L7IH 2VZSA 2CIIB 1UVQA 3IKCB 1DEEA 2DQJL 1OGAE 3B5GA 4OLYL 4E5XA 1OT2A 3HZVB 1PKQA 5TE7L 3WHXA 3NCJH 1WSST 1OTUD 4Z7VA 1BREA 4K23L 3U9PH 4G6FD 6FABH 3L5WB 1EA9C 3I50H 4PRPA 2DMBA 4KTEH 1JPGA 2AEPL 1XH3A 1P4BL 5FO9A 5TE7H 3QI9A 3IDGB 1U8PB 1AHWA 2JIXB 4JKLA 3S7GA 2D03L 3H9HA 4S1DC 3IXAA 4JLRB 4LLAA 1G9MH 1DQLH 3T0DA 1WUNT 3T77B 1ZWIB 2GFBA 1IARB 5ALBH 3PNWA 5GS0D 3NZ8A 2JB6B 4YAQA 2J4WL 1NMCC 2QSCH 1P5UA 2A6KB 1R3IH 2HJKA 3RWFA 5JOFA 4LLMB 3P4MA 4A6YH 1FYTE 5IROA 4DGIH 3DO7B 3U30B 5LAXB 5HHOA 1R5VB 1J7VR 1HXYB 3VXUD 4DW2L 1FVDB 4NWUH 3QG6B 3O6FB 1NL0L 1X5YA 1VFMA 2NY1D 1YJDH 4GBXA 4XB8A 1JZ5A 1XF4B 5J3HC 2AK4A 4ALAL 3ULVL 3DO7A 3ABZA 4JJ5B 2QHRH 2G60H 4G8FB 3QQ3B 5GRZA 2X4TA 5IM7A 2G2RB 3UX9B 3MRNA 3V5DA 3VRJB 3MLRH 4NCC2 4ZFGL 5JPMB 4Z8FH 2Y06L 4R26H 2NY4D 1HWGB 4WHTA 3RI5K 5C2BL 1FZKA 1BFSA 4N9GA 3WE6B 3P73B 4P48A 4CVXB 3P0GB 5GRJL 4ODTH 4P2QD 3ZZ1A 1MFEH 1KIQB 4G9FA 2D31B 2J5LC 1LO5A 4YHYB 2UZXB 5CS7A 5F72S 1ZHBA 4RIRB 2FWOB 3AREA 3BZDA 5KVGH 2X4RA 1D9KB 4XMPH 3HAEG 2AP2A 1YMME 5IBTL 2R0KL 2VDNL 3PV6A 5E8DL 1JNHA 4WIQA 5FA3B 4G6FB 3O4LE 2RCSL 4LKCA 3ZKXB 1T03H 3C08H 4PREA 5CSBA 4S1DD 4S10A 1QPPA 3QIBD 3ULUF 4YZFF 1I8LA 1WIPA 3MCLH 3QXAA 3MFFB 2J8UE 4FQHB 1FAIH 2H2PC 1HDMB 4PJ5B 5GJTL 1U0QA 2HN7B 1AD0A 1DUYA 3ARSA 4AH2A 1CGSH 3R0NA 2H3NB 1HOCA 2Q76B 3AS2A 5I6XC 3D85A 4KKCC 1S7VB 3O81A 1UJ3B 1MFAH 3LDBC 1TZHA 3MR9A 2ZSWB 1CTOA 2FATL 3FMGH 5E5MA 1FL3A 4W81A 1G84A 1SJEB 3FT4B 4HFUH 3V6OC 1PSKL 4RFNC 5SV3A 4Z7UF 3ULUL 5DQJB 5GGRA 3V4UL 2Z8VC 5E5MB 3MV8A 2OQJA 2GITA 4L3EA 5AEAA 5IQ7H 5FGCB 3MO1A 5GJSH 2OXGA 1K8IA 2W9EL 4NJ9H 4DGVH 4LEXH 2DM2A 2VR5A 2ARWA 4Q0XH 5IESL 2CIKA 1KXTB 4G80B 3O0RL 2PO6A 4ELME 5GS0L 4OJFL 4NQSB 5D7LA 3CVHA 5D1QB 2ICWA 5F89A 2FJFA 1N64L 4JB9H 4FQHA 5SWSA 1WJ3A 4I1NB 1CVRA 1G7HB 3CSBA 2F8OA 3VFUB 2P24A 1NGYA 5GS0H 1CCZA 3QXUA 3C6LA 4FFYH 1XCTA 3D0LA 1LE5B 2EDBA 4WFFD 4QXGH 2ZUTA 3ZKNC 2N7AA 1TQBC 2WAHA 5CHNB 4MJ6B 1KTDB 3ULVD 2AJSL 5SX5K 2J88L 4U1IB 4OB5L 1UA6H 4HEME 2VZVA 3SJVE 5A2IH 2WUCH 3CX5K 4NKOB 1SYVB 1LVEA 2Y07H 4U3CA 1Y0LA 5JZ7C 1QA9B 2OTUB 3FFCB 5DD5L 2NZ9C 2E6PA 4ODUB 4L5FL 2OP4L 3QUZD 2LVCA 4YDIL 1OP3H 1BP3B 4KKAC 4FQPA 3IT8D 3T4YB 1MHPH 4RRPG 1PX3A 3TBTA 2NX5D 3PQYA 4UUJA 1UB6A 2P8PA 4BZ1L 5D1ZC 5KSAC 1LEGA 4WI5A 5H2BB 4V1DB 3U2SB 1YC8A 5GRUH 2CRZA 2P5WD 1DBBL 2FGWH 4JFXA 2OJZH 4H5SB 1I4FB 1HCFX 1RHHA 4N8VB 1N0XL 2EYTA 4TSAL 2Y5EA 4HIJA 3HPLA 1BAFH 5DYOB 3U0PB 3ZKQD 4JCMA 3ZKMC 1F3JB 2ERJC 1WC7A 3MRBB 3TZVD 3EZ8A 3MXVH 5C0GB 4HIHB 3NCBB 5I17B 3C60B 4F80A 1OGTA 2NY7L 1VESA 4B41A 4DZBB 1R5VA 4DVRH 3H0TB 2IGFL 5D96B 1ADQA 1TQCB 5FYKE 2YD6A 2Z0BA 5BZWA 4Y4HD 3FQNB 2D9QB 1A6PA 5H35B 2NYYC 4G80A 4C58B 1TJIH 3MV01 2DYPA 1QSEA 1FLTX 1N2RA 3Q0HA 3ZYIA 5K9QI 1YEEH 4JLRA 5C08E 2EIDA 4U6TA 5EPMB 2DWEA 2F5AL 4X99B 2Z91A 3X3GL 3SKOB 3BP5B 2AEPH 1XCQB 3G6JA 2BY3A 3MRCA 2N56A 4O4YL 3A6CL 4TULH 5I1CH 2XG4A 3QZWA 4QCIB 4FHBD 4OF6A 3ZSTA 3TA3C 1AE6H 5C92A 3SGKA 4LP5A 3GIZL 1NCWH 4PJ7A 2YHGA 5EOCJ 5FO7B 3SDDC 4NM4L 3WSQL 5IKCB 3RGVB 4I0PD 1A02N 3CSYA 3EDEA 1TLKA 4G6JH 1GHFH 3TT1H 1N6UA 1U8OB 4PJXF 4NCDA 2LAGB 2DBLL 1KPUA 3DX7B 4PJCA 1KG0A 4L4VB 4GAGL 4JZNA 4OQTA 4OCSL 1QEWB 1EGJH 1K9TA 3MACH 4PTUA 2DL9A 4GT7A 4OI8A 1KJ2B 3NIGF 4HMDA 3FT3A 2ESVA 5DWUH 5T3XL 5MERA 4OV5B 1NUDA 4XVTH 1EGJL 5FA3A 1HWHB 3EO9H 3WJLA 4OF8A 1OAZH 4FFZL 4OZGA 3WV0A 4OBSA 3U9UA 2A73B 1RZKC 4X9FA 1JPSH 2LTQC 1OARL 1ZVSA 5C0GA 1XGTB 3PIQB 3VWJB 1NFDA 3S96A 1C8PA 4NO3B 1IEBA 3IF1A 3LKQA 1ZA6A 1WBYA 1FC2D 1INDH 3K8LA 4PJ7E 1F45A 4NO0B 3O41A 2VIRB 3K74B 5HYIA 4N90D 2YBRB 3U2SA 5IBTH 1FIEA 5DFWH 2X5PA 3PWUB 4HMCA 1YEIL 5D4QA 1QR1B 1UT9A 4G5ZL 2YN3A 3D48R 5C71A 2IALB 1YEFH 1MCHA 3UTPE 1JGEB 3MA7A 3VXNB 3BPCB 4G8FA 5HHXL 5C9KA 4P5TB 4N8CH 3B3IB 5L6YL 4OGXL 5FM4A 2EE6A 3BT2H 2HMIC 4PR5B 4JG1L 1BZ7B 5IHUL 5LVEA 2H8PA 1OL0A 3QG6A 4XHJD 1FVDA 4JG0L 5C7XH 2WK2A 5CHNA 2I26N 4K3JL 2DJSA 2X1OA 4ELMA 4WO4A 1I9IH 1X9QA 2Q8BH 1VDGA 2CD0A 2FBJL 3PHSA 4WO4D 5T3ZE 1OWRM 3OJ2C 3NZ8B 3D69A 3T0EE 2Y25A 5C0JB 4JG0H 1JMXA 4HW6A 3SKNB 3E8UH 4NRXA 3IVKA 1FG9C 4N0YH 3GFUA 3VG0H 2QSQA 2VXSH 5F1OB 1N8ZA 4LNRB 5JQ6H 2AV1B 4MAYA 1KLGA 3ES6B 1P4IL 3QPQD 1AI1H 2YEZA 2NY2C 3H9SE 4LHUD 1JTOA 3KPPA 1MLCB 2W9EH 1T22A 1QFWI 3ZKMD 4CU6A 4QRTB 4HSQA 5DVMA 1DE4A 3PWPD 3V4UH 2D0GA 5E2VL 2D7TL 4JFPA 3TYGL 3V8OA 2EDRA 3DYOA 4YFLF 5KVFH 3VFSA 1XIWC 1ZVSB 5CEZL 4CVWA 4P2QB 3VXPA 3EDDA 5DA0B 2VE6A 5DMIL 1MWAH 1M4KA 1HHGB 4NPYA 5F9JB 2VDKH 3SDXA 5A40E 5TDPA 1KPRA 4Z0BL 5KAQG 5B22A 1S7VA 1N64H 4JB9L 5HGHA 2VLKD 3VH8B 2D4FA 5HYQA 1FGNH 2X9YA 1ZT4A 3NPSB 1G7JB 1JYVA 5EFIA 4N0CD 3BP6A 1FFNB 4JM2D 1YEKH 5T3XD 1Q0XL 4LHUG 43CAB 1D5ZB 2ARJQ 4ZUTA 3IJYA 2IADB 5EU3B 3WXWH 5MEQA 5DJ0B 5EU7C 3TM6A 4U33A 4BH7B 5EG6C 1RZKL 1F13A 2JJUA 2CO7B 3MOAL 2X4RB 5KSBB 4HS8H 1CQKA 4ONGL 5IJKC 4PJEF 4PUBH 4F33A 2GAZB 4M1DL 3RDTC 4P3CL 3MYJB 4RISH 5IMKA 3IDJA 1U8JA 2FECI 4JQVA 5A2JH 3NIFE 3VGGA 2OL3A 2Q6WA 1A3LH 1KBGH 4AZ8A 4BZ1H 3VFWA 4OFYA 4QHMB 2ZOLB 5L7XL 4N5ED 4E42A 4XI5D 3RL1B 3TBSB 4LK4A 1BBDL 3V5KA 1TZGL 4ZSOB 4B7LA 2G60L 5TPWL 1KN4L 3RVXC 4PJHA 4R3SB 1RJZA 3U6RB 5BS0B 5F7UA 5IFAH 4LP4A 4ZQKA 3LEYH 2BK8A 1A7BA 5IBUG 3KPSD 1QYGL 4K3DL 3G6DL 4Z7WB 3X3GH 3WKML 5LAXA 2PW1A 1TJIL 1JGVL 4KJYA 3BPCA 3HR6A 4XPGH 1YEGL 4L9LA 3S4SA 3SJVB 4WI3A 1QR1A 3UPRB 4KTEL 4EJ1C 4IMLA 3ULVC 3BEVB 3Q6GH 1L7TH 4I3RH 5IBUB 1WEJH 4X7TB 4G8GE 3FO2A 2DQCL 5E2JA 5ESVA 1IC4H 3O2DH 3QT2A 3VJ6A 3DV4A 1Y0LB 3MYJA 4QHNB 5IFJB 2GTZA 4TQEL 1HH6A 4FXGB 3MBEA 4OTXL 5JLZA 1KTDA 1MCIA 1YY9C 2QHRL 4XPHL 1FP5A 2VWEE 1K5NB 3D3VA 4XP4L 2Q7YB 1MREL 4WY7L 3RDTD 4CNIA 1K6QL 1YQVH 2E7MA 5DZNA 1IKFL 2F8VA 5C07E 1NBVL 2DKUA 4FQXD 5GPRA 4PGZA 5SWSB 1BM3H 4D0BA 1V05A 4PJEA 3M45A 4R97B 3TBVA 4GW5B 1Q9WA 1NC2B 1S9YA 4CN4A 4X6DF 3AS0A 3P9LA 1IC5L 3CFCH 4PGDB 4JR9L 5D70H 3BMVA 2HT4D 3IKKA 4Y7MA 3GM0A 5IEHB 3BGFB 3RX7A 1QRND 4XT1C 2EYRB 1NFIB 4UQ3A 2BVPA 5DQJA 1TNNA 3BPOB 3WL9A 1FO0L 4HMEA 4KY1H 1A2YB 1OF2A 1ZHLA 1FL3B 3A0OA 1GGCH 2XPGA 4LF3B 5JIHA 4G6AC 1Q9LB 5HI3D 4NQED 2Y6SD 4U4BA 1V7ML 5KANG 4F3FB 5ETUA 4Y4KD 1CGSL 1WCBB 1HINL 4U1LB 2R1XA 2JE8A 3REVB 1E4KC 2M26A 4RMWA 1NMAH 2IBGA 3MRMA 2J88H 3CFKB 4FQIL 3DUSA 4JY5L 3H7LA 1NEZA 3GJFA 3K4ZA 5FGSA 5I30H 1FVCA 1UKTA 4XVJH 4ZODA 2PTTA 2DI7A 4HLJA 2E8YA 2NY3B 5JQ6L 5FYJE 1N59A 5ERWA 5FHBL 4LVOC 2XG5A 4QKXB 3HPLB 3RNQA 2H32B 2OLDA 5D7JC 1P7KA 5CJOH 4P57B 5I75C 4GRLC 5T1DH 2EH8H 4X6BA 4JFEB 4RGNC 2FX9H 3OB8A 1KPVB 1LO5B 5EOTA 2D31A 2HFGL 2AJ3A 3CU7A 3D6GA 4LEOA 1FL5B 5DEGA 3PWJA 3HG1D 4WU7A 1L0YA 4NQXA 2P4AB 3O9WA 3RP1A 2R0ZL 5I1JH 3FQWB 1T7YA 5CKAA 1RUQL 4UT6L 1E4WH 2CDFB 3MNWB 5K9JL 4RQQA 4LVOB 5IP4A 4IBLT 4HG4K 1H8NA 2AJSH 2H32A 3NPZB 4JZJA 3AY4C 2IANB 3G04B 3TZVB 3ARED 4OUUB 1C16A 5EU5B 5HVWA 4Q6IC 1P4LB 1G1CA 1R3LB 3KHOA 2BXZA 4XPBH 4P5TD 1X5FA 3UO1L 3ZE0E 4GAYB 3NCEB 4Z7NE 3GSWA 5CJXA 2R2EA 2R2HB 4P23B 1CL7I 4F7TB 1WIUA 3IDNB 4BZ2L 3QHZH 4PPTA 1AY1L 5EO1A 3CLFH 1DBKL 4N1CA 4JAMB 1OD9A 3IDUA 3HCVA 4MHHG 4OQ1A 2YPLA 3OKKB 5F70A 1OM3H 4OFDA 4ODXB 1A5FH 2F9BT 1U8OA 4KK9C 3W2DL 5LWYL 3RTQC 2Q1EA 2UUDK 4HKZB 1YMMB 1A2YA 4RGNE 1AXSB 4KMTL 3MGOB 3VD5A 4CU8A 3OGCA 4X80L 5F96H 1XGUA 5D1XD 3L7EA 4KMTH 4HIEA 4D0CA 3G6JB 2ZG3A 4LDOB 1L7IL 3GSNL 3IKCA 1G7PB 2F54D 5F7DA 5D7IE 4JFED 5HD8C 4AH2B 3SE8H 5HYJA 3ILQC 3U4AA 3LN4A 1HE7A 1CF8H 4OSUL 1H3XA 2HRPH 4XBGA 4I2XE 3MX0A 3SGEI 3HRPA 5D2NC 2R0KH 1P7QD 1C5BL 3PXHA 1WZKA 3DXAE 1FORL 3T8XB 4WGVB 4ZNEE 3FFDB 1V7NL 5C0FB 1MRFH 3I6KB 5ADOH 2V9RA 2YR3A 6FABL 4KTYA 5CP3H 4HUMB 2X4QB 4X6DB 4X4YA 4ZTOH 2E7LC 4KFZC 4MQSB 3MBED 1PGRB 3SOBH 4ETQA 1UM4H 2D2OA 1VGKB 4J8RB 4EIZC 1F8TH 5EO0A 1NAMB 3UAJD 1JWSB 4Y19A 3FRPG 2NY0B 1KJ2H 4MXWH 3LVEA 5CBEA 5ILTL 1CDHA 1RZ8A 4KQ4H 4NJAH 4KV5E 1IZKA 1EO8H 4KZDL 5IMMB 4O5LL 3HA0A 3OJMB 4JQXA 3AC0A 4KRMB 1R0AH 4LRIA 1CGYA 4G9FE 5GSRB 4Z6AT 4RGOH 4GSDH 2PXYC 4OTXH 2OXHA 2IEPA 2UYLB 4XBEL 3LHPL 4YHIA 1BD2D 4YXLH 3LB6C 3WJJA 4QRPE 5GGSA 4FQCL 3OAYH 5IVXB 3E8UL 4GRLD 2XTJE 2OI9C 5I8KL 3ARBC 4AM0B 4G8EB 4M5YL 1WQVT 3JUYA 4X98B 3KGRA 4O2EB 2MCPL 4H26A 3VI3E 4U1NA 4HF5H 3C5ZC 5EC1B 5JA8B 1UWXH 2I07B 3X12A 1LQSR 4KKCD 2ICWJ 2C26A 4NM8L 3DSNA 3BD4A 4KHXL 1ZEAL 5BS0D 1LO3H 4FG6C 3DHJA 3E6FA 3GZKA 4QHMA 4YQXH 4AL8H 3LH2L 2HKHH 3P30L 4XP9H 2NW2B 3OKDA 4XNMB 2EIZB 2P5EB 4CDGC 3ZYJA 2X70B 3GJFH 1S5IL 2APXA 4X9IA 1G0YR 4LLDA 3IS1X 1Z6JT 2FYYA 3DX8A 5D2LE 1FNGB 2PCPB 3CPLB 5ID0A 4Y5XB 1T89C 4KROD 2WP3T 4JFQA 2GI7A 4AQ1B 2CH8A 1OW0C 3WS6C 5FCUH 3MLTA 3ARFD 1A3RH 5FUCC 1QSED 1UXSB 4R8WH 3G5ZB 1JGLH 3KJ6L 5I1IL 1IBGH 1UYWH 1IMHC 1GZPA 2EYRA 5E08L 1BFTA 5FYJL 1Q8MA 4GQ9H 4I2XB 1J05B 1CDGA 2YPLB 3OKKA 4S1SL 5J6HA 3VWKB 5JUEH 5C6TL 1J18A 4QY8A 4PJXA 1IBGL 3T0ED 3S36L 5EO1B 4I18A 5CJOL 2P48B 1CFQA 2WBWB 4JM2B 1AJ7L 2Q8BL 3ZHLA 3RFZC 5IK3B 2LTQB 5E24E 2CUIA 2HT3C 2RR3A 5F6HJ 4HEPG 1BHGA 5DRZA 2AXHA 2V7NA 4JFDB 1DUZB 3HUJA 4ZAKC 2NXYC 5EC2A 4ONFH 5H37G 1BD2B 2EH7L 1XGQA 5IUSA 3GHBH 3LN5A 3VFNB 3GRWA 1ZT7A 4Z78B 4BJLA 4U6YB 1AI1L 5SX4I 1RUQH 4UT6H 2Q3AA 3MV9E 4PJAE 3ROLB 1QFUH 1YZZA 2NXZD 1YPZB 4LLQA 3UP1A 1G7MA 4KHTH 5DLMH 1I8MB 1RFDH 4Y4FC 2X70A 3TBYB 1AGBA 1MFDL 4P46A 1A6AB 2VL5B 1U2CA 3K2UL 1LEIA 3PQYD 4MAYB 2VR4A 4AQOA 1DBMH 2DIBA 2R4RL 3HR5A 1FVEA 4HHAA 5DS8B 5MEPB 2PKDA 2VDPL 3BGMB 1E4XI 3QG7H 3FJTA 3RHWF 3PHQA 4HIIA 1OAQL 4WFFE 3UTTE 3TCXA 3MV9D 1TVBA 3EYSH 1TPXB 5DHVH 1JZ2A 5TE6L 4QRRB 1I7TA 2WSKA 2W0FB 3A67H 3GSVA 4MXVE 4LIQL 3UO1H 5F3HA 4PLKD 1S3KH 1VACB 1JGUH 4WJ5A 5KSBF 1WWAX 4NZTH 2A6JB 2DF3A 3SKUD 4BSWB 4QGYA 5IJVA 1PEWA 4NFBA 1KIRA 3DYPA 4JREB 4MMZC 1VA9A 5FYKD 5D8JH 5DD1H 3PL6A 4KVNH 3UDWC 1MCJA 3HNTL 3D39E 2AGJH 5K9KA 1JGEA 3MA7B 1RHFA 2X6MA 5D2LA 5GS2H 1S7WA 3DI2B 3QCUH 3MCKB 4YFLI 3VGEA 5DJCB 3MOBH 2FGWL 4R0LA 2EDXA 3ILPA 2PTVA 4HLZG 3CXHK 5AWNL 1S7XA 4LKXA 3P11H 1IQWL 5LGHL 1JHTB 5A1AA 3H9HB 1U8JB 4J1UA 3S96B 1EAPB 4M03A 3DRQA 2XTJD 2DQFB 3FB6B 1SJVA 4QO1A 3H42L 2R1WA 4MDJB 4KI5E 1EVUA 3MLVL 1A6UL 4W6WB 4NZDA 5ICYA 3S37L 2EDHA 3BP7B 4CKVX 4I0CC 1NGQL 3GMQA 1NBZA 3GSRA 5F1IB 2YA1A 4O51B 1XZ0A 4GG6A 4XNXH 4L9DA 4HT1H 4JO4L 3CC5A 4MA1C 1UM6H 1UVQB 4HGWB 5SWSD 3B2VH 1MY5A 4I3RL 3BN9C 3O4OC 4P2RE 5FYLD 1A4JA 4ZYKB 3FQXA 4J3WA 1T1WB 4NHCH 4PJCB 4HH9B 3FO9B 3O2DL 1G7JA 4KK5D 5I1GL 3D18B 3K81A 3LN9A 4LCWE 2VZTA 4PLJC 2BFVL 1HH9B 5TDOA 1CFTA 4IRSA 5D2NA 3MV9B 1DL7L 5E2WL 1JF5A 4I2XA 1FV1A 4QRRD 2EC9U 2AJXL 3BKCH 1UACL 4M1CD 5TE4H 3T3PF 4NC1E 2D7NA 4U3XA 1OAXH 1F3RB 5BJTA 1HKLH 3QZWB 1ZHKA 2DJUA 1MJ8H 1Q72L 1JCKA 1WEJL 4YHLL 5J3HD 4PG9A 1U3HA 2AEQL 3DV4B 4CVUA 4BUGA 1ZLUH 1WFNA 3OPZL 3DX6A 4GAGH 4APQD 4HWBH 5AZ2H 1JV5A 1YA5A 5J13C 3KPRB 1OY3B 4FFZH 3UXFA 3LKSB 5DFVC 4PJFF 2XKNB 1BX2A 3TFKD 2AXGA 4M5YH 2FR4A 4FN0A 4MB4A 2ZG2A 2AQ2A 5DFVD 2IPUK 5A2LH 4J6RL 5FK9A 1D3CA 3OHXA 3EO1B 4NNYA 4X9HA 4U7MA 4Z7WA 2DQIH 4N9OB 5D1ZA 4ODHH 4NKMA 2A74A 4U7KA 2NMSA 1RUPH 2W0LA 5JO5A 3SCMC 5BS0A 3VI4E 4KMLB 3RVWD 4F58L 1HKFA 1K3ZA 4IDJL 4NKDB 4EUPA 1FPTH 1DBAH 3HRZB 1LP9A 3VMOA 4YHPA 1KN2L 5J1AB 3MNVB 3LD8B 4M3KB 4XC3L 1FRGH 1CI5A 2AKRA 4X5LA 4QTHA 2AABL 4OZHB 2H2PD 4UDTA 3BKML 2VH5L 4L8DA 5L2KE 1MIML 4OFIA 3KPNA 2DQTH 4WWKB 5KOVC 3T2QA 1A3QA 1FVEB 4HHAB 4UAOC 3EUUA 3MGTA 2ADIB 4GAJH 2IALA 2Q6WB 2X4SB 3L3IB 4PRHB 3V6ZB 4OZIF 1KPVA 4MAYC 4LPTA 4D9RE 4X6CF 2V5SA 4ZOBA 1PKOA 1T66D 3ROLA 2IAND 2WUBH 2GSIB 2B5IC 5BV7L 3RWGB 4Z7WE 4MA7H 1VEOA 4ETQB 5I1DA 5HI4D 3DO3A 1OCWL 1P4IH 4YFEA 3NCYS 4HPYH 2X4QA 1D5ZA 3MRDB 1SM3L 4HJJL 5EA0H 5IVXE 3OL2A 2B1AL 5BMFL 3GUTA 4HZLA 4WGWB 5DT1L 3IB4A 3O6KH 4KTDL 4GO6B 2E5EA 4JM2A 3C8HA 1SBSH 2E7CA 5CIPH 4ODWA 4MZ3A 1WCBA 1J0YA 1DDHA 3O4LD 4KTDH 1MFDH 2IC2A 3DX7A 3P0VH 3T0EC 4AEEA 3MV8B 4LF3A 5F9JA 2V2TB 5T1LB 3MQIA 4G7VL 5DJ6B 3QDGE 1EEUA 1ORSA 1T83A 4MSWA 3TH2T 3SDDD 3O3DA 4FTVD 5JNYA 4KKLD 3KR3L 1T5XB 3QCVL 4Q2ZA 2R39A 3GJEB 5IEHA 1FBIH 1W72A 4KH2A 1K4DB 4NUJA 3UTOA 3IETA 1FN4B 4LIQH 1D6VL 5HHVL 4JDVB 1F00I 5T3XE 1C12A 2APWA 3LQAH 1ND0A 3O3EB 1N2RB 2XN9D 1QSEB 4KKBC 4NRXB 5IVOA 2Z8RA 3WS3B 1J5OL 3CD4A 1UM4L 1FZJB 3VD4A 1B4JH 2M1KA 2MPAL 1LP9E 1B0GA 3JTSB 4ZPVB 2CR6A 5HHNA 4JM4L 4TSAH 3OKEA 4PJBE 1U8IB 2CGRH 5F1IA 5I74C 1J1OL 4Q9QH 1JNHB 4Z7OF 3MBEB 5C0BD 2QADB 5ITFA 4IHOB 3HLAB 2OTWB 3QWOB 5JDJA 5E6ZA 4PRBA 2AK4E 5EBMB 4I9WD 1CBVH 1JVKA 4E41A 5D6DC 2LE9A 1QVOA 4UINL 3MMEB 5EZOH 3W9DB 2YD8A 1KIQA 3I2CL 4HG4J 4GUPB 4YC2C 3QEUA 2NW3B 1UZ6F 2VDML 3F5WA 4P9ML 4OZFH 1MEXH 1UADC 4L1DA 4Z7QE 3SJVA 3VXME 3LEYL 3R06A 4I3SH 5CAYB 1ZA3B 5KSUB 2MCG1 4KKAD 1OARH 2FEDC 4JJ5A 2PW1B 1ZA6B 3S37H 1DLFL 3ULSA 4MAYD 3JWDL 3ULVF 3GHEH 3KYAA 3L6FA 3VWKC 4PRBB 5T1LD 3S5LA 3U6RA 4XHQA 1HXYA 4IRZH 1VFBB 3SDDB 1UWEH 4XP5L 1L7TL 1RK1B 1IM3B 3EOAA 3T8XA 3TH4T 5E2WH 1OAYL 1V7NH 3FB5B 3LIZH 1JGDB 1XIWD 4X5WB 2LV4A 5DR5H 3TBSA 4OD2B 2DBLH 3MRQA 3LQAC 3MJ9H 2NXYB 5FA4B 1UGNA 3AMLA 3D2UB 2Y72A 5F88A 3RVWC 2ICWB 1CDYA 2WWKO 4JZNB 2P5ED 2VUOA 4TYUA 3IAQA 2NY5L 4FNLH 2OL3B 1MHHB 5E9DA 4MD5A 3WMSA 2NYYD 4FZEH 3QIWB 1AHWB 2JIXA 1HZHH 5KW9H 2XNAB 5ETUB 5FYJH 3PWVA 3C2AL 1YPZA 4LLQB 4R90H 1G6RA 1GGIL 4GOSA 2MJWA 1TITA 4OF7A 4PRPD 4JRXE 1OF2B 2HFGH 4OKVA 1HILA 5M95B 5C0BB 4HWBL 3FT4A 4M7LH 1PKQB 3H6JA 4EUPH 5EN2A 1WZMA 5HVGB 1H5BB 3PABB 1GGIH 4R7DA 2H9GA 3P9WB 1N4XL 1BEYL 5KOMC 1UH3A 2B4CH 2E9WA 2XV6B 3EHBC 1A7RL 1BFVH 3TJEL 3ARYA 1KGCD 3GHBL 3QIWC 1KUMA 4LVNB 4Q9RL 1Z9LA 4JFZH 5C0EB 4GW5A 4KQ3H 5ITBH 5J6HB 1I3VA 1WZLA 4PJ5A 1QACA 2XZZA 2ZUXA 3W39B 2VH5H 2BX5A 3HMXH 1FO0B 5CZXC 4MS8D 4L4TA 5FM5O 5KS9F 3QFJD 1YJDC 4JFZL 5EWIL 1CFSB 3WO4B 2C7UB 1EJ6A 3GB7A 3NGBC 4IJ3B 1X5HA 4HUXB 4CMMB 1QD0A 4JGMA 4YBQC 4JPKH 3QG7L 2F8XC 2N1KA 1RHHB 3SDXE 4C55A 3MREA 2CDFA 3MNWA 4M6MH 2FWOA 2R29H 1LEGB 4MS8C 2AJUH 2HVJA 3UROR 4PP2B 4L4TD 3OKDB 5JDSB 3ARXA 3TWCL 3NZHL 3TGXA 1Q9KB 5CINL 1QLEL 4YXHH 3QHFL 4Z76A 4UDTB 4U3HA 1KNOB 5DHXB 4NN6B 5GS1C 4H26B 3AAZA 3RUGE 2VSCA 3VDCA 1U41A 3HNSH 2HJLA 3PWPE 4KUCD 4L8SA 4H0HB 1X5JA 1YPZF 3HZMB 1QHPA 2IFFL 3W5NA 1XCTB 3D0LB 5FEBA 4B5EA 1Q9OA 2CKBH 4DTGH 2NY7H 3O3AB 4ZOAA 1DQTA 4MGXA 1CE1H 3ZDXE 3X17A 1D5XA 5FO8A 2PYFB 4F7PB 3EDJA 5C0CB 2DMCA 1MCWW 2A6KA 2YUXA 1MVUB 1HHHA 4K3GA 2A38A 1A7QL 4TTDC 2D0FA 3UBXG 1SEQH 1LDSA 2FSEA 4W4OA 1JV5B 3NMEA 1CFVH 1R5IA 3G5XA 4PJGE 4JRXB 4WDIA 3MZTA 4JDZB 2GY5A 2HAZA 4NZUL 3KXFB 4P2RA 2XPGB 1PKQE 4JO4H 3RWJB 3HUJE 1U3HB 2E9JA 4LFHG 1U8PA 1FBIL 4F33B 1ZGLP 2ZJSL 2DDQL 4LSPL 3NFPB 5ILTH 3P0YL 5DD6B 3E2HB 1IAMA 5GISH 3FFDA 1QRNA 5HHNB 5DDHB 4PRNA 1GC1H 4NQCB 2E27L 3GJFK 3U7YL 4XAWH 3UYPA 3TNNB 3D18A 4MWFA 4LCYA 2DN7A 2W59A 4Z95H 2BC4B 4K7PX 3LN4B 3F58H 4Y8DC 5TGBA 1TZGH 5DZLA 1ZSDA 1ZLWK 2EIBA 4NUJB 1GGYA 4RA0C 1RURL 3F58L 4MNHB 3U83A 3JV4B 5C86A 1FFRA 3D9AL 2B1HH 5SX4H 4YHKL 3WIHL 2ZNWA 3UJJH 3QUXD 4P2QA 4NYLA 4MAUL 3BJ91 5EO9B 4LSUH 3MV8D 3PP3H 3Q1SH 1CFNB 5DUPL 1GXEA 3IRPX 3M17B 4WUUE 2HA1A 3T2NL 4GW1A 1OWWA 7CGTA 3VXQA 5DQ9A 4X6EA 4YE4L 4YHYC 4LRNH 3IU3B 4JRYD 1IC7L 1S7WB 4JN2A 5BW7A 4M9PA 1KB5L 1SEBA 2G2RA 5FUZL 1AKJA 4H88H 1N3NA 1OB1A 2NY1B 4KPHH 4PGEA 1AXTL 1ES0A 4PRAB 4OM0H 4JO1H 5IB5B 3NCYP 3TESA 4OLUL 1DZBA 2WBJC 1WFUA 3FOLB 5E56A 2IG2L 3WUZA 5J06A 3D69B 4R2GC 5JR1L 2X2YA 3MTRA 4HIHA 2XN9B 4CGTA 5HD8D 3DUUB 1INQB 1BQHG 1CD1A 5CBAA 4R3SA 2EYTB 4C57C 1ULVA 3RRQA 4JPWL 4D9RD 2AQ3A 3RX5A 2D7MA 3FOMA 1YNKH 2YZ1A 3EGSB 4LCCC 4XBEH 3K8KA 1DN2A 3RL1A 1WBZA 4PJGB 2J8HA 3FQWA 1IGJA 1U3YA 3EYFB 2ADIA 4WWKD 3T4YA 3K4AA 2DQEL 2R69L 2KUTA 4I5BB 1A1NB 1D5MA 1HIML 3HKFA 4RWYH 4E0RB 1RZJL 3ZTJH 4Z7VF 1E27B 3LHPH 1WBZB 1GIGH 4OZHA 1V3LA 3EYQD 3IDJB 4JFEA 3WN5B 4AENB 4A2LA 4X6BB 4D9QD 3NN8A 5FOJA 3SGEH 5HHPB 3BDYL 4NDMA 1HIMH 1WBYB 4RWYL 2PNDA 1RJLA 4HKXB 1IE5A 4MLIA 1X5IA 4NN6C 3IFPB 3K2UH 4NKQB 4KRLB 2YPVL 1KEMH 1UXWA 4K7FA 4LLWB 4EDWL 5FYJD 3SE9L 4OGYL 3IJYB 3QXTA 3NFSH 1Z9SA 2MKWA 1NANH 2DQTL 3ZHKA 1T80A 3GSQB 3SDAA 5HPMB 3U4EB 2GJ6A 2FGZA 3THMH 1JZ6A 3TH3T 1A7PH 4NKIH 1MVFA 3H9YA 3S3SA 4GXVL 3ALXA 3L3KB 5DJZB 1Y6NR 5GGVL 5HBBA 1R5WB 4KK8D 4PJ9A 3QA3B 1E4XL 5HHXH 4OKDA 2EDFA 4H8WC 4DK6A 1QKZL 4CL7A 3C8KA 5BV7H 2EE3A 3S35L 1SY6H 3T04D 2YUZA 4UTBH 4GRMA 5B8CC 3L7FB 5L2JB 3S8WA 1PG7X 3K4DA 3GSUA 3VG9C 5J6GA 2ED9A 3LQAL 5DVNA 2VL4A 4UTAL 2JJTA 5BJTB 2BSSA 1VHPA 4MA3B 4AK1A 4UMGA 4TTGA 5F7LB 3D1MC 1DVFC 2VABB 3FL7A 3WIFA 1MQKL 3TPUB 2WWKT 2VQ1B 4WUUA 5I73C 1A1OA 1IQWH 5LGHH 5E1HB 3LOWA 1FIGH 2SEBB 2EH7H 4MA7L 4H1LA 4OIIL 1MCNA 3K8MA 3S88H 4M43H 5EORH 2F53B 1A22B 4QNPE 1TJGH 3RGVC 4MQ7A 4QHUB 3I84A 1NCDH 4Y4HA 3JBG7 2G5BA 4O58H 4O2EA 4XNXL 4P9HH 3P3YA 3G6DH 3CXDH 43C9A 3EOBA 5I19L 1AR1D 3N06B 1D9KA 2APBA 2Q87A 1NMBH 1Q94A 1U36A 4WI8A 5IB2B 2E6JA 4F9PA 1ZT1B 4PD4J 4K9EH 4OLVH 3QXVA 4J1UB 4MJIB 4G9DB 1EHLH 3WO3B 4LHJB 4EEEA 5E8NA 5JTWA 4JFFD 3F6LA 4V1DA 4XWGL 3PL6C 4HJGA 2OK0L 4LSQL 3U1SH 1J1PL 4AIOA 4YHZH 2YZ8A 3STBA 1JIBA 3JTTB 2FIRT 4NO0A 4PB0H 1JWSA 2NNAB 3QI9C 4JKPH 5K9QG 4K94L 3UEZA 4NO3A 3ARBB 4ORGB 4P2QE 4PJ8C 5EU7E 4Y4FB 2QHLA 3TIDB 1R3IL 1Q94B 3TFKC 1MWAB 1CBVL 4M4RA 4L8SB 4OZGB 2HJLB 3BZEA 1HHJB 4DW2H 3I2CH 3FO1B 4FZEL 1HNGA 1E28A 2Y36L 5FXCH 4X7SL 1LE5A 3QJFB 1QRKA 3C6LB 1KNOA 3V5KB 1IAIM 1J0JA 5FYLL 2AXJA 3ECBA 3TCLB 4H8WL 2X10A 4LSVH 3BEWB 4RGMC 1KJVB 5IG7B 3J8F7 2X44D 4YXLL 2HJFB 1QLRA 3OKNB 4ELMF 4JGUA 1E4JA 2BVQA 2VDQH 1EH9A 1GCFA 4JKWA 4UOW1 4LSVL 2O5YL 3QIUB 5I1EL 4WFGE 1AC0A 5DJYA 1N4XH 3IETB 1K4DA 5I74B 2JLLA 2BY0A 5KG9B 4P9MH 5C08D 4Y5VA 1UKSA 3BE1L 4Z7VB 3RZCC 4PS4L 5CUSH 4Z5RA 4OZFB 4CW1B 1CFSA 4DGYH 4U6XA 4NQDD 1FCCA 1MF2L 2JTDA 1FFOB 3MGOA 4DAGL 3RPIB 1AXSA 2D0HA 4X5XB 2V17L 3V5HA 1N5YH 2GJZB 5GRXG 4XMKH 4KZEH 1NAMH 3T1FB 4MJID 3G5VA 1YEGH 3U7AA 5IK3A 3T3ME 5C0EA 5EDXA 4JFFB 1QSFD 4OBRA 4O5LH 1UB5A 2JB5L 2BNQB 3OR7B 5SWQA 2C4XA 5GJTH 5HPMA 5BZWB 3IDNA 1OQXA 1F2QA 5E70A 3VWJD 4RFNB 3HHRB 1RUAL 1QFWL 1TVHB 4HXBL 1Z2KA 2D9CA 3MRJA 2B1AH 5BMFH 5B39B 4JCLA 3KYMA 1FFOA 1RIHL 1I9IL 1N5AB 3RAJH 5L8LB 2BY2A 5J11B 3O8XC 4YBHA 4JANA 3HI1A 3QUYD 4UNTA 4JFPB 4JN1L 4EKXA 1CG9B 2DQUH 1JPSL 1H3TA 1DANT 1RJLB 3GBMH 1OAKL 4PRPE 3KDMA 2KQMA 4G6ML 4LLDB 1YQVL 3PWVB 1AJ7H 3C2AH 3DXAD 3WFHB 3KPPB 2PYEB 3DMMA 3QSKB 4HFWA 4K2UL 3NH7H 3KPSA 5IQ7L 3N85L 5ALCH 4Y5YB 4EN3A 2CUMA 1VPOL 2IMMA 4N9GB 3EAKA 2ADGB 4HUKB 1F90H 4DQOL 3BPOC 1YMHB 3CNKA 3TYFA 1CXIA 5I2IA 4M6AA 5H37H 1BQHB 2FZ3B 2LU4A 3PV7A 3FOMB 2BNUA 4NKOA 4D8PB 3CVHL 4WO4B 1PQZB 2R9HC 1BZQK 1JPFA 1MOEA 3JWDC 3HZYA 4NKIL 1U8LB 5LCVH 4OB5H 2NTFA 3REWB 4F2MB 4RSVA 1MWAA 1AGDB 4PR5A 3KNBB 1BVZA 1A7NH 4G9FD 5GXBB 3U7WL 1D7FA 3PGFL 3RNKB 5JUEL 5CFHA 3DUSB 1FCGA 1YEKL 1I7UB 4WFGD 4H20L 3PWLB 1X5AA 4K3EL 3OR6A 2DQDH 3MA9L 4IRJC 4N1HB 3HZKB 3MFGB 1Z9OA 3PDOA 2A0LD 3PQYE 2YBRA 3R1GL 3NIGE 4Y19B 1S9XA 1QBMH 1T20A 1EMTH 3QUYC 4IOIB 2V7HA 1T0MA 2E27H 3VFGH 4NHUB 4L4TE 4PYGA 2QADC 5B4MD 2DICA 2QV2A 3V4VL 2XRAL 1JNLL 2OTWA 2OJZL 2QJDA 5C0AA 1W8OA 2MQ0A 2FO4B 4NQDA 2ZUSA 1KB5B 3QUMA 1FH5L 1JUFA 1TCRB 1FV1B 3IDIA 3CFDA 3F7PC 1IGML 4APQC 1KJ3H 4HZAA 3FN0L 3DBXA 1KYOK 3BYTA 3RZWA 1DVFD 2OZ4H 4OCWH 2AS5M 2J8UA 1UEYA 2X9XA 1QEWA 1UH2A 5FGBC 3LD8C 2Y6SC 3SO3C 4JO3L 1A6VL 5EZJA 3H42H 1ACYL 3DBXB 5CZKA 2HRLA 2O5ZH 1SMOA 2X1WL 3O6LH 2I5YL 2IF7A 5HYSG 4UIKL 1Z3GL 4HLZH 4HGKC 5B8CB 3QUMB 3BO8B 5LBSH 1L6ZA 3C2SA 2QSCL 5E7FA 1CN4A 2YD4A 2D7OA 5J6GB 4XPTH 1T0MB 5C0IB 3BW9B 1U58B 4O4YH 4OZ4B 1U8MA 4RIRA 1MI5D 4NZRL 1EO8L 5IIEB 2BNQE 3RVVC 4N0UB 1EZVX 1R0AL 3RU8H 3PWLA 1NCCL 3RWIA 5CJ5A 1RI8A 3OF6D 5BRZA 4DOHE 1S9KC 1A14H 4P4KD 2BSRB 4S1QH 5HY9B 3FQNA 1ADQH 2CR3A 3GDBA 2G75A 2BNRE 1NCCH 4WFHE 4UU9A 3MRPB 3DIFA 3QUXA 5IW1A 4KI1A 3GMPA 5A43C 5I1HH 3R4DA 1IFHH 1NCTA 3F7QA 3VA2C 1I9EA 3C6SB 3K7UA 3DVNB 1B2WL 5I1DB 3U46A 3HZYB 3VXRB 1H0DA 3HI6L 3NVQA 5GGRY 3HC0B 1IKFH 1EGJA 1K3IA 5IFAL 1FFQA 5IWLA 5FYLH 5IB1A 3CXHJ 2YMXH 4U1MB 2XXMB 3RWCA 3LKRA 3LAFA 4NUGL 2EYSA 2VXQL 2A77L 5IB4B 3MLYH 3NGBB 3GMMA 2HTLD 3F7YA 3HN3A 25C8H 1T0PB 5HGGS 1KB5H 4JR9H 5D70L 15C8H 3EYUH 2MFNA 3P9MA 4M61A 3KPNB 4WWKA 3CLEL 4EN3B 1ORQB 1FZOB 3EFDL 4ODUA 5GGQL 4EI5B 2CJUH 1MCPH 1XF5A 1UWEL 4WTZA 1JTPA 3BP4A 4HFWB 2M2DA 3ZE2F 1FAIL 1FORH 4PS4H 4UOW0 2BOBB 1SYVA 5L9DL 4XMPL 4OQTH 3B8SA 3VGDA 4UT7H 1R24B 5D72H 4NNPL 5DMKB 5FUCE 4LRNL 1OTSC 5I18H 2V17H 3OKLB 4XMLH 3G6JE 4HUXA 3UYOD 3WFCH 1KTLA 4L29A 4P5TC 3Q6FA 2XTJC 3MRJB 4OLXH 4LCUB 2VB5A 3DV6B 4KPHL 4NRZA 5GGVH 3RZCA 1LK2B 5DI8B 2XA3A 2DL2A 1FO0A 4PJEE 3RA7H 1IZJA 3PDDA 1UYWL 3S35H 4OLWH 4X4ZA 2ZCHH 1PVHA 5FYKL 5D1XC 3UPAA 4PJDE 2PR4H 3CVHB 5D1QA 4JFFA 2QR0A 1NGPL 3OX8B 5K93A 2BNQA 3LB6D 1NUGA 3VFOB 4U1LA 3WUWG 3RVTC 1XGPB 4NJ9L 3A6BH 3RJQB 1EFXB 3LZFL 5LQBH 4Y16D 1FLRH 5GGRB 3TN0C 1B0WA 4QRSA 2EXYD 4EDWH 5IW6B 4KUZH 4NT6B 5T33H 4LBEA 3FTGA 5ID0B 1BEYH 3LKOA 4ZFZB 2F15A 2ZUYA 4D3CL 1P5VA 5KVEH 1VSCA 2OR8A 1WVZA 5I1AA 1CLOL 3HMWH 1CIUA 5DK2B 3TBVB 2NY3D 3OKNA 4M5ZL 1VERA 4D3CH 4L4JA 3E6FB 3RWEA 5T5NG 4GKOA 3TCLA 1XIWA 4JM2F 3GGWA 4YDKL 4YPGB 5ESQB 1F4AA 1PBYA 1HHJA 3EOAB 2AJUL 4HV8A 1QSFB 3KLAB 3ILQD 3BP7A 4NC0B 3GI9L 1I3UA 3WNPA 2APFA 4N0RA 4JHAH 1IKNA 2Y9RT 2BDNH 3WXVH 1EAPA 2X05A 5FIEA 4G42B 4UBDD 4LLVB 4I77H 4LKXB 4YZFE 2RHEA 2ZKHL 5KSUA 2XYCA 2VXUH 1BGXL 4RAUA 5CINH 4B53A 2VC2H 2Z31A 3MCKA 4WV1A 1HHHB 2XZQL 4JQIH 4N5UA 4Q0XL 1EO5A 5IESH 2PYEE 4G42A 3FHQA 3V0VA 1NDMB 3LRGA 3GMLB 4IS6A 2XFXB 4DFIA 3O3AA 4NQUA 3IF1B 2VLRB 3ARDC 4O2FB 4P23D 4YJZL 4Z0XA 1CDUA 2Q86A 2ZUQC 4NBYB 4X4YB 1LO2L 3IRZA 4YDLB 4QOKD 4PGJA 5ESAA 1IJ9A 1QSFA 4Z7UE 1CFVL 4QHUA 3OKEB 3CJJA 1LDPL 2QSVA 1IGFL 1KJ2A 4M93C 2ZOLA 4XPTL 3L3GB 2FX7L 3LSOB 1UWXK 2BMKB 1BIIB 2X7LB 3QIUC 3C5SA 1DBKH 3RWDB 2RAMA 2JJSA 3OXRB 4M4PA 1IGIH 2FIKA 2D03H 2DLTA 4DUWA 3EYSL 3QH3B 3N1FC 2ZJSH 4KZEL 1I1CA 5IKCA 5CJQH 4DZ8B 3UTQA 1FSKC 5L88L 5F1KC 2CK0L 1OTTC 5CMAB 5FKAA 5D9SB 3ZDZF 4HCRH 1U8KB 5IW6A 3NACL 3N1PC 3KYOA 4HH8A 4NN7C 3IFOA 3QDGD 5L2JA 3VG9B 1ZK9A 2Z92B 1XEDA 1UCBH 3P4NA 3HE6C 3SE3C 2AEQH 1PZUB 1VADA 2YC1B 1F4YL 4YIQA 4WNQA 1FZMB 3BPLB 3X13A 1R3JA 2HLAB 3QJHA 3WNKA 2QR0B 4O9HL 1MFCL 3Q3GB 3U0TA 4F9LA 3RVUC 2VQTA 3VFOA 2B7DT 2F54E 4NUGH 5JIPA 2GJ6B 3W9EB 3RBGA 5JPNB 3QEQA 4MX7A 4XX1G 3C5JA 2YSSA 1MJUH 3H0TA 4LAJH 4HS3A 4M7ZC 4NO2B 5I71B 5CUSL 3G5ZA 2AI0L 1CXFA 1LK2A 4Q74A 4MD4B 3EFDH 1H3PH 4ZS7H 5CCKH 3G04A 3TZVA 2J1KA 1Y18A 1AO7E 4DEPB 4NM8H 1JI1A 3EFFA 4XNZC 2VKWA 3CMOL 4AENA 2B0SL 4QRTA 3ZE0F 4CADB 4WI2A 3HAEB 3QXWA 4I8DA 1ETZA 4Z77A 1YC7A 1NCWL 3GIZH 4XP9L 4ELKB 4JY6A 3FN9A 2XXCB 4UUJB 2K7QA 1T5WB 2L4OA 1GHFL 3TT1L 5ECJE 1I1AD 5GGSY 3BZFA 5F88B 2HKFL 3KLSA 1AGCA 3JV6A 4P3DB 5HXMA 1GGTA 1YN7B 2ARJA 1VFAB 5BV7B 1MFBH 4FQIH 1I85A 2FATH 3FMGL 3Q2CA 4G8EA 2FEDD 2X4NA 3MLSL 1MRCH 5KJRL 4P5MB 4MJ6A 4HUUA 3C6SA 3PE9A 1M1SA 4BFEA 3HE6D 3LRSA 1ZGLB 4P2RD 3VXMD 4GMSL 5F7WC 2BSTA 1OAZL 1NH6A 4MNQB 1G7IA 2ZUWA 5FHBH 5C09B 3KLHD 2G75B 3GMRA 2HFEB 2MCPH 3LQMA 1J10A 2A1WL 3GKZA 4UU9B 4WTZG 2DOCA 3VE0B 2LVEA 3OHXB 3C09B 3BHBA 1T3FB 3AM8C 5MEOB 2NY4B 4KHXH 4PJXE 3VXRD 3P0VL 4J4PD 1RJYA 3LZFH 3VGAB 4JN1H 5DMJB 1H3GA 2MKLC 2VDKL 4S2SB 5IIEA 4KROB 3F6IA 5D7IB 2VDOH 5BS0E 5GQBA 4OGYH 4Y19D 3O9WD 2GJ6D 4DGVL 4XC1H 1U8MB 3QDGA 3P4OA 4OJFH 3CFJB 3PWPA 3CDGA 3DETD 3OGOE 3FCTB 5B8CA 4XC1L 4QRPB 3UTSA 2CDEB 4DQOH 1U8IA 5HPOA 1ZOXA 5GZOC 3OMZA 5TDOB 5KSAA 1U3HC 4XCFL 1HHIA 4PYHA 1OOAA 4ZUWB 2QQNL 2R2BB 3BFOA 1RIUL 4JFDD 2YKLL 4KJPC 5E6IB 5HTSA 5LBSL 3FQXB 5FYJU 1QSVA 5EB9A 3VFGL 4QHLA 4P2OC 4YO0B 4BYHA 1XT5A 1LO0L 1YY8B 3RGVA 1I7RB 3V0AC 4O51A 1T04A 1B6UA 4Y4HC 1MNUH 2Q8AH 3QEGL 1TCRA 2VZUA 5D2NE 4A6YL 4Z7UA 4P3WA 5C3TA 3ARGC 3MXVL 2FO4A 5ID1A 5DRWA 1UJ3C 3P4OB 4S0SD 1EFXD 4P2RB 3BP5A 3GSNH 2E7LA 1S9XB 1TJGL 3ELAT 4PJIF 4ZDHB 2HT2D 3SKOA 5HGAB 4HJJH 4HKZA 5EA0L 2V7HB 1S5HB 1CLZL 5HYJE 3EOTL 4XH2A 1Q0YL 1JHTA 5J56B 3QISA 1S7XB 5HHOE 3BIAX 4JDZA 5DD3H 4RFEA 1LD9A 4XCCH 4J3XA 4I4WA 2R1YA 4MDIB 1LK3H 2XICA 1J0HA 2VTFA 2W0KA 4X7EC 3V6OA 3VXTB 2X4TB 4FQ1L 2F5AH 4M6NL 2IANE 3FHAA 4XCCL 3BQUC 5I1KL 5TDNB 3MLYL 4JDTH 4KVCL 5D2LF 1MAKA 3BN3B 3ETBF 3JWDH 4ZUSA 2OTPA 15C8L 1F3JA 4OD3L 1DSFH 1NGXB 3DROA 2GCYA 3QNYB 1HI6A 1UM6L 1PG7L 2IBZY 5ANME 4NO5A 1KJ2L 5CP7B 3SPVA 4EXPX 4NZJA 2C4FU 4HBQA 4QRRA 1KJMA 2ADGA 1S8DA 1Q38A 2ARJB 4PJFA 2OK0H 1NCAL 4OQTL 5HHMD 3DSFL 4HX1A 4XVSH 4GH7B 3BGMA 3NACH 4WWID 4F37K 1U6AL 1TDQA 5DQDH 1OLLA 3DMMB 1AR1C 4MCZB 4D9LL 5I1HL 2EZ0C 2W60B 4J3VA 1NFKA 3WNMA 1S7TA 4QTHB 1AGBB 3L95A 4HCRL 4PJ9C 4XNYH 5T3ZL 2UVFA 3TVMA 1FNHA 1Y18B 4YHPB 4FRWA 3V7MA 1JPGB 3LQZB 1PY4A 1NCNA 3UCRA 1CE6A 3QRGH 5HYSB 3IAPA 2C3GA 1W8NA 4P4RB 4XP1L 4MAUH 2B20A 5DUBB 1YEHH 2ILLA 4XPAL 4MD4A 4PJAF 3GI8L 2AJZA 4PGBB 4JQXC 4YDVA 3I75A 4WENB 1IFHL 1U93B 4NNYB 1IILE 3MSPA 3B9KA 3CFKA 3RTQB 2FJFB 3SE3A 1OGAB 1JK8B 4IOFC 2P5WA 2VDQL 2Z8SA 2XKNA 5DSCB 2RGSA 4PY8J 5LGKA 1KT2A 2GY7B 1KELH 1NJ9A 4OFKA 4FQ2L 3I75B 2NTSP 4F9LC 4R7DB 3MO1B 1FZMA 2YPVH 4RMRA 2WBJB 2MHAA 3AUVA 5DC0A 5C0BA 2Z92A 5IT2H 3GSXA 4CN1A 2APTA 3U7WH 1FNLA 2P7TB 3JSSA 4BQCA 2AJXH 3BKCL 5E94B 4ONHB 4FTVE 1G6RB 1DN0A 1ZE3C 4JFQB 3H8NA 4JPVL 3WJLC 3TVMB 4OF0A 2BVYA 1TNMA 4GQ9L 1M7IB 4XVUC 3WNOA 4NN5B 3TWCH 3WFDL 1V3JA 3MLSH 4XP4H 4LMQI 2AJYL 4TN9A 3R8QA 5INDB 2YEZB 2ATKA 3BPLC 1MIEH 1CU4L 4OLXL 2UWEB 1E6JH 4HXAL 3VCLA 1AD0B 1T7WA 2Y4SA 5DEZA 1F3DJ 3MUJA 4ODSH 1JGDA 4X5WA 3NZHH 2ZNXA 2NCMA 3WEXB 1HEZB 4OD2A 3CC5B 1MIEL 5IW3A 1B9ZA 4HAGA 1ITBB 3QO0B 1J0ZA 2R0ZH 3HPJA 3S3PA 4DTGL 1UWGH 2NY2D 3V6FB 4G8GB 2EDNA 3IDXH 1U2HA 4M7LL 4OIAA 5H94A 3AREB 1MPAH 5JHDB 1X6LA 2CXKA 5D7LD 2X41A 3ARBA 4ORGA 3ARGB 3VXTA 3HS0B 4XC3H 1SEQL 4WW2B 5C07A 2OJEA 3INUL 3F5WB 5CZXD 3BN9D 5T33L 3BRFA 1VGEL 1P7HL 1WAAE 4KQ3L 3KPRE 1QQDA 4F7MA 4WW2A 5C07B 4X6DE 5BCAA 1PD6A 5T3ZD 3GIVA 1A7NL 4XCEB 4HKJA 5GZOD 2HTKC 4JY5H 4NFDA 4WW1A 3ARQA 4U49A 2VQUA 4J7RA 3T0WA 3PIQA 1MHPL 3T3PE 4JFOB 3WFBL 3MRFB 3G9AB 3VA6A 4P23C 1T04B 4X6DA 1G7QB 4NP4H 3LY6A 4PUBL 5ELIA 2FECL 1SVCP 2QQKL 1EX0A 1HQ4B 1FZJA 3DARA 4UIMB 2C1PA 4RMQA 1WV7T 3RIAF 4AEFA 4E42B 5DT1H 3PHQB 3U7YH 4Z9KB 3VCLB 3GI9H 5BVJA 1FNSH 2EKSA 5CKGA 3Q5YA 4H1LB 4RAVB 5HVHB 3D9AH 1EHAA 1PZ5A 1CLZH 4JVPA 1NAKL 2VLJE 5F8RC 3JUZA 5EZLA 5B38B 5EBWB 1F4WL 2GAZA 2NX5B 4QHKJ 3LKOB 5I1JL 5DMYA 2ZKHH 5ICXA 3MRRA 2DM3A 5FO9B 2BSSB 4TNWK 3AFLA 3MRKB 2MWCA 4MA3A 5CWSB 2OSLA 2NY5C 4AIZB 5IEKB 4QLRA 4IOSD 4W6YB 4GKZB 3STZA 4ZS6C 4GRWF 1J8KA 1RZIA 3V0WH 1WT5A 3RY5A 5BVPL 2M8XA 1N7MH 3L9RB 5CZVH 5IR1A 3QIBC 1H9VA 2V7NB 4P4KA 3FQUA 1U3ZA 1NGWB 5D7SH 2W38A 5HGBB 3QA3A 1XGPA 4FQ1H 4M6NH 1CFQB 2F19L 1SHMA 1M7DB 4KRPD 4CUCA 3WKMH 5HDOA 1UQSA 4OLZH 2VLKA 3G5YB 2VZ1A 3QCTH 5J4MA 1J5OH 1P7QA 2A6DB 4OZIE 2QEJA 4RDQF 3SDAB 5IQ9B 3GUTB 1B4JL 4ZOEA 1MF2H 3MJGX 4R7NA 3BYYA 3VFRB 1G7IB 3OAZK 2BSTB 3ULUC 5GS2D 2ORBH 1ACZA 3Q6GL 3BQUA 4OCLC 3LPFA 3OKLA 3G08B 2BVOA 3T4AB 3EOYG 1C16B 5AUMA 1BJMA 1JNNH 1TXKA 3T0BA 1VFAA 5KBNC 2FYYB 3DX8B 4FQCH 2IPUG 2BRRH 1EHXA 3MJ9A 4BH8A 3KYKH 3WN5A 4GJTB 3BZFB 5J11C 2Z35A 1IAIL 4GBXD 1YECH 4TNWF 3HC3L 5D5MF 3BVNB 5T1KD 1K6QH 2OCFD 1ZANH 5IFHH 1MEXL 3VG0L 1Y6MR 5DEGB 5GIRB 4OFYD 4ELKA 1T2QL 2ADFH 5IBLC 1CF8L 3H3BC 2DQIL 3QWRA 4WWKC 5C0JA 1QSFE 4FFWC 4PJCF 3RWCB 1MFEL 3L5JA 3HMXA 1LP9B 1A47A 1J8HE 1KELL 4JQVC 1G6RL 2A74B 1MELA 1H0DB 3VFTA 5KS9B 2AXFB 2GTWA 3GSOA 2VDOL 3QEQB 2W65A 3ZDYF 1SEBB 4ZFOL 2NY6C 1OD7A 1FPTL 2ZZUT 3VRIA 5F8QC 2VLLB 4DKEH 2WP3O 5EUKB 1PW3A 4TTDD 5IMMA 1QKZH 1R3HA 5D96C 2EEBA 1MCFA 1CL7L 1ZTXL 4QRQB 2I9TB 2RCSH 3DX6B 4X7CC 1CFNA 4TOYL 5JXEA 1AXTH 3AXLB 3M17A 3VXSA 1QFWH 4N8CL 2BDNL 4OCNC 3WLWD 2F58H 3IFOB 5F9OL 5HHMB 2ZCKH 5C9JA 3SDAD 5EO0B 1MLBB 5C0ND 3WFZA 1G0DA 1MI5A 4NNXB 3QUKB 2FCBA 2DM7A 4H0GA 1XGYL 3VGAC 3CCHA 4I77L 4R4BA 4TOYH 4G8IA 5C0IA 4Z7OE 4NGHH 4HUWB 5CMAA 5DJ8A 1YYML 5FKAB 5T5NF 5CWSA 1YDPA 1UENA 4I0KA 4OLWL 1KCVL 2Q20A 1QOKA 4M62L 3U36A 3D85B 1P9MC 1UWGL 5LQBL 4PJIA 4P59H 2EO9A 2RBLA 4XAKE 4PGDA 1AH1A 5F3BA 4A2MA 1A4JB 2MQ3A 5IBLD 4LHUA 1A7RH 1YUHB 5H8DA 3LS5L 3QULA 2HN7A 3NCFB 4L4VA 1RZJH 2A6IB 3NCMA 5TF1H 1Z0NA 4I48B 1UKQA 1LE9B 6CGTA 1QRNB 4LKCB 1YDPB 1EAJA 1GH7A 4PJ7B 3O0RH 2XIDA 4K9EL 3FCTA 4OLVL 4Z0XB 3NAAH 4IDLA 3VXOB 3N0PB 4QHKI 5CIPA 4WW1B 4S11A 1HH6B 4XCFH 4PB9L 1B4RA 3DRQB 4ZG1A 3IJSA 4JRXA 4XPFL 4X6FB 4FFYL 4Y4KC 3X11A 3KXFA 4ENED 3AGVA 2A83A 1MJ7H 4X7TA 1D5BB 4L8CB 2ITCA 4PJHE 2EICA 3GSNB 5HI3C 3WE6A 1RVFL 5K59E 3TVMD 4LLUA 3BHBB 3OR6B 2PYFA 4F7PA 4NQVA 2IJ0C 2QQKH 1J87A 5C0CA 1BF8A 5I9QB 3I85A 4M9OA 4QYOB 5MP6L 2P47B 2BHUA 1QNZH 1MQ8A 4MNQA 5IF0A 2QQNH 2X4OB 3HTLX 3CH1B 5ALBL 5LGJB 4YXKL 4ZQKB 4P5MA 4PJ8A 1F3DH 3V6FA 5I6XB 3U0PA 3W2DH 2VLKE 4BQ6A 3X14A 1CR9L 3O11A 2ICES 1QZ1A 4OGAC 5AG8A 5I8CB 1MREH 3AAZB 4WY7H 5AZEL 1MNUL 1AGCB 4J23A 3RWEB 1GZQA 3DHMA 4GKSA 4XRCA 5F21B 5L2KA 4PV8B 2DQGL 3T77A 4I9WE 2YOCA 4M43L 5EORL 3HR5B 3ZYOA 1FL5A 2YPLE 5EBLB 4LQFL 1ZHNB 1YY9D 4RMTA 3EYVB 5HI4C 1QA9A 4GMTH 1ONQB 4YK4C 3SO5A 4FP8H 2IQ9L 3ME0A 3UZEA 2O5YH 5F7FA 1KACB 5J7CC 3QI9B 2ICEB 3S35X 4NRYA 4ESKA 5BOZG 5D5MB 5EOQL 4BK4A 3EZJB 5IHBA 4U1IA 3QWQB 2A9NH 3KG5A 4K8RC 1N5YL 1ROWA 5C07D 5JW4N 2FL5A 4NIKB 2G9HA 3BISA 2QKIB 5JOPD 4MQTB 3P0YH 3U4BL 4XGZA 3WIHA 2WWMC 2YPKB 2KPNA 3SDXF 2IPKA 2H1PL 2X1PA 2A9NL 4EI6A 1XAUA 4NBXB 3F62A 3W39A 3T1WA 4EZMA 3NABL 1KT2B 2I25N 1RZGA 3MRMB 5F44A 3VH8G 5DC4B 1MCRA 4XTRD 5K9OA 3QQ9C 3HNTH 3R8BB 3VWKA 2EC8A 2YXMA 5HHME 3NFNB 1X5KA 1JWUB 1K8IB 4R90L 3V5HB 1JJUA 3UYRL 3AS1A 4A6YB 1NBVH 3ZE1E 1M7XA 4JKPL 5EN2B 1NCAH 4CRPA 1CGXA 2V5YA 4U6XB 1RZ7L 1F11A 3RVXD 5TJWK 1HKLL 2QKIA 5D6CA 3C5ZA 3PABA 1V8HA 1BVKB 2G9HB 4X4MA 5IV2A 1KTLB 4L29B 4P4RA 5EOCL 4WI6A 5FM5M 3MRKA 3O2WH 1A1MA 5KG9A 4LCCB 3LRHA 32C2A 1NGPH 4NRYB 4Y5VB 1VFOA 1DANU 1FNGA 2H2SD 2PCPA 5J13B 5FDYA 1HXMA 4RCAA 5ADPH 5GGTH 2BVQB 3PHOB 3RWDA 4XNMA 4X4ME 3OSKA 2AI0H 4X8JB 4F57H 1EUTA 4MD5B 2O61A 1GIGL 1YNLL 1FYTB 2EKSB 1KLGB 4DCQB 3DMMC 2WIIB 1T21A 3F7YB 1K2DA 5ADPL 3L3JB 1KJVA 3K80A 5DJDA 3V6OE 3QJFA 1Z5LB 3TA3A 4EN3C 3EIFA 5MI0B 3P2TA 4X98A 4YNYA 1RD6A 3TPKA 4NO5B 3X14B 2XWBB 3ZTNH 1SY6A 2Q7YA 4U1SA 4QXUH 1SYSA 1CTNA 1HYSC 2Z9TA 4KI5F 1AIFB 4YEEA 2X1XR 4YR6B 4Y88A 1A3RL 3SE4C 1SBBA 3GMPB 5HHQB 5C8JA 5F71A 3QDJA 4IIQA 4PRIA 4U1HB 3B3IA 2HWZL 1UA6L 4ZAKD 5E8OA 2H6PA 1QLEH 4RAUB 4PJBB 4BSVB 5CBEB 2ESVE 4GUPA 4LARH 1RZ8B 5BXFB 1ZLWH 1JPST 4PV9B 1MHEB 2APVA 3O4LB 5FKPA 5EBMA 3X3FH 5IJKA 3ZSSA 5C0BE 3O6FC 4GBXB 4AEIH 5DMGC 4YR6A 3QB7C 3BDYH 1VGKA 2IAMD 2AERT 1I8KA 4U6VH 3WLBB 3OBAA 4POZC 3ISWA 1BFOB 2VXUL 2VDLH 4XNUL 1TMCB 2XWBA 5B4MC 1YY8A 1FDLH 4P99A 4MQ7B 2EH8L 4ZSOA 1KCRL 1L0QA 2VWEC 5GZNC 1RJCA 3ARWA 2VAJA 3U79A 3IDMB 2PXYA 4OCXL 1B0RB 3AS3A 1HHKA 4PTUB 3WIIL 2SEBA 1T6VN 4WI4A 4MCYB 2PW2A 1ITCA 4WUUB 4PIRF 2CKNA 4Y2DB 3SDYH 3H9ZA 4D0CB 3L3HA 4WI7A 4OZGE 5IMKB 3IXTA 4Z0BH 3D0VB 5J12C 4MA8H 2V2WB 4R2GD 1YEEL 5HGDB 3HNVH 4PLJD 1XGUB 3O3DB 1BVKA 4GRMB 4NHUA 4C83B 5DJ0A 2DDQH 3GM8A 5DEFB 1P69B 3ZL4H 1H15A 1C1EH 3NA9H 1IM9D 2YPLD 4ZUUA 1B6DA 3QPXL 5EZIH 4GBXC 5GISL 2DMKA 3NIDF 4FXKB 2V9TA 1B3JA 3S6CA 5DJZA 4P46C 4WUKH 1ZT4B 4CAGA 2V2XB 1WAAA 4QRUA 4ONOA 3F65A 3RNKA 3B5HA 4NN7B 2Y7QB 1OW0A 1LNUA 4Z7VE 4M7JL 4ORZC 1NL0H 1LEKB 5E2TL 2HG5A 5C09A 3GSOB 4X6CE 2ICWI 1JZ8A 3KYKL 2Q3ZA 4ALAH 4LVHB 3ULVH 1KOAA 3Q6FB 3LRSB 4JVWA 1ZGLA 5GS1A 2GSIA 1A6ZB 1FG2A 2C3VA 3T0AA 1QPXA 3HC3H 3UTZB 5JXAH 4D8PA 3H3PL 3FZUD 4BKLA 3GMOA 1KN4H 5D1XB 1DQMH 2UWEE 5FECB 2BJML 3RKDC 2OZ4L 2FX7H 3PQYB 3RY6C 1S7UB 4ERSH 1Z9MA 2WNGA 1IQDA 3V7AG 4OD3H 3F12B 1T03L 2BCKA 2V5RA 4L3CA 1ACYH 2BNRA 4LLYB 4XHJC 5FECA 3UBXI 5D7LE 1E6OL 4YDLC 3BKYL 5IMLB 4M8QB 3HAEA 3MRGB 2F53E 3VW3L 4ETYA 4UIKH 2C4FT 2FJHB 1QBAA 2JCCE 2YA0A 5E7BA 3LEXB 5CBAB 1IRAY 5FAAA 1NGZB 5E8EA 5FUZH 5TE4L 3N1QC 3PWNA 5D72L 5JIIA 4NKDA 3LMJH 3KPQA 3UPCA 3L1OH 1UZ8A 4FTVA 4K7PL 2I9LA 2YSSB 4XI5C 5IHZA 2AK4D 4QYOA 3VFUA 1CLYL 3O2VL 1OTUC 3W9EA 4HD9A 1T7ZA 1J8HA 4JN2B 2YD7A 3QQNA 4YWGH 4RFEB 1R3JB 2HLAA 3O2VH 1IGCH 4J4PC 3VWJC 1Q9LA 4Q97A 3QO1B 2DWDB 4LOUC 1MPAL 1E4KA 2OQJB 4PJBF 2ZOKA 3DTXB 4C54A 4BFGA 4FMFA 5AAMA 5CCKL 2AK1L 1M6OA 5JMOC 3SKJL 1RU9L 4Z8FL 2OSLB 1QG3A 4C56D 5DJAA 4D0DB 2BVPB 5DO2D 2O93L 1CFTB 2B39A 5E2VH 1LE9A 2IPTL 2JJTC 3PGDA 5CJ8A 3QI9D 5EU6E 2PUQT 4DJMA 3MJ7B 3B8YA 3OJDA 1HK6A 2IH1A 1HQRB 1QLRB 1TTFA 5FCUL 3LSOA 1T1ZA 2DLFH 2FLBT 2XZCH 5FUOL 1GGBL 1UZ6E 4ZYKA 4PBWD 2CJUL 1FJ1A 5CEXA 5HSFA 3MJ7A 4PB9H 1TJHH 2EDYA 2IBBA 1TFHA 3EJYC 3DX9B 4F7EA 3T0XA 1XR9A 3IJHA 4UNUA 5DDHA 5IMOB 3C09C 4UTAH 5DJAB 4PY8I 4ZSOE 4D0DA 2JCCA 3QUXC 3A67L 3MRFA 5BZDB 2YA2A 3PV6B 4Y1AE 4QCIA 5IFJA 3SGDH 3NFPA 1NBYB 2NXYD 1S9WB 4XCYB 3JZ7A 2VRAA 1M05B 1W0WB 5I75B 3AY4A 1WGOA 3FB6A 4NOFA 4RWHA 5ESVB 1ZHBB 2IH3A 4XXCC 2DWDA 1MHCA 3MXWL 4NQEE 2XZQH 4JQIL 2FSEB 5KTEH 5DRNB 1OAUH 1C5CL 2YD5A 4P2CG 2ZP0T 4BSVA 3BEVA 2DYPB 3GBNH 5EU4A 4IMLB 4IRSD 5MEOA 3SHSA 3P4LA 1ED3A 3O6MH 5DGQA 4KJYB 4ZXBA 2EECA 3V0WL 1BQLH 2ZCLL 5C0AE 1JI2A 2DBJA 2JJWA 5IVZB 3TBWB 2MQCA 1VACA 2YUWA 2R0WL 2XWJB 3O6ML 4JHWH 1NBQA 1KJ3L 2IBZX 4OCMC 3O6FA 2Y5TB 2CMRL 1SYSB 3PWNB 4XP6L 5F1SA 1Q1JL 3ALPA 1FQ9C 4ZPTA 5CD3A 1DQDL 1I7TB 4IRJB 1WBXA 4XZUB 3B5TA 2CD