3ZE2E

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 42
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2E02
5IB5B 3LKSB 4L8BA 3U6RA 1LP9F 3PWPD 4Y1AE 2ESVD 4JRXA 3MRPB 2FD6H 3EO1A 1BJMA 3QISA 3KLHD 1OAQH 2KDGA 3AXLB 4LDLB 2W91A 2X05A 4WI2A 2F5AL 1YJDC 4KI5D 1FFPA 3DLQR 2LTQB 2A83B 2DLFL 1Q9OB 1FORH 3SOBH 5B8CA 1SJHB 1CDJA 1DQLH 4DAGL 3PGCB 1IGTB 3I2CL 1V3KA 1JWMA 2XTJC 2YMXH 3UYOD 3O3EA 3LB6C 2IPUG 4MA7H 2C1PA 4EBQL 1IKNA 5MEPB 5EBLB 1KELL 4XPGH 4OBRA 1RZFL 3P0VH 3EDFA 2XTJD 4YWGL 4M8QA 4MJ5A 4ODTH 2E7BA 1DE4A 1Q0YL 3LB6D 3O0RL 1OSZA 1WC7B 3EOTH 4LHUA 1RIHL 2H6PA 3RI5F 3PDGA 3BAEL 1DEEA 3ILPA 1MUJA 3H0TB 4Z7QE 1FNGB 4YHMH 5EUOF 1YN7B 3JXAA 4RFEB 4D9QE 4R4FH 2OTWA 1FAIL 3KLSA 4YBHA 5TDPA 1K9TA 4NO5B 4LPVA 1XT5A 1BFSA 2GAZA 4HBCH 4BZ2L 3PIQB 4APQA 4JFOB 1QSFE 3ZYIA 2C3VA 1BF8A 4K3DH 5JPNB 2E27H 3ZHDA 2R4SL 1VKXB 1DQMH 2HJKA 4YE4H 1V05A 4TRPH 4PJ8A 4G9FE 2G75A 1F5WA 4GRMA 2FR4A 3HZKA 1NSNL 3CGTA 1QNZL 3R8BB 1QD0A 1KCRH 3I3EA 3T2NH 3A0OA 3VFSA 2YUXA 3P73A 2XWBA 5HI4D 5IF0B 1F11B 1FVDB 3HG1E 4LPXA 5CHNB 4YDIH 15C8L 3JTTB 1XF1A 4LHQB 2UUDK 4PUBH 1ZT4A 3U1SH 3INUH 4P3DB 3UO1L 2JJTC 3HPLB 2H26A 4FZEH 2WBJB 3VA6A 1MAJA 2DLGA 4GBXB 1FLRL 3VCLB 1IKFL 3OGOE 3OZ9H 1PYWB 3QA3B 3ROOA 5IEHA 3S9DB 2HRPL 1P84J 3DECA 4GRLA 3WYRA 2ITCA 3HPJB 4HIEB 2Y5TA 3FN0H 3GSQB 1S9VA 2X4QB 2YHGA 4MXVF 4LARL 4P5TA 1UB5B 3IF1B 5CJQL 4QNPE 3ULUH 3MJ7B 1CD0A 3MRQA 4OZHF 3CC5B 4NHUA 4MMZC 3W0WB 2EXWC 4N0FA 3NPZB 2DQTL 5D8JL 5I8OL 2HVKA 3TH4T 3RKPA 1KACB 1T22B 4XVTL 4KKCC 5KSAB 5JW5B 4FQIH 5TFSH 5IBLC 4IHOA 4PB0H 5CZKA 3JZ7A 2EXWD 4HUWA 4QRSB 1IGFL 2QV2A 1IEAB 4H1LB 1DR9A 4A2MA 3BKJH 2CIIB 1N6QL 4RX4D 3NA9L 4CW1B 2ARJB 3QRGH 4KKCD 4LKCB 1FZOA 4ZUTA 2APBA 5IBLD 2QKIB 3KPPB 1D5IL 4WEMB 1GL4B 2RFXB 5HHQA 3C5JA 1DQJB 4JFHE 4HDIA 3FT2B 1HQ4B 2B8OT 3SN6N 3CXDL 2CSPA 4M7JL 1JPSH 4OUUA 4AEFA 5HYJE 3QDJB 3VWKC 5IBTH 3GIVB 5FYLD 3WXWL 1R3IL 3HUJB 2RGSA 4ZUUB 3ARYA 1ZLUK 4X6EB 2V7HA 5E56A 5CKAA 2HTLD 4YXLH 2GTZB 2VAJA 3VWKD 4OGXL 4OFIA 4TVPE 4JG0L 2YPLB 5EH1A 2GEEA 1A0QL 4JEGB 1G9NC 2DQDL 2DN7A 2RIKA 3T4AA 4JFYB 4J8RA 1PD6A 5EU3A 4PG2A 2G9HB 1FIEA 3F7YB 1QBLL 3RWEB 1R5VA 2Q6WB 5F3HA 1F3RB 3AREA 2FZ3B 1IC4L 3FFDA 5CAYB 2P5WD 3MRKA 5CKGA 1MCWW 4ZXBB 4YR6A 4E9LA 1DBJH 2JB5H 5EO1A 1MHEB 1TZHA 1KB9J 2P46B 4ZYKB 2NY1C 2XA8H 2FWOB 1XZ0A 4UDUB 2ZPKH 3L5WA 4MHHG 3I6LD 4XVSL 1L6XA 1M7DB 5DJ8A 5KANI 4RFOH 43C9A 3C6SB 3V0WH 3JWOL 5I76A 4KJWC 4HKJB 4M02A 5L7XH 1FZKB 1FNFA 1IC1A 5L2KA 2ATPB 3FFCA 5ISZD 4R7NB 2VLRD 3I6KB 4L8SA 4KI5F 5DHVB 4AG4L 1EFQA 4WTWA 3W39B 3SCMD 5E1AA 5MENE 2YK1H 1VEOA 4JQXA 3V5HB 3UYRL 1ZWIA 3HI6H 3BMWA 2X4UB 1J0ZA 3ARDC 3KPSB 4XPAL 5CJ8A 1I3RA 4CNIA 1HK6A 1FG2B 4NQXA 4YK4B 1FFQA 4YHKH 3KPQA 4JY4B 3GM8A 5CILH 3DMMC 5JIHA 1IL1B 3JWDL 5I2IA 2F53B 2WAHA 3ARDD 5GS0H 5KS9F 5F1KC 4XBGA 3D18A 1VACA 3HC3L 1XFPA 4KGLA 2D7TH 3DMMD 5D6DC 3X3GH 5EOCL 1YNLL 3ARBA 3D0LB 3UTSB 3IJYA 4XMPH 2AQ1A 3WNKA 2VDQH 2UWEA 3UTQB 1R3KA 3BVNA 4EQ2A 1WISA 4XXCC 4JO2H 4G5ZL 3BIKA 4M48H 3ILQC 4UDTB 2DQHL 1UH4A 4F7TB 5KG9A 4JN2A 4QTHB 4WV1C 1Y0LB 1GGIL 2AVGA 1LE9B 4L4TD 5D5ME 4DQOH 2J3SA 4JRYB 3ILQD 2QADB 4KQ3H 5GS1A 4Y2DB 1YNTB 4JHAH 2CLRB 2DDQL 1CDBA 1XF5A 2VC2L 3ZL4H 4XPFH 1VB9A 1XGTA 3G5ZB 1LO4H 4HMCA 3PV6A 5KOMC 2FO4B 2HT4C 1O7VA 3MV7E 1F3DH 3QIUA 4ZFFA 3GMRA 3AS2A 3HI1B 3BSZH 5T1LA 4YBLC 4QOKA 2ADFL 2JCCE 4M5YH 4M1DH 3S97C 2L7UA 3KLDA 2VSDA 3BPNB 4O51B 2E7LC 2XN9E 5ACMA 1SJEB 2HT4D 4KVNL 2CGRL 3MOAL 5GSVB 1LO0H 4H0IA 3OAZH 5I1DA 1IGML 4Y1AB 3OXRA 4KQ4L 4YH6A 3VI3E 4JDVB 4HPYL 3LKSA 3FAXA 1AGBB 1NUFA 4RQQA 4DN4H 1T0MA 2MQ0A 2HH0H 2VL5A 1QYGL 3NFSL 4HC1A 5C07E 1UWEH 4F9PC 3GMLA 1TVHB 3VMNA 5JOEA 1WBXB 1FIGH 4J4PA 1G0XA 3PGCA 5FGSA 3W9DB 4NRYB 4KFZC 1XR8B 2HJLA 3B4NA 1AHWA 3GBNL 1HKLH 2CQVA 2F58H 4YGAB 3MLVH 2YUVA 1IC5L 4Z76B 2WINB 2VQ1A 3UC0L 2DD8L 1DVFC 2PO6D 1AE6L 3U7AA 1A9BA 3V5DB 1FZMA 2X09A 3O3BB 2GY5A 5HGBB 3VFRA 1AXTL 3SE8H 1JGEB 2OL3A 2RR3A 5J1SC 4ZS7H 2IGFL 1WC7A 1WZMA 2VLKA 5DVNA 2Z92B 2MPAH 5JMOC 3TC9A 3MUGA 3Q6FA 3O8XB 4RFEA 1J0YA 4OD3L 1DBML 1QSFB 4C56D 4RISH 1TMCB 4OM0L 4MLSA 5EBMB 1CIDA 1C7TA 4JFDE 3PIQA 4MWFB 5CEZH 1NCWH 2F54D 4JFOA 1WIUA 3P4OB 4G9FB 4NYLB 3FRUB 4WFHD 1ZHNA 5EIQA 1UENA 1LO3L 4NNPL 5C0DA 3PGFH 3MXVH 2P24A 4BSWB 5CJBA 4HS3A 3HAEA 5FCUH 5GGQL 3GO1H 1EEYB 1NGZB 3JTSA 3TBSA 1KCSH 2FIRT 3HG1B 2NY2C 1UM6H 1S7QB 1FO0L 3AVEA 4OFYD 3GHEH 2VDKH 4NWTH 4ODWA 1RZKL 1G6RA 3L5IA 5EIVA 4JY6B 3EW3B 5DJXA 4I3SL 4WUUD 2IH3B 3MC0A 3DI2B 1KJ3H 3OXSB 3IDGB 1J88A 5T3XL 4U1KA 2NY2D 4YHLH 3I6GA 4KXZI 5D7SL 1MQKH 2WNGA 3ARGB 2G60L 1NCNA 4XRCB 3IJSA 3SKUD 5B3JE 2F9BT 5TE6L 4FNLL 3QO0B 4FS0A 5FDWB 1RPQA 1Q72L 1E28B 3FAWA 5GGTL 3LRSB 1O5DT 2PCPA 1KTLA 2KUTA 3BWUC 1Y6MR 4K55A 1IM9B 1MNUL 1OP3K 1KN2L 2AEPL 3OKMA 4K7PH 2Q8BH 3SDXF 2NX5A 1AXSB 3ES6B 1MHHB 1ZANL 3CVHA 3PQYE 3CSYA 3ZTNL 4OV5A 4WUKL 3T4YA 2VIRA 1T22A 2EC8A 2XRAH 4PJXA 1WBYB 1MRFL 4KUZL 2DM3A 4GG6A 3TNMB 4PRDA 4GQ9L 3VXPB 1NAMH 2BXYA 2XFXA 1B0WA 4KAQH 4PGEB 2CIIA 1T3FB 1RHHA 2D2OA 1TCMA 4LCUA 5ALCL 3BP7B 3O2VL 2JJSA 4HX1B 5EBGA 1EHXA 1VFBA 4ISVA 5JQ6L 4GKNA 4GKZA 3QRFM 5HYJB 1DQTA 2XQBL 2VDPL 3FT2A 4YHNA 3ZKXB 4PJIE 3TBWB 4KRMB 4ODXB 4HIJB 4EBQH 2BVOB 2FL5A 4RGOL 1KELH 2A2QT 4X6FA 3CD4A 4UAOC 1RZFH 5LWYL 4LCCA 2BMKB 1U58A 4LMQI 2BVYA 5KVDL 1G7IB 3EYVA 1KGCD 1RIHH 1QLEL 3ESVF 3L95A 4PRID 3O4OC 2GY7B 3WCYA 1JZ8A 2FGZA 4MAYC 3JVGC 2BHUA 2YPVL 2CKBH 4P9HH 1R0AL 4NQVB 2G9HA 4FQHA 3WNOA 4WNQB 4BZ2H 1WVZA 5F1SA 5I1EH 4MAYD 1SEQL 5C0JA 4WU7B 2R4SH 2C3GA 2YD1A 3B9KC 4NO2A 4ZXBA 1JTOA 3FT3B 3FT4B 3VXMA 1MHEA 3GUTB 5F72S 3IGAB 4HUUB 1ZV5A 1CDUA 4CDGC 5IW6B 1QNZH 2BJML 3IFOB 3B9KD 2H2PC 5EO9B 5E2WH 1QP1A 4NPYA 5C92A 4TSAL 4PJCF 1M6OB 1QSED 4AIZB 5GPRA 3EYSL 3K3QA 5MENB 2OXGA 3VXSD 4FQ1L 4F7CA 15C8H 1HXMB 2J8HA 5HI3C 1I1AA 3RFZC 4P5MB 2H2PD 3QCVL 5E5MB 3UO1H 3O81A 5FHBH 1T2QH 1ZVHA 6CGTA 1FLRH 4H20L 2X4UA 3TJEL 4NQCE 4F15C 4OGZA 2B7DT 4NCDA 3T0EB 4IDLA 5HI3D 3S36L 4PJGE 4PBXA 2NXYB 1K2DB 1DANT 3LKQB 3IU3B 3Q48A 2HVJA 4Y4FA 3TA3B 4KHTL 2DQIL 3OGCA 1CICC 4LLDB 4ELMA 3GBML 1HNFA 1BOYA 3CSPA 2JELH 3RKDD 1JWSB 3NCJL 1RIUL 1YPZA 2V5MA 3UTSA 3K0WA 1CICD 5CEXB 1QO3B 5IBUG 2BVQA 3HC0B 3B3IB 4RZCA 5IB1A 4U6VL 3S35H 3SGKC 1FJ1A 2P5EA 5I0DA 3FQNA 5D5MB 1IGFH 4MX7B 2Q20A 2ICWI 1LO5B 1KB5H 2E5EA 1ERNA 5H37G 1YEGL 1N6QH 1A4KB 1IARB 3WD5H 1MJ7L 5TDNB 1FC1A 3CX2A 2AK4E 4YGVB 4JRYA 3F65A 1X6NA 1JHTB 3MV7B 3LKOB 4RFNC 3MRFB 2NXZB 2RQ8A 4X6DE 4HKXB 4IMKA 4XBPB 3NIFF 5E2TL 5ICZB 3CXDH 4WDIB 2XN9B 3HI1A 4M7JH 1F3JB 1XGQB 3HA0A 5D7KD 2Y07L 1XIWB 3ULVF 4JZOA 4XP5H 4O51A 4P2QA 5C7XL 5F7DB 2AI0L 1BOGB 5TJWK 1ZLVK 1G7JB 2H32A 5D1XA 2OSLB 3NCCB 5GSVA 3O6LL 5L0QB 3U0WH 4CJ1A 4JFZL 1JYWA 1J0IA 4P4KA 3DI3B 3P30L 4DOHE 2ADJA 1R6VA 3NMEA 4OGXH 1P4LA 1F58H 1W72A 2J8UF 4JDVA 1A0QH 2ICEB 4DUWA 5C07B 4J3TA 5DJYA 1FFNA 3VGAB 4CVUA 5C3TA 4L4VE 1HYRC 1RJYA 3RX5A 3LQZA 3MV01 1AO7A 1MWAL 4OLVH 1EERB 5D70L 1QBLH 4HEME 1FL3B 1PQZB 4U6XB 3QFJE 1TTGA 3ZYOA 1TVHA 1R24A 1I1CA 1IC4H 4KDWA 4K94C 4K23L 4BQ8A 2NY7L 3BUTA 3FB6B 1TITA 4GXUM 4O2FA 5F7FA 4UU9B 1JZ2A 4KKNA 3G6JA 3PABB 1CBVL 3JWOH 1JGLL 1IT9H 4WCYL 3OB0K 3EGSA 1N59B 2DLTA 4JKPL 4CVWA 1KCUL 3ZDXE 3CDCA 5IMOA 5E99H 1U93B 3SEPA 1UXSA 1KCVL 1QPXA 5BRZD 3K8LA 3T0VA 5FA4B 2YA2A 3RIAK 2Z92A 4FQLH 2RJMA 5CIPH 4AG4H 3QXAA 4NN6B 3CH1B 3UYRH 4JFDB 4XPAH 1FV1A 2DS4A 4HWBH 3QEUA 4FFYL 4JDTH 3TLRA 2FLRT 3HZVA 1QFWL 5K9OA 2FEDC 2IQ9L 4M7ZC 2QL1A 3QXDB 4YPJA 2BERA 3KPOB 3JWDH 3RWHA 1AR2A 4R7DB 2NW3A 1T04B 1WWAX 1U3HB 4M6MH 5BCAA 3BN9D 3L9RA 3BH8B 5JW4M 1JYVA 5D7JC 2VRAA 4N9OB 1QQDA 1MCDA 1QFWI 4XMLL 2A9NL 4Z7NE 4BSWA 2G5BA 1GJIA 5ICYB 4PGCB 5FOBB 5D7JD 1IAIM 1A3RL 1OOAA 1BJ1H 1AKJA 1AGDB 2DQHH 3TVMA 1UB6A 1TJHL 4WRLA 2YS4A 2V9QA 1CXFA 2GYSA 4I3GA 3NPSB 3S88L 1GGIH 1NC2B 1UWGL 3BPCA 3ARGA 5HHXL 2VC2H 3UTTD 3TPUB 3EYOA 1OP9A 3QSKB 1HHKB 4FN0A 3QEHA 2V2XB 4P57B 1Z3GL 4AM0B 4K7PX 1LK3L 3H9YA 3O4LA 5DJ2B 4PR5A 3V79C 1OGTB 4KPHH 3EYUH 5FV2A 3K74B 3ARFD 1P84K 4KVNH 3V6BR 1JNNL 4KRNA 4JKWA 4U1NA 1T21B 5TF1L 1CXKA 5GS0C 2XPGA 3TBYA 1IGMH 5JR1H 1FBIL 4KQ4H 4KJPC 3VFPA 1J8HD 5A40E 2AERT 1AQKL 3TYGH 2PYED 1XGRB 5IBUB 3VXPA 1QYGH 1SM3H 3EDDA 1A7QH 3NFSH 1MFBH 3EKCA 4ZTPL 1HE7A 5T3ZH 1T3FA 3NGBB 4M4RA 1NGYA 1NMCC 1T4KB 3K4ZA 4D9RE 1QLRB 1IAIH 1FVCB 1UWXH 3GK8L 2FECL 2VITB 5HYJA 4ZO9A 2D9QB 4W81A 3GBNH 1B4JL 2ATKB 3JV4B 3MCLL 1HZHL 1IC5H 3TBWA 1YY9D 2WWMC 4HIJA 1X4YA 3TWCH 3C8KA 5BXFB 1JI1A 2FECI 1KNOB 4MDIA 3P9LA 4F33B 1AXTH 4EDXA 3VGDA 2VDOL 1NAKH 2BMKA 3ARTA 1BBDH 1ZKAA 2IGFH 3NZ8B 1NL0H 2WWMD 4PREB 4WJ5B 3EIFA 3QCUL 3ZT6A 3PWPA 1S3KH 3DGGA 3QJHB 3FQXB 1NDMB 2BVUA 4QRUB 4RNRB 1C5CL 2FYYB 2EDBA 4H88L 3O2DA 2ZNXA 1TQCC 4OM0H 3HE6A 5FA3B 3O3AA 4J23A 2NY6C 2R23A 5HDBE 3RBSA 4S1DC 3ULUE 5SX4I 1KXTB 1DANU 1MLCB 1C1EL 2AXJA 5I1IL 1IJ9A 4MLIA 3D69B 5ICXA 1LO3H 5I9QB 4NNPH 4OCYL 4PGDB 4XT1C 2V17H 2FSEA 1DDHB 3ZE0F 5HVFB 3K2UH 5GGQH 2D7QA 1CGSL 4XGZA 2G5RA 4AH2B 5E2UH 3ULVH 4JFQB 3BP6A 1RZKH 1N2RA 2YA0A 1VFMA 4ODUA 2A38A 3QCTL 4KV5F 1KB9K 3FCTB 2X4RB 4R3SA 1A7NL 1NBVH 4I3SH 3WDHA 3NCYP 3QQ4A 5DA4A 3RVTC 4UBDD 4XC1H 4KKLC 5T3XH 3MUY1 4HHAB 4NQCB 5E5MA 5EU4B 2XKSA 4G6AC 4PJGB 5D7SH 4ZS6C 2G60H 4FTVE 1FL6A 4JQIL 4U1SB 1FFRA 1SEBB 3TO4C 1P69B 4NCC1 1F6AB 3RVTD 3S5LA 1QLFB 4KKLD 4AL8L 5C3LD 3DIFA 3NACL 1NLDL 3T0EA 5J6HA 1G7PB 2G2RA 2VDLL 3QUYC 4G6AD 3QAZB 4ZS6D 4ZPTB 5EZJB 3SO3C 3QBTB 3TO4D 5E08L 4PJEE 1MNUH 3V2AR 1KN2H 3WHE1 3ALPA 4N9GB 3QNZA 3S35X 5T1MB 1JWSA 5BS0A 2JIXB 3QUYD 5D9SA 4XWGL 5GGRY 3MCKB 1J0KA 4L8CA 1F6FB 4Z5RB 4LHJB 4KDVA 3HC0A 5JHDE 3DBXB 1S5HB 4XCNB 3BPLB 3ROLB 3MV9D 3OKLA 5D4QA 1HOCA 3O2WL 4KUZH 2C4FT 3MX0A 1BGXL 4LVEA 3HNTH 1G6VK 4HWZB 1A4KA 4X6DB 4X83A 1IBGH 5ALCH 1JHTA 2BOCA 1H5BC 2JJTA 3VFMB 4PJDE 3UTPD 4NUJA 3ULSB 2QQKL 1U8OB 3FO0H 5DC9B 2LU3A 2VDPH 5F97E 1RJLB 4DGVL 5I1AA 5F3BB 4NN5B 1A8JH 4RGOH 1H3XA 3C09B 5L9DL 1XIWA 2R0WH 1S7TB 3MLPA 4DOHB 3IDJB 2IMNA 3B9EA 4CJ0A 5KVDH 2VDNH 3LN5B 1AP2A 5A43C 4RMUA 4YQXL 4NC0B 4L4VB 4HK3N 4F9LC 5JA9A 4G8IA 2DAVA 2FGWH 4HIHB 5EPMA 3QFJB 2IPKB 1R0AH 2R2BB 5E6IB 4X7SL 2H3NB 3HE7B 2GT9A 4U7SA 5KSUA 1D6VL 1FL3A 1CVRA 3BWAB 4BSVB 3QWOB 2ZCHH 4YFEA 4ZUSA 4U7MA 3GSNL 3G6DH 4PP2A 1JGVL 3P4NB 2O61A 3N50A 2DLHA 2A74A 5CWSA 2BJMH 2A73A 4XXDA 1N59A 4MSWB 3H8NA 3BX7C 1HCVA 4TSAH 3NIDF 5FB8B 2HN7A 1URLA 5FGBC 4M61B 3BKCH 1AI1L 5EUOE 2XKNB 2P7TA 3AU1B 32C2A 3IETB 1HSAB 5EZOL 3D39D 4F37F 4I9WE 2GHWB 4HFUL 2PYFA 2VOTA 4HC1L 3T65B 2FB4H 3RVUC 1VGEL 4KVCH 4IRJC 5D71H 3S36H 3BISA 3HB3C 4PJ5E 1FGVL 3DHJA 4KDTC 4P23B 3DRQB 2VWEC 5IHUL 5IGXH 1MFNA 3QQ3B 2HJFA 4Y16C 3UDWA 4KHTH 4LIQL 1T04A 2MWCA 2X40A 5B21A 5IFAH 4IRJD 3GBMH 1WITA 3TM6A 4UQ3B 1CFQA 4LLYB 1M05B 2YEZA 3C5ZC 4N5EC 3E0GA 1ZLWH 3NCJH 5ID0A 4NZUH 4Y16D 3AM8C 2AXFB 4LEXL 5DC4B 4DGIH 4IOSD 2GCYA 4WTZA 1SJVA 5FYKE 3WL9B 4Y4KB 1CYGA 4N5ED 4U6VH 3KPMB 2VLRA 2WZPD 1T0NB 3L3GA 5DQJB 3VI4F 3OHXB 5D1QB 4KRLB 1DLFL 3QEQD 3GJFK 4OCXL 4XPTH 3A6OA 4M6AA 4Y4HD 3KYKL 1MREL 4B7IA 1BFTA 4P5KB 3FQUB 4GW5B 4NKMA 2EKJA 4P2RD 2EYTA 1OGAA 5CD3A 1R3JB 5CSZB 2CK2A 5M94B 3VXTA 4MXVE 5HVGB 3BEVB 5HHVH 2V2XA 3C60C 4JM2F 2AJ3B 3S4SG 4PJBE 1NC4A 1Z0MA 4OZHE 3MRIB 3MLYH 2NY3D 2W38A 3FB5A 4JO1L 5DUBA 3MV8E 3PWVB 3C60D 4RMVA 5E8EA 2CDFB 2VQTA 2BSTB 1ZLWK 2NZ9C 5I19L 3FOLB 1D5MB 3RJQB 3O9WA 1KPVA 4TUOB 5D6DA 3NA4A 2AV1B 5I71B 5EOCJ 2F15A 4LU5H 4QXGL 1A1OB 5CP3A 4Z6AT 1N26A 3F58L 3KYMA 1KLFA 4EI5B 4TOYH 3WLBB 1A3LL 2NZ9D 5JQHC 4XXCA 1WFNA 3I02A 2V7NA 5D70H 4ZUWB 3IDYC 3CZFB 1KT2B 4HUMB 3CXHJ 2ARJQ 4LKXA 4WW2C 2ZP0T 1A4JA 1JIBA 2EIZB 4WV1A 3L7FB 1DBBH 4K23H 2W92A 4KK5D 2NY7H 4KK6C 2AEIT 4JHWH 1S7UB 3PE9A 3VJ6B 1QFUL 4DCQB 1O7SA 5EORL 2R1YB 4PJ7A 5IHBA 2VN7A 1G0DA 3EYFB 4KK6D 2I60L 3BDYH 1KNOA 4HCRL 1NFIB 4GW4A 4L29B 4PRPE 2WM0A 4H8WL 3SE4A 5DZLA 3O6FB 5IMKA 3QR2A 1A9EA 4ZPVB 3H7BB 3FQXA 3DUUA 4YIQA 4YHIB 1NDMA 1GHFH 3OJVC 3DX7B 5HGHB 4FFYH 4X6BB 3LD8C 4KMTH 3WEXB 3QG6A 2AJZA 1KIPA 4BM7A 2IQ9H 3R1GH 3FMGH 4WGVB 1MCSA 3EZJB 4S1SH 3LEVH 1LEGB 1MLCA 5DD3H 3D69A 4WI4A 4P48A 4F9PA 4HQQH 2N56A 5TE7H 4PGDA 4D0CA 5CFHA 4QGTA 1OARH 1KIQB 2CKNA 4OZGE 4BQ9A 2EDFA 1E6OL 2JJWA 3VFOB 3MODL 1U8NB 1I8MB 3MR9A 4KI5E 5BZWA 3EFFA 1U9KA 5LJYH 5MEOA 3JWOC 3SKMA 1XF2A 1DVFA 1FSKB 1LDPL 4FTVB 5F7NC 3RL2A 4CUCA 3HNSH 4XNQB 1ORSB 2C4FU 1UWGH 1UC6A 4G8FB 2X1PA 5HHXH 4XH2B 2FLBT 2F54A 1IRAY 5DVOA 5AD0B 1UCBH 5KS9E 4ODHL 1AGFB 2XTJE 4PJEB 5E94A 3L3HB 3V4VL 4PJFF 5B39A 3O6ML 4XHQA 3ZKSD 1Z9MA 1A6TA 2F19L 2EEBA 4XC3L 5D7LD 3N1FC 5T1MA 5JHDB 3JWDC 1JNNH 4OFYA 2EEDA 1CR9L 1YMHA 3PV7A 2IBGA 1LNUB 2GJJA 1S5HA 5T1DL 2IQAA 3D2UB 3GSWB 2GSIB 5HYQA 2EH7H 2PTTA 2XZCL 4KZEL 4ZNEE 1G7QA 4BKLA 3NN8A 5E1HB 1D7FA 5SWZA 2IANE 1A14H 1B4RA 3QHFL 4PJDB 3B83A 1JNLL 3RY6A 1QA9B 5C0CD 1KJMA 3RX8A 3TN0D 1CS6A 1C08A 2APXA 2EYSB 4U1MB 1ONQB 3OMZA 4V1DE 1N0LA 5DT1H 1B4JH 2YUWA 1CTOA 3MCLH 3B6SB 1RJLA 1S7XB 4GAJL 3RHWF 3SQOH 4G9DB 3GSXA 3ZZ1A 1LVEA 5IK3A 4OSUL 4OJFH 1LP9B 3ET9F 1DQDL 3D48R 1GAFL 3BP4B 5HGAA 2VDOH 3S4SB 4YHYC 5HYSG 1W0WA 2CDEA 4Z0XB 3QCUH 1I7ZA 2KKQA 1UT9A 4OZFA 3I9GL 1A5FL 1CGTA 1C5CH 4F57L 2P49B 3T0AA 1GOFA 4NBXB 1OM3L 1D5BA 2R0LL 4NGHH 1ITCA 1AD9B 1BFVL 4F37K 1KPUA 3IDIA 3BWAA 1CL7H 5CGYD 5D2LA 4NQDD 4X99A 5EA0H 5SX5K 3RGVC 4Q58C 2HWZH 5MI0B 3ARSA 5EZLB 3P4NA 4JGUA 3RNQA 4AMKL 1DQQA 1CGSH 2NYYD 4Z95L 4UV4L 5KTEH 1OWWA 2VXUL 4MSWA 5KVGH 5EUOB 2NY5H 3V7MA 5LAXA 1W72L 5BOZG 3G5XB 4JDZB 2W65A 5DD6B 2YRLA 1OT2A 5ADOL 5DD1L 3GSRB 4NC1C 3RUGE 4PJ5B 3VRJB 1WT5C 3CJJA 2ICCA 2A0LC 3NACH 1NLDH 1DUYB 3MRNB 5KZCD 3V6ZB 4PGZA 1AD0B 5FYLE 3BDXA 5EIIA 1MJUL 2VDLH 4HZAA 5GJSL 3QQ3A 5IJVB 4DK6A 1ADQL 1AFVH 4WI7A 5E08H 5GJTL 2A0LD 2BC4B 3NFPA 1X6LA 2W9DH 4NOFA 4BZ1H 3TZVC 3IFNH 5DVMA 3NTCH 1PKQA 2R0ZL 4MNQD 4XWGH 2GUOA 5DJZA 1TPXB 3O45B 3QT2A 3T3MF 3MPCA 3ABZA 3WL9A 4Y4KA 5EC1A 5INCB 3KPMA 4BELD 3QH3B 3VXSA 3TZVD 2P5WE 4Z8FL 5GHWL 5I16B 1C16A 1ZVYA 4NM4L 3UTZB 1WBZA 2IAMC 3ULVC 2RHEA 1RZKC 3AROA 4EOWL 5CUSL 3I6LE 1PLGH 4I2XA 4GW5A 1I85C 3RPIA 5BV7L 3SDCB 1BWMA 1SMAA 2W0LA 1R3JA 4IRSC 4OZHB 5CSZA 2IAMD 2QQKH 5ISZE 4JANB 5DJ6B 1HYSC 3HZYA 4JN1L 1EAPB 2CK0L 1X5YA 3CSGA 5I66B 3MV8B 3SKNB 5ILTH 3P4MB 1FNSL 3EOAB 1F00I 2VZ1A 5T3XD 5L9DH 4IRSD 1S9WA 4ONFH 4TTGA 4LLUB 3MRDA 2QHLA 2Z35B 2DKUA 4NJAL 5T1KB 4CN6A 2QQLL 1HYSD 4JFEE 3RNKA 1GZQB 3SBWC 4RRPG 4TSCL 2BSTA 5F96H 2NNAB 1DFBH 1D5MA 1LEIA 1UCTA 1MF2L 5D72L 1QRND 5DURB 1T7VA 3QQ9C 1ACZA 3GGWA 3LEYL 3WS6A 1HQRA 2ICWJ 1QBML 1OD9A 4M3JA 3ZT7A 2C3XA 1HN1A 2W60B 3W11D 1WF5A 1ETZA 1OL0A 3CUPB 5GSRB 3QQ9D 1KT2A 4PLNC 4KTEL 1S5IL 3DRTA 1A6WL 3K4AA 1IAMA 1FC2D 2EIZA 1D5XA 1I4FA 3L7FA 3B2VL 5J1TC 4UIMB 5IESH 3GSNH 3C8DA 3VJ6A 4JFPB 4NN7B 5DGQA 4I0CC 4QYOB 1K8DB 5T5FH 4PRPB 1WGOA 5DLMH 5GRJH 1VFUA 3DVNA 4L4TE 4NC2B 1KUMA 3EOYG 5FK9B 4WHYG 3H3PL 1AI1H 2NR6C 5KAQG 4LCYA 4RGNC 1GIGL 4Z7WA 3BXNB 5EZOH 4LNRB 4OCWH 5D93C 4ZPVA 1JV5B 3MJ9L 4HFUH 3WIFB 4ZUVB 5DTFB 5AWNL 2NR6D 4JO3L 5HYSB 2LU4A 3MGTB 2APTA 4RGND 2CD0A 1HEZB 3SQBA 4PD4J 1ODAA 1MHCB 4IJ3C 2ZCLL 3JUYA 1D3CA 3SJVD 1B2WL 1U91B 5IB4B 3K7UA 4JFXB 2VXVL 4H26B 5FO9A 4QCIB 1X44A 4G6MH 4OZGB 1XCQB 2FBJH 1Y6NR 5IKCB 2AKRB 2R0KL 5D6CB 4WFEE 3SPVB 3P9MB 2OBGA 5A2IH 1DTUA 1KIQA 5L2JA 4TVPL 5JDJA 3OL2A 4HUNB 1PSKH 3KS0J 3VFOA 4OKVB 3SDDB 1I8MA 4U6YB 5DDHB 4MQSB 3ARPA 5C2BL 3MYZA 4ERSL 1DLFH 1ZHBA 1XEDA 1CLCA 2EEAA 5DK2A 4OCXH 3OX8B 1PAMA 4X9HA 2DWEB 4GW1B 2VR9A 4G8FA 2V5SA 2P1YA 5KS9B 4AENA 2XTJB 3DV6A 1JHKH 3IRZA 1FP5A 4QKXB 2CIKA 2FJHA 2CXKA 5JMRA 1AGFA 1RJCA 4GLRH 2OJZL 3NIGF 3DUSA 4NO0D 1GSMA 3CVIL 1U95A 2WBKA 2D7OA 3MXWL 1F4HA 4NRXA 5CEYB 1H3PL 4JO1H 2PW1A 4URTB 4DUXA 4UIKL 3GMOB 5J4MA 2AP2A 4N5UA 4C56E 3MFGB 5D7JA 1BHGA 1T66D 4JG1L 3G04A 3RHWK 3L3KB 1VA9A 4F7MB 3GSWA 3IJHB 4JVPA 4WFHE 4ZOAA 3KVQA 2IANB 5ANMB 4CMHC 4EN3A 3E3QC 4GH7B 1KJVA 3V4UL 3VXUA 5CSGA 4XP4H 2N7AA 3QJFB 3WFDH 1U8HB 4V1DB 2XT1B 3MUZ1 3NIFE 1P7QA 1N3NB 1UJ3B 4IOIA 3FO9B 2CO6B 5CP7A 4X6CF 4WI8A 4WUUE 5EORH 5HGDA 4G9DA 1WAAF 2JE8A 1LEKB 1LP9A 3RY4A 1CDIA 2I60H 3U30B 5E9DA 4HCRH 4ZAKC 4AIOA 3S4SA 3C2AL 5FUZH 4PRHD 1J8HA 2B0SH 1QVOB 3ZKMC 4HT1H 2AW2A 1DUZA 2E6PA 4H1LH 2XZZA 2PYEA 3QDGD 4ZAKD 1GZPA 4XNYL 3QIWC 1HXYB 4LK4A 4BQBA 3ZKMD 2VLLB 5IM7A 4X5WA 3DX9B 1PVHA 4QRRB 3MOQA 3ZE2E 3Q6GL 2DQEL 1JPFA 3QIWD 2BY1A 1REIA 1I3GL 3U46B 4ELKA 3DSNA 1CGWA 4NQUA 2UYLB 4G42B 2YN3A 3SKJL 2FIKB 3LEXA 1OT1A 1N5YH 2CPCA 1KB5B 3MFFA 3WSQL 5FKAB 3PDOA 5EUOA 1U8KA 5LXGL 4IMLB 3BQUC 4UMGA 3DWTA 4HAFA 3TNNB 4QRPD 4LLVB 4JQVC 3RUGB 2ZUQB 3T77B 4JDZA 3J7HA 4BFIB 2Q86B 1FN4B 1OB1A 1V3JA 4ESKA 3BQUD 2A9MH 5HYFA 4DUVA 3VRJA 3DO3A 3MSPA 1FAKT 4LFHG 1LD9A 3DYOA 2DQJL 5IHLB 1K4CA 3V6ZA 1AD0A 1Y18A 5HYIA 4ODHH 1QR1A 4YHZL 4RAUA 1NANH 3OQ3B 4L3CB 1X5KA 3MA9H 5FUCC 1T03H 3MRGB 5T5NG 1EGJH 5I18L 1WUNT 4FQXC 1CDYA 4JRXD 1N64H 3DXAE 2F19H 4EI6B 1P53A 3AAZA 1H0DB 4XC3H 4FMKA 5CZXC 3V0VA 1J11A 1KENL 5FUOH 1PG7L 3X13A 2OX5A 1PW3A 3IDMA 5I8CB 3MRRB 1EFXA 2XOTA 1OAUL 5T1DH 5JORA 5CZXD 3W2DL 3QH3A 1IZJA 5DHVH 3THMH 4YEFA 1OCWL 3PNWA 3QPQC 4KZEH 3CK0L 3NCEB 5F9JB 4UTBL 1HCFX 4FZ8L 4NP4L 3UTZA 5AYQA 3SDAA 4YNYA 4LEOA 1I7TB 4HKBA 2EDNA 4EDWL 1JNLH 4NZJA 3QPQD 1HILB 3EOBB 3KWWB 3RWJA 5ISZB 4GSDL 1LE5B 5DJAA 1YYMH 4XMKL 1WICA 1QSEE 2V5TA 1R5WA 3SCMB 3LRHA 3HR5B 2OMNA 2MFNA 3QUMH 4R0LC 3FQRA 3EDJA 4JFEB 3BZEB 1V8HA 3DX8B 2VLJE 4X5XB 1A7OH 1GAFH 4NHCL 2JB6A 1RZ7H 4K3EL 4TTDD 4P46B 1WQVT 1T1WB 4MCZA 6FABL 1A02N 3MV9A 3I9GH 5GRVL 3VD9A 2MHAB 3PF2A 3T0DA 1ZTXH 5K9KB 1N0XH 4MQXC 2IPUK 4D9LH 4F57H 3DMMB 5DRNB 3H9SD 3FZUC 3WN5C 1A1MB 5D2NB 3ZT5A 4PRAA 2FX9L 3MJ6A 3CX5J 1K5NA 1BFVH 4MQXD 5LGHL 4LSDA 4Z78B 5ITBH 3S96B 3I50H 4HK0B 4ZOEA 4AY0A 3UJTL 3QUKB 4UIMA 4W4NA 1NFDE 4L4TB 5JOPD 3CXHK 1U8JB 2OCFD 3KPNA 4UV4H 4PGBB 1IGCL 2X4OA 5J1AA 1OF2B 5IQ7H 1J0HA 1CGXA 3ME0A 3N85L 4J3VA 4X4XB 3MMEB 2EIDA 4DKEL 1NCDH 1BREA 2O26U 3OR7B 4YXKL 5D7IE 1CD1A 5DMKB 4LNRA 4YDLC 4P5TD 1OWRM 5IR1A 1RMFL 2X4TA 2Q87A 2ITDA 5EU7C 1JMXA 3MJ8B 1U2HA 5D7KE 3QG7H 1UZ8A 5KW9H 1XR9A 4DVBA 4GG8B 2VMFA 2Y72A 5DWUL 4DZBA 4F9LA 1FLTX 4OB5L 3V6OE 1YUHA 4C57C 3RZCB 5IB4A 4FXGB 2IPTL 1ADQH 3ZE0E 1L9NA 2ZG3A 5IVXF 3VFTB 2IADB 3L6FA 2VDRL 5D6CA 1ZLSL 1OP5K 4TUJB 1I7UB 2BDNH 5J57B 2R0ZH 3LKPA 3PHOA 1HSBB 2C26A 2WSKA 1NAMA 1M1SA 5E00B 4ZFZA 4TSBH 1ND0A 5D5MF 3E6FB 1GRWA 4OKVA 1LHZA 3MBEC 3GB7B 3JWNC 8FABA 4Z8FH 4NZRL 3KXFB 4XPBL 1I1YA 4KTDH 2NY5C 1ZT7B 1FQ9C 5FGBA 2PO6B 5INDB 5FM4A 3L3JA 4B0MM 5CUSH 3MBED 2C1OA 4M6NH 2JCCF 3AC0A 2CJUH 5GGRA 4KY1L 3TIDA 4G43A 4MJIE 1NGPL 1R5IB 1SQ2N 1MFCL 3CDFA 4XI5C 3PL6B 4IRJA 4YHPB 5BRZE 1E0OB 2CK0H 5FM8A 5CMAA 4C56B 4KDTA 3Q3GB 2CKBA 4Y16A 1P4BH 4NJAH 4ZQKB 2NPLX 3IVKB 1CXIA 4XI5D 3QWQB 1YEKH 2QQLH 1KXQE 4TSCH 3D0VB 5HHMD 1UKTA 4I18B 3C5ZA 3G5VA 4Y19B 1WCQA 2VZOA 5D72H 2WWKO 3LN9A 1MHPH 5MP6L 4ETYA 1J87A 3LEYH 4P49A 1G7HB 5ANMA 3U4BL 1X5FA 1QBMH 3DVGA 5D96C 5DEFA 2VH5L 5SV4A 4OLWL 1K3ZA 1S8DB 4NQSB 2CO7B 2XWJB 4HUXA 5EUKB 3U7YH 4P2RA 1MH5A 5JO5B 4ZD3L 5AAMA 5E8DL 4QLRA 4C4KO 3FFCD 4WUUB 5AUMB 5M7QA 4U3HA 2QHRH 2IBZX 4F58H 3B2VH 3MLZL 3RWIB 1XGPB 5HDOA 1C12B 3BO8B 2ED7A 3MGOA 2MNUA 3OKKB 4HSQA 3MOBH 3VWJA 1J1XL 2Z4QA 4QRTB 4R4BA 2VQUA 4MXWL 2EKSA 2VUOA 2X44D 3BW9B 5JHLH 5DEGA 2HA1A 3VXQA 3H3PH 2QQNL 2ED8A 2H9GB 3KPLB 3JV6A 3UTTE 2VXQH 3A67L 3ARBC 1PDKA 1OLLA 1RUKH 4XNXL 4WWKC 5DZNA 1CE6A 1BFOA 2BRQA 2IBBA 5F6IC 3P0GB 3WE6B 2AJVL 1DJSA 2Q1EA 3HN3A 4TQEL 5AWNH 5BVJB 3DYMA 3TO2B 4JO3H 4JJ5B 3RWDB 4GXUN 5IFJB 3ARBD 1KCLA 4PJ9C 4HGKC 4WHCA 2ZCLH 2YD5A 3DX9A 3KR3L 2OM5A 3M1BB 4QRRA 8CGTA 2HLAB 1B2WH 3MO1B 5I6XC 1ZSDA 2VXVH 1BAFH 1LGVA 5J13B 4G42A 4P3CH 4OCMC 2Y36L 2EE6A 3AS1A 4MJ6B 3U0PA 3FO1B 4K9EH 4WW2A 1NGQH 1ZHLB 3QIUC 3BT2L 3D25B 3QQNA 3KDMB 4TVPH 1KB5A 1MQ8A 3WO4B 3FHAA 3X11B 1F4XL 4WI5A 5DHXB 2J1KA 3TNNA 5J3HD 5DQDH 5C2BH 1EEZB 4J3OC 3QIUD 5ETUB 4ERSH 4YO0B 1CGUA 2YBRA 1T7WA 2O93L 2PR4H 5T1LD 4P9ML 3CDGB 1FN4A 4QOKD 5HHNB 3EO9L 1ACYL 5JW4N 3HCVA 1JUFA 4GJTB 1RK1B 3P11L 3U7WL 4HKZB 1RUMH 4QHLB 4LSSH 1UJTA 1VFOA 4O58L 1YMMD 3PWLB 5TPWL 3MGAA 1QBBA 2XNAA 3DXAB 1MI5D 5IP4A 2OJZH 1WCBB 4L3CA 5F1IB 4Z7UE 5I8EA 3CVIH 4ODVL 3MXWH 4JRWA 1H3PH 4Y5YB 3I3BA 2XTLA 5JDSB 1NLBL 3O4OB 5F21B 3LPWA 3QEGL 3VI4E 1FNEA 5ESAB 3T09A 4JREB 5BJTB 1BEYH 1I9IH 1FZJB 1FE8L 5ID1A 1GPOH 4D0DB 3K1DA 3CIQA 5E5RB 3V4UH 3B9KB 4M43H 1I7TA 4KK9C 2WUCL 4PJIF 4E41E 5F7MC 4F3FB 1QSEB 5AZ2L 1G9MH 1LE5A 1J10A 3MRHA 4Q0XL 1F2XK 5JNYA 1INQB 2HT3D 2YWYA 2Z8RA 3SDXA 4KK9D 5HD8C 1RHFA 3TBTB 3GJFB 2VLJB 3HR5A 5I1LB 2FD6L 4S10A 5CIPA 4NRZA 4G6KL 5D7LA 1UQSA 3X14B 1OY3B 5F7LB 3DX8A 1JPGA 4L9LB 3VRIA 4QF1A 2ERJB 4HWBA 5HD8D 3U2SB 4MD4B 4P46A 3FTGA 4IDJL 2E6JA 4OLYL 1HHGB 2VABA 1FORL 3SOBL 1N8ZA 4FOMA 5FIEA 5C1MB 1NKRA 5K9KA 2W0FA 2YMXL 4XNYH 4LCWA 1T1XA 1KJ2H 3WHXA 5C08A 1S9XA 4MA7L 3WJLA 3REWB 3STZA 4H25B 2BY3A 5D2NA 1YNKH 3IS0X 4NSKB 4WHTB 2R69L 4XPGL 2DJSA 5C0CA 4JB9L 4JPWH 3QZWG 5DI8B 3Q6GH 4QRQA 2WBJC 2IMMA 4GRWE 2FATL 4ODTL 5F8QC 2K7QA 1NFDB 4GBXC 1I3GH 1I3VA 5DC0A 1J5OH 1OAYL 3EOTL 5DUMH 3WNPA 5EOQL 3S96A 4AEHH 1VERA 2BNQA 2YD6A 4R4FL 1NKOA 2WBJD 3WS3B 1M4KA 3VXRB 3WSQH 1OF2A 1CXHA 2BP3A 4X4XA 4HBCL 1RZIB 3MMEA 2DI9A 1YZZA 5A3IC 5J6GB 2RAMA 2HG5A 3VE0B 5L6YL 1H3UA 3BPOB 1E4JA 4WI9A 4I0PB 3LZFH 4YE4L 2B20A 1Q9LB 1QEWA 4U6HB 5E8NA 5A3ID 4PY7A 1YQVH 4DTGH 2QSVA 1KCRL 3W0WD 2NX5D 1VENA 2DQJH 4GG8A 2BFVH 5LBSH 4MCYA 2P45B 1MY7A 4YHZH 3STLB 3WIIL 1AC6A 1ED3B 4MB4A 3WV0A 3W9EB 4DW2L 4YDIL 4PJCA 5I18H 4OD1H 1KN4H 4L9DA 4PD4K 3VFWB 4FZEL 5F88B 1I7UA 3RVVD 2DQGH 3MLTB 3D6GA 1HSBA 4HV8B 1PG7H 1G7MB 4F80A 4YAQB 5T33L 3RGVA 3GMMB 1I1RA 4O02H 2YZ1A 2EH8L 1HH9B 2K7PA 1OAUH 4GAFB 2XWTA 2YXMA 3KNBB 4P4RB 2NY0B 3QWRD 3S3PA 4LCCC 3FN0L 3KXFA 2VZSA 4FZ8H 4DKDC 1RZ8A 1T80A 3O3UN 4ZO7A 1ZT7A 3UBXB 4MYWB 3ULUL 1I1FB 4MJIB 3DV4B 4EDWH 5JIKA 1BIIB 1U8IA 1ES0B 5E70A 3Q5YA 5DUPH 4PJFE 4PLJC 4X98A 2DYPB 4HZLA 2AGJL 1JGUH 3PL6A 2VUYA 4FQIL 1WT5A 2YPLD 2DIJA 4D8PB 2DIBA 5MEQB 1S7SA 3D39E 4KUCD 2BNRE 5F7HA 3OJDB 4ZXBC 3Q3GA 3BKJL 5TH2B 3HLAA 4MNQA 4NHCH 5A2LH 2Q7YA 4AT6B 1NBYB 3O41A 3JUZA 5TQ0H 4YFLI 3D85B 4Y19A 5J0BA 2EYRA 4ZXBD 1MCRA 2XIDA 3TZVA 4O9HH 5FEBA 3LV3B 1RJZB 2HT2C 1BVKB 4WI3A 4M7ZB 3HRZA 3V5KA 4KRPB 1EIBA 1K3IA 5GRWA 5DRWB 3BGMB 5C0BE 5B38G 1QTYT 3WFEH 5IQ9A 1WWCA 2FNBA 2FX9H 4OIAA 1I1AC 4RIRA 3MZTA 2HT2D 5C9JB 2OXHA 1DLHB 3S3JA 2IAMA 3RTQB 1MOEA 3M8OL 4S1QL 5AUMA 1IGYA 1Q1JL 3UJTH 4ZODA 1K8IA 1I1AD 4YK4C 4EJ1C 3KYNA 2WMPA 1Q0XL 5C09B 1I85A 1RK0B 4ZSOE 1U8MB 3ELAT 4IRSA 2J8UA 3D5OF 3QEQE 4QT5B 4QRTA 3UTTB 2R2EA 4DKEH 1MCOH 3REVB 5DHYA 3UJJL 5ERWB 1QRNA 2F53D 4JFFE 3IFPB 2XA8L 3MBXH 3SBWA 2ZPKL 3M17B 3ARFB 4NKOB 2ADIA 4RFOL 3V0WL 5BVJA 4JJ5A 4ONHB 3H2WA 3UTSD 4HS8H 5HHOE 4I77L 4ZG1A 2BOBB 5H37H 3VH8A 2HLAA 3MO1A 5JLZB 2IPTH 1R3HB 1FDLL 2QADC 4Y2DC 4NO3A 2VYRE 2BCKA 3H9HA 1CF8L 1ZLSH 3O3DA 5JTWA 3N9GH 3QZWB 4IRZH 4PJAA 3HI6L 5KJRL 1ZHLA 2WBWB 4JRYD 3TYFA 1UYWH 4F2MB 3NOIA 2GQHA 4PB9L 4YHKL 4OF0A 4QTIL 3RVXD 4JGJA 5DVKA 1A6PA 4OCRH 2Y25A 3L5JA 1C5DA 3IXAB 4Q6IB 5D1XC 3B8SA 4XPBH 5GS0L 4OZIA 4Z77A 4P4KC 2YD7A 3CDGA 3MNVA 5EWIH 5IVZA 3P77B 2D7TL 3X3GL 4P2QD 4OZ4B 5J8OA 4YXHH 4MD5A 4HKZA 5F44A 1IEBB 1BZ9B 5D1XD 4QHLA 4Z7UB 1L6ZA 4HD9A 3TT1L 4P4KD 3U36A 4RGMB 1UKQA 1NGPH 2I07B 4PY8I 3T08A 3BJ91 2YSSB 2E3VA 5ACLA 4UT7H 5I15L 1XCTA 3WUWG 4XAKD 3BHBA 4HIIB 4I4WB 4UUJA 2ZJSL 3SKOA 4Y5YA 3T3ME 3QNYA 2AS5M 3RBGA 2GITB 1ITBB 2M1KA 4OF3A 5IJKC 4G8EA 3DX6A 2J6EH 1HDMB 4L3EB 1LO4L 3CFKA 1TQCB 2DM7A 5MP6H 4YHOL 4GOSA 3RA7L 1CXEA 1T5WA 4K3HA 4E41B 2VAAB 1JF6A 4M5YL 4M1DL 3RWCB 3TH3T 2P48B 4JM2B 4OLWH 1BZQK 4K3JH 2ENSA 4LLQA 4PJXF 1KTDB 3KPRE 4LVHB 1LO0L 2VO5A 5FYKU 2A6DA 3O8XC 4GG6F 1YEJH 5E8DH 4X4MA 2NTFB 1P2CB 5HJ3A 3HMXL 5GS2H 3S37H 5EN2A 1JPTH 5I1LA 4LSRL 3O8XD 5BV7C 1P9MA 5IB2B 5FYKL 1L7IL 4QHNA 3F7PC 2XV6B 2HH0L 4MXWH 1CCZA 4GUPA 3BKYH 4KMQA 4QHMB 1UWEL 1KYOJ 2QQNH 3PGDA 5DZOA 3GSUA 4MD4A 1NBZA 3A67H 1FIGL 1HHGA 3TIEB 4K71C 5EBWA 3TO4B 1EHNA 2GKIA 4O00A 3ZYJA 5JIPA 2F58L 3MLVL 2VLMD 4O4YL 4TQEH 3QUYB 1BD2A 4PTTA 5ENWA 2GSGA 1R3LB 4H25A 3S98A 3QFDA 4YX2H 2ADGB 5C0IA 4N0YH 1NDGA 3HZMB 4I13B 3IB4A 3HG1D 3SGDI 3F62A 4JO4H 4I5BB 4CU6A 3GKWL 2DM4A 2ICWA 5FKPB 1CGYA 1YEEH 3T1WA 3ARGC 1ZA3A 4ZS7L 3TVMD 5B38B 1SVZA 4XP9L 4FQQB 2CRIA 5F9WB 2MPAL 2Y36H 1KF9B 2NLJB 3CX5K 1JYNA 4RWYL 4UI2A 3TCLB 3BT2H 3VG9B 3RL1A 1BZ7B 4RISL 3ARGD 3VXRA 4MD0B 1BBJA 3IT8D 3MACH 1NCWL 4FHBD 1SYVB 2X70B 3DARA 1MVUB 3QDMA 4LF3A 3VFNB 5F89A 5B4MD 5EU5B 3C5SB 3IKCB 3O4LD 4FXKB 3U4EA 4P9MH 3LRGA 3OPZL 3PGFL 3MXVL 1P4IH 3LOWA 3ETBF 3P11H 5FCUL 3GNMH 4GT7A 5KSVA 1IAKB 3GO1L 2H41A 2OR7A 4U7KA 3V6OA 1A1NA 1KCSL 1BLNA 1CFSB 1UM6L 4C83A 4MNHA 3GHEL 2VDKL 4NWTL 4NNYB 2X1OA 2XZQL 3STLA 4Y5VB 1I9JH 3PP3H 5DYOB 1XF4B 2Y06L 1NGXB 2CRYA 3W9EA 5SWSA 1KJ3L 2Y6SC 3GI8L 2W0PA 1LK2B 1F6LL 4R8WL 4YHLL 4LBEB 1RUQL 5DJCB 3VD4A 3FB7B 4S2SB 1MQKL 5TGBA 1SJXA 1N7MH 1B6DA 4KJYA 1KEML 2WP3T 1H8OA 3ZKXC 3QEGH 1G7MA 1RULH 2KZ1B 2Y6SD 4BQ6A 3ZYZA 4UOW0 3L3OB 4JFHD 2FH8A 4E0RB 1HH9A 3KYOB 1ZHKB 1YPZF 4K9EC 2EDYA 4MDJB 1IM3A 4X80L 4X4YA 4ORGB 5HYJD 1ZT1B 3KNBA 4OT1H 4ZTOH 3KPTA 4YDJB 1FE8H 4NQDE 4PJDF 5KANG 1NEZG 4LVNC 4OGAC 4Q7DA 4MS8C 3QUZB 3BQUA 5GIRB 1G1CA 4KROB 3UBXA 2AXHA 1YY8B 3NFNA 4PJFB 1T7XA 2XY2A 5C6TL 4K8RH 1JZ3A 4JQVA 2VB5A 4LPTA 4K7PL 3GMQB 1BIIA 3BZ4A 5LQBH 1KG0B 3NIGE 1CFNB 3WNNA 2O5ZL 5I17A 4MS8D 3FQWB 4LLWB 3RRQA 3D39B 3QXVA 1XF3B 2BNRB 5H35B 3UAJC 3GJEA 2XRAL 2X1QA 3DSFL 1U8LA 2V2TA 4NWUL 5L88H 1UXWA 5E8PA 4G6KH 1T1YA 4CADB 1NAML 3PP3K 4KAQL 3HE6D 5BW7C 4X8JB 4DN3H 1I9RH 5JW3L 1M71B 2BSRB 5KN5A 3UAJD 3WUWB 3MREA 4HWNA 1A6ZB 4FQXA 4IDJH 1U92A 4OLYH 3RP1A 3SDYL 3W82A 2VKWA 3D85A 3E6HB 5C0BB 5A16B 5E0QA 1RJZA 3QNXB 5IMLB 25C8H 3T8XA 3BH9A 4LOUC 1Z5LA 3IDXL 4XBEH 4MMXC 5CBEA 4MQ7B 2B2XH 2A6IA 2R69H 3G6AB 1AQDB 4EIZC 1H9VA 4JB9H 2UUDH 3HFMH 4YZFF 2UY7A 4BH8A 4X6CE 2FATH 4LOUD 4MGXA 3AS3A 1OAYH 3WUZA 1JF1A 5EOQH 4ZSOB 3LSOB 1WAAE 3T0EC 3QEQB 4QXTA 4R96B 3GRWL 2VE6B 2NXYC 3L1OL 5C09A 2CKBL 3BKML 4HPOH 4Y4HB 3TA3C 4P9HL 3LHPL 1MLBB 1EHLH 4PS4L 3T0ED 5I1EL 1K6QL 4JFFB 5L6YH 4R0LA 5F1NA 3DETC 1EZVX 2XG5A 1BQHG 2NY3B 4JY5H 5FO8A 3DROA 3PHQA 4WTXA 1JWUB 1YEDB 3H9SA 4PLKC 1RSFA 5HHOB 3M17A 4NKOA 2PW2A 3C60B 5BS0D 2P8MB 3DETD 1CFBA 5IG7B 2R29H 5E2WL 2DMCA 3PP4L 2WIIA 3QULA 4PLKD 3WIIH 3D3VE 4Y88A 5JLZA 2ZWLT 3WN5A 1R3HA 3FOMA 5E8OB 4DW2H 1IAOB 4J1UB 1KIRB 5MERB 2FHCA 5EC2A 4U1IA 1MY5A 1AGCB 2NXZC 5FHBL 1T2QL 2R8SH 3PXHA 2WQ8A 1Q94B 3LAFA 5T33H 1E4XH 2FJFB 2GTWB 4OFVA 3MV7D 2EH8H 3CFIC 5JXAL 1EUTA 2VISB 2NXZD 3ZLQC 1XIWC 3VDBA 3WFHB 1P6AB 3OKEB 1B0RB 4PRNB 3R06B 5JUEH 2YKLL 4MZ2A 5L0QC 4JLRA 4PJHE 2XN9D 2HRLA 5I73C 1L7TH 5IHZB 2JELL 4PJBF 1ZLUH 1SBBA 1XIWD 5DJ0A 4EUPA 4UQ2B 4M3KB 3IAGC 1II4E 1C8PA 2IH1A 4M6OH 4UOW1 4GS7B 1JBJA 3VGAC 1RIVL 1V7MH 1TLKA 2VERN 4A2LA 3C6LB 1F4AA 3O6KH 3S35L 2AGJH 2Q7NA 1G0YR 2FX8L 3R0NA 2AEQH 2I5YH 3DPBA 5IB3B 1HI6B 5CLWA 1KB5L 3OKOB 4LMQE 4RMQA 4HK3J 1IGJA 3WD5L 2CLZB 4WIQA 1T83A 3TCXA 4TULH 1KFAL 1D5ZB 5DFTA 4OLXH 3G08B 4LPYA 4POZC 4L3EA 4HFWA 4XCYA 1DN0B 1BQLH 5FO7B 4NQEE 3SJVE 5CBAA 2A6JB 2HFEB 1HHIA 2ID5A 2VAAA 4HJJL 2PXYB 4FFVC 1TENA 3KPRB 5FYLL 3RWCA 35C8H 4POZD 2XYCA 3MBEA 4XP5L 4JR9H 43CAB 3S37X 3BIBX 3OKNB 5CCKH 4NN6C 5DFWH 3U0WL 1NEZB 3M8OH 5C8JA 3EDEA 1UKSA 4FFVD 4S1QH 5IOPB 1Q1JH 2YC1B 2AK1H 1OW0A 1F58L 1FCGA 2D31A 2GJ6B 4MNGE 3H6JA 3C2SA 2BVPA 4PG9B 1Q0XH 4CVXB 1G7LB 1TTFA 2CLVA 2C3WA 3UDWC 1ZS8B 3U48A 1U3HC 4OF7A 3SO5A 1KOAA 4N0UA 4OLVL 4PV9B 1T2XA 2E8ZA 3P9WB 4CL7A 2DKSA 2XZAH 3MLXL 5ESVA 3UJJH 1JNHA 1TCRA 2JLLA 1S7VA 4ZOBA 1O0VA 1NQBA 4DEPB 3FQTB 1ORQA 2H2SC 1IT9L 3MRMB 3U0TA 4F7PB 2E7HA 2ADGA 1I9EA 2AJSL 4I77H 2I24N 3V7AE 3OAYK 1GGTA 4XZUB 4N8VG 2NY1D 3HHRB 5E99L 4OZGF 1FYTA 2H2SD 9CGTA 5JPMA 1Q9WA 1X7QA 5EU6A 1JN6A 5EULV 1FDLH 4KJWD 4FQLL 4FQQA 4QHKI 5ITFB 2R2HA 4NT6A 1CF8H 1E27B 5FDYA 3VD7A 5KJRH 4R4NC 2LQRA 1T1ZA 4HWBL 4D0BB 2X4PA 1AJ7H 4JDTL 4ACPA 3KAAA 3W81A 3LKRA 3TN0B 5J89A 2OZ4H 5DJDA 1NJ9B 4PB9H 3A6CL 4LGPB 3X12B 1OGAD 4QTIH 2F74A 5CJOL 5FF6B 1XGUA 3ZDYF 5C0FB 1NUNB 4R4ND 4M6ML 3F5WB 1PEWA 1CFTA 1W0YT 1NC4D 3IKCA 3S8WA 4HJGB 5FECB 1IE5A 1AR1C 4NKDA 1BQSA 2QR0A 4KH2A 3O9WC 3GSVB 3FRPG 3QUMB 5IW1A 1CWVA 1IAKA 4FQCH 5E2JA 3L5HA 4JPIB 4M1CC 3MLUL 4WWKA 2HFGL 5IUSA 4JKMA 3C9NB 3TT1H 3OAUH 2ZSVA 1AR1D 4Z7VA 5F93C 5IVXE 3O9WD 5I15H 1BECA 3LPFA 3NGBC 1CQYA 1RFDH 1YYLL 3MYJA 2X41A 1NCBH 3QIBB 4M1CD 4PJ9A 2ZJSH 1LK2A 2I9TB 4Y7MA 1H15B 2EDTA 5JW4Q 5DS8A 3QDGE 5C0EA 3U9UB 4WW1A 1H3GA 3KYAA 3Q5TA 1EXUA 3HMWH 2GJZA 5KSBA 3KJ4C 4AYFA 2YD8A 4EXPX 4YDKL 2X4SA 4C55A 1E4WH 4JZJB 1RY7B 4WENB 1KCKA 2LAGB 4YHOH 4GAYA 3RA7H 3RWFB 3DO7A 1XAUA 4KPHL 1RUAL 3SE4C 3GSNA 3EYUL 1YDPB 4O2EA 3KLAB 3OKDB 3FO2A 5DEZA 4ZFOA 3IXTB 1DBKL 4LCIL 1YMMA 1KG0A 4HGWB 5JR1L 4DZ8A 3UMTA 2EIEA 1MI5A 2B4CH 3MLWH 5F8RC 1JZ6A 5ACZA 3HMXH 4QRPE 5IB5A 3TYGL 3MRPA 4LSRH 5FYKH 4NFBA 1L7IH 1T20B 2JF1A 3AXLA 1SM3L 3CU1A 1A7QL 1MFBL 1QZ1A 5T3ZL 4CGTA 5I9QC 3RPKA 3V7AG 1IAIL 2A83A 2Z31B 1Q9OA 3QDAA 1K85A 4NFCA 1SJHA 3F6IA 3SGDH 1IGTA 4CU8A 5FCSH 4XVUC 4O4YH 4RAVB 3GMPB 3GMNB 4JRXE 1TJGH 1VADB 4UT9L 1IAII 4X6CB 4MQ7A 2NW2B 5EBLA 5MEPA 3TWCL 2C9AA 1WFUA 3AGVA 4JHBA 3GKWH 4XVUD 1NAKL 2BY0A 1BBDL 1S7RB 1NL0L 1GGCH 4U1HB 2MJWA 4XP9H 5LGJB 4ZSOA 1TZIB 1DVFD 2DICA 2HFFB 1S3KL 3H0TA 1FNGA 4BQCA 1YN7A 2VE6A 3A6BL 2H8PB 1KLUB 3LH2H 4RWYH 3SE9H 3QAZC 4X7CC 3ARZA 4R97B 4NO5A 3RUGF 1EVUA 1D9KB 2E7MA 4FRWA 4XNMB 2ZSWB 1OP3H 4HF5H 5TDOB 5JPNA 2BHZA 1VKXA 1VSCA 5KAQF 2X42A 4NOBA 1J1OH 5IMMB 3OPZH 1JWUA 4MA1B 5FXCH 2DBLH 2V17L 4B5EA 5K9JH 3K2UL 5ESQB 3BPLC 3RIAF 1T0PB 4H5SB 2JIXD 3CLEH 3D3VB 3VGHA 5IG7A 1CGVA 5E2UL 3ULVL 1XMWA 4LDOB 1UVQB 1MFDH 2XZQH 5IF0A 1F11A 1FVDA 1NBVL 1A6AB 2Y06H 4NZTL 3SY0B 5CHNA 3RY6C 3GI8H 4XC1L 1V5JA 4J1UA 3JTTA 1KBGL 4FA8A 4G3YH 4R8WH 4P3DA 3HPLA 1VDGA 4MXQC 1RUQH 1JMZA 4N8VB 5DMYA 2WBJA 5SWZD 4GBXA 2OR8A 1KEMH 1N5AB 3VCLA 4LPWA 1OAXL 3VGBA 1PYWA 1YECL 3QA3A 4LDEB 5BQ7B 3QUXB 4AEEA 4NN5C 4PJHB 2ZUSA 1MEXH 4MXQD 3C09C 4Y5XB 2XA3A 4X80H 7FABH 1GGYA 2I9LB 4POYA 5FYJE 3HPJA 4HIEA 4FQJL 2AJYH 3R06A 3GSQA 4OD2B 2X4QA 4LSUH 4X7EC 1UB5A 2X4NB 3IF1A 2EXYC 4PRBB 5HDQH 5C6TH 3MJ7A 3CC5A 3Q2CA 3W0WA 5JOPE 5IFHL 4PV8B 4Q2ZB 5E6ZA 1WZKA 2CUIA 2O5ZH 4HCRA 3F7VB 2EXYD 3C6LA 5E6IC 1U41A 3HE7C 1YC8A 5KSAA 5JW5A 3LS5H 1I8KB 3DSFH 1HWGB 4NWUH 4QRSA 4RAHA 4H1LA 1IEAA 4ETQB 1ZGLB 3CFBB 1CU4L 1HI6A 3HNTL 1FNAA 2FBOJ 5JW3H 4KC3B 5DRXB 5E6ID 5D93B 2ARJA 4CW1A 1IBGL 4LL9A 4NQEB 4LKCA 1I7RB 3SJVB 2QKIA 3SDYH 3KPPA 3L3IB 2E7CA 4HH9B 1DN0A 5FV1L 2RFXA 3FO0L 3QWRA 3QDHA 1DQJA 1HQ4A 5I75C 2BSSB 5EU7E 2PXYA 4XCEB 4LSVL 4ZDHB 3QDJA 3KPRA 3IDXH 5D1ZB 3CFJB 3GIVA 2R0WL 4KKBC 3HUJA 4MNGB 2VDNL 3R4DA 4ZUUA 2CR6A 4X6EA 3F12B 1I3UA 4NZDA 5IOPA 2YC1A 2GTZA 2GJ6A 1J05B 2ZNWA 2YPLA 3GRWH 4JJHA 4JVWA 1JCKA 4KKBD 4P23C 5EOTB 1NGWB 4LHUG 3L1OH 4K7FB 2FGWL 3BKMH 4YDVB 3MNWB 4JFYA 3BZDA 3LHPH 3V0AC 1RURL 5GGUB 4PS4H 3F7YA 2BSED 3RWEA 3BEWB 2Q6WA 1K6QH 4U2ZA 2JTDA 4P23D 3I85A 2FZ3A 4KI1A 1OD7A 4EQ3A 3VMOA 2ZCHL 5DK0B 3E1F1 5J11B 4ZYKA 3G6DL 2FWOA 4UDUA 5GRUL 4Y4KC 4M9PA 1EGJA 1M7DA 4TN9A 3C6SA 1EEUA 5D1QC 3PP4H 4HKJA 3ARVA 4JZNB 1FZKA 1P1ZB 2ATPA 3BKCL 4Y4KD 3ZSTA 2EDWA 5HHME 3B5GA 4R7NA 4JM4L 3I6KA 4BK4A 2X89A 5D1QD 1YN6B 5DHVA 5ITFA 3W39A 3I75B 3V5HA 3PWUB 1ROWA 2FB4L 2JK5B 4KVCL 1JRHL 3KPSA 3QHZL 4CMHB 2VN4A 1T5XB 1CD9B 5D71L 1FG2A 1NJ9A 1Z9OA 5JXAH 5TF0A 4BK5A 4JY4A 4NUGL 2WP3O 5IGXL 1IL1A 5L2KE 2F53A 3FFCE 4DGYH 2YKLH 1ZLVH 5IFAL 1JRHI 2MCG1 4MA3B 5C0RH 1OAKL 1HH6B 1TVDA 3QUMA 5I71C 4NZUL 3D0LA 3KHOA 4GAGL 5IVXB 3WS6C 4OCSH 4DGIL 3LPGA 5AZEH 1EX0A 3DYPA 5J7CC 1RIVH 2B5IB 4EI5C 3UTQA 4GKSB 3MRLB 2DLIA 4UDTA 3BP5B 3QDGB 5C9KA 3BE1H 4ZAKB 4F7TA 1QFHA 2FX8H 2I9TA 4ZFGH 3RWGB 2UZIL 5T5NF 4QTHA 3G5YB 1Y0LA 4EI5D 3P40A 1KJ2B 1LE9A 3ECBB 4XPTL 3NABL 1VHPA 3OR6B 1YNTA 4Y2DA 2CLRA 1KFAH 2AXGB 2EE3A 2NZIA 2VL4A 4U49A 3ZKQD 4H0GA 3QIWB 3V6FB 3G5ZA 2QBWA 2JCCB 1X5JA 2FO4A 2UWEE 3OB0H 5HHVL 1PG7W 1MIML 4U6TA 4IM8A 4HJJH 4WHYH 2AJUH 4OI8A 2AABH 3MLYL 5FYLH 2F8XC 3BGFB 3O6FC 4NJ9H 2Y1VA 4YFDB 1SJEA 1MWAB 1V3MA 3IXTA 2EDQA 3MRJB 1LO2H 4QRPB 4U1LB 4PTUB 4PY8J 4Y1AA 3GSOB 2J88L 1K4DB 3BJLA 3ULUC 4M9OA 3EHBC 3VD5A 4LU5L 2V2WB 4WO4B 1AGBA 1CFVL 3WIHH 1KV3A 1P5VA 4QOKE 4TOYL 1WJ3A 2ZOKB 2JKXA 1P6FA 4CVZB 1ZOXA 3MRBB 5F7EL 4OTXH 3ULUD 1CLYL 3EHBD 2DKMA 3MLXH 4GKOA 1SHMA 1WBXA 2OR9L 2X1WL 2OI9B 3U6RB 1DBBL 4JRXB 3W9DA 4NRYA 4JHWL 3ZE2F 1XR8A 3EO1B 5F6HI 1ADQA 5IJKA 4I3RH 3CMOH 4Z76A 2WINA 4KHXH 4W6WB 3UEZA 4DKFL 1FSKC 2J8OA 1FFPB 2AJSH 1F3DJ 3V5DA 2J5LB 3O3BA 3BDYL 5B8CB 5HGBA 4KMLB 5HGGS 2QSQA 1JGEA 3AMLA 4W68A 3UBXI 5L8KB 1JWMB 4G8GE 4M5ZH 1L4IA 4M7LT 2VDML 3O3EB 5HVWA 2ORBL 3O8XA 1RD6A 2RCSH 2C1PB 1KLUA 4LIQE 2B1HL 1QSFA 1GHFL 5D2LF 5F9DC 1UZ6E 4OLEA 3RX7A 4KMTL 5EBMA 4M8QB 3A6CH 4MWFA 3R1GL 3FMGL 3TEUA 1QRKA 1OSZB 4LHUB 2H6PB 1HINL 3P4OA 4U31A 4G9FA 4NYLA 4XNMA 4S1SL 5CJOH 5I1GL 1DEEB 3ILPB 3FRUA 3LEVL 2D03H 4TPRL 5DD3L 1Q8MA 2FDBP 5FFLA 2OTWB 3PG2A 2VLKE 3MROB 4HQQL 5TE7L 2FEDD 1OARL 5J12B 2W9LA 3B43A 5EZIH 2GAZB 1EEYA 1NGZA 4PFEA 4Q9RL 5JHDD 4APQB 4EN3C 3MLUH 1H3TA 2HFGH 2C3VB 3HG1A 2UZXB 1S7QA 1QG3A 3K8KA 5CP3H 2HJKB 1UVQA 4LASL 4HIXH 4JY6A 1YEIL 4PJ8B 1A6AA 2X9XA 4JAMB 2G75B 2IH3A 4GRMB 4UILL 3HZKB 4LLMB 3OXSA 3SY0A 2FR4B 1YYLH 3IDGA 5CSBA 4EN3D 3HNSL 2YXFA 2DRUA 2VNCA 1C5BH 4TNVF 3WHE0 1RUPL 3VXUD 2PF6A 3WFCH 3VFUB 2NY4C 4XRCA 2ZUTA 3VFSB 1EV2E 1W8NA 3P73B 2XWBB 1FL5B 3Q1SL 3DOSA 3QO0A 1P7QD 5FDWA 2ZG2A 4YDKH 1UCBL 1E28A 3LRSA 2NY4D 3NAAL 2H26B 1RUAH 1NMBH 1JI2A 5E7FA 1IM9A 1G1YA 5LGKA 2XACC 1EUUA 5GRYA 1PBYA 2I26N 3ROOB 5IEHB 1OAZL 2VJXA 3PQYB 4FFWC 4RMRA 5E9DD 1DBKH 1AXSA 4LCIH 4GMSL 4GRLB 3ES6A 2ITCB 1S9KC 1P7HL 1MHHA 4D3CH 3F7VA 2Y5TB 3SGEH 4LSQL 3S7GA 3UTOA 1S9VB 1WBYA 4P5TB 4FFWD 1A7RH 3TBVB 2CUHA 2EH7L 3GI9H 3EJYC 3MRQB 5CS7A 1QFOA 5GS0D 2LVEA 3TNMA 5C86A 4NHUB 1LILA 1EPFA 4KJPD 3MJ9A 4PGEA 1A14L 4N0FB 3LY6A 2AAVA 5DRXA 5MI0C 4R6UA 4ZO8A 3BP7A 2YD2A 2HVKB 2NX5E 4HX1A 4PJIB 3V9FA 4IHOB 5DT1L 4HUWB 1F02I 1F8TL 1CLOL 1FGNH 3W5NA 3BOVA 4PJXE 3SQOL 2FRGP 4ZDHA 4ODXA 4UT9H 4GG6E 2BVOA 4OJFL 1NFDF 1OPGL 1FZOB 2R56H 3NH7H 4ZUTB 2DQCH 1UH2A 1Z0NA 3VG0H 1G7IA 5HBBA 1DP0A 1Z6JT 5HHQB 3C5JB 4HDIB 3WNMA 4TUKH 5DMIH 5AAWA 1UADC 5C0AE 4OUUB 2QEJA 1J86A 5EOTA 3A6BH 5F9AC 5D7IF 2ZZUT 5HSFA 2APVA 5GZOC 4NQVA 3T2PA 4WNQA 4NGHL 4HH8A 2V7HB 3X3FL 3BI9X 4HAGA 4WU7A 1CL7L 2L0DA 1CDGA 1MCNA 5EA0L 5GZOD 1TPXC 3FT3A 5BW7A 3FT4A 3GUTA 2HWZL 3T4AB 3IGAA 2NY6D 4HUUA 5I1CH 2FX7L 4J8RB 1FVEB 5EU3B 5JZ7C 4S1DD 4Z7WF 5IW6A 5FYKD 5KTEL 1R5VB 3IFOA 1CL7I 3RDTB 5F3HB 5KVGL 5EO9A 3AREB 5HHMB 2NY5L 4LPCA 1FH5H 3HAEG 2DL2A 3SDAC 4K7PY 3MRKB 4YR6B 1M6OA 4JZNA 1EFXD 3DTXB 1E6JL 4AIZA 5EO1B 2JJUA 5MENA 1TZHB 4C59B 4NZTH 5JZ7D 4OF6A 1XZ0B 1HXMA 2J7LA 1KBGH 4P5MA 2EDHA 5DJ8B 43C9B 3VXME 1TZGH 3SDAD 1OAXH 5IWLC 1YECH 5L2KB 4UINL 3FFCB 4D94A 4F8TA 3B9VA 1CD8A 1K2DA 3LKQA 3IU3A 1B3JA 3B9AA 4L8SB 4XPHH 2OS7A 3TA3A 4FQJH 1AFVL 2D0FA 4QWWC 5E1AB 2N7BA 4BUGA 4LLDA 1ZWIB 5I8KL 2YWZA 4CNIB 1I3RB 1TNMA 2W9DL 4BZ1L 4EIGB 3IFNL 4NQXB 1HHJB 3NTCL 5IFHH 5T1KD 3KPQB 4C54A 3QXTA 4QWWD 1WEJH 4U0RB 4ODBD 1CE1L 5CEXA 1QO3A 3B3IA 5I2IB 5CEZD 1X4ZA 5DRZB 1H3WM 4XBGB 3D18B 5DURD 1VACB 5D5MA 2AK4B 4MX7A 2JJVA 1LO5A 4ELME 1CU4H 3ARBB 3IJYB 2ZUWA 2CMRH 1KJ2A 5TDNA 2OJEB 1PLGL 4YGVA 1MJ8H 1YPZE 2UWEB 3MV7A 1R3KB 3BVNB 3LKOA 4BFGA 4NN7C 1MRDH 3MRFA 3BIKB 3D1MC 4HKXA 2JCCA 5KG9B 4XBPA 5ICZA 4WDIA 2XN9A 4JN2B 2P5EE 1F3JA 4WFFD 1MELA 4LSVH 1XGQA 1OTSC 5ILTL 2LAAA 4ONFL 5GS1B 5F7DA 1BOGA 1G7JA 5CJXA 2OSLA 2YD3A 4OF8A 3PV6B 4S0TD 4FQPA 4Z18A 2OK0L 3MRJA 5F96L 4ZFFB 1OTSD 1G84A 1DFBL 2OP4L 3GMRB 4LRNL 4QOKB 2ICEA 2VXSL 5C07A 2F8OA 1M7XA 4OQTL 1RURH 2ZOKA 2VXTL 5I1DB 4P2QE 1PQZA 4U6XA 3OXRB 4NBYB 2EO1A 1BF2A 4M7LL 3EO0B 4KI5C 4QXWA 4RQQB 4M00A 1H3VA 2YN5A 5BMFL 4M7KL 5IESL 3FB6A 1T0MB 5GRUH 2VL5B 4UT6H 4XAKE 3VDAA 3SDDC 4UU9A 4IIQB 3PABA 5CLTA 2WW8A 4NQTA 5T5FL 4ZFOL 4YZFE 4OKDA 5DLML 5GRJL 3GMLB 3NBNA 4G8GB 1AO7E 4L5FH 4X7TB 1U93A 5GGVL 3SDDD 4LP4A 2HJLB 1ZMYA 3GJFH 4JM4H 1AHWB 3QI9B 5FA4A 4XP1H 4M93B 4OCWL 5CZVH 1HKFA 3EJJX 2VQ1B 3CH1A 4JFDA 1JRHH 3QHZH 1A9BB 1FZMB 3G6JE 1HWHB 3VFRB 3RU8L 2QSTA 2OL3B 4NUGH 3QXDA 1GOHA 2VLKB 3KPOA 3GIZL 4DK3A 4R7DA 2DI8A 3RVUD 2UZYB 1U3HA 5C70A 4TNVK 3BH8A 4P9HC 3MUGB 3Q6FB 4G6ML 2FBJL 3HB3D 3MROA 1WZ1L 5IW3A 4Z7UF 2PTUA 2CH8A 1OAKH 4G6FB 4ONGH 3NZHH 4GAGH 5ICYA 4PGCA 2IJ0C 1NCTA 5FOBA 2GW5A 3MNZB 4X9BA 1PSKL 1ZHNB 5K59E 3C5ZD 2DF3A 1T7ZA 1AGDA 1RZGB 5FM5M 3OSKA 4QHKJ 4JAMA 5C0DB 4LLMA 2P24B 2IAND 4WEBH 5HI4C 4HS3B 2UZIH 3HAEB 1UJ3C 3JTSB 3TBSB 1NC2A 2Z0BA 2LV4A 3NABH 3TV3H 2VLME 3E8UH 3VFUA 1CLZL 3CAFA 4ODWB 1G6RB 1QPPA 1JHKL 4V1DD 1FL5A 1TQBB 3VWJC 1ZEAL 3TPUA 1U36A 5DJXB 2HKFH 1HHKA 2CXGA 2WANA 4P57A 1MIMH 4AM0A 4U1KB 1QBAA 3KGRA 3U30C 3OF6A 1GOGA 5DJ2A 3I6GB 1IGIL 1OGTA 5E4IA 3VWJD 3IJSB 1GXEA 4X9GA 7CGTA 2E8YA 3SHSA 3PQYA 1T21A 4HMDA 4GLRI 1NMAL 3D87B 2J88H 2WLZA 2PCPB 1UEYA 4YBQC 1KTLB 4WEUD 2O5XL 1OTUC 3EUUA 3E2HB 2B1AH 2I27N 3GHBL 3SE3A 3TBVA 2VTFA 3OKMB 3CZJA 1CFVH 1XGRA 3O4LE 1BJ1J 4OFKA 3OBAA 3VA2C 2NX5B 1F4WL 5F7EH 4YBQD 4XP4L 1CLYH 4ALAL 2J4WL 4LRIC 3WFDL 1OTUD 4WHDA 5TE4H 1T4KA 3CVHB 4TNWF 3CSYB 1KIUA 1QLRA 4QRRD 4OV5B 1FVCA 2OR9H 2VIRB 3T4YB 3QPXL 4PJIA 4PJXB 2VITA 2XQYK 1F4YH 4GG6B 4GRWF 3JV4A 2ATKA 4PRDB 1DZBA 2XFXB 4J6RH 4K94H 3T1FB 4BFEA 1MPAL 2ZUQC 1RHHB 4DKFH 3ARQA 4LCUB 2ZUUA 2E9BA 5BXFA 4U1GB 4R2GB 1JTPA 1VFBB 1BM3L 4F33A 4ISVB 2ZG1A 4GKNB 4GKZB 5C0AB 5FOJA 3GDBA 4N1CA 5FUZL 3ZKNC 2B0SL 3NZ8A 4PREA 4HT1L 4WJ5A 2MTPA 4YHNB 4P99A 2VDMH 5DD5H 3QJHA 2HTLC 2ORBH 4QRUA 2FL5B 2FYYA 4RNRA 2B1HH 4X6FB 3ARRA 2MCPH 3ZKND 4EXKA 5FA3A 5BZDB 4LCCB 3T0XA 1KULA 1U58B 1EA9C 3VD3A 5IROC 3EYVB 4P2OB 2Q3ZA 3IAPA 1HINH 4AEIH 5I1GH 3L95B 3CPLB 4TPRH 2CRZA 5GXBB 2WUBL 1BIHA 3PWPE 1FVEA 2ESVE 1DDHA 4NIKB 1N5YL 4FQHB 1SY6L 4Q9RH 2MQ3A 1A6VH 5DVLA 1JGDB 3RDTA 3JV5A 3HNVH 4AH2A 2P44B 4JFQA 5C0JB 2D4FA 2P42B 4LASH 2C3HA 4NO2B 2W59A 3FCTA 4LVOB 3DTXA 2X4RA 2AV7B 3VXMB 1YEIH 2YZ8A 2J6EA 4UILH 1F42A 4XB7A 4CMMB 4GFTB 4HHAA 3K46A 4NQCA 5EU4A 4J12A 1RUPH 5F7KC 2A9ML 4PJGA 3FJTA 1H8SA 4NPYB 1RU9H 4U1SA 3SCMC 4XP6L 4P2YA 1FPTL 1SEBA 3Q1SH 3ZDYE 1F6AA 1QLFA 3TF7C 5ALBL 1G7PA 4F7CB 1I1AB 3CFEB 4ZPTA 1T03L 3MA9L 3NAAH 5EZJA 4YC2B 1EGJL 4P46C 2DBJA 1N64L 1GYAA 1EMTH 4N9GA 4JFED 1WSST 5FUOL 2JIXA 1OAZH 1G9EA 1HHJA 2DLEA 3EYQC 1NANI 1IILE 1EH9A 3MCKA 3MUHL 4GMSH 4WY7L 3VMPA 4Z5RA 2HVJB 4P46D 4Y4FB 3WJLC 1TTUA 3T0EE 3DBXA 4RSVA 2W9EH 3OGCB 4LSQH 4XCNA 5D2NC 5DRZA 3ROLA 4ELMB 3THML 5GISL 1PGRB 3CSBA 3EYQD 3BRDA 2AK4A 2YD9A 4LCWD 1YPZB 5JOFB 5C08D 4A6YH 2BRRH 4LQ1A 2BNUB 4HWZA 1I75A 5SX5H 4X6DA 2OJEA 1PJ9A 2BVQB 5BS0E 4RZCB 5IB1B 1FJ1B 2P5EB 4FFZL 4G7VL 3VFMA 1YYML 3ULSA 3WJJC 4HXAH 1U8OA 3FQNB 1KEGH 4L1DA 1F8TH 1TJIL 1CLOH 3VW3H 2BNQD 1FFOB 3TESA 1T6VN 2NTSP 4P3WA 1MSPA 5F3BA 3QUML 2UY6A 3LQAL 1OPGH 4CKVX 1S7TA 1A7OL 5DFVC 3IDJA 1RZ7L 3LIZH 3STBA 1NUDA 3LN5A 2IC2A 1ZE3C 1ZTXL 1KTRL 4L4VA 1N0XL 3S34L 5DFVD 4D9LL 5I1HL 4JZOB 4HIHA 4P2QB 3RZCC 3QFJA 4OIIH 2IPKA 2H32B 5D1XB 4XTRC 2R2BA 1J12A 5E6IA 4O5LH 2ZUXA 2H3NA 3HE7A 4N90D 4P4KB 4EZMA 1NEUA 3X3FH 2L7JA 2ADJB 4IBLT 3U79A 4BSVA 1P4LB 1W72B 3RGHA 1DSFL 3UZVB 3QWOA 3RZCD 1Z9LA 3EO0A 5ITBL 2IALB 3AB0B 1JJUA 3I50L 4I48B 4U1JB 4WFED 4DVRL 4XTRD 3DNKA 1INEL 5DJYB 1FFNB 3Q5OA 3UX9B 5B3NA 2FX7H 4Q9QH 3TT3L 4MAUL 3CFCL 1RJYB 1EHAA 4IIQA 3LQZB 1A47A 1A2YB 1AO7B 2HP4A 1DL7L 3NCFB 3RI5K 5IQ7L 1YQ2A 1R24B 2IG2L 3RGVD 2W07A 4G8GA 3OJ2C 4W4OC 1WTLA 5FB8A 5T3ZD 1NCDL 4X7TA 2PO6C 1E6JH 4M61A 3UPAA 2DTML 2XKNA 3AU1A 3IETA 1HSAA 2GIYA 3QI9A 2Q8AH 4O2FB 3KXFD 5IV2B 3G6JB 3EGSB 3UJIL 3T65A 4LSTH 5CJ5A 2EDOA 3PL6C 5JXEA 5KVFL 2M2DA 5EO0B 3QG7L 5KW9L 2H1PH 3BYYA 5IMOB 4UINH 1HIMH 5K9QG 1UXSB 4UTAL 1KC5H 4P23A 3DRQA 4WW2F 2P8LB 1NCAH 3S5LG 4ODSL 5FGRA 5C6PB 3QXAB 3OAZK 3PL6D 4Q9BA 3VXNB 1A6UH 4UQ3A 2DJ4A 1TXKA 4LLYA 4I18C 5I8KH 1M05A 5GS3A 4LFHD 1F90L 1FV1B 3QEUB 3T0WA 4GRWH 3HZVB 2BDNL 5ADPL 3MLSL 2Z91B 2Z93B 3EJZC 5K9OB 2AXFA 4HXBH 1CE1H 2ZCKL 3RWHB 3MNZA 4TSBL 5BV7B 2NW3B 4G7YH 4NNXB 3L9RB 4Y19D 4U4BA 4N8CH 2YR3A 2EECA 1T0NA 1QQDB 1RZGA 4UV7L 5DQJA 2E6QA 3OHXA 1S7WB 5D1QA 5BO1H 1BMGA 3EJZD 3ZO0A