3ZE2F

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 47
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2F02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze2F01
3HFML 4G9FD 4I0KA 2D7TL 4I0PA 4LAQL 5GRVL 1Y6KR 1VEPA 5BVPL 5IROC 3D85B 2Z8RA 1I1FB 5ID0B 4RA0C 4WU5B 2NY0B 4WWKD 3HCVB 2OR9L 3EDDA 2CIKA 4JPWL 3TBWA 4KI5C 4U6YA 1GOFA 3UJIH 3ARFA 2G5RA 3OG4B 1KIPB 4FQQA 2HT4D 4HCRA 4UNTA 3DGGB 5IEKA 2HT2C 4FG6C 4YH6A 3ULSA 1BGXL 4QNPF 5BXFB 3HPJB 1DBML 3PGFL 1MI5A 4BH7A 4P46A 4R4BB 1OARH 5CZXC 1NCAL 1OAZH 3MRRA 5GHWH 4BZ2H 3PG2A 4LCWA 4WUKL 5D1ZD 3DPBA 5HGBA 5T1MA 2O5ZH 1BAFL 2DD8H 3OX8B 5FAAA 5I8KL 1F58H 3HE6D 1T66C 2HN7B 4GW5B 4BZYA 5I1AA 4FFWD 1ZGLA 3ROOB 1Q0YL 4ESKA 5HHQB 3S4SG 3U4EB 2P46B 4ETQA 1AR2A 1I9JH 3AVEA 4KRPB 3RNQB 3M17B 2ZJSH 1I3RA 2YRPA 3FMGL 1OY3B 2LABA 3BO8A 2DJ4A 3D2UD 1T20A 4XB7A 4O4YH 4Y0GA 1HDMA 2J7LA 4DVBA 1FL3B 2NNAB 4PLOB 1EZVX 1JNHA 5I1LA 3SGEI 5EO9A 5IVZA 4TQEL 3MV9B 4X5XA 4YO0A 5C0AD 4JCMA 3UTQA 2IALA 4JB9H 4U6XA 3KPRD 5DF0A 5HHXH 2NY4C 5ILTH 4UU9A 3D18B 2JJTC 3TNMA 3HZKA 4J7RA 5F7KC 1NCWL 4GW4A 5F3BA 3KWWA 4M03A 5J56B 2UZYB 1JTOA 2BNQA 3VFUB 1VB9A 5HI4C 4X5LA 1EGJL 5C0IB 2B4CC 5ICXA 5C08A 3QCUH 3OXSB 4CW1A 4NC2B 4RWYL 2LTQC 4QTHB 2F53D 4XPHH 1A6VL 2ITDB 1CU4L 4L9LB 2V7HB 2X1QA 3HPLB 3W2DL 3AS0A 1FAIL 5GRUH 2ADFL 4Y4FC 5CBEB 4UV7L 3B3IB 5CP7B 3TH3T 3VD9A 1X44A 1T1YB 1MCCA 1HSAB 3X3FL 4NPYB 5IQ9B 2VISB 3BDXA 3UDWA 2CJUL 3RDTB 2YA0A 5E99L 3BRGC 1XGYH 2IPUG 5HYJA 1OL0A 1W72A 4P2QE 4EI6A 5DK2B 5C9JB 2NW2A 4P2OA 3RWEB 3WV0A 4RIRA 4N5EC 1QNZH 4HFUH 4ZPVB 1FLRL 3I6GB 3VXRA 3ULUL 3CFJB 5IVOA 2CO6B 1NBVL 3EFFB 4HIEA 1QLEL 4K9EH 4Q9RH 1FH5H 4N0UA 4PUBH 1NGQL 4OZHB 3GHEH 1WEJH 4OZGF 3WEXB 3RZCA 3AMKA 4G9DB 3OJ2C 3C2SA 4GLRH 3MODH 2Z35A 3I75B 3BQUD 3MBED 3OGCA 4PD4J 3BMVA 3NN8A 1EVUA 4OGXL 3FT4B 4KUCF 2YEZA 2Q7YB 5FB8A 1T03H 1J0ZA 3VFNB 1AI1H 1HE7A 4L29B 5F7HA 4OZFB 4UTBH 3EYSH 3TIEA 5FKAB 3UYRL 5FDYA 4B53A 5KJRH 3IKCB 2FATH 3D2UB 3STBA 3CMOL 4F3FA 3UPRB 1BMGA 2IAMA 3GHBL 5GIRA 4NQDE 3L5HA 3P30L 5IMOB 4WW2B 1QFWH 1H3WM 4GAYA 1UJTA 5T5NF 1AGDA 3U36B 1ITBB 3NCJH 3P2TA 3UZQA 5T1DL 3MLPA 1XZ0B 1BQLH 5L9DL 4F9PA 4XMLH 1VERA 1RVFH 3UJJL 3X11A 3V4VL 1NPUA 4LP5A 2RBLA 4NWTH 2XZCH 3PL6A 2Y36H 1KIRA 4YHYC 3WXWH 3TNNB 4NKIL 4W6WB 4ONFH 4PJAE 1PKQB 1DR9A 1AQDA 5CJBA 3ROLB 3O6FC 3EYOB 2Q8AH 4OLUH 1KPRB 3T4YA 1FFPB 3QIUA 1I8KA 3C5JA 2CUIA 4JGUA 5EA0L 1J8HE 4JVWA 1C5DA 2F53B 5K59E 4TUJB 3LVEA 4OZHF 3QUXD 4HQQL 5IBUB 1KEML 2NYYD 2J8OA 2F9BT 2NY2B 3AM8A 4HW6A 2H9GB 5AAMA 2FEEL 4KQ4L 2GSIB 1JWUA 5GQBA 5C1MB 4K94C 4TTGA 1MF2L 2FX9H 1UZ6F 1IM9A 3BP7B 4LCYA 2BSTB 4OF6A 4PJEA 3WNOA 2HVJA 1UB6B 5IJVB 2KH2B 1RZ7L 4KJWC 3HZVB 3VXUE 4PGDA 5IGXH 1D9KA 3AB0C 1DQML 1WISA 5T3XH 4D0BB 3P73B 3QEQA 1PZUB 4K7FB 4F7PB 3H9SA 5A43C 3MLVH 4PJXA 2VLKB 4C56E 3MRGB 1IEAA 2RGSA 1URLA 2EICA 5JR1L 4QXGH 3IJHA 4U1NB 3SBWC 1JF1B 1RZFL 3F58L 4ORZC 5C0RL 3G6JA 4WW2F 2F5AH 1QSEE 5MHSE 2D31A 5TE4H 2Z31A 1T1XB 4OZ4A 3RGHA 1I1AC 4YDJA 3JWOL 4ZTOH 3WS3B 3ARSA 5J7CC 3DHMA 4KK9C 3BQUB 3MBEB 1N3NA 3MJ7B 4MXWH 3EDEA 3TZVC 1KTDB 2AEPH 2D03H 3E2HB 5GJSL 1JZ7A 5MEND 4YR6A 2XN9A 1JUFB 1S7SB 3KS0J 2Y72A 3VA2C 3VA6A 3K1DA 3U7YL 4C59B 2BK8A 3H9ZA 1BJ8A 1YNKL 4HKJA 4ZFOL 1A7QH 5DJXB 4K2UL 1NUFA 1WCQA 2IH3A 3D6GA 1XR9A 4ODUA 5H94A 5JPMB 4K23H 1C8PA 2R39A 2EECA 4HC1H 4XXCA 1CQYA 4YAQA 5IP4A 2WIIB 4DOHB 4PV8B 1F8TL 3BEVB 4KROC 5E2TH 4MA7H 5KOVC 5E6IC 1S7RA 1ETZB 3QJHA 4KVNH 3KXFD 4JGJA 3LV3A 2P43B 4XVJL 3P4NA 3F12B 1T6WA 5I1IH 4QF1A 1R3KA 4PGBB 4PJBA 3T8XA 5ESAA 4TPRH 1P6AB 3ZYJA 4DUXA 3RX5A 4HHAB 4HUUA 4LCIL 4P5KB 2IMMA 2ZSWA 5HI3C 3CX5J 3Q48A 3T1WA 3L5XL 1CLOL 5IB4B 2VZSA 3M8OH 1CL7L 1H3PL 4XWGL 1LK2B 2XV6B 4ENEC 1VESA 5IUSA 3K2UL 1RUQH 3FOMB 3FHQA 4G7VH 1VFOA 1Q0XL 3NFPB 2ZG1A 3FQXB 4M6NH 3GIVB 4ONGL 5IMMB 3VW3L 3OZ9H 2GFBB 2LAAA 1Q94A 5DQ9A 5L2KE 1OB1B 3VGBA 1AKJB 3QQ3B 4P5MA 4FP8L 3BD5A 5EBMA 3BISA 3NMEA 2H8PA 1RURL 4APQA 3MLRL 1JWMB 4YXKL 3QIBA 3VFOA 1PEZA 4EDXB 2EYSA 4PRIB 3MCLH 3GMPB 5D7JA 4UT6L 4Z7NF 3BDYH 2CO7B 4YHZL 1E6OL 3MJGX 3EOTH 5JLZA 3QZWA 3KPNB 1J18A 5I73C 4JFFD 2HFGH 2APFA 5EOCH 3TT3H 1RUMH 2GJZB 2PW2B 4MJ5B 2W65A 2HLFC 1LQSR 5D1QD 2HRLA 3C6LD 2X09A 4K7PY 1Z9LA 4LFHD 4GXVL 3IVKA 2XZZA 1UM4H 4H26A 5HYSG 4UT9H 1Q9KB 3CDFA 1H15A 1YECL 3FN0L 1HQRA 2AK4D 3CZFB 5E4EC 3LKPA 4D9RE 3MJ9A 2QSCL 4U6VL 2WIMA 4Z7VE 3F6IA 1WFNA 3RQ3A 4MJIB 2DTMH 4NO2B 1JIBA 4GRLC 3GKZA 4X7TA 5FGBA 3DRQB 2Z0BA 5IB5A 1OM3H 5E0QA 1Z2KA 5E1AB 3MPCA 2EH8H 3GMOA 5ID1A 1K4CB 4DW2H 4G6FD 4KPHH 3VFWA 3RWGA 2PCPB 3H9HB 4ZS7H 3O3AA 4GKNA 1EJOL 3EO0A 3H0TB 3O6ML 3V5HB 1UCBH 3MUZ1 4NM4L 1Q9LA 3SKMA 3CLEL 1OTSD 3AU1B 3G5ZA 4M9OA 4RNRA 4XBGA 1T21B 4NC1C 1INEL 3ZDYE 1WQVT 5DMKB 1HOCA 4YQXH 2DB8A 1F3DH 4GMTH 2ZCHL 2HJFB 4Z7OF 1MRDL 4X6DB 3CFBB 5LQBH 4LQFH 3KDMA 1ZSDA 5HYQB 2FIKA 3IU4H 3VXMA 3HMXL 2A6DB 3GSVB 2B1AH 3H3BC 3FFDB 1EBPA 5I1JL 4R7NA 3UC0L 1RZKL 4GO6B 2CKBH 1TZGH 3TO4B 3OAUL 3P0YL 3QUZA 4H1LH 3R0NA 2Q1EA 3BZEB 2VLJA 3A6BH 3I6KB 4IIQB 3KPSD 3MV7B 4NYLB 4G6JL 1AE6L 3FO1B 3UBXA 2R4RL 5FCUL 1R3LB 4D9QD 3VFRB 4JQVC 5HY9B 1G7LA 1U8LA 4J6RL 4PJIB 1LO3L 2NZ9C 1YN7A 1J88A 2JF1A 4JRXD 1JRHL 3DRTB 1QP1A 1YMMA 2FJGB 2QHLA 5IB2A 5E2VL 2ZKHH 4M8VA 2IQ9L 5C3LD 1U8PB 4ZYKB 2DKMA 5DRZB 3VWJA 3FTGB 4E5XB 3LRGA 1SBSH 2VKXA 5DWUL 4I3RH 1GGCL 5IM7A 1K3IA 1AXSA 1EVTC 4PRNB 5E8DL 4JO3L 1NC4D 1T7XA 2GITA 5T1LB 3HNVL 2P5EA 3QFJA 1FPTH 2CXGA 4ELKB 3KG5A 4PLJC 1RZJL 2OI9B 2HT2D 4JFEE 1U3HD 4KJYB 4WW1B 3DMMA 4Y19D 5D1QB 1A7OH 1EZVY 3C6LB 3VGAC 1XGUA 3D25A 4BQ8A 1A6WL 1F11A 1MLBA 1BVZA 1NAKH 1YEKH 4OFVA 5TE7L 4EUPB 1FG2B 1OPGH 1P5VA 4B7LA 2ATPB 2UYLB 2R0KH 3W9EB 1J1PH 2AP2A 5E24E 4XP1H 2C4FU 5ISZD 1YPZB 4X6DF 3OKOA 5DRWA 4X4MA 1ADQA 1DBBH 5SWZA 2CLZB 3CVHH 1HHIA 2DQHH 2LE9A 3GUTA 3BIBX 2AAVA 4OFIA 1SJHB 4UDTA 4WI7A 1DEEA 1YEFH 1CG9B 2NTFB 1BFOB 2Q3ZA 5IVXB 5B38A 4PJHE 1CE1L 4JZOB 2UZIH 2XTJE 3V8OA 5LWYH 1B0GA 1G6RH 5DJCB 3SCMD 3D85A 5CD3A 1JZ4A 3ZE2E 1MREH 5FHBH 5ID0A 3LS4L 5JPNA 5FM5M 4XRCA 5LCVH 1ZMYA 4GQPH 5KVDH 1NMAL 4Y8DC 4Q6IC 1XF5B 3S88L 1F4YL 4PJIF 1MPAH 2ICES 1KIPA 5MEPB 4OLVL 3DGGA 3DVNB 2FLRT 3VXSE 3RU8H 3NH7L 4MX7B 3MLZL 5BXFA 1IZJA 3HPJA 1D5IH 1J5OL 1MNUL 4DKAA 2NY2C 3QUMH 4Z7QE 1P4BL 1R3IH 3TA3A 2L7JA 3ZKMC 4ALAH 4NKOB 4RA3A 5J6HA 2ICCA 4E42B 5FYKE 3DWTA 2P8PB 3SKJL 5DJ6A 3HZMB 1AO7E 3OX8A 3HG1E 4NZUH 4ZS6D 4GW5A 4HG4J 3KPSB 4KZDL 3MLUL 3GI8H 3LPGA 5CGYC 1TETL 1TQBC 4X5WB 2XKSA 5HI4D 2UY6A 1HN1A 1M6OB 2J6EL 4PG2A 5HHQA 1H3XA 4NN6B 3RJDA 2OR8A 3U4EA 4U1GB 2B4CH 4JRXB 5DFVD 4MLSA 5IMKB 1DQDL 3RNQA 2LU4A 1NL0L 4LP4A 3NACH 1B0RA 3AMLA 2XA8L 2R1XB 1YPZF 3S35L 1WIUA 4YHOL 3N1QC 4Z0XB 1V5JA 4OV5A 4XXDB 4OZGA 3BZ4B 2AQ2A 3BPNC 1FL3A 2NNAA 3LRHA 4PV9B 1BD2E 1MCBA 5L6YH 1KJ3H 3WJLC 5H35A 3MV9A 1DQLH 4YHPB 4GT7A 2NW3B 5C09B 5IVXF 4X6CE 1U3HB 3D18A 1FO0L 1ZANL 4E9LA 2DM7A 3D3VD 4J3VA 2HTLD 4S11A 3S3JA 3OAZK 5IB3A 1ACZA 1WZ1H 3N1MC 3VFUA 1X9QA 4D0DB 2NLJB 5JOPE 3JTTA 2ICWI 5ISZB 3C6SB 1MJUL 5C0IA 5L8LB 1UXSA 2VC2L 1G7MB 2MPAH 3OXSA 5KAQF 1N6QL 1FZKA 5EZJA 5E2UL 4QTHA 2ADIB 5DHYB 1BLNB 3MLWL 5CJ8A 5KVEL 4L9LA 3FO2B 2V7HA 3FQUB 3HPLA 1L6ZA 3I6LE 4G9FA 5HD8C 5CBEA 4M1GH 4R2GC 3B3IA 5CP7A 1D5XB 4IRSB 4N0FB 4NNYB 4KTDH 4L3AA 4NPYA 3SCMB 4U2YA 2VISA 2E7BA 4PR5B 3RDTA 4PB9L 5SX4I 4WO4C 4WWKA 5DHXB 2P24B 3QI9D 5DK2A 4DFHA 5C9JA 3RWEA 2E6QA 4LCWE 3QISA 4ISVA 1ZHKB 1WBYB 4WEBL 4ZPVA 3EYQD 1MIML 2VRAA 3ZDXF 4KVCL 1VCAA 4YBLB 4X99B 3ZDZF 3VCLB 3QPXH 3U9PH 3CFJA 2VLRD 4XNZB 1YZZA 1NAML 3GB7B 1MH5B 5I1DB 1KCRL 1LHZA 4ZUVB 5D1ZA 3EO1A 4HWEH 5IIEA 4QRPD 1A9BA 3BSZL 3DVGB 5JUEH 3WEXA 3HE6A 4KXZI 4G9DA 1SJEB 2GJ6B 3VXPA 5JORB 4Y88A 5D1XC 5E8NA 3I75A 4MB3A 3BIAX 1IFHH 2DQUH 5JIIA 3MRNB 3O6FD 1BHGA 5EOQL 3WUZA 2Q7YA 1BBJB 3OJDB 3VFNA 3P3YA 3VD4A 3K80A 4OZFA 2FBJL 2EO9A 3B2UC 3B2VL 4OCRH 5FKAA 1ZT1B 4O9HL 5HDLA 2V17H 1BFTA 3IKCA 3SQOL 2R0ZL 1CR9L 3D2UA 3C5ZB 1JK8B 3UPRA 4NJAH 1E4JA 2K1MA 4JQIL 5H8DA 4WW2A 2ID5A 5B39G 5J12C 3T0BA 1WWWX 5LAXB 2FECI 4JFDD 4K94H 3U36A 5J3HC 5C0AA 3TPKA 2IFFH 2Y7QB 5HHOD 1DSFH 2BNQE 5DD0L 3X17A 2VDQH 1XZ0A 2EEAA 1MCHA 4PRPD 3BKCH 3KPRA 3RWFB 4DKFH 4NHUB 1KBGH 4NQSB 4B50A 1ZVHA 5DEFA 4QXUL 5C0EB 1QZ1A 3TN0C 5EU6E 3B9EA 1UWGH 5L7XL 2WP3O 3D3VB 3QDMB 1WV7T 4HPOL 4PJ9D 3MA9L 2I60L 3MYJA 4HJ0C 1RUAL 3TNNA 4LPWA 4R26L 1PKQA 2AJXH 4MXVE 2OCFD 3LH2H 1IEBB 3ROLA 4E41D 3TP4A 1KPRA 1FFPA 3IFOB 4HS3B 2R23B 3CSYB 4OJFH 3UTTB 1EEUA 4OSUL 1IC7H 4KK9D 2F53A 3SDXB 1CF8H 2X42A 5HYJE 3O3EB 2VDKH 5BRZD 1AJ7L 3TO4C 3WUWG 3AREC 5FA3B 3P40A 2COQA 2H9GA 2H2SD 1FYHB 4IIQC 1P69B 2GSIA 5GGRB 1YC7A 4RAUB 3VXRE 5E00B 4XPTH 3MLSH 4HWBH 4BFIA 1UQSB 1UB6A 5IJVA 3PDDA 1FSKB 4NZRL 4U05A 4FABL 3HZVA 4CBPA 5DFWH 2CGRH 4NQUA 4D0BA 5FDWB 3P73A 4JY5H 2XICA 1OQXA 4F7PA 1OCWL 2VLRB 4HUNB 3PXHA 4PJ8B 1J12A 4NFDA 3O9WC 2ZCKL 4GUPB 3ISWA 3MRGA 1LGVA 3W11C 2CH8A 3FB5A 3ULVD 1EHLL 4QRPB 1MAML 1VDGA 1UH3A 4U1NA 2MNUA 1MFBH 4NWUH 1T1XA 1UH4A 3NCJL 3BKYL 3WS3A 1MCPH 5FYKL 2ZUSA 3Q3GA 5E2JA 4DVRH 1NFDB 5HHVH 2APWA 3BQUA 3MBEA 3MJ7A 4XPGL 3RPIA 3V0AC 3JWDC 4YFDB 5JOFB 4HIHB 4NUGH 1Q9WB 1JUFA 1S7SA 2RCSH 2HH0H 4EIGB 5EZOL 4LDEB 2IBZX 4W6YB 1LK3H 3INUL 4FFYH 4U1JB 5DJXA 3F7PC 5LGHL 1SEBA 1TVBB 4YHNB 4DTGH 1NGZA 4HH9A 1FNAA 2PTVA 4JY6B 1TDQA 3OAYK 1S7WB 2WIIA 4XCFL 3DURA 4PV8A 1S5IL 4WFEE 3BEVA 3ALPA 2QTEA 3SDXF 2WUCH 3EYUH 1OAUH 2W38A 3FQTB 2QSTA 3IS1X 5KSVA 3F12A 1L7IL 4JFXB 3MUGB 1KB9J 4GW1B 2HLFD 2A1WH 1A7RH 5GS1C 4IDJH 5IB4A 3NFSH 4PJ9B 4OQTL 1VADB 3MNVB 1Z9OA 5B38G 1LK2A 4O51B 5EO0B 1PG7W 1HNFA 3MC0A 5C0ND 2DQGL 5T3ZE 2VDOL 1JGVH 3BW9B 3NFPA 3FQXA 3GIVA 5IMMA 3RY6A 3I2CL 4HDIB 2J1KA 2GFBA 4MSWB 3BD3A 4LGSB 5DURB 2GIYA 1OB1A 4DEPB 2F15A 1AKJA 2DLTA 5BRZB 1F6FB 4W4OA 4PJEE 3QUXA 1QFOA 1YEGL 3PJSA 2F58H 4J4PA 4YPGB 2EDKA 1RQ5A 4XAKD 1JWMA 4CJ0A 3O2WH 4EDXA 4PRIA 4ZPTA 5I8OH 3GMPA 1XAUA 2EDNA 3QEQE 4Y1AB 3H9SE 1WUNT 4MXWL 3NCBB 4PJXE 4HCRL 1LE5B 4NN6C 2XACC 2OSLB 3KPNA 4UB0H 3LPFA 4R4ND 5KVFH 4RISH 1Z0MA 3CPLB 5JXED 3MACH 3VG0L 3ZE1E 5I1GH 1KJVB 4EOWL 1R6VA 2PW2A 2GJZA 5BZWB 4MJ5A 3G6JE 5EBGA 5EN2A 4FFZL 4M7JL 1U8KB 3DX8B 4GRMB 3HI6L 4YGVB 4Y8AA 1Q9KA 3CH1A 3WJJC 4JZJA 3CZFA 2XN9E 2O5XH 4MA7L 3FZUC 4D8PA 1IGCH 5BS0E 1RPQA 4NRYB 4ZMAT 3GNML 3NA9L 4NBXB 4NO2A 3IGAB 3GJFK 3S5LG 1P4IL 4JPVH 2EIZB 5FO9B 2OBGA 3DRQA 1QR1A 4L5FH 5GGQH 1K4CA 3MGOB 1R3JB 2I07B 3VJ6B 4XB8A 2PCPA 3MLYH 3H9HA 5IEHA 1RI8A 3P4LA 3H0TA 4G5ZL 1CICC 4UQ3A 3FB7A 4ODSL 5KVMC 2UWEB 3L1OH 3AU1A 5CJ5A 3OB8A 4PJBE 5CJQL 4OKVB 4NQXA 4DQOL 1MCIA 4IM8A 3HNSH 4X6DA 3CFBA 2DWEB 4JPIB 1NEUA 5HGDB 5HYQA 5I18L 2KBGA 2A6DA 3GSVA 1IAII 4XGZB 4IRSC 2XZQL 3TPUB 3B43A 5E5UB 3U4BL 4H5SB 4ZFZA 4LLQB 3LN4B 4MQTB 4NDMA 1J7VR 4L8CA 5CCKH 1A5FL 4WI4A 3CX2A 5DRXB 5D2NB 1E4KA 4HIJA 5F9JB 3HS0A 3BZEA 4RSVA 3OXRB 2KDGA 5D2LB 1JVKA 1RU9H 2OL3A 1EAPA 4XP6L 4AT6B 5MP6L 5AD0B 2HFGL 3BGAA 3ES6B 3FO1A 1IGTB 1OP5K 4N0CC 1R3LA 3VFRA 3KLSA 5HY9A 4KHTH 2VLMD 4PJIA 1MCRA 1S9YA 1ZLSL 3DRTA 2GQHA 2FJGA 3MZTA 5HPMB 1MHPH 1G7HA 1U8PA 1YNTA 2WP3T 3LS5L 4U1SB 5CEZH 5DRZA 1XGTB 2YD2A 2WQRA 3FTGA 4E5XA 2BDNH 2IMNA 4KKAD 5DUPH 5B21A 2BC4B 1K6QH 1W72L 3O4LB 4QOKD 4MB5A 5BW7C 2DI9A 4YK4B 4FTVD 2HRPL 3G5VB 1G7IB 2A9ML 3D48R 4JFFA 4ELKA 1IGFH 2ICWJ 3BPLB 6FABH 4KJYA 3TYGL 2I5YL 5D1QA 3C6LA 1DVFB 3RWDA 4JFQA 5I8CA 1M4KA 2YWZA 5CSBA 4EUPA 3C5ZC 2UWEF 2N4IA 1FG2A 1NUGA 3G08B 2ZCLL 2ATPA 2UYLA 3IFPB 4RQQB 3W9EA 4KAQL 5HHPA 3PIQA 2AK4A 4Q9BA 2VWEC 2R69L 3REWB 1YPZA 2BJML 5CFHA 2BFVL 5D7KD 3L3JB 3C60B 1HI6B 5JHDD 3I9GH 2CLZA 3KYMA 5CGYD 5I0DA 1SJHA 2ITCB 5F89B 1CG9A 1G1CA 2NTFA 4I3SL 3H3KA 1KELH 4PJFB 3O3UN 1VGKB 1BFOA 2DOCA 5DI8B 5GRZA 5L0QB 4JZOA 2DBJA 4IRJC 3WNPA 5D2LF 5JMOC 3NPZB 2JE8A 4PJ5D 2B5IB 2Z92B 4NP4H 3FQWB 4EIZC 3VXME 1HYSD 2MKLC 4OTXH 3MQIA 4YZFF 4XTRC 1XF5A 1CIDA 4Y5VC 1J8KA 2E7LC 3DJ9A 4P5TC 1DN2A 2NX5D 1MCWW 3DVNA 4HBCH 1F2XK 2VLJE 4OCLC 4H0IA 4K07A 4MX7A 1J0JA 4L3CB 1F42A 2YK1H 1FV1B 5GS3A 2Y5EA 3ARDD 1DQTA 4G7YH 4NKOA 1GIGH 4XVTL 5FKPA 4FZEH 4E42A 5HHNB 3ARVA 2P8PA 2EEDA 3HZMA 3T0AA 5EC1B 5I66A 5SX5K 5IFHH 5DK0B 1BVKA 1YMME 1FSKC 1HHHA 3KPSA 4H0HB 4QNPE 1KLUB 5FGRA 2Q86B 1MJ7H 4X5WA 2CDEB 1M6OA 3PWPE 1H3VA 3V0WH 3WO4B 5D70L 3ILQC 4KV5F 4MDIB 1NKOA 4JRXA 4ZTPL 2Z4QB 2OS7A 5IMKA 5T3ZL 4Q0XL 3S96A 2P5EE 3T09A 5I9QB 5ICYB 2R1XA 4OUUB 3QFJE 5E94A 2YD9A 3V95A 5TF1H 1Z0NA 4R2GD 3QDAA 3EO9L 3KHQA 2QADC 1KTLA 4LHQB 4Z0XA 2GKIA 3EJYC 4XXDA 3A6CH 3O8XB 2DKUA 2AXFB 3BZ4A 1CDBA 2EH7H 4PV9A 4KTYA 1PJ9A 1YN6B 3JZ7A 4WO4D 4FTVB 2AK1L 2M26A 4NKQB 4YHLL 4YHPA 5JZ7C 3OBAA 4PJFF 2NW3A 3CVIL 5GGTA 1MCSA 3QNXB 4NC0B 5FYLE 1U3HA 3WIHA 1IQWL 4P23B 4B7IA 2E27L 3R1GL 1OGAD 1N0XL 5FUOL 3JV4B 3IXAB 5CGMA 5SWZE 1BZ9B 4UILL 1MFAL 1WLHA 2ESVB 4DKEL 4XWOD 1JGDB 4TSCL 2NY5L 1Y18A 3S36H 3RBGA 4I0CC 2IAND 2NLJA 3CIQA 4JRWA 1G9EA 5CSGA 3Q5YA 5B8CB 5K9QG 5ISZA 1BM3L 5IQ7H 4U7SA 1G7MA 2EE6A 1FFNB 3J7HA 2B8OT 2EC9T 2M2DA 3T1FA 1GGTA 4GXUM 2W9DH 2W0PA 5FO7B 5JOEA 2ADIA 3IDJA 1BLNA 4NO3B 3FQUA 2GCYB 3WIIL 4YDLC 2VKWA 4D3CH 1G6RA 1D5XA 3WFBH 2FCBA 4P2CG 4XMKH 4N0FA 5ABDE 5DJDB 2X4NB 5CJOH 4NNYA 1J10A 3SCMA 4JZNB 4NN7C 2B0SL 4PR5A 2XZAL 1CIUA 3SDDC 5CHNB 4XPBL 4YUEL 1R5VB 4AH2B 2P24A 1NUNB 4BYHA 3LKOA 2BRQA 1KIQA 1ZHKA 2BSSB 4NKDB 2VQTA 1S7XA 5C7XH 2B2XL 4I13B 2XWBB 3I50H 3IDUA 1CGWA 1X5YA 2AQ3A 4DEPC 3GEWB 4X99A 1JTPA 3VCLA 3VXQB 5J3HD 3QUMA 4UTAH 4P3CH 7CGTA 3B9DA 3BYYA 5I1DA 5ICZB 4ZFOB 2VXUH 4ZUVA 5SWQB 1QBML 4OM1H 4P4KB 1I7TA 1ZHNB 1N5AB 1GPOL 5CILH 5ERWB 1NCDL 4OCYH 4EI5C 1GH7A 1FIEA 2XY2A 2GJ6A 5JORA 3RVUD 3VH8B 5IR1B 4XCNB 2EDWA 5ANMB 3U9UB 3MRNA 4OD2B 1ZKAA 1BBJA 1V7MH 4AM0B 4DZBA 3OJDA 3PQYD 4NUJB 3MXWH 4OZGE 5E8PA 1V05A 2NY7H 3VFSB 4P9MH 1ZT1A 2X2YA 3MV9E 5DMGC 3TM6A 3HI5H 1AXIB 3DI2B 4FQ2H 5DZNA 5DGRA 3L6FB 1JK8A 4WRLA 4Q9QL 2IBZY 2DAVA 4WHTB 2JJVA 1YY8B 1KNOB 3S37X 3RTQC 4RGOL 1IZKA 3GJEA 3NAAH 1F45A 5GXBB 5DZOA 4EBQL 4RMSA 3RWFA 3TCLB 4NQSA 5C0EA 3MRQB 3K81A 5C6TL 5FO8B 2PO6B 2X4QB 2QHRH 3G6DH 4TVSa 3D3VA 3O9WD 4GQ9H 4RFEA 2ARJB 1QA9B 3MJ9L 3PWVA 3ECBB 3BI9X 5DQJB 1DEDA 3D9AH 3KPOB 3V7MA 1TJHL 3PP4L 4OM0H 1IAIM 3F7VA 4G9FE 4FQJH 1IEBA 4HD9A 3FQRB 4KJQC 4RMTA 2R23A 1U8NB 4H88L 4PPTA 1MCFA 4LSUL 3SDXA 3DXAD 3O3EA 5IW1B 3V0VA 3CC5B 1KF9B 3JWDH 1N7ML 5FA3A 1ZXQA 4LIQH 4JVPA 5L88L 2HJLA 4PIRF 2NQCA 3KHOA 1HINH 2MJWA 3SDAC 5GGRA 4CN4A 2UY7A 4YDIH 3IETB 4M48L 3P4MB 4XNUL 2A73B 1QFUH 2R0WH 4Y4KB 1A14L 1LO4H 2JIXD 1UQSA 3MFGB 3VD7A 5J13C 3QB7C 3SDYL 1X5XA 4MMXC 4OZHE 3MYZA 1IEHA 3SE9L 4YBQC 5DRNB 4IMKC 5FDWA 4AQ1B 4J1UB 4J12A 3MRHB 2VLRA 1JMZA 4PJ8A 5A2FA 4GUPA 1JN6A 1PG7L 5L2JB 1UZ6E 4QRPA 4L4TD 2OMBA 3EZJB 1AHWC 1A1OB 1Q38A 5DQDH 1CFNA 1KCSH 3HC3L 2W9EL 2FH6A 1K8IB 4KJPD 5AZ2H 3OF6D 3P9MA 3BPLC 5TDNA 3CAFA 4HIHA 1IC5H 1Q9WA 4FQ1L 1N59B 2EIEA 1JV5B 4LU5H 4AMKH 3C2AH 3WD5L 1JZ3A 3ZTJH 5EU5B 1U8HB 4S1SL 4M5YL 3MTRA 4XP5H 1SVZA 1TVBA 4YHNA 1A7NL 3DVIA 5F7EL 3KJ6L 4LPUA 4MS8C 5EIIB 4JY6A 1T89A 4F33B 1S7WA 3C60C 3KPRE 1W0WB 1GSMA 2YKLH 3OJVC 4JANB 4OJFL 3PWNB 2HKFL 4KK5C 5DLMH 4BSVA 1QRND 3ULUC 1KJ2H 3FQTA 2RAMA 5HHOA 5L0QC 3T77B 4JFXA 3MUGA 4N8VB 1JWSB 3E3QC 2C1OA 3ARBC 1MWAA 4YIQA 1PKQE 4GW1A 1DBJL 1IL1B 3MV8D 5CBAA 1NGWA 1RHHA 1ZTXH 4WU7B 5FYLL 4PJ9A 3RY4A 1VADA 4U7MA 3MNVA 2F53E 4NNPL 5F9OL 3V4PH 1D5BB 3BP4B 3B5HA 3GSUB 2R15A 1JNNL 4GAJH 1ADQL 4O51A 5EO0A 1BFVL 3FAXA 3QIWB 3FZUD 1NLBH 4N68A 3BW9A 4O58H 4E41A 2DQIH 1P9MA 1KV3A 1AIFB 1MUJB 4I18B 1W8NA 4I2XA 3JUZA 4HDIA 4RBPH 1TNMA 5BRZA 4BJLA 1K8DB 2ZUQC 2P49B 4RX4D 1L9MA 1SBBA 2AEWA 1RZ8B 1MFBL 4YPGA 2FR4A 1T5XB 2IGFH 5I8EB 4R97C 1YC8A 1A3RH 4PYGA 2H26B 1YDPB 1CICD 1ZE3C 3JV6A 3LCYA 4GG8A 4C56B 1YYLH 2XQBH 3ZYOA 1KB5B 1ZOXA 1LE5A 1IKFH 3TVMC 4H1LG 2OSLA 1ACYL 3MSPA 3P9LB 3DSFL 3H6JA 4OFDA 1FGVL 2UV3A 1QSEB 1KJVA 1M7DB 3MGTA 5BZWA 3V4UH 5I15L 4RMVA 5I9QC 1ZHBB 2X10A 4LHJB 1U8KA 1FVDB 3WFCL 2A6JB 3T0XA 2BXZA 4RGNC 4Z7NE 4GRMA 2FGWL 4XAWL 4LRIC 2RB8A 4YGVA 3DV4B 1IT9H 4MZ2A 4PJ7B 3T2NL 3U7WH 5LVEA 4QHUB 3N9GH 5JDSB 2BP3A 2PYFA 2SEBB 5DHVA 1S78C 2WZPD 5CLTA 4NRYA 4ZO9A 4L8SC 4PBXA 1BJMA 2R29H 3IGAA 1XH3B 4N0CD 2EIZA 5FO9A 4P23C 4HK0B 4JDZA 1YYML 3EIFA 1CT8A 3SOBH 1R3JA 2I07A 4JR9H 3RWIB 1RMFL 3NOIA 4WHYH 3TJEL 2JCCB 3IXTB 2DQJH 4N0RA 4TVPE 1CLZL 4P0DA 2UWEA 2VABA 3DARA 3MBXH 35C8H 4K3DH 1BX2B 4CU6A 2G60H 2F8VA 2JB6B 4OD1H 4OKVA 3FRPA 2DLEA 2CMRH 2DWEA 4HGWB 1QRNB 1L0QA 1TTFA 3DV6B 5GGVH 5HGDA 3OKEB 5E56A 3JVGC 3VWKD 3RA7L 4XGZA 5D7IA 1W2KT 3PDOB 3O6LH 3TPUA 2X4SB 2DLFL 3KLAB 4LLQA 3LN4A 5AYQA 1T0PB 4PB0H 4QHKJ 3H7BA 1C5CL 2JK5A 5D2NA 3IDIB 4P4RB 3S4SB 2CR6A 4PP1D 3VGDA 1IM3B 3Q6FB 4HWUA 5D2LA 4Z7OE 4TOYH 3JWOC 3OKKB 1XCTA 4JFPB 4Y16C 3ES6A 1G7JB 4NRZB 1IGTA 5HVHB 3NIGF 5CUSL 4F7MB 4QRRD 3UO1H 4LSQH 4PRIE 5CIPH 3QO1B 2H3NB 1IGMH 4DGVH 5HPMA 1FRGH 4U1SA 3R0MA 1JGEB 3U0PB 1XGTA 4P3WA 4PJ7F 3THMH 2XNAB 1XIWB 1QTYT 4IRJD 2BC4A 4GLRI 1MRCH 2ARWA 1MFNA 1ZVSB 2W92A 1DBAH 3C87A 5JHLL 5I1KL 2QQLL 1M71B 4P5TD 1G7IA 1X5FA 3HE7C 4RWHA 5JXEA 5K9QI 4EXPX 1CDHA 3MLYL 2YWYA 2GW5A 1CE6B 4O2FB 1P7QD 4G8IB 1DVFA 3SGJC 2JCCF 2V9QA 1U2CA 5DD3H 1NDMB 1FYTB 5J0BA 1S3KL 4I9WE 4RQQA 1QFWI 4JGMA 4D0CB 2ZUVA 2Z8WC 4MA3B 1HHJB 1NANH 2X4OA 3REWA 3T65B 1YEDB 4FQXB 2DQFB 3L3JA 3MCKB 3BGMB 1HI6A 3LRSA 3OAZH 4ZAKC 5GISH 4NHCH 1B88A 2CRMA 2ITCA 5F89A 1BBDH 5EFIB 2DQEH 4PJFA 1VGKA 5GS0L 2PO6C 5DI8A 1DFBH 5EU4B 3SE3A 5C0GB 1AR1D 4YPJA 3T0DA 3OB0K 1SM3H 5D6DA 5DC4B 4X6DE 2Z92A 2N1KA 3FQWA 2Z9TA 4WTZA 3SDCC 1MVUB 5IHZA 1MFCH 1YEHL 4K3JH 1QBLH 4JRYD 2X1WL 1OAYL 2H32H 1PQZB 1L4IA 4AG4H 1UWXK 1AD9B 3EJYD 5IT2H 1PYWB 3KJ4B 2YC1A 1MJ8H 1EUUA 3SPVA 2AJVH 2NMSA 2VOTA 2X4UB 3WFDH 1HWGB 3WFZA 3STZA 3QEGH 4GRWB 4L3CA 2RFXB 1T4KB 5JIPA 1E4XL 1FV1A 1YEEL 1TJIL 3OR7A 1WTGT 5D8JL 3EHBC 1XGPA 3DSNA 1FCGA 1NCTA 4MWFB 4KZEH 3BIKB 3A0OA 1UADC 3WKMH 2R56H 4MAUH 1WWAX 5DVLA 4FHBD 5HHNA 5L8KB 1EJ6A 1R3HB 5ACLA 4PJIE 2XKUA 4JFZL 5EC1A 2UVFA 1Z9MA 4X98A 4U3HA 4XX1G 5DK0A 1KLUA 1RFDL 3PDGA 1IGFL 1U3YA 1IAKA 4LRNL 4G3YL 2VXSL 2FD6H 3SE4C 2PKDA 5EPMB 4DN4L 2Z4QA 4NJ9L 4XC3H 1MLCA 1LO2H 3O6KH 1FE8L 3O2DH 4F9LA 5CZVL 4XP9H 5TPWL 3S98A 2FDBP 3Q6GL 4DGIL 3O8XA 2AXFA 2HP4A 4Z7UB 4OLXH 3SDDD 5K9OA 3TGXA 1LO5B 4FTVA 1W0VB 2RJMA 1DN0B 5IESL 5TDPB 1I7ZB 3KYKL 3RVXC 1MCOH 3I85A 3BFOA 4X7EC 5EU3A 1JNJA 2AK4E 2V7NB 1RZKC 4XVUC 2NY1D 4YXLL 1YPZE 2OXHA 1LEKA 5C0CD 4P23A 3WNKA 1NFIA 1HSBB 3JV4A 3IXAA 5CWSB 1BZ9A 2A2QT 4U1MB 2ESVA 1Q1JL 1BJ1J 1JZ8A 3AROA 5JQ6L 1JGDA 5A40E 2EDRA 4R4FL 4O02L 1I8LC 1UYWH 2XTJB 5B8CA 3MREA 4HBCL 5GGUB 4N90D 3NFNA 4PLKD 4DCQA 2ICWB 1FFNA 3QT2A 4GRWF 2YK1L 5FO7A 4KC3B 1ZLVH 2FJHB 1BPVA 1UJ3C 5F1OB 1FG9C 3G6AB 5GZND 3QUYC 4NO3A 1E4WH 4KKBD 5E4IA 2R8SL 3RFZC 2QL1A 5GRXG 3HFMH 2OR7A 3ARWA 4R90L 4PLNC 3CK0L 5DJDA 3MRCB 2D7TH 4FQHB 4LAQH 1T0MB 4RGMC 4PJ5A 3L3OB 2A74B 4JZNA 5BVPH 2C3HA 5DMGD 5CHNA 5A2KH 4XCCL 3RVWC 1FZMA 1UACL 2OR9H 1QFHA 4I18C 3QA3A 4JPWH 1B4JL 2BSSA 3QWOB 4U1IB 5EC2B 2WK2A 4TVPL 4NKDA 3RI5K 3VRJB 1RZJC 2E6PA 2XWBA 3RTQD 4KWUA 5DYOA 1VFMA 3HUJA 3OL2A 4ORGB 2HT3C 3FRUB 2E7HA 3KPSE 1DBMH 3PGFH 4G8GD 5HSFA 4PJCB 4NM8L 3ARDA 5ICZA 1NCAH 4F58L 1J1XL 1JNLL 1H8OA 5SWQA 1XF2A 3W39B 3MRFB 1JI2A 4WUKH 2WM0A 4D9QE 4P4KA 3VXOB 5I75C 4ERSL 1ZHNA 4Z7UF 5DS8A 5DT1L 3DETC 4QT5B 1BAFH 4JRXE 5I8KH 5ERWA 3ZDXE 1KYOJ 3VFVB 4MJ4A 5BJTB 1QO3A 5GSRB 4S1QL 3VH8A 3ZDZE 2K3TA 5E95B 2VR4A 4NIKB 1JZ5A 3RBSA 4LAJH 4LLUA 4XCNA 3S37L 1GVIA 1T1ZA 4WHDA 5ANMA 3U9UA 1U95B 4PYHA 1G0DA 5LGKA 1Q0YH 2P47B 3V79C 4TRPL 4JG0L 4KJQD 4LSVL 3QDGB 3W0WB 1BD2B 1H5BC 3CCHB 1HIML 1TENA 4IHOB 5EBLB 1D3CA 1R24B 3FMGH 4X6CB 1NH6A 2JLLA 4Z0BL 2PYEB 3MA7A 4OI8A 3SDAD 4HK3J 3EDJA 3PGDA 1HH9B 1KNOA 1UA6L 4PGEA 4TQEH 4UNVA 3P11L 5J1TC 3WLWC 3QUKB 2AJSL 5M94B 4CVZB 3TCLA 4G6ML 4W4NA 4I0PB 1FNLA 3SJVD 5ISZE 3MRQA 4U1LB 5C0CB 1D5ZA 5FO8A 4U0RB 2PO6A 2X4QA 1DBKL 2XRAL 1NCWH 2BY2A 2DM4A 3ORJA 3DI3B 3VG9C 3ECBA 5DQJA 2D4FA 3TBWB 3D39B 3ARFB 3FQRA 1H8NA 1FVEA 4KHXL 4OCXL 1EGJH 1S9KC 5GJTL 4M7ZB 2PF6A 1TTGA 3BPOC 1R5IB 1MI5B 4BH7B 4P46B 4BQ9A 4PJCF 4RWYH 2AXGA 5IW1A 4N5UA 2QR0A 3CC5A 4KKNA 1A6VH 1MHEA 3HAEH 5MI0C 5FM8A 1CU4H 5FECB 5I6XC 3DYPA 3W2DH 4GG6B 3RKDD 1FAIH 2IH1B 2ADFH 4UV7H 1DP0A 5F7FA 3X3FH 3P4MA 3GDBA 2A73A 4Y4KA 1CVSC 2CJUH 4URTB 1FNHA 5E99H 4PS4L 1GHFL 1EFXD 4XP4L 5HYSB 2VXVL 3L95B 4EN3D 3NCCB 2PUQT 2I9LB 3LD8B 3QPQC 2DM3A 1FLRH 1XF3A 2BSRA 5DRNA 4EQ3A 4J1UA 3MRHA 5HGHB 3ULUH 3BO8B 4X6CF 2GJ6E 1NBVH 1QLEH 3BWUC 2YA2A 1A9EA 1NGQH 5J11C 2PN5A 4DVBB 3CXHJ 1QHPA 1A1OA 5D7LD 1YMHB 1JNHB 5EO9B 3NAAL 4CMHB 2E6JA 1KPVA 5I30L 1K8IA 1O5DT 3KR3L 3VD3A 4WVRA 1NEZA 3QQ9C 5EUKB 1OOAA 2VQ1A 2DQCL 4UU9B 1TNNA 4OGXH 3HZKB 1N59A 2BNUB 4AL8L 1QFWM 2QHRL 3G6DL 4F37K 1NCBL 1WT5C 1U8HA 4GW4B 5F3BB 3KWWB 3EOBB 3SY0B 3GJFH 1HNGA 4LPTA 2BNQB 2EDOA 1ODAA 4ZUSB 5EIIA 4FQJL 1ZLUK 4F33A 3CMOH 1W0WA 5C08B 1TMCB 3GHBH 4JANA 1UB5B 3PWNA 3P30H 3MOBL 3PXJA 3D3VE 5E5RB 3TVMD 3ET9F 1E27A 2H6PB 1DCLA 1VFUA 3T77A 25C8H 2Y23A 1BIHA 2AGJL 4GG6F 5T1DH 5L9DH 2BVUA 4U6HA 4BK5A 1IL1A 1HZHL 2NXZD 4LCCC 3UTZB 2BMKB 3UJJH 1ND0B 4WU7A 3V4VH 5C86A 3QG7L 4NO0B 5I2IA 4RGND 1QSFB 1G6VK 3SDXE 1W72B 3RVTD 1D5BA 3BP4A 4MA1B 3GSUA 4P2OB 5TF0A 1GZQA 3GKWL 3MNZA 5ALBL 4NKIH 3QIWA 4YDKL 3BXNA 1MUJA 4L1DA 1P4LB 3NBNA 4JKLA 4LPXA 1OW0C 4HIEB 3NCYP 5EA0H 1TJGL 1E6JL 4MYWB 1II4E 3ARGB 1OP5H 4DAGL 2G75A 3R8BB 4N0UB 1K8DA 1RZ8A 2QQNL 4HQQH 3TH2T 1KEMH 5I8EA 5LKNA 5KSBB 1CK0L 5B4MC 3PP3K 4I1NB 3H3PL 3RP1A 4KFZC 3HI1B 4KQ4H 1YDPA 2OQJB 3IS0X 2VLRE 3TBVB 2Z35B 1KB5A 3OGCB 1PVHA 1MF2H 3NN8B 1EFXB 2QQKL 3P9LA 2ZUUA 2X44D 4EN3B 1CFSB 5ADOL 4QRPE 3RI5F 3B9AA 1RZ7H 5F6HJ 5TQ2L 4GBXD 4XP5L 5JW4M 1ZHBA 5KS9B 1EIBA 1LP9B 1FVDA 3MRMA 2A6JA 5KW9L 3PE9A 4WV1C 4F3FB 1DL7L 2FL5B 2R2BB 5A2IH 5HPOA 2VL4A 3OKDB 4PJ7A 2VN7A 5JR1H 1BWWA 3LIZL 4X80L 3R8QA 3LKSB 3NTCL 4A6YB 4WDIA 3F58H 1RZFH 5JDSA 5C0RH 2MKWA 3WDJA 4OCWL 3EJZD 4L1HA 2V5MA 3JWOH 1XFPA 4F80A 1RK1B 1XH3A 4QGYA 2PW1A 1JHTB 4UAOC 2L7UA 4HK0A 5GJSH 2ZP0T 3WE6B 1ZGLM 2DS4A 2DLHA 4XI5D 3U7YH 2GI7A 3PL6B 1YNKH 4KKCC 2JCCA 3D0LB 4K2UH 3IXTA 2XTJC 4WHCA 3VMPA 1P84K 1BX2A 1CGXA 2JB6A 5IBUG 2NZIA 5DJZB 4S1DC 5GGTL 1F8TH 3EOAA 4BM7A 2Q20A 4HGWA 1QRNA 4EXKA 3DV6A 1SHMA 4IRZL 3OKEA 1X4XA 3WIHL 1Y0LB 3PDOA 4XVJH 1KUMA 1NCCL 2X4SA 5KSBF 1CD8A 4E41E 1PZ5A 3IDIA 3MV8A 1JWUB 3S4SA 2WLZA 1DANT 4LCIH 1ED3B 3FAWA 4I2XE 2J8HA 3GSNB 1IKFL 3L5XH 1CLOH 1VGEL 5E9DD 1IM9B 4LCYB 3OKKA 1CL7H 4PRHD 2MSPA 4JFPA 2X1PA 3MJ6A 5BRZE 5J06A 1H3PH 1G7JA 4NRZA 4XWGH 4CMMB 2C3VB 2VTFA 43C9B 3K2UH 2XG5A 4PGDB 4F7MA 1Q0XH 2O61B 3QEQB 5KS9F 5C71A 1N6VA 3L3DB 4ONGH 4U1HA 1LP9F 5JNYA 1QBBA 3VW3H 3QO1A 1KLGB 1HXMB 1JGEA 5J9PB 3U0PA 4FP8H 2CQVA 1XIWA 2XNAA 3BH8B 4ZOBA 1TZHA 1RURH 2V5RA 1UM5L 4JREB 3MLRH 5FCSH 1NGXB 1ZVSA 4YXKH 4I77L 3QHTC 4MGXA 3C09C 4NZJA 3SDCD 4UT6H 3TBSB 1SY6A 1YA5A 1E6OH 3WS6A 1FGNL 1M71A 1MCJA 4YR6B 4A2LA 5K9KB 3S34L 1UVQA 3ULVE 3SOBL 4DGYL 1I1RA 1MHHB 1CE6A 4O2FA 5KOMC 5IBTH 4G8IA 4X7DC 5GSVB 3K3QA 4RCAA 4F7TA 2MFNA 1NDMA 4GXVH 2R2EB 4HUXB 1U3ZA 3EHBD 1FYTA 1MSPA 4D0CA 2H41A 4QYOB 4YAQB 1YECH 3FN0H 4MA3A 4DKDC 3T65A 2ZUWA 4KDWA 1YEDA 2KZWA 2R1YB 4FQXA 2DQFA 3MCKA 3BGMA 1O7SA 2QSCH 4U6VH 1QSVA 2D4DA 2QLVB 2FEDC 2WAHA 4I0PC 1R3KB 4PJBB 2UWEE 5EFIA 5F96L 3T8XB 2Y07L 5GS2H 5DFTA 5I71C 2C5DC 4Q97A 5KG9B 1TPXB 1EEZB 1FDLL 4PREA 1EJOH 1MVUA 3RNKB 3ARFC 1IARB 3O6MH 4NM4H 5CLWA 3U0WL 3CLEH 5ETUB 5TE6L 5I1HL 5KSAB 5JMRA 1INEH 1AD9A 3HB3D 4P46C 5KZCD 1CLYL 5D2NE 1U93B 2ZCHH 1MRDH 1YUHB 2VR9A 2X4UA 5EOCJ 5D2LE 2RFXA 3CU7A 4M1DH 3VWKA 1NMBL 1NC2B 3HMXH 3UXFA 2H8PB 4HF5L 2V5SA 4MWFA 3TJHD 4LLWB 3BIKA 3QIBB 5I1JH 3UC0H 4YZFE 1RZKH 1OP9A 1R3HA 1MRFL 3OAUH 3P0YH 1CN4A 5BMFL 4H20L 5C07B 1CVRA 2YUWA 1RSFA 4M7LL 4J3XA 3ZKXC 1MEXL 4PRHB 2CLRA 3VXNB 4KQ3L 2KQNA 1CXLA 2NY6C 4G6JH 1AE6H 1U8OB 5K33A 5FCUH 4M8QB 4UOJA 4XAKE 2W65B 2XOTA 4UZGA 4QRRA 3LEVL 3PUCA 4J6RH 2W91A 3F7RA 1LO3H 3O4LE 5EPMA 5JQHC 1T1WA 5HVFB 1JRHH 5B39B 4MCYB 5CD5C 3S36X 5E2VH 3L3HA 3QUYD 2ED7A 2IQ9H 1J8HD 2MMXA 1HQRB 4XPAH 3LKPB 4YE4L 5DWUH 3FO9B 4HKXA 4MQSB 1CFBA 5D96B 2WWMC 2BCKA 1GGCH 3QXVA 1RZGA 5E8DH 3RGVD 2FO1A 1AFVL 4NQVB 2AKRB 1D6EB 4JO3H 4KV5E 5ENWB 1LO5A 3HNVH 3JTSB 1CGVA 4PJBF 1W0VA 4X7TB 1DN0A 3Q5TA 5TDPA 1K9TA 4HX1B 4JM2B 1I7ZA 4ZUTA 4FXGA 4JJ5B 1JI1A 2G9HB 3GMOB 1IGJB 2V7NA 4M4PA 3VFWB 1U36A 1F4WL 1RZJH 1P7QA 4BFEA 1C16A 1HSBA 3O3AB 1AGFB 1DDHA 5CWSA 3EO0B 3VXUD 2HT3D 5A1AA 3CSGA 4U1MA 4X6EB 1NEZG 4X9IA 1A6WH 5TE7H 1DTUA 4RNRB 4XBGB 4O5LL 1KEGL 2H2PC 1NUDA 1V3JA 3O0RL 3AC0A 2P7TB 4K3EL 1ZA3B 4PJFE 3LB6D 3WUWB 3BD4A 1VFAB 5JW3L 4C4KT 3WNMA 5IHBA 5GGUA 5HI5C 3DETD 3VGGA 3BAEL 3CFCL 2ICWA 2EC9U 4KK8D 1G9ML 2J2ZA 3VXMB 3FT2A 5EIQA 2FJHA 5MHSD 4WGWB 1T83A 2OX5A 3G6AA 4W68A 3ELAT 2JJSA 3FFCD 3H42L 3UDWC 1BJ1H 3QUZB 1CE1H 4KU1A 4GSDL 1BFSA 3A6OA 5JXAL 1T0MA 2OP4L 1YEJH 2A0LD 3L3OA 4P2OC 2AJ3A 4LVNB 1TCRA 3LS4H 5M95B 1U58B 4POZC 4JRYA 3ZHDA 3AAZB 4NN5C 4U1IA 5EC2A 1F4YH 4R0LA 3VRJA 5KZCB 3WHXA 1YN7B 4OLVH 4M61B 2OZ4A 1MWAL 5IB2B 5KN5B 4YC2B 4HSQA 3NH7H 5I17B 3MLZH 4ORGA 3FRUA 1J5OH 1MNUH 4PJCA 2QQQA 2ERJC 4QXWA 2WUBL 4G42B 4P2RD 2MOVA 3RZCC 3BN9C 3ABZA 3MRFA 2C3XA 5FYJE 5HYIA 2Y9RT 3O41B 3SEPA 3V6BR 4QT5A 3SKJH 4KDTA 4LVHB 3VFVA 4JM2F 2DF3A 1ZGLP 3QFJB 1IKNA 4KZDH 3LKNB 3EDFA 3MLUH 4PBVC 3KLHD 1TETH 5D4QA 3N1PC 5EU7E 3QRGL 2J6EH 5GGSA 3QDGA 3D25B 1LILA 4Z7WB 1MLBB 3CCHA 4PY8J 1DQDH 2IAMC 3L9RB 4LBEB 1NL0H 4FTVE 1R24A 2CLVB 5BV7B 1UYWL 2FSEB 2XA8H 4BFBD 5SWSD 2ZSVB 2PYEA 3S35H 3OKOB 4YHOH 4MVBC 1U0QA 4NQTA 1WBZB 1CFVL 1UWEL 3HKFA 4OFYD 1HHIB 3GUTB 3QCVL 1CTNA 4F9PC 4AIOA 4UDTB 2ESVE 1DEEB 4JM4L 1TQCB 1UG9A 4GS7B 5B38B 3QUKA 3QPQD 4CVZA 1AQKL 3PL6C 1B0GB 1OTUD 3QULB 4JFOB 1XEDA 3T0EB 4Z76B 4U1LA 1EXUA 3AXLB 5C0CA 1FO0H 5CD3B 4LPYA 4Z9KB 3IFLL 3ULVL 1ZANH 1P5UA 4WUUD 5D72L 4MHHG 5JPNB 4XRCB 4MA8L 5E70A 5JO5A 3O3DA 2DI7A 3ZTJG 3FONB 4M43L 3D39A 4LOUC 3QIUC 5AZEL 4GAFB 5GZOD 2CRZA 3NABL 4OLYL 1MJUH 5E8OB 2MCPL 2X70B 3ALXA 2VC2H 4Y4HB 1R5IA 1N6QH 4LEXL 3IB4A 5E2UH 3BRDA 3AM8C 4MQXD 3TA3B 3QQ9D 3MLWH 3B9KD 5J6HB 3PV6B 3FFCB 5KVEH 5KVGH 5FECA 3V6FB 4GG6A 3ZKSD 1JHKL 2IH1A 2FX7L 3DGCR 5DJ6B 1JYNA 4DN3H 4BKLA 2EXWC 5ACMA 5TQ0L 3AS1A 3ZL4L 5C6PB 3HUJE 4ACPA 4PB9H 3DBXB 1D9KC 4AIZA 4ZFGL 1DZBA 1U6AL 3VGHA 2B20A 5HYSA 3L95A 4Y5XB 4R7DA 2I9LA 2J3SA 4WEBH 1K4DB 1MIMH 4RMRA 3CJJA 2NXYB 4Z7WF 4KVCH 4UNUA 1QVOA 3EDKA 4HXBL 5HGHA 3QSKB 3M07A 4OF5A 2B39A 1B0RB 4UT7L 4G8GA 43CAA 1T2JA 4NNXB 1LD9B 2PR4L 1NAMH 3BKJL 2NY5C 2Z31C 2E5EA 4P2RB 5ANME 1KCRH 4OV5B 3BSZH 3L7FA 4OZGB 1KENL 1T5WB 4M93C 1QOKA 1YMHA 1Z3GL 2JELL 1INQB 5H35B 3GIZL 1EDQA 5JW4Q 1GGIL 2PXYB 5EUKA 3IF1B 2BNUA 1OTTC 1VFBA 5EOQH 4ZSOB 1FZOA 3EOBA 1X5LA 3SY0A 5MERB 3ZZ1A 1KXTB 2FBJH 3E0GA 4XXCC 5IB3B 3EYFA 1B4RA 3B2VH 4ZUSA 4O9HH 3MR9A 3BDBA 2VZOA 3SQOH 1AD0B 2R0ZH 3JTTB 1CR9H 5SWSB 4CVXA 1UXSB 2ADJB 4ZNEA 1UB5A 1FC1A 1FZKB 1EHNA 5EZJB 1O7VA 4JQIH 4FZ8L 4BUGA 1UM6L 4OLZL 4C83B 1IC4L 1UT9A 2H6PA 2EDYA 5CP3H 4WNQB 3QG6B 3C8HA 1SVCP 4G9FB 4U0QB 5DD0H 3GBML 1WGOA 2AJUL 4HJJL 3AFLA 4FQCL 4ZXBD 5DJ8B 3UTZA 1A02N 4QXUH 2CRYA 2BMKA 1ND0A 4BZ1H 4LHUD 5L7XH 4JFED 4NO0A 4IDLA 3X14B 4WWKB 1QSFA 4HPOH 5EO1A 3MA9H 2BX5A 4X4XB 1WCBA 1EBAA 2I60H 4JO4L 4NGHL 3TIDA 1RUAH 1N5YL 2P4AB 4ISVB 5K9JL 4X9GA 4R26H 5ESVB 1MCLA 4WHYG 3V6OA 3RY5A 5TDOA 4BSWA 1S7TB 1X4ZA 1P4LA 3TWCL 5C92A 4CN6A 4GJTB 4ZO8A 4APQC 4OSUH 3ARGA 1MHCB 3QIBC 1RAMA 4N9OB 5D1ZB 1AJ7H 3GFUA 3EO1B 2E3VA 3LN9A 5IIEB 5D7JC 1A9BB 1S7UA 5KSBA 3HE6B 4CVUA 1C1EL 3HI1A 3VXPB 3IDYC 2OQJA 5CMAB 3TBVA 5E8NB 5E2WL 1EFXA 2XWJB 3QEHB 1S9VB 4WI2A 5FM4A 2VR5A 5C70A 4EN3A 1CFSA 4NZRH 3TH4T 4K8RC 4S1DD 4FABH 5C0DB 2J88L 2VDML 4HKBA 5KS9A 3QQNA 1LP9A 1OCWH 4I3GA 3VXSD 2ZCKH 4JVUA 5D96C 1CGYA 2FL5A 2R2BA 1A22B 1HILB 3OKDA 3LDBC 1EHLH 4AIXA 1AGEB 1MAMH 1FBIL 1XF1A 3LKSA 4A6YA 2VERN 3PWJA 3O11A 4UBDC 2EYRA 5FGBC 1FZJA 5FYJL 5FYKD 1QPXA 5C0AB 4Y2DD 1CXHA 25C8L 2DJUA 3BKYH 3RUGB 5FYKH 1A47A 1RK1A 5BOZG 4ODBD 1JHTA 3KPRB 3PHQB 4XPGH 1I8IA 5TFSL 4JDVB 2MQ3A 3W5MA 5DEFB 2YOCA 3WE6A 2QSQA 5EZOH 4OF0A 2DL2A 4KTEL 3INUH 4ZOEA 3MYJB 3TF7C 5LGHH 3D0LA 2W07A 2DMKA 4HS8L 4YHML 3TBYA 1PSKH 4IOSD 3OB0H 1WC7B 3V7AE 2BHYA 3CFDA 4LSPL 4WGVB 4XCFH 5DJZA 1S5IH 2VUOA 3FT3B 3DECA 4XH2B 3WN5B 4AK1A 2YPLD 2OTWB 3G04B 3FKUS 3KPLB 3QO0B 3W82A 1UENA 1Y0LA 2DQTL 2P5WD 3QUZC 3VFGL 1I9RH 1UWXH 2V5TA 1RIUL 1L7IH 4F15C 5CJXA 5CKAA 5DJYA 2HWZL 5DUML 4H25B 1RULL 1CDYA 4M3KB 4M6ML 1ED3A 5F9WB 3GSNA 4OQTH 4BFIB 4NSKB 5ITFB 3GMNA 15C8L 4QY8B 4CMMA 2C3VA 2VYRE 43C9A 3RWCB 3Q1SH 5T3XD 2DQGH 2VDOH 4YC2C 3QDHA 4AENB 2O61A 5DSCB 2IPTH 2A83B 3L3DA 4KH2A 2AI0L 5F1IA 2EXYC 3VWJC 2QJDA 3I2CH 1KLGA 3VRLF 4Q6YA 1P7HL 3MOAL 3VI3F 1HXMA 3IDXL 4OIIL 2RHEA 1I75A 4OAWB 1RV6X 3FB5B 5J9PA 3BH8A 1YEGH 4OCSL 3IDMA 3NIGE 4XMPL 1NGXA 2OJZL 3UPAA 2VH5L 3I6LD 3RUGF 2HTKD 3Q3GB 3TBSA 3I02B 1FFQA 3RPIB 1WF5A 4HCRH 3DMMC 4LLDB 4WFHD 4TNWF 5K9KA 3QNZA 1L6XA 3SQBA 4PJ7E 4CL7A 5IBLD 1MCWM 3VG0H 3CGTA 4GBXA 1MHHA 4EOWH 3SKOB 5GSVA 2PTTB 4FFZH 4M7JH 4NOBA 4HXAL 1SEBB 2Q6WB 1OGTB 5TJWK 1NGZB 5CZKA 4HH9B 4HUXA 5MEOB 2R2EA 4XC1L 4PFEA 3B6SA 3HI6H 1KFAL 4QYOA 1J1OL 1U91A 1IQDB 5F21B 1T2QL 1ZWIB 3DURB 5IJKC 5HHMD 1OP3H 4M6AA 2R1YA 5F7MC 3ESUF 1TQCC 4GXUN 4CVWA 5KSVB 2WQ8A 3GNMH 3NA9H 2JCCE 3E1F1 1MIEL 2GK2A 1RD6A 1P4IH 1CXEA 3BHBB 1A1NB 5KG9A 5IFAL 2ATKB 3GSQA 2NY0C 5DVKA 3S9DB 1EEZA 1QRNE 1IE5A 3RNKA 4G5ZH 1UEMA 3ARXA 4ODSH 5ETUA 3D5OF 2BVQB 1U8MA 5KSAA 2WWMD 5CJQH 1ROWA 3HHRB 4XNXL 5LBSL 2Y4SA 3ZKNC 4CN1A 1DQJA 5ALCL 3MV8E 3WMSA 1HWHB 1U93A 3BEWA 1G7PB 3TA3C 3KPMB 4DQOH 2YPLB 1YUHA 1FORL 4YHIB 2AQ1A 4OZIF 5I18H 2P5WB 3QHFL 1NC2A 3QUXB 4LPCA 3LQAL 4UIKL 3PJSB 2XZQH 2WSKA 3OKMB 2O93L 4LLWA 3U4BH 1J9CT 2WANA 4Y7MA 4ZPTB 1A5FH 1AY1L 1PLGL 5C07A 1ZEAL 2Z8VC 4XHQA 2DTSA 1FJ1A 2C4FT 4JO1L 1U8QB 4PG2C 5E9DA 4G6AC 4FN0A 5EU6D 1INDL 2WINA 2G2RB 4PRHA 3VXNA 4X7FC 4XP6H 1V3LA 5MP6H 4M5ZL 2NXYC 4KRPC 1U8OA 1J11A 5HI5D 4M8QA 5IBTL 2HG5B 5EN2B 1ES0A 4QXTA 1S9WA 3GM0A 4ELMB 3HTLX 3F5WB 1R0AL 1MVFA 3L7EB 5IW6B 1NGYB 1ZLSH 1HK6A 5B39A 4MCYA 4TSAL 2ADGB 4MNHB 1FIGL 3CH1B 1U92B 3LS5H 4JZJB 5BOPA 3FO9A 5HYJD 3LQZB 4D8PB 1TITA 4YX2L 4LPVA 1W72H 4NQVA 2AKRA 1D6EA 1I4FA 3PF2A 4MHHI 1NKRA 1BIIB 5ENWA 1YQ2A 4NFBA 2HA1A 1I7UA 3JTSA 5T5FL 4POZD 4HX1A 4JM2A 2HRPH 1QR1B 3ZLQC 1FYTE 3VXRD 5MENB 4JJ5A 2A9MH 2G9HA 5C0BD 3VI4F 1IGJA 1K2DB 4HLJA 1VACA 5F7DB 5IEHB 2CIIA 3TYGH 3HA0A 1P1ZB 1AGFA 2I5YH 1PD6A 4UQ3B 4X6EA 3FB7B 2ZCLH 2IG2H 3BN9D 3VXTB 3TFKD 2P7TA 1ZA3A 4KAQH 3WUWA 5HHMB 1VFAA 4LEOA 1F4XL 4NQXB 2R69H 3P0VL 2BJMH 3IDNB 4FMKA 4V1DD 2BFVH 3KXFB 4L9LC 4M1DL 1CD9B 3L5WB 1MOEA 4X83A 4MAYD 4HAGA 3WBDA 3BOVA 5DD5L 4ZFZB 4NDMB 4L8CB 4I3SH 1CFQA 2NY3D 3RDTC 2X9YA 2WBJD 4OIBA 4HIJB 3HS0B 1VA9A 4WWKC 3ZTNH 4KK6D 2AEIT 1C7TA 2OL3B 5FEBA 1EAPB 2APBA 1EK3A 1QRKA 2ZOLA 4GRWE 1G0XA 4WTWA 2HT4C 1U58A 4X9FA 4K7PL 4HGMA 4MXQD 3CLFL 4F57L 1I9EA 3AAZA 5EUOB 1QD0A 3SGKA 4ELMF 2HMID 2M1KA 2DQDL 5FOBB 1S9YB 3RPKA 2ZWLT 4M61A 2VXQL 1VEOA 5KN5A 5D1ZC 4KGLA 3EKCA 3HMXA 3U46B 5I17A 5IHUL 3MNWB 1G7HB 1YNTB 4WJ5B 5BVJB 1WWBX 4XPAL 3NIFF 5D6CA 2MCG1 3HE6C 3K8KA 4G42A 5I1EL 4I48B 1PX4A 3O41A 4FFWC 4QRRE 4HV8A 4XVTH 4LMQI 3LMJL 4OV6F 3HAEG 2D7NA 4S10A 1JJUA 4M6OL 3LKNA 3QIUD 4KI5D 2P42B 1ORSB 4JFFB 5DDHB 3TV3L 3NPSB 1NBYB 4PRAB 4GOSA 4MB4A 4FG6D 5GS0C 4BUHA 2VXTL 5D70H 3RWDB 4JFQB 5I8CB 5CZXD 4Z7UE 4Z7WA 1Q9OB 2YRZA 5E08L 4ZTPH 5T3ZH 3L9RA 2VAAB 4Q0XH 4LBEA 1T6VN 2CLVA 3S7GA 2FSEA 5HHPB 2BXYA 2AK4B 3PIQB 4WW2C 5IOPB 4L9DA 2BY0A 4IOFC 2ZSVA 3EO9H 1KB5L 1BEYL 2F54D 1T66D 1JE6A 4WEUD 2EXWD 1W8OA 1WBZA 3RGVA 2X1OA 5IJKA 3KYMB 3DYOA 1XF4B 1D9KD 2AK1H 4YHLH 3GMRB 3VD5A 4ODHL 1A3LL 1H8SA 3CVIH 5E03A 4G6FB 5LXGL 4JFOA 3QULA 4Z76A 3T08A 3T0EA 1YEJL 3AXLA 1KN4L 1VPOL 1IQWH 1NMCB 2E27H 3R1GH 4PGZA 1I1CA 1N0XH 5FUOH 4UILH 1MFAH 1X6NA 2ED9A 2Z31D 5AG8A 4DKEH 3FONA 4TSCH 2NY5H 1EH9A 4KMTL 5EUOF 1MFDH 1BM3H 5E8OA 4K55A 2X70A 5B22A 2XN9D 4Y4HA 3CU1A 2WMPA 3RAJL 4MAYB 5BS0D 4LSRL 2NY4D 5HYEA 5IV2A 2Y5TB 3PV6A 3R06B 3FFCA 4JRYE 2NY3B 1OTTD 3SHSA 4JKPL 4LLAA 5FKPB 3V6FA 3WIIH 3IAGC 1YNLL 2WBJB 5I66B 1C5BL 3U0TB 1BVKB 4FNLL 1HHHB 4U4BA 4RRPG 2B0SH 2XZAH 3DBXA 4XPBH 2BVPB 4YUEH 4O2CB 4PJCE 1Y6NR 2J4WL 4Y5XA 5DUBB 3PP3H 4UQ2B 5F8QC 1K4DA 1FHGA 4XBPB 4XNMA 3PWUA 2XXMB 2B2XH 2VQUA 2NR6C 3S96B 2ORBL 4Z95L 2YD4A 4JHZA 4NNXA 1LD9A 3NVQA 1IILE 4GAGL 5E94B 4Y4FD 1FVCB 4R96B 4LKXB 3S5LA 4P2RA 1JGLL 1KTLB 3OV6A 1B90A 1QBMH 3F65A 1NC4B 1T5WA 3BQUC 3MBEC 3QDGE 3W0WE 4YGAB 4TUOB 1INQA 1GPOH 3E2HC 4XBEL 1NCDH 4ZUUB 5FUCE 2OJEB 4N5ED 3MUJA 3ZT5A 5D93B 2PXYA 3EJJX 1RJLB 5AWNL 1MY5A 1X7QA 3IF1A 2PYEE 4Y19B 3ZSSA 5A16B 3QBTB 4DFIA 2I26N 4ZSOA 2DDQL 1HXYB 1F02I 2KUTA 4APQD 3GRWA 5MERA 3FO0L 4LSDA 1PFCA 1KTRL 2XFXB 1NANI 4RDQG 1Y18B 5JIHA 2GTZA 1SEQL 4OFPA 4QTIL 5HDOA 3ME0A 1AD0A 3RWHB 1XCQB 4U33A 5SWSA 3BH9B 1SY6L 4DUWA 1QEWA 2NCMA 2ADJA 5EZLA 1YJDL 4Q9QH 3CVHB 4XVSL 3T1FB 5E6ZA 5C0CE 1T7ZA 4KMLB 4OFYA 3OTTA 3IDJB 3RWJA 4C83A 4EDWH 1MELA 2FLBT 4RGOH 2V2WB 3ZKQD 1KULA 4P59L 2YPVL 5KVGL 4WNQA 2FO4B 3QG6A 2ZG3A 3GBNL 3D39E 2UUDH 1G6RB 4DN3L 4EBQH 1A4JB 3O3BB 1CWVA 3T04D 3LOWA 5DJ8A 1P7KB 4N90E 3QQ4B 5C6TH 4MD4B 4WUUA 2FZ3A 1MI5E 3X14A 1ZA6A 4X4XA 2QEJA 3MJ9H 2VDLL 3LKOB 4U49A 1A6PA 3RY6C 1KIQB 4YEEA 5ESVA 1S7XB 2VE6A 1TJHH 3PP4H 4GG6E 4HUVB 2B1HL 4N9GB 2W59A 1S7TA 4W4OC 3QUXC 3QUMB 4OLWL 5CEXA 2NYYC 1NGPL 3WNNA 4J4PC 4H88H 3BVNB 4LSUH 4KDVA 1EAJA 1MHCA 3DVFA 4PD4K 2NY4B 3B9KA 4QEGA 4LCUB 3WL9B 3IU3B 5DMIL 4L4VD 1N7MH 4EQ2A 2HAZA 3KAAA 1I7TB 2F5BL 5L88H 3OKYA 4P9HL 2EDFA 4Z5RB 4N8CL 5FUZL 4M48H 2VNCA 1Z6JT 5CMAA 4KI5F 4XNUH 4MNQD 2IADB 5ADPL 1N64L 1A14H 2XWJA 3QEHA 1S9VA 1G9NL 1GOHA 4BFGA 3SDYH 5H37H 4DZBB 5C0DA 1JYVA 3T3PF 3SE9H 5IMLB 5E8PB 2LTQB 3IJSB 5F6IB 5IK3B 2BNRD 3A67L 4JZJC 4LLMA 2Y6SC 1WFOA 4X6FB 2P8LB 1I7RB 4IEFB 1PG7H 1HILA 3AS3A 1AGEA 4I4WB 3NIDE 3GJEB 2BRRL 3HC3H 1OAKL 2W9EH 3RUGA 1UXWB 4KJWD 3DO7A 2DI8A 3PHQA 1L7TL 4JDVA 1YMMD 3BT2L 2VSCA 4FQ1H 4LDLB 4BZ1L 4ZNEE 5C08E 2EXYD 4KKLC 3VWJD 2YR3A 3PWPD 4LSSL 1BQHG 3WD5H 1I85A 3AY4A 4S1SH 4M5YH 4TSBL 4RFEB 1ZVYA 3V5DB 3PWVB 4X0KB 1EFQA 4UDUB 1A7NH 2FX8H 2CK0L 5F7EH 1GRWA 3KJ6H 5ELIA 5GRWA 3F7VB 2P5ED 1WC7A 2DMCA 3EYVB 1I1AD 5ECJE 3FT3A 4XH2A 3WN5A 2HKFH 2OTWA 3S8WA 3G04A 3VFMB 3KPLA 3QO0A 4WCYL 3TZVD 3HLAB 3DMMD 3V0VB 1QSFE 2VIRB 3U6RB 1E4KC 5HJ3B 4YDVB 1A6ZB 2Z91A 5FHAL 3H8NA 2HJLB 5GGSY 4H25A 3QEUA 1DBJH 4ZXBA 3V6OE 1CBVL 1QPPA 3N85L 5JW4R 2HLAB 3I84A 1F90L 5FYLH 4LLVB 1RUPL 2XG4A 3QWQB 2JKXA 3QI9B 4NSKA 5F9OH 4NNPH 5HBBA 5ITFA 2GUOB 4N0UE 4V2BA 5SWZD 3M45A 4KRMB 4QY8A 1JNNH 4MCZB 1ADQH 1OAQL 3C8KA 1BFVH 3RWCA 4KROD 2IPKB 5E6ID 3CXDL 4PP2B 5KSBE 1KT2A 4AENA 3KVQA 5DSCA 2WWKT 2A83A 2FB4H 2EO1A 2D2OA 4E0RA 3BN3B 4HLZH 4WY7L 1QFPA 3MGAA 1JN6B 3IAPA 5KTEL 4OZIA 5EBWA 4OAWA 1KCVL 3KPTA 5INCA 3ZT7A 1AGBB 5HI3D 2NY0D 4CU7A 4P57B 2IQAB 2FWOA 1JPGA 1CFNB 3PHOA 4FOMA 3BESR 3WSQL 4YHYB 5KS9E 1CYGA 4ENED 3NPSC 3I02A 1LP9E 4MNQB 3P9MB 2OI9C 4LLDA 5TDNB 3O6FB 5D1QC 3C6LC 1ACYH 1T7WA 2OZ4L 1NSNL 3DSFH 3ZKND 2ZNXA 1FGVH 1U8JB 2AABL 4HT1L 2VDNL 3SKOA 4RMUA 2AJZA 2PTTA 5I15H 1EHXA 1JZ2A 2Q6WA 1OGTA 3RIFK 3WFCH 5MEOA 3X13B 1PSKL 3QXUA 3BMWA 2EIDA 2FGWH 4XAWH 1GC1L 5IWLA 5T33L 1IQDA 1WTLA 1ZWIA 3DO3A 3T2NH 4R3SB 4BSVB 4MJ6B 3CX5K 2C3WA 4F8QA 4JFDB 4HK3N 4JQXA 1I9RL 4Y2DA 5HHOB 3OJMB 1AP2B 4KRPD 4PRPB 4YIQB 2C1OB 1MWAB 3BHBA 1A1NA 3AB0B 1YYMH 1NMCC 5CBAB 3QCTL 1NGWB 1RHHB 4JKWA 2ATKA 3IDGB 1OTSC 3TYFA 1B2WL 3EW3B 1RMFH 1FNSL 2DLIA 4HPYL 4ODXA 3TJEH 2XPGB 5BQ7B 2DYPD 3Q1SL 1CLZH 1LE9B 4OT1L 4E41B 2BVQA 4LL9A 2IPTL 4AZ8A 5CINL 2JJWA 3NCFB 4I2XB 1I1AB 4S2SA 2FECL 3T4AB 1G7PA 12E8L 3KPMA 3SGDH 2YPLA 4M7KL 4GRLD 4XNYL 4YHIA 3TZVB 2Q8BL 1KCUL 2G5BB 5C2BL 2P5WA 1I9IL 2R0LL 3RA7H 4JN2B 3F6LA 3SE8L 4HKZB 5INDB 2FR4B 3BE1L 3OKMA 2DLFH 4FXLA 4JFYB 3JXAA 1C5CH 1A64A 3JV6B 4GG8B 4OQTA 5I19L 5F88A 2AV1B 1U8QA 4M3JA 5DXWA 3GSOB 3KPPB 5I74B 2VZUA 2G2RA 1MY7A 4PBWD 2D7QA 2QSVA 4U1GC 1SYVB 4WFFD 4FQIL 4Z77A 4KROB 3MGTB 5CUSH 3UYPA 2HG5A 1A7PL 4ELMA 2X9XA 4S1RL 3F5WA 3L7EA 3BP5A 5IW6A 1NGYA 5FGCE 4OF8A 2AJYL 2ADGA 2XA3A 3GK8L 4MNHA 1U92A 1IGIL 3RDTD 4LGRB 4GKOA 2CDFA 2PYFB 3LQZA 3UROR 5DHVB 3T2QA 1BIIA 5D93C 1U3HC 5JHLH 5I1KH 4JFHD 1N4XL 4Q2ZB 2QQLH 3N50A 4JDZB 5MENA 5E6YA 1AC6A 1CT8B 2NZ9D 1BVLB 4LSTL 4N1CA 1K2DA 4UV4L 5F7DA 1P1ZA 2R2CA 4LQ1A 3MXVL 3HRZA 3IAQA 4ODWB 4PJGB 1NFKA 4X4ZA 1AGCA 4JDTL 2VABB 4HC1A 3GMMB 1MFEL 3VXTA 4Q9CA 1S3KH 5DD1L 1EMTL 3BPCB 2DKSA 3FOLB 4MJ2A 2FHFA 3IDNA 2FYYB 4WFGD 3KXFA 4BELD 2VZTA 4IJ3B 3L5WA 4HIIB 5I73B 5D7IB 5HVWA 2EKSA 4DK3A 4OGYL 4PLJD 2Y06L 3BP6B 5GS0D 4HIXL 3SCMC 2XYCA 5FF6B 3H7BB 1CDIA 4OZFH 2JK5B 1T04B 3LEYL 5GS0H 5TH2A 4BH8B 4C55A 4UUJA 4FMFA 5F7WC 1XCTB 3MLXL 5KBNC 1DE4A 3TO2B 2IBGA 1W0YT 1Q72L 1YEHH 2BSED 2DYPB 5E4EB 4YBLC 2L4OA 4IOFD 1OAYH 3FCTB 5EUOA 4XNZC 3QYCA 4LASL 5FOBA 4LKCB 3D69B 5TGBB 5C07E 4GRLB 1ZS8B 1CTOA 5CEZD 3U46A 2OTPA 5E9DE 3MNWA 1NJ9B 4WJ5A 5BVJA 3ULVF 1VSCA 1E4XH 4L4JA 4PRHE 1YEEH 1TJIH 2FEEI 1I1YA 5D8JH 4I48A 2F74A 3S35X 3S3SA 1T3FB 4ZS6C 1I3UA 2H1PL 3FQNB 3V52L 2EC8A 5JW5B 4JFZH 3DX9B 4RAHA 4NKMA 3U2SA 4CADB 5J57B 2D9QB 5EU6A 4OKDA 1Z9SA 4LLYB 2BVYA 3BWAB 1J87A 1ORSA 5DDHA 5DFVC 1RFDH 1NBYA 3KYOA 4LRNH 4ODTL 4PRAA 5DEZA 1JZ6A 4G3YH 5F6IC 2VXSH 1E28B 5F71A 5IKCA 4PJGF 4AEIL 5FYKU 1Q9OA 2NY2D 4DN4H 1VKXB 4NJ9H 2VAAA 2IG2L 3ZKMD 1G7QB 2AEQL 5D71L 3DYMA 3WIFA 1T0NB 1FE8H 1JGUL 5IOPA 5CZVH 5HDBF 2X4OB 1BREA 3TT1L 3GGWA 5DMJB 1LEGB 5TPWH 1DUZB 3LRSB 3Q6GH 4DGIH 4Y5YA 1MCDA 2GY5A 1EERB 1EHAA 5HDQL 3GI9L 3GMLA 1XF4A 5D7IF 5J4MA 4OI7A 3GMRA 5IESH 3KYKH 5I1CL 5C0BA 1YEIL 3ZTNL 3H7LA 2VLKD 2CK2A 2I25N 2HTLC 2EDHA 3T2PA 2NR6D 1OAXL 3K4AA 4YXLH 3P4OB 1MJJA 2VITA 1AH1A 3RIFF 5IHZB 1IAMA 2FJFA 1Q1JH 4A6YL 5KSUB 5JQ6H 1EO8L 2QBWA 3N0PB 4CNIA 1ORQB 3SKUD 4R4FH 4U1KB 4O02H 5AEAA 3GSRB 2YC1B 2N7AA 3SPVB 4V1DA 3GMQB 3U1SH 1UFUA 4HUWB 2I24N 3STZB 4HG4K 3JSSA 4MAYA 4JO2L 4Q7DA 3OR7B 4NZTL 1HKLL 1XGPB 2CKBA 2Y5TA 3R06A 4H1LA 1F6AB 5FA4B 3W81A 2R8SH 3MRBB 2WBJA 3VGAB 4G8FA 1CL7I 3IFNL 3HC4L 4R90H 2EE9A 3CK0H 3QI9C 3U0TA 4X98B 3LN5A 4AEEA 5F97E 3EYQC 1F4HA 1LO0L 2EDXA 1IAKB 2BVPA 4O2CA 4XCCH 2GYSA 1UACH 4QHKI 5DUBA 5EWIL 4UQ2A 4TVPD 4LHUG 2LU3A 4PJ8C 1B4JH 4OB5L 4YNYA 1JFQL 4TVPH 4XBPA 5JW4N 1IAIL 2P8MB 2A6IA 1MLCB 5HD8D 2GSGA 5IG7A 1FVCA 4NM8H 4R96A 3MRLA 5C3TA 4LKXA 2LAGB 3GSNL 4F58H 5D7SL 1J1XH 1JNLH 2DM2A 4PY7B 5IROA 1NC4A 1RZIA 4ERSH 2D3VA 4QOKB 3O2VL 1V7NL 5DT1H 4TUOA 5K9OB 5DJ2B 4Z7WE 1G9MC 1PKOA 3SKNA 4ZUUA 3HN3A 4Q6IB 1OWRM 4S1QH 2OJEA 1MQKL 5EU3B 4HUKB 2YZ1A 3S37H 1RJLA 1LEKB 1N6UA 3ILPB 1CI5A 4Y19A 1AKJD 1M1SA 1NFIB 3RL1A 5A16A 2E9BA 2YXFA 4TRPH 4JG0H 4LSVH 4X4ME 5EZIL 1HXYA 4WI3A 4J4PD 5B3JF 1T89C 2XFXA 1HIMH 3MLTB 4PRID 2OK0L 3L3KA 3RWHA 1XCQA 1MAJA 2ZOKB 1MFDL 3MREB 3BH9A 3VGEA 4NCC1 3E6FA 3GO1L 3NFNB 4DCQB 2F54A 4Z0BH 2O5YL 4JJHA 3T0EE 3CVHA 5JHDB 2LVEA 5D1XD 4ONHA 1HEZB 4X8JB 1NBZA 1TQBB 4ZD3L 1UA6H 2V2WA 1A0QL 4FQLL 2FO4A 3P11H 4DJMA 1A4JA 2AJSH 3O3BA 4PJ9C 2FNBA 5FFLA 2VL5B 4G6MH 1P7KA 4PJ5B 3QQ4A 4PRDB 3B2UD 3B9VA 2EIBA 2GJJA 1G1YA 4MD4A 2JJUA 1DBKH 2XRAH 2Y6SD 3OPZL 1FZMB 2WBKA 1P9MC 3T3MF 4H8WL 1F5WA 2HKHL 3QA3B 2YMXH 3KGRA 1ZT4B 3FFCE 4MJID 2NX5B 2X9WA 3BPNB 4UIMA 1GJIA 4HUVA 4I9WD 4N9GA 4KHXH 4OCXH 5DYOB 3HUJB 1UH2A 5GJTH 1H3UA 4WI9A 5AG9A 4JN1L 3BVNA 3UTSD 3ARDB 5E1HB 5BS0A 2H2SC 1XF2B 32C2B 1CGSL 3NZ8A 2P1YA 3C08L 2JJTA 3IU3A 3CDGB 4LCUA 5GRYA 5SV4A 3WL9A 2BHZA 3TN0D 1WIPA 5C8JA 5DS8B 4KKLD 4D9LL 1C08B 4F8TA 2JB5L 4MDJA 5I74C 4OQ1A 3BZFB 4U3CA 3HMWL 4Z5RA 1QO3B 5EORL 2GT9B 4HJ0D 4U2ZA 4LLUB 2IADA 1T1ZB 3IYLW 4TUKL 4PS4H 4X4YB 1GHFH 4KY1H 4XP4H 5JTWA 4P2RE 2VXVH 1JRHI 3AS2A 1RUKL 4M4RA 4L8BA 5IMLA 1NLDL 3IJSA 2J12B 3QFDA 4DZ8B 4F7EB 2BY3A 5IK3A 3ULVC 3TO4D 1JYXA 3ARED 4Y4FA 4R2GB 1GZPB 4X6FA 2P8LA 1I7RA 2MWCA 3V6ZB 3MA7B 3MV7D 3OR6B 1PBYA 1GYAA 3PGDB 5AYUL 2OL3H 2VAJA 4I4WA 4ZSOE 4WO4B 4EDWL 3PHSA 4LVEA 4OFKA 4PGEB 4X7SL 1UXWA 5FV2A 5I30H 3KR3H 2R4SL 4K8RL 5SWSE 4ETYA 3EFDL 1SJVA 1UGNA 1D5ZB 2DQCH 4AL8H 1LDPL 1OGAB 2Q76B 5GRJL 1NCBH 4MNGB 1RIVL 3V5DA 2XIDA 1IAOB 5J8OA 4FFVC 4X0KA 3Q2CA 5CEYA 3W11D 4UDUA 2IANB 4PGCB 5T1LD 4IMLA 4GMSL 4QKXB 1FVEB 2LFGA 3EYVA 4U31A 1N8ZA 3HUJF 4IJ3C 2IC2A 4P99A 1A3QA 7FABL 2XXCB 5D1XB 1KGCD 4WUUE 3MOBH 3WDIA 2AXGB 3VFMA 3HLAA 4L3ED 2QR0B 2VIRA 5D2NC 3U6RA 5IF0A 1MHEB