3ZE9A

3d structure of the nifese hydrogenase from d. vulgaris hildenborough in the oxidized as-isolated state at 1.33 angstroms
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
278
Chain Sequence
GERPPVFWLQGQGCTGSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox State-Dependent Changes in the Crystal Structure of [Nifese] Hydrogenase from Desulfovibrio Vulgaris Hildenborough
doi rcsb
molecule tags Oxidoreductase
molecule keywords PERIPLASMIC [NIFESE] HYDROGENASE, SMALL SUBUNIT
total genus 83
structure length 278
sequence length 279
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3ze9A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3ze9A02
5JSHA 4U9IS 2FRVA 3UQYS 1WULS 1WUJS 4CI0B 1UBUS 1WUKS 3ZE8A 5A4FS 5A4MS 4IUDS 4KO1S 1YRQA 5JRDS 4IUBS 4UE3S 4U9HS 1UBTS 5JT1A 1UBKS 1UBHS 3CUSA 4UE2A 4UEQA 1YQ9A 4UCWA 5JSYA 3ZEAA 4UE6A 5JSUA 3RGWS 4UPEA 4KO3S 1UBMS 4IUCS 1UBOS 1UBJS 4UCQA 5ADUS 3USES 5D51S 3AYZB 5A4IS 4UQPA 4URHA 3USCS 4OMFG 4UQLA 3MYRA 1FRVA 4KN9S 3ZE6A 1FRFS 1WUHS 4UPVA 1YQWA 3AYXB 3ZE7A 1H2RS 4KO4S 4GD3Q 1UBLS 4TTTS 1CC1S 3H3XA 4UD2A 4UCXA 4UD6A 4UEWA 2WPNA 1WUIS 4KL8S 4KO2S 3CURA 3ZE9A 4C3OB 5JSKA 1H2AS 1UBRS 1E3DA
chains in the Genus database with same CATH superfamily
4U9IS 2JEYA 3CRW1 4I3GA 3KJFA 5EZQA 3QFTA 1SVWA 2IDKA 1E69A 2JW5A 2OB2A 3JR7A 4K28A 3W6OA 3BIFA 4ENPA 1W4LA 4L4ZA 4L8VA 3MJTA 4RZXA 3WRYA 3C14C 3K5HA 1V16A 2WU1A 1PZEA 4V0LA 2DJ5A 5AM1A 1XVVA 3FGOA 1N8SA 1P39A 2JVIA 5CCXA 2AW3A 3F9IA 3EIHA 3UY4A 2DUWA 2A6PA 3RFFA 2QK4A 4OMFG 1QMPA 4OHMA 3CRVA 5HJ2A 1R0CA 1FBNA 4YFVA 2ERYA 1E9RA 2IXBA 3GRZA 4TXLA 3KYDB 5FBHA 4D5EA 3DM5A 1V16B 2O1EA 3ETEA 4NFSA 2HFJA 4EO4A 4Z9BA 3KTFA 3VPXA 4MJ3A 1QOPB 1A27A 3QLVC 2CGEA 4G5XA 1OXVA 5ALFA 4DLVA 1PFVA 3LLUA 2H5IA 4D8UA 4WACA 5B2ZA 3EGOA 4L6AA 3GAFA 2GZ1A 3CS3A 3G2LA 1TUEA 1WWKA 4WZZA 3CVWA 4FCVA 5AM0A 5JHHB 2ZJ8A 3A36A 1QS0A 1E6KA 2CXUA 3I1JA 4I1OA 4QOHA 4ZYYA 3EE6A 4QOFA 1PCXA 3SFVA 4V2IA 1QU3A 1CFZA 3OJOA 5ALUA 2H0RA 4YDQA 3WMRA 1CQZA 3SR4A 1WNTA 1NYLA 4I4LA 1TU4A 3UGJA 4JH0A 4QGFA 2P90A 2QX4A 1LPSA 3HGQA 2YZ7A 4N12A 4OU4A 1T3TA 3ZG6A 2PSSA 5I7RA 5HDQA 4ILKA 4ZAWA 1E9AA 3C4JA 2W9XA 3JWJA 2NM0A 5EIHA 1E6MA 2BFWA 3GQBA 1T36B 3BIOA 4W5OA 5B5SA 2EWVA 1ZFNA 2FOIA 2XWPA 1JNYA 2QLFA 3CRMA 2J07A 2CLFB 1FFBA 3AEKA 3R20A 3V33A 3IPYA 2CFRA 1TMGE 3UGKA 4TN1A 2Z04A 3RVKA 5ALZA 2CEKA 3FBTA 1MC1A 4CHGA 4F7DA 4HGQA 1TFUA 3ZGXA 5LZ2A 5DOZA 4J0JA 3D3KA 3W5IA 1L5WA 3MCZA 4CCAA 3NM4A 2HU7A 3SNHA 4XIJA 2NNWB 4KITB 1A8IA 5CB4A 1QGOA 5F1KA 2XUAA 2H4FA 3E9EA 1IY8A 2PE5A 4U1RA 1P5HA 5E3JA 1OQAA 1JHUA 3QVLA 4YQFA 4BZPA 1GA4A 3ZV3A 4IDDA 4U7TB 1OGYA 5D3MA 4AY4A 4TYNA 2VP3A 3CWCA 4H7FA 2I7XA 4RJTA 2YBEA 4U9UA 2ZJBA 3GFRA 3PNLA 3TRDA 2AWNA 1YV9A 3FBWA 2YN0A 3UMFA 1U6KA 2HEGA 2QPLA 2HHAA 5LVAA 1M2GA 1FVOA 2XMGA 4GRDA 2Y77A 3D1JA 4PZYA 4PLTA 3KRTA 4NEQA 5KSYA 1ZMRA 2CFCA 2R6GA 3TE7A 3ZZUA 5BN1A 4V03A 4DKXA 2SCUA 3JQDA 1RCUA 2IOYA 3JQBC 1KK1A 4GC5A 2RHTA 1M6EX 2A5FA 3GVPA 3L8EA 3RFCA 4QICA 3VBEA 1ZOPA 3K8ZA 4EAQA 3JAKB 5ECGC 4BNMA 3FVRA 2CF6A 2VBIA 3KB6A 1P31A 3SR0A 2ZYRA 4AUEA 4DANA 3ANYB 1L7MA 1OI4A 1RXVA 4DWJA 4MW1A 1RKUA 3LO5A 3U7HB 3NC1C 1Q22A 4HOYA 1YH3A 3WHKA 3D8RA 1TD1A 3TBFA 3VC7A 4EY4A 4I50F 4IDBA 4CM4B 1YSCA 1RRVA 3R3HA 4JFRA 4A9AA 4FB5A 3GH3A 1UJBA 1AQUA 1AKWA 1JVSA 1LRJA 1T1SA 2NADA 2YJ4A 4WI1A 2XITA 3RRYA 4EI2A 3OQNA 2R6AA 4NFLA 3R7NA 3ISTA 2M1XA 2WIJA 1Z35A 4HLNA 4MKHA 3MM4A 2OFOA 1SQFA 1KK0A 4HKTA 4RK1A 3MWFA 7REQA 1LY1A 1WQ3A 2B2XA 5C37A 3BRCA 4ENWA 3PGA1 4ZTZB 1DWQA 3NC0C 2WUVA 4LZAA 4UVGA 1PR0A 3TOVA 5DLQC 3D2LA 5DK4A 4W8GA 4CIVA 2Z9DA 1C29B 5JMWA 4EVSA 3SQOA 2FR8A 1CEXA 2R8BA 1G2QA 1O95C 4JZKA 3RROA 2XNKA 3DDZX 3LSYA 3CMMA 4QVKA 5TMDA 3UT5B 1MO5A 3R3ZA 2A9OA 5J5VA 4LMRA 2J4FA 1DDOA 3WNQA 3I1FA 3U48A 1EGMB 2POQX 3GEDA 3RSOA 1NQAO 1Y0BA 4RVFA 3Q7IA 1UANA 1XJQA 3TJRA 4JI2B 2H31A 2G9QA 2R79A 2X4DA 3MA0A 5D86A 5BPFA 1QLWA 4N01A 2BY4A 1YWGO 3ET4A 4P34A 1E1NA 1TOAA 2VP0A 3PIIA 4YAWA 2J0VA 4Y6QA 4A8PA 3I5UA 4DC1A 1X3LA 3CG0A 2QN6A 4KFUA 4QGHA 5HUQA 4QECA 1SU6A 1O58A 2PX0A 2WKSA 4AJ9A 1ZNWA 2UZ1B 5G1NA 4BGDA 1JJFA 2HFKA 2DZDA 2W2XA 1I5EA 1UPCA 2JJYA 3UC9A 3QIAA 3R5XA 4HG2A 3PC8A 5C53B 1IM5A 2E89A 1NQWA 4OIFA 1HG0A 1Y81A 5IT4A 3RYIA 4BU0A 5DBGA 1C41A 1JNXX 4MIKA 4TOIA 4B75A 2DFKB 3UFXA 1GAQA 2WUGA 4YRSA 4QUIA 3BA6A 5AHKA 2IXDA 5CT9A 3G88A 4R3UC 2XCSB 5KQPA 4TUYA 2YY7A 1BO6A 2QKYA 3EVGA 4KQFA 4FYXA 3UW3A 5JZMA 1K5PA 2FWAA 1YAJA 2C7QA 4O5OA 4MYDA 2P91A 4BO7A 2YWRA 3TD6A 3M70A 4ZFNA 2BELA 2QL9A 4R1OA 3WIEA 3WP0A 3DQPA 2XYHA 4GI1A 4I1VA 2HZBA 1QIMA 3FETA 3HCNA 1TZBA 3JQ7A 4C7KA 1CJSA 4PZUA 4FN5A 2VPWA 1K97A 4Z4EA 1H2AS 1MQ8B 2B8TA 2YASA 4HX5A 2H3EA 1SXJD 1CDOA 5AK4A 2AI2A 3FOCA 5LDDC 5B1DA 1RI1A 2C04A 2BKEA 4L0MA 5FUBA 4BLUA 4FINA 2AB0A 1EINA 1QIIA 2E7ZA 2IIVA 2XADA 1VG0B 4X1IA 2WJAA 2R8RA 3DOEA 3C85A 1XLWA 3QF4B 4ZMSA 3GUZA 5C1BA 2AYYA 1E9BA 1CUBA 5C18A 2PGLA 1T3LA 3TTXA 3H6GA 2X0JA 5EHIA 3QPVA 3ELYA 1RYHA 1XALA 2NYUA 1ZISA 5C7IO 3S99A 2PIDA 1BW9A 4MQ4A 4NQRA 1V3UA 4KR3A 2MWMA 4PYRA 4AXBA 1CV2A 4A8HA 4AMUA 5ALYA 4OYRA 4B7UA 3BOSA 3V1UA 4PYMA 1BIFA 4QJBA 4TSKA 2HNBA 4DR2B 2PU7A 3OZCA 1FDWA 2X41A 3HYNA 2V7TA 1I7QB 1S3SA 4ZAGA 3CLRC 3GRFA 5LDHA 3NQ41 4C7MA 4B3MB 3TW6A 2FEMA 2OCBA 3W8NA 2DSTA 4DA8A 3IERA 4HUQB 5EMMA 1PLJA 4BFSA 2WSIA 3V8BA 2ZITA 2QUJA 4CHTA 1XA3A 2QVGA 2X8LA 3J80A 1KJ8A 1L5ZA 1W1WA 2NZ8A 3AZQA 3BGDA 3HA3A 3HNRA 4GQBA 3JX9A 2G06A 4TKUA 1JIVA 3CU5A 3R5FA 5AJTA 4GKAA 2FTKE 4M1TA 4R9RA 3U60B 4FEGA 1ZUNA 5KWSA 1P4SA 2Z09A 4FFDA 1XCJA 3OU2A 2WJ6A 3KJIA 2YWJA 3P8ZA 4BMZA 4C2AA 1SKMA 4GP7A 4NMLA 5EQJB 1HFEL 1K68A 4DV6B 2EHDA 3FTNA 2Y66A 1GU7A 4RORA 3TFWA 4CM6A 4YT2A 1NN1A 1V1RA 5TRTA 4OJKA 4XH9B 3MCUA 3KTAB 2NO5A 3L1HA 1H1TA 4I4CA 1MDFA 2QQFA 2PGNA 2C5SA 4HTFA 3G0BA 1TA9A 5E4FA 1ORWA 2C0QA 2VPTA 5TB5A 4AM8A 4E6EA 3T3MB 1NSYA 1LS1A 1UWVA 3CTMA 4PE5B 5IAJA 3LMKA 1XD2A 4I19A 4DSAA 3NVKI 3I9KA 2QB5A 1EFPA 3GUYA 2IHKA 4K6GA 3RF6A 3KD3A 5JZSA 2ZT5A 3MHTA 4P3PA 4MLDA 2OD9A 3H4MA 4B3FX 1QQTA 5F52A 1FFYA 3AEUA 2R97A 1CSEE 3WRVA 4F93B 1WF6A 3GEMA 5BMVB 3BXZA 4ZTBA 3WWOA 3ZD9A 4AW9A 4DREA 1DX4A 1KEPA 1ZIDA 4DCCA 4EG7A 1N7JA 2UXCB 5KVCA 3GJ3A 4GBMA 4DC0A 1LF5A 3SJZA 5FBKA 4DBLE 1B00A 4HRYA 4YP6A 3S3TA 5JJIA 1E2IA 2I2BA 1SRRA 5CDFE 3VR4H 3PGMA 1ENZA 3W34A 3GL9A 5BWNA 3TRHA 2FH5B 3QV2A 1H5UA 3G8BA 4XIIA 3KTDA 3QX8A 3DZFA 3JQ9C 4CUJA 5CFOA 5KCMA 1O6CA 3CE9A 1IIRA 3GHHA 3MJDA 4D9KA 5LP6A 2CL5A 3I0ZA 4TS4A 1CUCA 2BJWA 4L2IB 4OXQA 2XUQA 3T41A 1Z74A 5JSQA 2OHGA 2NSLA 1J9ZA 3W3AD 4TTJA 3KOOA 2YOHA 2W2KA 4O59O 2QRMA 3KOXA 3AESB 1OHHD 5EHQA 2NTYC 2FN9A 3QKRA 4EFLA 4HZUB 5BSTA 4OXKA 2A92A 2VTKA 4W4TA 1NY5A 4H7DA 4E5VA 3QBVA 3R24A 2WIDA 2C5GA 4WKOA 4TV8B 3VR4D 1HYEA 5TGTA 3F6YA 4Y9SA 4AZ0A 2GHQA 4X7RA 2Q1YA 5ANRB 5AVXA 3DE7X 3AGQA 1DPGA 2WVGA 3SM3A 5F9FA 2V5AA 4YPFA 4GE3A 1ECCA 2O2HA 5HRCA 1YK0A 4UHBA 4J43A 1OU0A 4BB5A 3UATA 3ZBPA 4C5CA 1CIPA 1E2NA 1YJ5A 3EDYA 4ABYA 1L2TA 4TV8A 3B1YA 3CKYA 1DOHA 4TLAA 2G8LA 2ALJA 3I72A 4M1WA 2Q9AA 3AYZB 3EUEA 1IWOA 2G5PA 1HQKA 4OUDB 4YJFB 1TGYA 2P2NA 1FX0A 3M81A 3MVEA 4MV1A 1V47A 2WZCA 4NIMA 1KJ9A 3THYA 1L1QA 5FA6A 3MUEA 3GFVA 4L51A 1GN8A 3E3LA 3NFRA 1NV9A 2RHOA 4XFKA 3ZJ4A 5KS2A 4CMEC 1NRWA 2C4HA 1ZKDA 3ABOB 4XRGA 1KGSA 1UDCA 3LQFA 4U2GA 4Y3UA 4FDTA 3ZHVA 2RIPA 2IOHA 1THMA 2IPAB 1KFJB 4R16A 4F85A 4RMNA 1GKYA 1H9BA 5TMPA 1E2KA 2ZAMA 3HZHA 3IJEB 5C1IA 5C1PA 2O23A 4BVJA 4RD6A 2PGAA 3Q0TA 3VOSA 4YUYA 1S3GA 5H8WA 1RWOA 1T34A 1ISGA 5AVKA 3NR2A 4HMQA 1WUTA 2AFHA 3HM9A 1NJ2A 1IM2A 4KV9A 4XJTA 2DETA 1SC3A 1I32A 2AS0A 4NPCA 3KQLA 4MWTA 5E1DA 1YQXA 4IJVA 1WAMA 1UJNA 3BGWA 1V26A 3ZY5A 3K9NA 3V1KA 2G88A 4E5DA 1LI4A 3THWB 3SD7A 1QQAA 1N5OX 3JW8A 4J1NA 1MT0A 2R7NA 5DFAA 3D8NA 3LOQA 1WLSA 5AW4A 4UE2A 1UPBA 5FFNA 4B34A 5TS3A 5AWFC 4MPTA 4O3FA 3VNQA 1TQ4A 2CNKA 2YNMD 1TYAE 4CLDA 4V1CB 2R6DA 3KEGA 4GSKA 4NJOA 1FDOA 3FOWA 3QXXA 4I5IA 5ENZA 4ZI7A 1X1QA 3NM6B 2BDTA 2WSSA 2ZTUA 3WMWA 5FXMA 2QBYA 3SZRA 3Q3VA 2VQSA 4JYBA 4AO8A 1ZSYA 3MGGA 4DG9A 4ZGWA 4PG5A 3UAOA 1I0ZA 2XVZA 4GI5A 1JKFA 2H0AA 1DJLA 3SS8A 1W88B 5KTYA 1Z5OA 3PFGA 4GX5A 4NKRA 5IANA 3QUSA 5JTTA 3I92A 1J1IA 1X86B 3FCSB 1NFFA 3D4LA 1X1TA 2P6NA 2QG4A 1RJDA 2EZUA 4JYZA 3INGA 4MWDA 2FX2A 3REGA 3FVWA 2AXQA 1B6TA 1C9DB 1KZ9A 2HPVA 2Y0BA 4IX1A 1SOWA 4N1AA 4ZWNA 1KK2A 1NLUA 4KXNA 1X7WA 3UVEA 5B37A 3JWHA 3WK7A 4PLCA 3HCAA 3OD5A 5AQ1A 3QVUA 3EB9A 4L3WA 1YZTA 5GZ6A 4OGGA 2DOKA 3T1NA 2YQ5A 3AI2A 2XGGA 3JYHA 2ECOA 4B0OA 3Q85A 4IH4A 1LSJA 3P9XA 1L5KA 3PJGA 5JXGA 5ALDA 4XEUA 4L8WB 3NV9A 5H7XA 1H8EA 4LRYA 1HBJA 2G76A 4QT4A 3A7DA 3HE3A 3PJDA 4KE8A 5BT9A 3RC3A 3N2LA 1JEYB 1DKMA 1Z7YA 4B32A 4KLAA 4JLNA 1LKZA 1R2QA 4M22A 3PU6A 2XH8A 5EPUA 3T1QA 4WD3A 1TQ2A 1YULA 4N5DA 5CPBA 2OXFA 3JTEA 3AFHA 3SZ3A 2DE0X 2I29A 4BEVA 3HP7A 2CL0X 1SVUA 1VXRA 2RHCA 2WAXA 3D1LA 4L6CA 5CITA 2J9ZB 3DF9A 1P7VA 2ENUA 4HXGA 3DMTA 2E1RA 3HSYA 1OPXA 5JSYA 4HLDA 3NHFA 2JRCA 4JQOA 3Q8LA 1HDYA 1T13A 2D06A 2WOOA 3MPUA 3OPVA 2C1EA 4IIBA 4MQ5A 3ESRA 4IPTA 5A6VA 1Z5WA 5CA0F 4IRXA 1L5SA 3BXXA 3O1IC 1J8DA 1Z6XA 1RP7A 1FDTA 3VR1A 1NG9A 2XCRB 4HBGA 4JUAA 4CN9A 5AKJA 5DYNA 3RTBA 3GLGA 2FAXA 3FA2A 2ZRDA 1H85A 2A0XA 2R65A 4YR9A 5ADVA 1QP0A 2AE2A 1MC4A 2GAJA 3GX1A 3R3YA 1KY5A 3LPAA 5ELXA 1YGYA 2AVNA 1KWKA 2AK2A 2HH9A 3IV9A 2XNSA 1Q1GA 1H22A 3AK4A 3ICCA 1WCIB 5FWYA 1FX0B 1XVIA 3OI7A 4IG4A 1L7OA 2JEZA 4CODB 5CA0A 3BCSA 4WL0A 1T4GA 4JLMA 1V2HE 1XZMA 3FHJA 2XY4A 1VRWA 2FFJA 3C74A 1IEWA 4IHAA 5EWJA 3ZCRA 3I5YA 1KRWA 4YMWA 3RTCA 1EE1A 4E70A 3U1BA 4RPJA 5BPHA 3ZX4A 3ESYA 1SQ5A 3JS5A 1UMBA 5CFNA 1Q7CA 1Z2AA 1N4DA 1WA5A 1XMJA 1LWOA 2BEVB 4M8NE 3OIUA 3S1AA 3CTPA 1NVTA 4TSRA 3E7WA 4JYPA 4IRUB 1Y63A 3OFKA 4LDZA 1AS2A 1T43A 5DVZA 2ZQZA 2RKBA 4O2AF 1P2DA 3ISJA 1VHLA 1TJ3A 1ZJ4A 3AM4A 4A6EA 1GZ7A 1KYIA 5DTRA 4RKFA 1PDWA 3AR5A 1U2EA 4WESB 2O07A 3OICA 3HA5A 5AR1A 4GM0A 4QOGA 3ZWXA 4Z99A 5KYWB 4XB1A 5CFLA 2AEJA 2WILA 2JFUA 3G1TA 1M76A 2JHPA 4B7CA 1NMEA 2XUHA 2YHAA 1ID1A 4PF1A 1YTLA 5CW1A 2G9NA 1JPVA 4BMDA 3NHJA 3ZJVA 4C30A 3IXMA 2GETA 1KKMA 2QSJA 2J1LA 4HYQA 1F8YA 3LM8A 3IDAA 3OWOA 3Q7TA 1JEEA 3SHTA 3RSHA 5JWOA 1JBEA 4M1YA 1U6IA 3FB4A 1T1GA 4X93A 2J31A 3WISA 4B8YA 3PXUA 3ESAA 3HYTA 3P2JA 3IOEA 5H81A 3FNEA 4LEIA 3W1WA 2V0GA 4P08A 4AP9A 3T61A 4EGSA 5IJAA 1DFIA 1JE1A 1XTJA 3RYTC 4EB8A 4PLFA 5JROA 3M8KA 1JR2A 1E2UA 3A6LA 1CR0A 3KHTA 3EY9A 3L92A 4XYGA 2O2DA 1WBDA 1AK2A 1RQNA 2IP1A 1EJ6A 3E2MA 2ZP1A 3PVSA 5IBPA 1YVUA 4EJ0A 3TZLA 3E18A 1P4RA 4WASA 2VZEA 3A1WA 3MSCA 4RNDB 4OAQA 5DBEX 3C1AA 1Z4NA 4D4MA 2H1CA 2PWPA 5ES4B 1GLVA 1ZRMA 1RNLA 1EK0A 4DXDA 5KREA 3HJRA 2CN1A 5ABPA 3FNIA 2O0KA 2LRHA 2NUTB 1Y4UA 4Y8VA 2OLEA 4TMFA 3QBJA 1P1FA 2P30A 4IL5A 4OQ4A 3A9SA 2PX3A 1PNRA 3UK6A 1NURA 5GZ3A 2W2NA 3BBPA 3DAGA 4RDIA 1GUDA 4IHQA 3U3KA 1VLLA 2NSDA 1CZOA 2HJGA 4J2TA 2R86A 2WZDA 1I5OA 4A8TA 2GAAA 3ANMA 2P2YA 2HX1A 4PSUA 2Q5EA 4F8JA 3L77A 4XWOA 4D26A 4LY9A 1JFRA 3E7XA 5JY6A 1RRPA 2OGZA 3K8QA 2HQSA 1CQXA 4Y2SA 4FFPA 2V7QA 4NJMA 2PPVA 2YH2A 2GYVA 2FWNA 4IFIA 4FLFA 4WZ6A 1JQBA 2XRZA 4EF6A 1UL1X 3CEMA 3EW9A 1KORA 4F4FA 1TO1E 2VG8A 2YHIA 1SC9A 1SKAA 4FC7A 1SKUA 3I62A 1XCMA 3TNDA 1QF6A 3BB1A 3X1YA 4QZVA 1HYGA 4GL4A 2ZSJA 4CIAA 3S6JA 3UA3A 1YCFA 2LKCA 3OZTA 1CZRA 1IBSA 2G7ZA 2D1SA 4LQCA 1FS4A 2RHLA 4UM7A 1DIRA 2ZSHA 3HU3A 5JBQA 5DI3B 4PFKA 1GG8A 1N1DA 4JSRA 1TEZA 2ZSFA 2PH1A 3ZWWA 1XZNA 2I7VA 3VISA 3ZZ1A 8AT1A 4L08A 4G81A 2P78A 3OQ1A 1XYYA 4YCDA 5A05A 1XDSA 1Z82A 3KSRA 4PVCA 3USES 4O4IA 4TL6A 2Y1EA 3MOSA 3AR9A 4KQ1A 4QOSA 1Y7PA 3U4DA 1EG7A 2GYUA 1FFGA 3RYHA 3VJKA 1P17A 1QWSA 3A7EA 3FKQA 1RXSA 1XWIA 4JK3A 5ETJA 3QM1A 3SJCA 4Z4CA 5DNYB 4GU5A 2V8BA 3O7MA 2H2IA 4X6YA 4ZVTA 3DPUA 4GGOA 1GIAA 4L28A 4CTOA 4CQNA 3V1MA 4RSMA 2QQ5A 3S4YA 3ASUA 4MH0R 3PITA 1NOJA 3QVGB 2IIQA 1IAVA 3AHDA 2G5CA 4EMUA 1B0UA 1ZWLA 2JAOA 4BY9E 2GAIA 4PPNA 1NQOA 4Q3LA 3PHIA 4OJQA 2JPDA 2WYWA 3NYQA 1GRQA 1LTKA 2Z8YM 4HGYA 4BVHA 1R27A 2QTRA 3HRKA 4ZT5A 4J8PA 2VNKA 5AK3A 3RJTA 3TPZA 3W8DA 4BATA 3COYA 2WF7A 4Z2AA 3EQZA 1JEOA 3DLPX 5CU7A 2Q7OE 2F3UA 3FYUC 1NI4B 3S7TA 1H6AA 1GR0A 4YAIA 5LZ9A 2OXIA 2BRUC 3VPSA 3IEIA 4PCUA 3ROZA 5IUJC 1BQ3A 1E1RD 1XGKA 2QM3A 1Y8RB 4OA8A 1AKMA 1PDVA 2GXAA 1U0BB 1LA2A 5LXTB 3RHFA 3LWDA 4RS3A 5G4KA 4U2EA 3ZUPA 3W1EA 2BTEA 1QUFA 1NDHA 4R9UC 1SIOA 3FDJA 4MOWA 2RH5A 4PVDA 4UNRA 1FUYB 4JLWA 3T7IA 4RPGA 1P62B 3ZLTA 3DP7A 3VR3D 4G8BA 2C9ZA 5AVTA 2OD2A 2GHIA 3IP3A 1NG1A 3GZTB 4WGGA 5CGZA 2IBMA 4PLWA 1U4NA 2BM8A 2Q4BA 3KEMA 1LDGA 3ZN2A 5J9FA 4PNEA 1UJCA 3OLXA 4DT1B 2HAEA 3U81A 4ZREA 4F3CA 1QPGA 3MCWA 3WBFA 1PG0A 3H5RA 3AMVA 4NU6A 3F71A 3K96A 4XLTA 4WKCA 5KNDD 3SPXA 1TIKA 2PS9A 2X8WA 3ICVA 1XNHA 5GONA 1WP4A 2WWHA 1Z4OA 5G0VA 2H57A 2O1SA 2Q2VA 2PZMA 1IN4A 2X9LA 3PD7A 4P86A 4ZVLA 2O8NA 4DDUA 3TVYA 1TVEA 1EUDA 3KZNA 4CLXA 3M0EA 4N47A 4NYIR 1S1CA 5B3AA 1Z5PA 1OC2A 3ZGOA 1U2GA 3KVYA 2GJSA 5JC1A 4OL0A 3V8MA 4F4JA 3DZBA 4F6RA 5A3QA 5IYZB 1FXWA 1UXKA 1MG0A 4NONA 4YACA 5CHEA 1J20A 5CVCA 1QG0A 3W8EA 1NW4A 1Z0JA 3AR2A 2AQIA 3I83A 4QGAA 2H9AA 2QTAA 3UYLA 4BXOB 2R4TA 5I4KA 1KP3A 1G2IA 4RK6A 2XBMA 4WXPA 4DCUA 3L7CA 2CDNA 4UUOA 1ZL2A 1NUUA 2FQYA 2BBSA 5HYVA 4K5QA 2R96A 4KXLA 2G9VA 4OB8A 5CXSA 2XA2A 3PC7A 4GMHA 4LKRA 1Z47A 4YCJA 2XXAB 4XWYA 3K32A 5HE9A 1RZVA 1Q0ZA 2V7QD 4KX5A 5I7SA 1PNVA 1EEHA 3EEFA 3PE3A 1OH5A 3PTLA 3P4YA 4DDTA 1YS2X 4E7OA 1M7BA 1M1NB 1SKYE 3EGDA 3IT2A 4O1IA 4UHJA 3ZS8A 1A9ZA 4YREA 1RLUA 2DQZA 1E0SA 1NFQA 4LWZA 3GLIB 3LOPA 4C43A 4DWWA 1RPAA 2AI1A 4BBAA 1K6IA 5C1DA 1QRTA 1M6VA 3AVVA 4RF2A 5D1NA 3H65A 3FWYA 1GFZA 1N9GA 3U16A 1I94B 4RWEA 2IYOA 4CR7A 1N2ZA 5CDHA 4TRMA 2QROA 4AJLA 3LUAA 3PQ2A 4MV8A 1MCZA 2X76A 2VN8A 2V9CA 2OC4A 2AN9A 4X8LA 2W2OA 5F7XA 2A0WA 2OSBA 2JH3A 4Y9RA 1PZGA 2W6JA 3HUEA 3IC5A 1LLQA 2OPHA 4EYOA 1TKBA 4IKEA 2A7XA 2ZETA 1II8B 5EWMA 2EHJA 2PS3A 3N2KA 4DCSA 1IRXA 4E31A 5EE0A 3IESA 3RVBA 2QE7A 1KE1A 1GITA 1T24A 3DC2A 3HQ4O 4J94A 4ALLA 5CJ2A 4Q7LA 3ZDCA 1RLOA 2PUHA 4UDOA 1FFXB 2HRZA 1PKXA 1ZM4A 4P8RA 2G70A 2HKIA 1B0PA 3IAAA 2Z3VA 1JHRA 3M1AA 3FMPB 3TR0A 1FDVA 5BN4A 3TZCA 5BV0A 3HWX1 3ZV7A 1JKXA 4U02A 1KSGA 3K09A 1UKVY 2VA9A 5CB8A 1O94A 1G6HA 5CNMA 1YVDA 2A4KA 1LNQA 4YAOA 5FR2A 1Q83A 4NCKA 1X2BA 5HKBA 1VL5A 2P6OA 1AUPA 1KPIA 1MOZA 1ONNA 1VLJA 3UWKA 3LQQA 1ODJA 3OZGA 4OHKA 2P0EA 1JG3A 1JQLB 4L7QA 4ZIRB 3OJCA 4S35A 2B6NA 3GJTA 1L7AA 3O8QB 3ZDQA 2GSDA 3ETDA 3N28A 1ILWA 1R6VA 4FHGA 3DMGA 4KIFA 1Y9ZA 5FHRA 3PD0A 2HPAA 3E35A 5IAKA 3WGUA 1U0SY 4MW0A 3VR3A 2Q3FA 2Q5QA 3DFKA 3DM9B 4JBLA 4XX0B 1F9EA 1MNAA 3DVAB 4WLEA 1ML3A 2IE0A 3WADA 3ZBQA 4N3GA 2VHCA 4MJLA 1Q20A 1T4CA 2OHJA 1R9MA 3DYIA 1ZU5A 2CXQA 2P79A 1CRZA 1EFVB 5FORA 3ZHBA 3ULKA 1GAWA 3MIZA 4IICA 1NUSA 1B16A 5KVVA 3A1UA 3CX7A 2V5UA 1G5RA 5KQMA 3KVVA 1YQDA 1IUPA 3DS8A 4X84A 5JWRA 1XZ8A 5KINB 3OA2A 4IHKA 3WNVA 3G5TA 1ZJ6A 1BROA 2PGXA 4JBHA 3A27A 4LVUA 3WBJA 3M5WA 4OB7A 1B0AA 5ICCA 4FK8A 4PEVA 3CLUC 2JIQA 3O4IA 4E03A 3L9XA 1H2FA 3MK31 1KY3A 1KRHA 3AF5A 3CCCA 4LHVA 3SYNA 4DR1B 1KR5A 3KLNA 5C1OA 2Q4TA 3LIIA 5DCLA 5EXPA 2R48A 1RKXA 3U1VA 3F47A 3H0KA 3W5HA 2A9JA 1GT91 2DBQA 3KBOA 3PQ5A 4OVKA 5J59A 4DNFA 1YONA 1GXSA 3WGJA 2AJTA 3HBJA 3KQOA 2BGNA 2XMPA 4P22A 4URHA 4YH1A 1MFZA 5CVVA 4E88A 4G0YA 2OE2A 4G09A 3NBXX 3W3ZB 4CCYB 5KX5F 2DCMA 4ZOLB 4MS1B 4LZZA 1VJGA 4PHCA 4QFDA 4U00A 3WMFA 5HOQA 3TNYA 3WYGA 3BSWA 2Z9BA 4MS4B 2V7BA 3QKWA 2BEWA 3H42B 4PX9A 2SKCA 4ZJYA 1F4PA 1NF9A 1BCRA 4RCZA 4RETA 4KPFC 1FNNA 1E1QA 5D5HA 5BRNA 2G71A 2VYQA 2H5LA 1ZGJA 4UTZA 1E32A 2C57A 4EW2A 1SEVA 2GWRA 3UUEA 4GKJB 3RTGA 5I7FA 1HF3A 2H1RA 2PT9A 5HEKA 4BFCA 1XN4A 3H2YA 1H5QA 2EWWA 3MT0A 1K2VN 1V39A 3FCEA 1ZX1A 3I39X 2HEIA 3O9MA 4BO3A 1T26A 1UXHA 4C0SA 3RT9A 1G7RA 3WL3A 4CLHA 4P2GA 3T95A 2OQVA 1QRSA 1GPNA 2H9IA 4HEHA 4PG6A 1I6KA 3K30A 3P9KA 5DTMA 5EWLB 2GF9A 4QDJA 1UJ4A 1P81A 4JC5A 4DPKA 2AOUB 2XECA 2ZB2A 3LRPA 5H83A 5CBPB 4PHFA 3L01A 1U2ZA 3GN2A 4NZPA 1LQUA 2XQJA 3ZU3A 5LQRA 2HA2A 2JAUA 2OYSA 3VZCA 2VCHA 3QLEA 4P38A 2IDMA 4PRZA 1L0BA 3LLSA 1PGNA 4UQOA 3X1WA 2RGWA 4LXHA 1IN5A 1B1AA 3OPNA 4WLOA 2I4MA 4JYCA 4V0QA 3K0CA 3K1JA 3OA0A 5K7SA 1EX7A 2X5NA 1Z73A 3UXYA 4FMPA 4NG4A 1XDGA 2XTZA 1X3SA 1QFJA 1XRRA 2WJ4A 1W0JA 3LRXA 3C7DB 2CMKA 2QT0A 1DIAA 1OAOC 1YR8A 1QYCA 1FX1A 2ZBFA 1RWQA 2VRCA 2ONZA 4ONEA 3PXAA 5CJPA 4L72A 4JDPA 4FU0A 3UH1A 6REQA 3FOZA 3KPVA 1TW2A 1O9HA 3KKNA 2WJYA 3H1EA 1RIFA 2J3MA 2O57A 4K3UA 4R8KA 2VO1A 3ZCQA 3HEAA 3F7OA 4DE5A 1VP9A 1VKNA 4D6YA 2P9ZA 3OIDA 4FDUA 4DCJA 1IBKB 4FZ3A 1QDLB 1GA1A 3FYUB 4WNAA 1XXLA 4DJDC 3GB9A 3OECA 4C21A 1T3SA 2NPFA 1KGDA 5SY4A 4FNOA 4O4IB 1MAUA 1EHIA 3L0DA 2NU8A 1YZNA 5JO0A 6GPBA 3EGXA 4V0NA 1U8FO 1YRLA 4Q93A 4D81A 5JJBA 3AB3A 3ZK7A 3TIVA 4HFRA 2NNLD 4QPCA 3DL4A 4RZHA 2Z08A 4IHJB 1YS4A 2OM6A 1P9OA 2FMFA 3CEPB 3L1KA 2ISCA 3LQ4A 5DGDA 1AKEA 1DCFA 3HCEA 1ADCA 1HOXA 3KQPA 4I5GA 3ORYA 4M7OA 4C0AC 4UTRA 2JGNA 1DE0A 2YW9A 3PICA 2R25B 3N0TA 1QP7A 1WXHA 3FTFA 1P9RA 4Y6SA 2YCBA 3LNCA 2C2XA 4G0VA 3K35A 4ZVKA 1RD4A 1MB9A 1C0KA 2HHJA 4F4IA 5ILQA 5C7LO 3OU6A 3ZHSA 1GNVA 1Q14A 4TN5A 1EX1A 1NULA 1MZPA 2FJUA 2YR0A 5B30A 3A9RA 3GOQA 5FPTA 1UDAA 4WK4B 1IY1A 4MJXA 2C78A 4RELA 5I7UA 4JS0A 4C0WA 1EXNA 2O0LA 3VSCA 1JG1A 2AG0A 5KOJB 1V96A 3IBSA 3IQXA 4A16A 3DLAA 4R68A 5D7BA 3RK0A 3BKXA 4BV8A 2AZXA 1MO6A 2Q1XA 4QATA 1VYVA 4ARCA 1H9AA 3ESBA 4K9OA 4MV5A 5K8JB 4N5NA 3D4IA 4JNKA 1F2TA 4C4XA 4YMHA 1Y8QA 3WV4A 1LDBA 1QHGA 2PVPA 3ZQUA 3P20A 3R41A 1RI5A 3D3EA 1XVTA 2HZ7A 1VL1A 1ZM7A 4GG1A 1MGOA 4CV1A 3QWIA 4TZ6A 5P21A 5LIPA 1DXYA 2JA2A 1QZXA 2C3PA 1XOIA 4HQFA 2W6NA 1LLDA 1TAHA 2VI5A 1RM4A 2XQGA 4YHHB 3INTA 2ACVA 4F84A 2B98A 2AV6A 3ER6A 4BNUA 3F67A 4EMBA 1JXMA 1Y9AA 1NTRA 1NXTA 2IU0A 3VPDA 2XE7A 3GLUA 5DT9A 4NDNE 4MWGA 3PWSA 3AJEA 5I7EA 4ABTA 3NH6A 2GA8A 1FOEB 4PHGA 3MJHA 4UUNA 2YN4A 3I9JA 3T1HB 2F8TA 2QMQA 2W8BA 2E37A 1YF3A 1T1IA 2ZYUX 3OQJA 5DHFA 4RHEA 1KMNA 4UAGA 5DMHA 3UJHA 4AUKA 3B9RA 4JR0A 5E4JA 3I1IA 5TQJA 1WB6A 1OROA 4YB8A 2HRQA 3AHCA 1IK6A 3CF4G 5FPSA 3VO2A 1V95A 1L6IA 2AOVA 1XVLA 4XXHA 3IUSA 5GINE 1UAYA 3B5EA 1XVUA 2IXGA 4NSNA 2ERCA 1VXOA 5DNEA 3F8WA 5EHZA 2I2AA 5A02A 1VLMA 1TEVA 2YXPX 5DCWA 4AMBA 1XAGA 3GEPA 3O4RA 4X1KB 5JYCA 4UUQA 3IDQA 4YJ2A 1QE0A 4GKBA 1XROA 4K1XA 4Q7JB 1JWLA 3EXHC 3KJEA 3GRKA 3NASA 2VK1A 5BQPA 1UP4A 3EPRA 1TMOA 1NNLA 3SVTA 2IYUA 2WVAA 1G6KA 3THOA 1MHPA 3EOAI 3MWKA 2MSWA 4RMIA 1R4MB 2H8GA 2I0FA 4UJ5A 1SG9A 1RAFA 3AILA 3D3QA 3QP9A 1TKCA 5FI5A 3E5HA 3RI3A 5YASA 2ICAA 1JEJA 3P0FA 5EKUA 1UFRA 5EVJA 3RT1A 4DLPA 1VG1A 4RESA 5EZYB 5CCEA 4B82A 2ZYDA 4PYKA 2NTEA 1GSIA 3PXBA 3M6FA 1NC3A 1PWXA 2NIPA 3D7NA 3MMPA 1SVKA 3PT9A 4Q18A 2OAEA 4RVGA 4AKSA 3R5KA 1T8RA 2XYQA 2IBSA 3R0XA 1P0MA 3RABA 4MIOA 3WGLA 4KHPB 4Z9AA 4BRZA 4KAAA 3PLRA 3KP1A 4CEHA 1MC8A 1SUFA 1AK1A 3G1WA 1PJ2A 2JGEA 2BMVA 3NBUA 3MBIA 3C3WA 2FSVA 3PEUA 4IMIB 2ZWOA 3SLGA 2WAOA 3U44A 2ZYGA 1D4OA 3T1YB 3X2FA 4H0FA 1PWEA 1HGXA 2SECE 2MR5A 4GSYA 1O5OA 5FFFA 5IDQA 3IOBA 3IIIA 3NS7A 4BHTA 1JI0A 4LNUA 3LA8A 2F1HA 4ZHQA 4LRTB 4AD8A 3MERA 2DX7A 2N75A 4NE2A 2W83A 1FVHA 5K3FB 3L0ZA 4QX6A 5GJVC 5DZSA 5KYVA 4PTYA 3FUCA 1KEWA 1JLRA 3WJAA 2IYQA 5A71A 3F49S 2O8BB 4B4OA 2CLIB 1N8KA 3Q8KA 2QTMA 1XMSA 3E0QA 4NCIA 4CFSA 4NE7A 1GFSA 4WK6A 5T67A 3NUZA 4IOJA 1NZDA 5TT0A 5CJJA 4WKGA 1M83A 1XJ5A 5HUJA 1CQJA 4AMGA 3GP8A 3TM5A 1UEIA 3DE3X 3MW8A 2C29D 4FMDF 3HB4X 5F12A 3CJQA 5KMGA 1UWKA 4FYHA 1ZEJA 4M86A 5BQXA 1XNRB 4OJNA 1Q1QA 3PX2A 1ORTA 3EF3A 4OOFA 4WFQA 5CCBA 4C0JA 2CUNA 3C45A 5JZVA 5LP6C 1O08A 4A0SA 4TS9A 5I9SA 1NXVA 1JALA 2H06A 1JDNA 3U3RA 4C07A 1C8BA 1SZDA 2RG1A 1QQ7A 2O0HA 1NI5A 4B5LA 1ZI9A 3RWBA 4PFQA 4HO1X 3MS2A 1V8FA 4XA8A 1KIAA 4UDYX 2ZWIA 3HHPA 5E3IA 3WZ2A 4LG1A 4XWGA 2II6A 4NXNB 3SBEA 4RXUA 4JJEA 1SCNE 1H4VB 3AU8A 5EUCA 2QSUA 4EB6B 5LP6B 3QKTA 3SIWA 3VKWA 3IKJA 4D5GA 5KUTA 4E7PA 3CVOA 4R1QA 3I32A 3KE8A 3O93A 1YACA 2FRVA 2X3UA 3D54D 1B2LA 3MJVA 1P6UA 3B7WA 3OD1A 3LSTA 3ONNA 5AICA 4RC9A 2AG1A 2IZ1A 2XDYA 1IBLB 2IEBA 2CD9A 2HGSA 521PA 3UJ9A 4R98A 4KGZA 4UEQA 4RY0A 1A7AA 5AKKA 1EBBA 2BI4A 3EOZA 5T6BA 2NZ2A 2W6ID 3K73O 4XCXA 5LZ5A 5KI6A 4EPRA 3V3KA 4B81A 3FVTA 2Q5FA 2ZIUB 3KWMA 2IW1A 3LVRE 3R3UA 2FMIA 4GWKA 4JEHA 4WLNA 4WLVA 1OFTA 5EE1A 3ZVLA 3KS9A 3IQDB 1T5OA 3BAZA 2QTNA 3L9WA 2ES4A 3SDSA 2F1OA 3CLRD 1P4JA 1DCMA 3WYCA 2ACWA 2C9BA 2ZYWX 2TS1A 3JYLA 5KEIA 1Q21A 2BFFB 1I1NA 3EQ8A 4IAOA 4K0KB 2ZE8A 5B53A 5JVDA 3CF0A 2JK1A 5D6OA 2Z8ZA 3KZOA 1SBQA 1PV2A 2XTMA 1MJGA 2AFIA 3OOSA 4W6QA 1YHNA 5FL3A 3CZCA 1DBRA 2CNOA 3BZUA 3HJBA 4ROSA 4R71A 5F76A 2P6RA 3LBHA 3D43A 2FPUA 2HV8A 1C0LA 5ERXA 1VMDA 5C5DA 1BWRA 4W8OA 5A0TA 1ZGGA 3EGIA 2LP4Y 4BVAA 3IUNA 3HZOA 2EC5A 3ZV5A 4PBTA 1QH8A 1C9EA 2PQ2A 3Q2IA 3OCXA 2GDJA 1PBTA 1PX2A 3JV7A 3KWFA 3KZXA 5G0WA 2RKWA 2WD9A 3WIOA 2X2EA 1NPTO 1GOTA 1WXQA 2HK8A 4H4DA 3GJRA 2PZEA 4DABA 1JAZA 1T5DX 1AHIA 1C7ZA 4I14A 1PJAA 4UE3S 1BEZA 2MSNA 4FGZA 3ZGVA 3NVAA 4GP6A 5CUQA 3BXGA 5AYVA 4FMBB 4Z7OB 1V5EA 2AW5A 5JS7A 5LFAA 2POCA 4KO3S 3UYKA 2OYRA 3Q2KA 1IZ7A 4CTJA 3K5PA 4RK7A 1P0IA 2AOUA 1CUUA 4FEAA 4K88A 3T7EA 1VYTA 5CBPA 4R1SA 2WU3A 1UDXA 3QNMA 1F2UB 3BM5A 1Q1EA 1UJMA 2BH9A 2RBEA 4EY8A 1PYDA 2WIFA 1JQJC 1OYWA 2DP4E 4JA0A 4KFSA 4JVMA 3UTDA 4GX2A 3EFOB 1WDTA 5HSGA 3WIUA 3TG8A 1WD5A 1CLUA 2JLBA 4XVCA 5BWOA 1FTWA 4NBVA 2C7VA 3LQYA 3I8XA 5FULA 5IT0A 1XCGB 4H7JA 5I4CA 3C6QA 1USUA 2IPMA 2UZ0A 4LZNA 4CF6A 4DBVO 4YJ2B 1Z5GA 3PHGA 2QR5A 2BKVA 2ZG6A 5K4HA 2ZK7A 3CUVA 1J09A 1ZNYA 5I7OA 3O1JC 2JLWA 1EVEA 1IM8A 1H6CA 1P3Y1 4B43A 3Q8WA 1IRIA 1ZN9A 1Y3HA 3I6BA 4Y98A 3IL2A 2OXTA 5IWAB 1R7RA 1ZNZA 5FL7D 1JEAA 2HF7A 3S81A 1IUNA 3GMDA 5KJFA 3P2KA 3TI9A 3WL8A 1HE2A 3FAZA 4C3OB 4CLRB 5FB3A 3DQZA 4BZXA 1SXJE 4IWYA 2R6CA 4LV5B 4PLHA 4CTNA 1Y4DE 5E0KB 3Q8MA 1D09A 2P35A 1PTJC 2P5TB 5CX1A 2VUIB 2PVSA 3S1LA 1OASA 1RJFA 1T3HA 3EW7A 3M2TA 1J8YF 3JQ7B 5JNVA 4NCBA 5GZ1A 3IVRA 3QE2A 5EQDA 4QXRA 2CLKB 2JLRA 1ZVJA 3A1NA 2PX5A 2FUCA 3DMDA 3QU4A 2XHZA 2QDXA 1QIJA 5J2UA 3BB3A 2G08A 1L7RA 1B8OA 1HY3A 3DULA 3NHLA 4OL9A 4PAWA 5HFNA 2Q4DA 5C80A 4AICA 4BFUA 1QOZA 2EFYA 3Q98A 4O4HB 5B7QA 3HTXA 1VLZA 3AYXB 1EFPB 3QPWA 2WP0A 2O2GA 1TUBA 1X0XA 3TCKA 3DVQX 5KBYA 4Q1BA 3ADDA 2VDRB 3SX0A 2NVUB 1YTUA 4FPXA 4ND4A 1EP3B 1YA8A 2O2XA 4PQYA 1EXWA 1D2HA 1FMJA 2LCIA 2XV1A 4UBMA 1FLDA 5FTJA 4PWZA 1RZRD 1RYMA 5ALMA 1IB0A 1VJRA 1Y1KE 1LW6E 4YWJA 1J0DA 1VSUA 3STWA 1QCCA 5AI8A 3JARA 4IJKA 4TTVA 1QC5B 5COBA 2OCYC 4D8TA 2QX9A 1U0OC 1FXWF 3GLFE 5IKOA 5CX1B 2ZBPA 1XG5A 4TYQA 1JHOA 2BISA 5A9TA 3ND9A 1YVEI 1PEDA 4TKLA 1YE5A 3C8DA 5JAQA 2W0SA 5IM4A 5J1SB 3KAKA 4RFSA 1I1HA 3U4QB 4FXOA 5C7YA 1J00A 4ZEWA 3D6AA 3T12A 1CF4A 1E3TA 1K4MA 2ZYSA 3ASVA 2C88A 3IFSA 1RACA 2VDUE 3QJYA 4Q7KA 3DTVB 2KBEA 3ND7A 4WJKB 1FP2A 2C4WA 1ML4A 2D8MA 2ZUCA 2ZWPA 3MJ4A 4L3VA 3U7IA 4RQTA 3IE1A 4Q1AA 4HNHA 1TX4B 2ZSEA 4QGBA 4HDAA 4IGFA 1D2CA 2B8WA 2O6LA 3QELA 4XVHA 2BCGY 5JBNA 1V71A 4KIGA 2BSQA 2A1TS 2C5BA 3GUCA 4KZKA 4HDSA 4PX3A 5FUWA 1OLXB 4UVIA 5G41A 4QRDA 4RNCA 2A0YA 3I45A 1GGEA 4K46A 5HE8A 1FTQA 3GFSA 3U62A 4HGOA 5C8ZA 1C1DA 3HHEA 3PXEA 1UEXC 1XU4A 2BEUA 1C3EA 2J5RA 4YV2A 3DGFC 3FPGA 2QTHA 1G8YA 2ASVA 2GK6A 4RTQA 2O19A 1DC4A 3TE6A 3NWBA 4X20B 1N8TA 2B8EA 4XUDA 2VL7A 1A5AB 2I4NA 3LF1A 4OYYA 3IQHX 5E1MA 3TQQA 2XWJI 5DIFA 3T7TA 4OH7A 2WWWA 1W4CA 2E4XA 3FFWA 3UUGA 5IMBA 1NXPA 2ISSD 3II6X 2R6FA 3PBKA 4AUNA 4HVLA 1RKQA 1WOYA 3O90A 4RXTA 3HXTA 4I4TA 1O96B 1XHLA 2IRWA 1HYQA 2XMQA 3DEFA 3R40A 2PXHA 4BLOA 1H5NA 2QZJA 2ID8A 1SHJA 1QTRA 3UA4A 2P1ZA 1F20A 4M1OA 1AQJA 2XHEA 4PIPA 4KUEA 1GPLA 1A3CA 4REMA 1JA9A 3QY0A 3O8OA 2LUOA 1BKYA 1LQTA 5JDCA 3ZYZA 5KOIA 3ZDAA 1H2HA 2FZ4A 2HCRA 1Y42X 1DKNA 2AZDA 4IDOA 4EM6A 1HNWB 1FQJA 3FNRA 1WZCA 1DCKA 2Z3WA 1P1KA 1G3MA 2P2CA 2EW1A 1P0FA 1UDWA 1UK9A 1W5FA 3R0IA 4FQ8A 4I99A 3MCTA 3WTBA 5JYEA 4Q48A 1YCGA 3PKJA 1Y5RA 3FYSA 2EJBA 2I55A 3UJ8A 1RXWA 2BVNA 3ZD7A 4C7OB 1QHNA 2XGMA 4QLOA 3VKFA 1LK7A 4QYIB 2JARA 1W9HA 2GZ2A 3O84A 2Y71A 2K2WA 2RMKA 4RVUA 3TLBA 1E96A 3VDXA 2ZRQA 1RWXA 3A05A 4ZDWA 2AJCA 4CFZA 5M34A 1ATZA 2UZ3A 1DNPA 4CQLA 1BOOA 2X8JA 4KR2A 1SUAA 3JVVA 4Y2PA 1QV7A 3VPHA 2CDAA 2HXYA 3HU2A 3SHWA 2PZKA 4TMTA 4D0GA 2PZLA 4NCHA 1AQIA 2CUTA 4K3VA 5D3KA 3U5ZB 1E5XA 5H3CA 3ABQB 4PC7A 4X7BA 3EXAA 2B6HA 3QUTA 3O2QB 3PDHA 3CXRA 4F1JA 1B14A 4CF7A 4PPYA 3SDZA 2QVBA 2W0MA 4B48A 4K40A 5EJMA 1AXEA 3W2EA 4H6XA 3T6KA 2ZRNA 5KDLA 3OHPA 4IV8A 1FDRA 3X1MA 1E7WA 2LIPA 5T3YA 4M9QA 5BUQA 1XEWX 4YHBA 3RVDA 3AIOA 3TIFA 1TM3E 1BS9A 1YR7A 2P8SA 3WOVA 4WBNA 3H5OA 5IYZA 4NS4A 1QJCA 3JZDA 1SOVA 3P4XA 5F51A 3PDWA 1E59A 3HH8A 4YUXA 3EPLA 5KKAA 1SC4A 1TTPB 2D0OB 3U7RA 3ANXA 4BNHA 1IEXA 1Q7GA 3DBLA 4CDGA 2MSKA 4HADA 1XTSA 5DCYA 4LYGA 2OBYA 1VSQA 4KN5A 1Q7TA 3SKYA 4HRVA 5CVEA 1VPDA 2YDXA 1JZSA 1XYVA 2ZLBA 5HDBB 3UMBA 4AIIA 1N5RA 1UODA 2ADOA 3FY4A 1QH1A 3RJZA 5F4BA 3LVFO 4LXUA 4ZCTA 1E0DA 2CD7A 1Z0DA 1X1EA 1MT3A 1L7NA 1QOQB 2Q99A 2Z1DA 4CM3A 1R0KA 1TM4E 4D3DA 2R47A 3KQMA 1OB2A 2E5LB 3G0HA 4AY2A 1Z0AA 4M76B 4BO8A 1S96A 1BU5A 2FVYA 2J9XB 3QTBA 1NBAA 1Y1LA 4PAOA 1Z0KA 2GD6A 1J9GA 1V7QA 2FP4B 4JOQA 1RM5A 3O5AA 4CM4A 2BHSA 1XHFA 4X6LA 1VE9A 3ITEA 1WHTA 1W0KD 2JCYA 3WQSB 1N0WA 1VPVA 4DZRA 2DLDA 1SO8A 2NU6B 1TIPA 3U0BA 5K8TA 3RPEA 3DOIA 2DFPA 3FE2A 3KXIA 4KQEA 3RC2A 2XXBA 2B82A 3PC8C 4G0UA 3QPCA 4RIEA 2SBTA 4LRWA 3ILXA 1NKSA 5EIOA 2R8YA 1R66A 1IU9A 1EDZA 3V55A 5L3SB 1T8WA 5J23A 1DQYA 1RAIA 3QEJA 4D9CA 2YY6A 3TEJA 1BYUA 4NEHB 4PR3A 3HI6A 3L7DA 4DB2A 1F17A 4IS2A 3RIEA 4EATA 3TLZA 1IULA 2PNJA 1PEYA 1CRLA 1MEOA 4CGYA 1T4DA 4PSKA 3D3WB 1XMVA 3DZKA 2P1RA 1KZ7B 3Q7EA 4O6VA 5DWVA 5CBKA 1FFWA 1WB9A 1X77A 3NXSA 1JMYA 4DLXA 1U0RA 3T5MA 4EITA 1NBOA 4M49A 4GI7A 3IIEA 4DLZA 1PQPA 1AQLA 1BMFD 1R5BA 2DFTA 2HSWA 2PAAA 2X1HA 3CLKA 3EZGA 3KKZA 4ZQCB 3OFVA 5UKDA 3TFQA 2WABA 4RVDA 4BGEA 5HTKA 2VP5A 1FXUA 4GWGA 4ZOCA 5BN5A 3TDMA 4BQEA 1EWKA 2HTFA 5KU1A 4IJMA 4ROTA 4C5BA 1AKYA 3FGZA 4HQOA 2BFEA 2JH9A 2B1JA 1E4VA 1T9ZA 2UYGA 1Q0TA 1EFKA 4DGSA 3IIMA 1BVHA 3VUFA 3WWZA 3F97A 3S0JA 3KQVA 4YUZA 4MVJE 2NTNA 3T9DA 1GFIA 4B6JA 3QQ5A 3G9XA 1N9GB 2XWSA 2M6SA 2XTJA 2P9CA 4H6WA 1GZHB 2FPSA 2FF7A 5DO9A 5D2CA 4P0QB 2NSYA 2O14A 2AG8A 1VP3A 2I6TA 4TMVA 2HCTA 4BMVA 1X7DA 1K98A 3C5EA 4PO1A 4H7PA 2DTDA 5CYPA 2ZKIA 3CT6A 1V7PC 1G17A 2RI0A 1TAQA 5THQA 5JD4A 2H9YA 1QHYA 3T0FA 5JASA 1YS1X 3C3EA 1QFZA 1IYZA 1T35A 5HBGA 1ZVMA 1HYBA 1U0JA 2BF4A 1GUFA 2C3UA 3H2HA 4I9NA 4TKUB 5TJHA 3R7WA 5L7TA 4NMWA 1ZCAA 3FDXA 1S4MA 4BNLA 4TQ9A 1EWQA 4DR4B 1I3MA 1G6OA 5H16A 2WVJA 1JN0A 1KAOA 1L5MA 2ACEA 3ML1A 4HTAA 2KS6A 4LY0A 1XDWA 4LYDA 3RHZA 1VCHA 4QQRA 3TZKA 4C08A 1U9YA 1U8XX 1IXRC 2Y1CA 2JFZA 2Z30A 1U5BA 2A9PA 3MPOA 3PFFA 2C59A 1EVIA 1QGED 1G98A 3CA8A 3ITNA 2ZRHA 1M10A 5BW4A 3W6UA 2D1TA 3LT1A 4IDNA 2CNNA 2PMFA 5KYGA 4NULA 1W49A 5FQNA 3N7AA 3H4IA 3E0XA 3AEYA 2WMOB 4TL9A 4OHZA 1DEKA 4G2NA 1NMZA 3D0RA 4DLNA 3H3XA 2FOXA 1UQTA 4FJ1A 4RA9B 4XOIA 3JALB 3NUQA 1QIFA 3JZAA 3FFTA 4QDKA 5T4BA 3ELDA 3T06B 5ICMA 3ESZA 4YPOA 1GD1O 1FRQA 3VR6H 2WMNB 2ZRJA 4DEYA 5HR5A 4FKZA 4Y6RA 2RC6A 2XVXA 3AUTA 3K6JA 3WB0A 4U4AA 1GP2A 2A1IA 3VPCA 4E1BA 2AEMA 4NG5A 4BJ5A 1Z0SA 1RYFA 5L3QB 3LD9A 3QPDA 1L7QA 4EKNB 4BLVA 1V4VA 4Q03A 2OUKA 3U19A 3ZDRA 2WWRA 1HWYA 1R1DA 2YUIA 3P5SA 1A8PA 1XP8A 4UHHA 1X9IA 1NYTA 1DAKA 1X80B 4CQMD 2ISQA 2GPAA 2ZJFA 2I91A 2WI8A 4LNAA 1KJWA 2G7MC 1U2QA 4LDAA 3JU3A 2OBNA 4LJKA 3D1VA 1UBKS 4N65A 2Q5JA 4RD1A 4LGCA 3REQA 1E6WA 3SC2A 2FDRA 3BVPA 4S1WA 5CFQA 3RWOA 3NTQA 5KTNA 1U04A 1MRNA 4M0PA 4FD2A 2W6OA 4MVJH 4MICA 1W35A 4GXTA 4LSGA 1BE8A 3QOFA 1PQ4A 5WRFA 4HNUA 4MKIA 2FW6A 2HU5A 2I1QA 3I2GA 5KVQA 3SBXA 4B3SB 4OQEA 3QBTA 3DR5A 1NBMD 2VAPA 5B1SA 4ADSG 2ODPA 4C0HA 5JAIA 1NSFA 2O5CA 4EARA 5AM3A 3DE2X 1K89A 3AWDA 4O4JB 4ZPXA 1M0EA 2QGZA 1Q7BA 4S12A 5JQGA 1BDIA 2RHMA 4JMPA 1OLOA 2NYRA 1R8XA 2GN1A 1RYDA 3KQHA 4U9HS 3BULA 3KZVA 3UWSA 3AFOA 3VMMA 1XAJA 1NW8A 4BEWA 1RVV1 3DEYX 1JA1A 2I2CA 4IDGA 5DX0A 1CJCA 4PG4A 1UBSB 4WZAB 3FUWA 4KE9A 2HMAA 2HREA 3JQEA 1CUWA 1UJ2A 3V48A 4YNBA 1KY4A 2IZ0A 1L1EA 3RHSA 3S2FA 5KQSA 2WFZA 5LXTA 3VR4A 1CB0A 1GU0A 1JMKC 2H1SA 3ONEA 3BWVA 2C3MA 3MD0A 4MIYA 2GVZC 5AJVB 1BG6A 5L9AA 4XJXA 3HPQA 1OIVA 1E99A 3F90A 3PNPA 1DQPA 4YCCA 3BFVA 3NIGB 4F45A 3RNLA 1TJ5A 1G4UR 1WKCA 1X0VA 2ODQA 3LKZA 4LXQA 4N8EA 4RSRA 3INNA 4YAKA 1U3TA 2PWZA 2ZE7A 1E8NA 3FCUB 5JT1A 2HSEA 3K0CC 1GQ2A 1XD2B 3PYLA 3AHFA 1VE3A 3OCWA 1VI2A 1E2HA 1ZOOA 4BNDB 1YZ3A 2I9KA 2EQ5A 3IP8A 4HZUA 2EQBA 1G9SA 1DZIA 1R18A 2W93A 4MR8A 4MKRA 3M34A 1YDEA 4MW4A 3TW4A 4RM2A 2RAVA 2YYYA 2XDAA 5T4FA 4D92A 2R0QC 2Y1KA 4NESA 5EEGA 3TZEA 4F2GA 4Z4IA 4QUKA 5I7VA 2PR7A 2VDKB 3JPWA 2O8DB 5I4BA 2BP7A 1M2OA 1N6OA 4OFBA 3WBKA 1JLMA 2H63A 3RYHB 2EV9A 3KVOA 3GPCA 4ZIRA 3Q7SA 3ZY6A 4XX0A 2BR3A 4M9RA 2WE8A 4ESEA 1H6DA 2VHWA 5EY5B 3VPGA 1GKIA 1Y8QB 4LHXA 1DWOA 2EFHB 3FDZA 4UVHA 1XI2A 1NUHA 2ZJ0A 3CF6R 1GZDA 4IFTA 4C88A 1UP6A 4R05A 1FJ2A 3HV2A 2REBA 4KU4A 1HQYE 3SF8A 1LPNA 3PC4A 2GM4A 4FYVA 3NTRA 4AYWA 4Q1VA 1TRKA 4FLMA 1C3OA 2IK8A 1WHSB 3HC7A 2PEYA 4G0MA 4B2PA 3PUZA 1JI3A 4I9GA 5FTKA 3JASB 3VYSB 2CXXA 3U13A 4QKQA 2P2GA 4MUIA 4DRYA 5BV8A 3LK6A 2NTJA 2YNMA 1YXMA 2VF7A 1G66A 1DTEA 2AD5A 4AKEA 1RWNA 4E5KA 3OIVA 2FMXA 1T4MA 2QGNA 1RYEA 3IRVA 1O9BA 4F9GA 2C7RA 4MTCA 4MI3A 1A0OA 1Z2DA 2O8DA 5EJ9A 1GPYA 2C3OA 1XZEA 1X70A 2XCOA 1E3WB 4IIXA 5SICE 2WTEA 5A9SB 1IY9A 4ILEA 5J2UF 4DBLC 1MW8X 1EIZA 3QKSB 2G1PA 1WP9A 4HQNA 4M37A 2XCIA 3EEOA 1QFMA 5LBUA 1NJSA 2I4OA 3THRA 5KC8A 1WR8A 1WUHS 3CKMA 2GF2A 3PXCX 4KTTE 3S2YA 2WB2A 4AY6A 4DQVA 5AXBA 5B4VA 3WWPA 5JZBA 3CRRA 1VMIA 1NPYA 2JI4A 2O7VA 3PL5A 4M83A 4BJ1A 5ALLA 5EAIA 3OSUA 3AY0A 3VR6A 1VKJA 3EY4A 4J07A 1PJLA 3FBGA 2I22A 3KM0A 3PT5A 2OA0A 1TJYA 5FWXB 1QYVA 2OD7A 1KMIY 1LV8A 2ZUDA 4D6XA 4JUCA 2GARA 1E4YA 3WHLA 5A03A 5DNUA 1ECPA 3H9QA 3GUHA 4JBIA 2H4WA 1UZLA 2JBAA 4UZSA 2JGFA 3TUZC 1I1QB 2N1BA 1C80A 3EFHA 4TQGA 3HO8A 3VR2D 2PG3A 1XAHA 3WK6A 3L6OO 3P0RA 4OH1A 1IQ0A 1Y34E 3RARA 4K7JA 2Y6UA 1KZ4A 2HF8A 4AY3A 5ALOA 3FCOA 4QRIA 5DV9A 3U4MA 1NBME 2ZAIA 4YAJA 5LC1A 1Z63A 4MA5A 2PX8A 1FIUA 5JCZA 1V43A 5LJLA 1PG5A 3PD1A 3GRAA 2QZ9A 4ALIA 3GK3A 3KPJA 3NWPA 4KL8S 5JISA 5JHGB 2CFIA 1MEEA 3WQRA 2WHXA 2PXXA 3K0KA 4IUBS 5TEVA 1V4BA 3BH0A 4XRRA 3U61B 2OUIA 1DAHA 1G5FA 1G6Q1 2C0CA 1CP2A 4B83A 1X1BA 4DDWA 4OTZA 5CCDA 1DEHA 2R1VB 2XUKA 3DL7A 5FCDA 3SGLA 4ZJPA 4E5YA 2WWYA 1OH8A 1KK3A 4PZ0A 3ADKA 4HLUC 5PGMA 1IZ0A 2XEXA 4PTLA 1KPGA 5ALJA 1WHSA 2NU9A 4HNAA 3CNQS 1AMNA 3NKFA 4Z0NA 1PF7E 2IHJA 3B9PA 5C0OE 3FUVA 4EA6A 1ZK2A 1SK8A 2B2NA 3EEQA 3DMHA 3HN2A 3JY6A 5GONB 1MKYA 2HY7A 2CHVA 1VBFA 4FFOA 1QTQA 1Q3HA 1OZGA 3OG9A 1ISRA 3HR4A 2DFVA 2IFTA 4BAGA 5LXTF 3TMAA 4MTLA 4BNYA 4DV0B 3W5BA 2AQ8A 3KCQA 3MQ4A 4N6NA 3AVXA 3KDPA 3G2NA 1O0BA 4HB0A 4LAFA 5BR8B 2C31A 3QHPA 3N3AC 1U5AA 1YS7A 2Y1OA 3HVJA 3RVNA 4DLKA 2EX0A 3A6ZA 1FEZA 1JLSA 1LEHA 2G67A 2P0YA 2A1UA 4OEHA 4B31A 2AMYA 4ED9A 3KQUA 3KOZA 1XDBA 2C9OA 1BE1A 4ERNA 3RRFA 4JBXA 1TECE 4FD3A 1NVXQ 3OURA 4D45A 1QVVA 2PGDA 4CI0B 2D5CA 2V7WA 3D7KA 4UAJA 5FV7A 4KO2S 3TI7A 1GNPA 2DRIA 3IMEA 2OHVA 2W4QA 1Q16A 3T3DA 3PDIB 4JT8A 2P6PA 2PRYA 4OGWA 1YZLA 4M1QA 4DEXA 1BGVA 1WLYA 2C00A 1FU7A 1VPEA 4KWIA 4MMYB 4ZALA 5AW7A 1QCYA 3IAXA 4XTRA 2JI8A 3T9FA 4BNKA 2X7HA 4NBSA 3K09C 3O4VA 1AQNA 1UZNA 4BLTA 1XZJA 1E2PA 4LGVA 1EZ4A 3RNOA 1T4BA 3E70C 3I0NA 2EFDB 3GLQA 3GJ6A 3GFTA 4PN3A 1GGFA 5EE5B 1Z62A 1JG6A 4EUHA 3D8TA 2E1PA 1WETA 1VE1A 4GOOD 4HATA 1JPJA 1TNDA 1VMEA 2BGGA 1SUPA 3V2IA 4N9WA 1PQWA 3KHSA 1L5RA 2VQEB 2YJ6A 2BGTA 4Y6PA 1W0CA 2BKXA 3T7CA 3LWNA 4PLVA 3C4QA 3GRUA 4GOXA 2VPZA 3HUDA 2AHOA 2B37A 4GNRA 1VE6A 3BIJA 3L4EA 4N39A 5ESXA 4DA6A 4G5SA 4MULA 1YGPA 4I50A 4KX3A 4BRUA 1N5LA 3WZMA 1C8KA 1VKHA 3RRBA 3MTDA 2PO7A 3R6TA 2OV4A 1ZIPA 3D6FA 1QQ6A 4Y1FA 3NJ4A 5K0GA 3WGZA 2F90A 4LRUA 3ABZA 2PX4A 5IVDA 1IN8A 1B6GA 1KQPA 3THXB 3GNTA 1NJ6A 1ISIA 4OI2A 5PNTA 4ZHQB 5DE3A 4F7WA 3SOZA 4CW7A 5HK9A 1VCIA 3UXHA 1YDMA 4AF8A 1BVYF 2OCPA 2XKKA 3HN6A 3ROKA 2G3YA 2ZRBA 1AH2A 1M2EA 1FU4A 3KEFA 3R5HA 2LR0A 2FETA 3ED1A 4BTEA 1IK4A 1CUJA 3D7SA 3MUFA 3WO1A 4S04A 2E49A 3MAGA 3VR2A 1EJ0A 1V0JA 4JL6A 3CEJA 1EP1B 3WDKA 4IOKA 1TF2A 2EBFX 4FNGA 2R00A 4ZQHA 1T36A 5TQVA 3OPMA 3W7BA 4EHIA 2QJRA 1CERA 2IHVA 1XD9A 3NEJA 1I7SB 2PPLA 3R9KA 5AW2A 4ZT4A 2ZVQX 1ABBA 4UQPA 4JA2A 5EJ4A 5BYAA 3K16A 5AT1A 5E7JA 4JVOA 1MQ9A 2DSNA 4BYGA 1L8OA 2ZSKA 3FYUA 4WNAB 1M34B 2JFOA 3NH9A 5T4EA 4A0HA 1WOMA 1JFLA 4GWLA 3ICWA 4XFDA 4ZEXA 4F9TA 2O8EA 3HSKA 1A5ZA 4OQQA 4L0QA 4GZLA 3RODA 2BM1A 2I9PA 1PL0A 4FUQA 4KB5A 3RT7A 4GR4A 4O4HA 3OPYA 4CR6A 1RXCA 2CWDA 2PM8A 3KCNA 5DM1A 1K8XB 2QXTA 3AC0A 2OCXA 2XAUA 3HR8A 2XTNA 2DR2A 4M6WA 6CHYA 2CJFA 3CFYA 2GTPA 3E15A 1C7JA 2JZCA 2GJKA 2JJ2D 3VYTB 2FG7C 2FW9A 2V7EA 1EGQA 4U6NA 1GGKA 1G5HA 4D9HA 3Q3EA 1Z5ZA 2B1QA 4INPA 4MQUA 3EBLA 4R69A 4BVBA 4EX7A 3RYFA 3GRRA 4FMCB 3PHLA 4Q6BA 4Z9XA 1YR2A 1PZHA 1R6TA 2ADFA 5FOXA 3RTDA 4Q1FA 1O89A 3OFND 2C20A 4NV3A 5AHRA 1N6HA 4FCWA 2NU6A 3QLVA 4K9MA 5KOHA 1BDJA 1L7PA 2CXSA 2B36A 2QX6A 3T99A 1MA3A 2R5WA 2F1IA 3NG1A 4TTRA 1EJBA 2FZCA 3RUHA 5J2TB 4V0SA 3U3ZA 3MT9A 1W25A 5I47A 1SQGA 2JAWA 1Q7RA 3DBLB 3EPPA 3FPAA 1OIWA 4PLPA 5BO5A 3ZEAA 5EQTA 2GK3A 1OXBB 4HRXA 1H6BA 3TLXA 4KGXA 4RHTA 2W2LD 2XB8A 3G85A 3RV3A 1DG1G 3LYAA 4YRGA 3B8HA 5NULA 2OV2A 1XEXB 2O3JA 2ZEJA 2XDQB 1Z0IA 1YC5A 3ODPA 1ZP6A 3ZJYA 5JJLA 1ZCFA 4X8OA 4LJ5A 2ZIVB 3E4CA 4WOKA 3TRIA 5FD8A 2A5GA 4IVNA 2PKWA 2PWYA 5JD6A 4YRQA 4WXYB 2K7ZA 3KV1A 4XYEA 2QUHA 1DX6A 2F6RA 3GVHA 3ZJUA 3PLAE 4UTOA 1EUDB 2CY0A 3OZAA 3L4BC 1AT1A 3GJXC 3IUJA 1L5OA 1FS5A 1PDOA 1RI2A 2RCNA 3COZA 4UTXA 4WN9B 4XYMA 3H9BA 3UOGA 2IPNA 3OE7A 1MIHA 2LDBA 2Z57A 5KVAA 4KSCA 4YMUA 5KOHB 3MGAA 1TU0A 3PWKA 3TNJA 1AOXA 1NR1A 4U7WA 5IJZA 1B3RA 2FP3A 4B3HA 1U7DA 3P19A 2ZUVA 3SFTA 1F6DA 3LFUA 4MI9A 2W2VA 2XT9A 3RSQA 1XRPA 1I33A 2NUPB 1ODFA 3K15A 4RHUA 4UHKA 2YKGA 3JAWB 1G55A 2FFBA 2N3ZA 3BCRA 1QP4A 1F7UA 2QU8A 1IOLA 8ABPA 2HSZA 1QTNA 2NACA 4UEWA 5IJ9A 3HKEB 1PSWA 1O96A 4BMCA 5JXWA 1ZR2A 3SSNA 1HV8A 2WM9B 3C1TA 1P1RA 3AETB 4R3WA 3VV2A 2AN1A 2PU5A 2D2EA 3A6EA 1LI7A 4EYQA 2Y9MB 1T25A 2NN3C 3B5IA 3PEFA 2XZPA 4BECA 1QGUB 4YP7A 5IN5A 4ER7A 2P9TA 1Z37A 1O77A 2PKQP 3BIWA 4LSWA 4Q4JB 3N2YA 2AI3A 2ZJZA 4DT1A 4Z51A 3CH4B 4I4IA 2B94A 1GZ4A 1PV1A 4Q4DA 3O8CA 2QG9A 3F3MA 4F2DA 3R44A 5EP2A 1W581 4UUAA 5G1PA 1SVIA 1OKKD 1U7WA 2JJ1A 2I6SA 4G5HA 2I7TA 4HWKA 4V0KA 3N8NA 1H4QA 4EGQA 3DTNA 4PANA 4RH3A 3ZWVA 4XSGA 1DHRA 1WXDA 2GGSA 3DT8A 2F55A 4RXMA 2FZGA 2ZB4A 3PPVA 5CNJA 1U2DC 1GTL1 3KT8A 5I01A 3WMXA 4I5EA 4NRDA 1XPRA 4WOCA 4R1UA 4P4NA 4DQXA 1A4RA 4UUPA 2FLWA 3MEQA 4BLRA 4GIBA 5H5JA 1VA4A 4QIHA 3WA7A 1CEYA 1PR5A 2SCUB 2V3VA 2FSVC 5DSXA 5FWYB 1RQ7A 4K6OA 3T15A 1AV7A 1OFHA 1OXXK 4URUR 5BV7A 4D9BA 1ONOA 2FCRA 2MJLA 4R9NA 4EQZA 4E4TA 4UBKA 4A6DA 1JR3E 1MXFA 1S3IA 4KWTA 5J4KA 2WV7A 5IJWA 3AEQB 4RIIA 1BXRB 5EMKA 2Q5HA 1CFJA 4RFSB 3QNUA 3WHPA 4C04A 1EWRA 3MYYA 2IZ7A 2X1VA 3KU4A 2ANCA 4Q3KA 4PGGA 3N6XA 4FWIB 2CV0A 5FNZA 1PT9A 2HMVA 2J6HA 4MEJA 5K3OA 3AR8A 1AS0A 1XLVA 2VOEA 2AOTA 4JHXA 2FSIA 2FLKA 2VRWA 4RPCA 5CW2A 4UBLA 3AL2A 4PYNA 1BH2A 1JV2B 4OKNA 1ORVA 1Q17A 4J29A 4TV9F 4X95A 4AJKA 1KO7A 3JAWA 3OIWA 5BYKA 3Q88A 2I87A 3I4FA 3E7FA 1JIJA 3ORHA 2VH1A 5EEHA 3NYIA 2PVCA 4HWSA 3PFCA 3ACCA 1YS9A 3BJZA 4IJ6A 2GMWA 3EQ9A 5DTQA 4CWAA 3PE4A 1Y7LA 2RK4A 3QFFA 3V1LA 5U9CA 2WU4A 2ZT8A 3FSGD 3EAGA 1NAIA 3IEKA 2V9PA 4V24A 5CVTA 2HJRA 3SOPA 4ASUD 1T5TA 3B3GA 3CNOA 3FZGA 3GCXA 3KKLA 2D4AA 4NNJA 4XGQA 4BMYA 4I55A 4PGMA 1VZ2A 5ESRA 2C2OA 3GF4A 4M8IA 1T8YA 2BGLA 2WD8A 1ULAA 3C6KA 4MRAA 3UV7A 4NMMA 4C78A 3L4SO 4G0WA 2R2AA 1ZI8A 5TF0A 3D8SA 1NGSA 5H0IA 1ADFA 4B2IA 3TRJA 3ZZNA 1DMSA 1MMFB 1QDEA 2I3AA 3AZOA 3PJFA 2JB9A 4R2LA 3B3FA 3ZR4B 2DTEA 5IF3A 5JATA 4PC6A 5IJ0A 2YV5A 5JEEA 1QGAA 1GUBA 2OR3A 3BRWD 4L9WA 4NLLA 3RVPA 1B76A 1Y3CE 3G79A 3W77A 1VJ0A 5F3DA 2IGBA 3DZCA 3W4KA 1NPDA 5DBIA 3C3KA 1GARA 1YIDA 1G4AE 3N0RA 5EC8A 4UBJA 2DWQA 2FQQA 5DW3A 5B7GA 5C51B 1BX1A 3ICQB 3I6IA 4QSHA 2AJBA 1J7JA 3GLFA 4ERXA 2AX4A 1AGXA 1G7TA 3F8SA 4XD2A 4G9BA 5K51A 2RKOA 1URPA 1RXYA 4MPRA 4CM9A 4D46A 1NJ5A 3VA7A 2QTLA 5HIAA 1IUKA 2FFRA 1YZGA 2W4IA 3HJHA 2HNAA 4GX0A 1FF9A 1OGIA 2HADA 3BB4A 2PGOA 3ILSA 5F78A 4BKOA 4J3NA 4II7A 1V25A 5DI9A 3O8RA 2EL9A 5BW6B 1M0SA 3K0BA 5CMLA 2F3RA 2RGYA 1LBIA 1TM5E 2JGIA 3TIXB 3WGTA 3WRXC 4EIWA 4QXQA 4KE6A 1KZHA 3KR9A 1FVXA 3AFMA 5THXA 3EXHA 2QQGA 4LTMA 2QVZX 3VH2A 1DO2A 2EEZA 2JD1A 4XZ3A 3R7LA 3TSYA 1VRCA 2INGX 1KDPA 5CA1A 2NGRA 1A95A 2EKLA 3PPWA 1USIA 5DJ5A 4Z2YA 3B1VA 1QM5A 1U9CA 1MJHA 1IPHA 3QVWA 2C0PA 4KUGA 4CL0A 4RH1A 3F9CA 1H3NA 1HSZA 4I1SA 3K8OE 1P1JA 2NPIA 4P4SA 3IJPA 3O8OB 2ADMA 4LVOA 4RK0A 3V7FA 1OKKA 1S7GA 4C1NA 1DADA 4G41A 5L95A 1BFUA 1WY7A 2WTBA 2YZNA 2VUHB 3GJ5A 1I2CA 1L7VC 4J1SA 1EAYA 4U6SA 2GFHA 4HAWA 2XMRA 3KKKA 3A1FA 4CFYA 2BFAA 2QYTA 3ABSB 3FW1A 3GRPA 3LXXA 4IDPA 4F3NA 3V7YA 1LSSA 3EZ6A 1ECLA 4DJJA 2HHHB 1HFJA 3AR7A 1FTSA 1U3FA 2MU1A 2MINA 1AK9A 3LUHA 4FZRA 1IQUA 4PAMA 2PMDA 1FMTA 1GL6A 1XLTC 4G01B 3MWDA 4TWZA 4D02A 5LPNA 2RB4A 1R8JA 1H8ED 1YL7A 3ZBUA 1A72A 4LFCB 2BKLA 2CSUA 4LJSA 4U7HA 3VH3A 2VRNA 4F9EA 5IG2A 1EFLA 4JSTA 4N3NA 3FWNA 4MMXB 1E3MA 2G07A 1YQ9A 5LP6F 1PFWA 2AN5A 2XUFA 2BEVA 4KG7A 4BL5A 3DTVA 3BQNB 3DDSA 3BE4A 4I08A 4B6EA 1N57A 1LNZA 4E4YA 1NLYA 3TSZA 3U49A 1O6GA 1QPZA 2IF0A 3AUXA 3GJYA 5U1PA 4LF9B 1ZD3A 3TQCA 2WIGA 3B85A 1N34B 1F51E 1WL8A 1H0RA 1NBWB 2VDVE 2ZBUA 3FPBA 4MV3A 5DM4A 3UCXA 1Z4KA 3PK0A 1V8DA 1PEKE 2QTFA 1SXJA 3M5DA 4G23A 2EKZA 1DS6A 2JNWA 5TQ0B 1EFRD 1SZJG 2XWQA 3VSDA 1WUIS 3TM4A 5CIYA 2L2QA 2Y1XA 3U2QA 4WJZA 5AJXA 4EFKA 2CMFA 1O5IA 3Q12A 3MZ0A 4LE2A 2UU9B 1NXSA 3SC3A 2Q8QA 5NLLA 1RC0A 2HBZA 2G5TA 4DMFA 1HQDA 1YQUA 2WWTA 2XMZA 2GF0A 3OKPA 1C3VA 3HWWA 4WOBA 4FVTA 2O1WA 5D87A 3ZWYA 2RB5A 4ZN6A 4QYWA 3RRXA 1HDXA 3ES9A 5L3RA 3VDMA 2C84A 3G2IA 3E22B 3HBAA 1ZGBA 4BQSA 1AGYA 2WSBA 1SUDA 3A6HA 3FNFA 3KAQA 3H83A 2QSYA 2CHQA 3GT0A 4AJ1A 1EXVA 2HV9A 2ZIXB 4NYIQ 2PV0A 4DLRA 2WWXA 4E2WA 2QLTA 1XCOA 2X9QA 3IEMA 1VYUA 1GPWB 4BN5A 2RJNA 3F2VA 1F0KA 2Y68A 5L3ZA 4NZYA 5DLEA 4YUAA 3FTCA 3T7KA 1V8PA 3EVNA 4W1QA 5ERGB 4EHNA 3OM0A 4Q4HA 3KO8A 4UM9B 2AC4A 4V1CI 4Q3NA 5DHPA 5CLIA 1CUGA 2IYWA 1XRQA 3C6BA 5HIKA 2X3FA 5SZHB 1U9IC 4YONB 2DY0A 2V54A 3L05A 5TARA 3CX8A 3D81A 3BILA 3BRWA 5DBHX 4KIWA 4I9HA 4P5EA 3G2HA 5AKYA 4HX9A 3F6SA 5DDIP 1IBCA 1HFKA 3KEOA 1M2HA 3MMSA 4I2VA 1C9YA 3U31A 4JVNA 1AMUA 1YJ8A 2Q6OA 1DKUA 2RHBA 4ND5A 1GNLA 2DHQA 3NXKA 4FE3A 4J0DA 1AURA 4AN4A 4WTOA 3SG0A 2ZTSA 3KELA 4PRKA 3ZHRA 1IHOA 3MJSA 4EHDA 2YMPA 4Q4CA 1YKFA 2JJQA 4GOKA 4ZRDA 4G36A 3G0DA 5FI0B 1J5PA 4ARZA 3DMFA 4I9FA 5F4ZA 4XGIA 1GYQA 2ZUWA 4LMBA 4MMZB 1QCZA 3IBFA 4IUDS 5I9BA 3LLMA 2WF5A 2FUG1 3A4MA 3FCCA 2HQRA 3OAAA 4WBNF 4URFA 4E3WA 4UZFA 1CUXA 2WU8A 4L15A 1DDIA 4LI0A 4LJ9A 1ZQ1A 3OQIB 2EL7A 1JA0A 3DEJA 2DWCA 3U37A 2AOWA 4JVSB 3W6ZA 4AKTA 4EJSA 4Y0VA 3E3OA 3QQPA 3T94A 1PHPA 3FTQA 3RG8A 1ABEA 4ZI5A 3ELWA 3EPKA 1LC0A 5EJ8A 3NDJA 2DB3A 4FFBB 4UAUA 3V6MA 1JR3A 1PFKA 1TD9A 2FZEA 4MS3A 3B6IA 3H11A 3OE4A 3L4KA 2OBLA 1ZHHA 4YALA 1GZ5A 1OFIA 2PV7A 4AJNA 3OCJA 4DDHA 4OY3A 1C7FA 1ORHA 1U9ZA 2AC7A 3L6EA 5I6DA 2A84A 4IMRA 3IHLA 4RGBA 1DT5A 2BGKA 1ADGA 2OFPA 3CCFA 2J3DA 4QGSA 1SCIA 4RPKA 2AFHE 4UEOA 5KYWA 2HA0A 2QF7A 4AJEA 4EGFA 1ESNA 3RBZA 4EUKA 2QXYA 1WCXA 3OOYA 4EG5A 3ENNA 4LJ4A 4FFLA 2GXQA 13PKA 2I8CA 1NJ1A 3FNGA 4NWIA 4DSOA 2FFHA 1SULA 3QX9A 4PZPA 5JV5A 1NWHA 3MS7A 4PNZA 8ATCA 2FQ1A 2TMKA 2QDKA 1BN7A 3IMGA 3V9AA 3ZHCA 4BZZA 3COPA 1P2VA 4OU5A 1RM3A 1N25A 1ULBA 5CR9A 5IC4A 1DXQA 4DIFA 4L0DA 1JEYA 3C7KA 5F64A 1MB4A 1QPBA 3KZCA 4IDHA 4Y1RB 3LGSA 1MNQA 1WSAA 3BF7A 1XTIA 2DPLA 2QVLA 1QK3A 4PO9A 4D3SA 1BCSB 4ND6A 4BQIA 4S2UA 1E2QA 3L7BA 2JHFA 4P4UA 3M82A 1ZD1A 3GH1A 2JFNA 4LXGA 1ORDA 2JCSA 2ATVA 2ZR8A 4ZCPA 1Z15A 1PL6A 4JBGA 5BNTA 1I4TD 1IATA 1P18A 2F62A 3O92A 1T9KA 1SCKA 1NYQA 1P91A 2QTVB 4FE4A 4KTVE 1P5JA 5CDUA 1T6NA 5J4VA 3WAJA 4FZJA 1TT5B 3ANSA 5ADWA 4X90A 4CGZA 1KAQA 3H5NA 3BL8A 4AZ3A 3FVQA 1WMEA 4KDRA 2P6MA 2IEDA 4KVZA 5GP1A 1KH3A 4BJ3A 2HPHA 5GPBA 3RAGA 1G4HA 4N41A 1GAEO 2DC1A 4PONA 3HGMA 2J9GA 3QEAZ 2PZJA 5KYUA 3IQWA 1WE2A 3QW2A 4Y2UA 3SMVA 1N3IA 1OC4A 1GDHA 3PFKA 1YBFA 1GWNA 1JZQA 1T2NA 1BD3A 2AFIB 2I2XB 2DUUA 1EUCB 2D1RA 2OHHA 3H84A 1R0WA 2O2YA 2XMSA 1E8MA 2YS7A 3E05A 3EIQA 3I01M 4OXYA 3T3HA 4W5WA 1SHKA 3L0SA 4RKEA 1C7IA 5KCZA 3IT1A 4YV7A 2O2SA 5EIAA 4FNMA 1GTG1 2X13A 4WA7A 1Y89A 3JWEA 4UDNA 4WAUA 5AI4A 4URWR 4AJ2A 1H2YA 2KE5A 3H5IA 3DC7A 5DI3A 3M3PA 1DXHA 1FSZA 5CDGA 1EAMA 2WLTA 3J81k 3RU9A 1EX9A 1LRKA 4OKSA 1JHAA 2WYHA 1FMCA 3CNHA 4HNQA 3ZWBA 1KJQA 1NNSA 2GHRA 2X0RA 1U4SA 4JB8A 4CPDA 5K6AC 3KFVA 1ZM2A 1KAEA 1KO1A 3BAFA 3ELBA 4IXWA 1FJXA 2IL1A 2LXNA 3ESXA 3MN1A 4JLKA 4QDTA 5AJUA 2BD0A 2VXBA 4L4SA 4TMWA 5DK6A 4R2HA 1M2VA 3GZNA 5LLSA 1NW5A 3TL2A 2Z6QA 4AS2A 2YVQA 1NT2A 2CCJA 1EUCA 4US0R 4QVGA 4J0CA 1NW6A 2CXHA 4GYWA 1W88A 4MGZR 2O8CB 1Z29A 2K2QB 1BE6A 5AUPB 5DP2A 3NTLA 3Q7PA 1TQDA 3JQQA 3NWEA 1KFEB 2JI9A 1DQZA 5DXAA 3V8RA 1M2KA 2HA6A 3T5AA 3DLIA 1Y9EA 3DJYA 5CT6A 1EKXA 3KFXA