3ZFJA

N-terminal domain of pneumococcal phtd protein with bound zn(ii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights Into Histidine Triad Proteins: Solution Structure of a Streptococcus Pneumoniae Phtd Domain and Zinc Transfer to Adcaii.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Zinc-binding protein
molecule keywords PNEUMOCOCCAL HISTIDINE TRIAD PROTEIN D
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04270 Strep_his_triad Streptococcal histidine triad protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.680 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3zfjA00
3ZFJA 2CS7A
chains in the Genus database with same CATH superfamily
1G3SA 4L6V5 2KMTA 2QA4T 3M0RA 1HJDA 2DXCA 2DYBA 1UGQB 2EYZA 4C92G 1I07A 2FVUA 2EQUA 4Y92A 5KH6A 4C5EA 1AWXA 3DB4A 2X3WD 3CD6Q 3V7SA 2NUPB 2DPPB 4KBMB 2GTJA 1B3QA 1WZOA 2NUZA 1GBRA 4M7AF 2GF7A 1PWTA 4GLMA 1N27A 5GAN8 2LQKA 2DL8A 1JJ2S 4AFZC 1E6HA 1PHTA 2EAYA 2J6KA 3BY7A 2YLBA 3OYHA 4IUPA 2M16A 3ZEHA 3HP9A 4IUQA 4LN2A 1VA7A 1NG2A 2AKLA 1YITA 3FEOA 4C8QE 4EMKC 3CPWP 2RM4A 2A37A 1A0NB 1QKWA 1MMAA 4A53A 1U1SA 2YUPA 2BTTA 4QKUA 5GAN3 1TUGB 1W6XA 1B7TA 4OP0A 2ROTA 3GP8A 4M4ZA 1BI0A 3M55A 3MCAB 3C94A 5GANj 1VQ5Q 3V8KA 2DFUA 4KH0B 2RHZA 1MV3A 1WDXA 1N9RA 3CMEA 1OU9A 2DM1A 3M53A 2QGGA 3X25B 4XTYA 5L8RE 1D09B 2BE7D 1IB8A 2C06A 3UATA 3PNWC 3TSZA 3OA6A 3PFSA 2W10A 3H6ZA 2CS7A 1VQMT 4XTWA 1VQ5A 3CC4Q 1X6GA 1MNEA 2ED0A 3GBQA 1YCSB 3QJ6A 5GAN6 2QGFB 4KGZB 1KD1R 3N5BB 4JS4A 5DLQE 4JRKA 1G3YA 5C6SA 3CCRA 1K0XA 1J3TA 1W4SA 2LQ8A 2CP6A 2KNBB 3RR6A 5LJ5h 1SRLA 1Q81R 3BFMA 4J9CA 2GBQA 2L5QA 4BY6B 1BBZA 1YI2T 4J8OA 1YJNT 3CC2T 4Z88A 3LGFA 4ZGEB 3CMAT 2COYA 2JTEA 1VQKT 1BCOA 3WVEB 3SWNB 1VQ7Q 2V8IA 4Z02A 4E6RA 4RTUA 1Q81C 1K8AC 2C0OA 5HKCA 2QTVA 4A4HA 1TTHB 1UTIA 1UGSB 2NUTB 1SHGA 3P8HA 4FM4B 1FMVA 4KUIA 4D8DA 4HCZA 4M75D 3CCUT 4J9HA 2M9UA 1MMGA 2D0QB 2V26A 3TEEA 2QEXA 2NYSA 1RAIB 3LX7A 3CCLT 4M75F 5KYYB 1WQ7A 4EDUA 5LJ5f 4B9WA 3TCJA 2VV5A 4LUEA 5LJ3d 3A8LB 3HSBA 3L2WA 1N9SA 3RMSA 3IQLA 2JW4A 1K9MU 3NHNA 3T9NA 3JB9D 1K8AR 2DZ9A 4V2SA 4J7IA 4HKEA 2KAFA 4QVZA 5GAOq 4MZTA 4AT1B 3CCET 4EMKA 4BDZA 4M77B 1EIFA 2RA2A 3OSSC 2ECZA 3VUZA 1VQ4Q 4M75G 2O88A 5KE2A 1PM3A 2GCXA 2RK2A 1ZQ1A 4ELZC 5I22A 3G6ET 4M7DD 1U06A 1YWOA 1N6AA 3GNFB 2K3BA 5GAOr 4JZ4A 4M7DF 1NEGA 4IIMA 2DRKA 2RJCA 4ZTFA 4HT9A 4AG1C 3NTKA 3PGGA 3JCMV 3CC4A 2DTIA 1QWEA 3I5RA 4RTWA 2JT4A 2PTKA 3MP1A 4Z8AA 1V76A 1UG1A 1YFNA 3FC3A 2LNVA 2VKNA 3CMEQ 3QG1A 5DLOA 1PKSA 3A8HB 2RNAA 1R0BG 2LJ0A 1JXMA 2OTJT 5AT1B 1LPLA 1AWJA 4EIKA 1K73C 1X2QA 1UGVA 2V8JA 5LJ5j 1KQSP 1M3CA 2RJDA 1YITQ 1M90C 5FU6C 2P0KA 2VUBA 2EQKA 5HK3A 3M5AA 1BU1A 1K9MC 2A0FB 2E10A 2L3QA 4PK4A 1PD0A 4EPCA 2CH4A 5CIUA 5HY6A 1IREB 4VUBA 4C5HA 3LH5A 5AYFA 2CGHA 3CXCS 2AZVA 2DTOA 1AEYA 3G1JA 1M9SA 4C8QF 1ZUKA 3VS5A 4ELYC 3V8JA 3A1PA 4C0DB 3OSVA 1NZ9A 4RTXA 1WXTA 1VQOQ 2YRCA 3EFOA 3I55Q 2DIGA 3JCMg 5D6YA 3JCMf 2BZ8A 2E6NA 3DKMA 2FO0A 1YP5A 2COZA 4CC2A 2OTLT 2C0IA 2EGEA 3VUBA 1QLYA 3QSUA 1ZX6A 2HCKA 2KT1A 2FZCB 1Y07A 1BIBA 4AFSC 3VYHB 3M0TA 2EQMA 1YJWQ 3VS0A 3VV0A 2JJ9A 2E12A 3V7CA 5IHKA 5GMKm 1UECA 4BE2A 5A0DA 1QVFS 2RHYA 1VQPA 5GMKj 5FWCA 2XG8D 2AIRB 1H3HA 3E9GA 1ACMB 2PQWA 2BUDA 4NL3A 4F04B 3NMZC 2QQAA 3LGLA 3A98A 5CKFA 1JBMA 2CSIA 1Q86U 8ATCB 3G4ST 2K2MA 2ZGWA 3SEMA 3HTRA 3M58A 2KYMA 4C0GA 2JOYA 4X34A 5LJ3h 2E65A 4A4FA 4M78G 4MMKA 5KYNA 1H641 4XAXB 1N8RU 2J7IA 2CUBA 4R55A 2CUDA 1M27C 2MCNA 3QO3A 5GAMf 1CKBA 3MEUA 2A08A 2BZXA 4JJDA 1I1JA 1NM7A 2R5AA 1W1FA 3O5ZA 4F14A 2YUQA 3PMTA 4ANJA 1QCFA 1B07A 3MEAA 4IUTA 1KHIA 4N0AA 1I81A 3M4YA 4F7UF 5D6XA 1M1KC 2K5LA 2LQWA 4Y28E 1Q82U 3L42A 1XTDA 3PTAA 2CDTA 1VQ8Q 3FDRA 4J9EA 3ASKA 3JSCA 2KY9A 5HCKA 1G3TA 1NYGA 4QQ6A 1LOJA 1M8MA 2KGTA 1X27A 5LJ5d 1IRXA 1QVGS 3PIPA 4YTLA 1QQJA 3HRTA 2LX9A 1KQSA 1VQ8A 2P0PA 3CCVT 4BDYA 2JMCA 2ZCFB 3M0PA 1OQKA 3JB9G 1FMWA 4OF1A 3GLXA 1JQQA 3RKXA 2NUTA 4RTTA 1Q81U 3E9FA 2IPOB 3F70A 4IURA 4CI0C 1N8RC 1Q86R 1KD1U 1JRIA 1UJYA 4J9GA 4M75A 1GCQA 1O9SA 3VYGA 4E47A 4C0FA 4RG2A 2E4HA 1M5Q1 4M7DE 1WHJA 4LDUA 1VQNT 1TUDA 1ZA2B 2VYTA 4HVVA 3CC7A 2DYIA 3VRZA 4O5VA 4WF2A 4QQDA 4C8QC 5CQYA 1OPKA 3OW2A 2RO0A 1QVFA 1AZGB 4M75E 1VQ9A 3JCMP 4PKCC 2VGNA 3CCMT 2PVDB 4BE0A 2LCCA 3OW2S 1QW1A 1YJ9T 2QI2A 2Y4XA 2LQNA 4JLIA 2NUPA 3CC7Q 1VQMQ 6AT1B 1GL5A 3CCST 1IO6A 5D6WA 4KH1B 5GANg 2GFAA 1ZBJA 1SG5A 1RLPC 1V29B 3BW1A 2F2XA 2RHIA 1XJWB 4M7DA 5D7UA 2ZPBB 1VUBA 3LH0A 3FIFA 1M2OA 3UDCA 2DILA 3CCJA 3I56T 2DNUA 3NTHA 1WYXA 2RI5A 2B8AA 2P4TA 1WJSA 3PIOA 3LWHA 2RN8A 1TH7A 1D0XA 2RQVA 5FWBA 5IT9E 1PSEA 5KYUA 2VASA 2DL5A 2LP5A 2QYZA 2ENMA 1SPKA 1OX8A 1VYUA 2DO3A 4D8KA 3EG0A 2JN0A 2QASA 2O9SA 1WIEA 1PCXA 1YJNA 1BKBA 2E70A 4XTUA 1I5LA 4BI3A 2DVEA 2K79A 2MYSA 5GAOp 1YHQA 1PD1A 4M7DG 2CREA 3RKYA 3OYFA 1U8RA 4A63B 1TS9A 3TSWA 4E7SA 4OMLA 1NPPA 2LZ6B 3JCMQ 1LVKA 2IVWA 4OGCA 3R6OA 3QWYA 1MNDA 3A8GB 3THKA 5EC7A 5KYUB 5A2QE 4PJOB 3SHWA 3CCEQ 4PJOG 4XTVA 4DA4A 1ABQA 2E41A 2Y4YA 1K0SA 1NYFA 2QQRA 2CT4A 2DEQA 3EGXB 4ESRA 2EYWA 2JM8A 3EFSA 4OMOA 3OYEA 1GFDA 1V1CA 2V1QA 4C8QG 2FRYA 5GANd 1GCQC 1NEBA 2OAUA 2JTFA 2XIDA 3WVDB 2HDAA 1PRLC 1K73R 5J3BA 1UGRB 3BDUA 1T3LA 3DB3A 3URGA 1IHWA 1VQPQ 2YDLA 2RJEA 2P84A 2EFIA 2EIFA 1VOMA 2JS2A 5GMKe 2YRVA 1RAGB 2FPDA 3ZBDA 3PT9A 3TQ7P 4LDXA 2ABLA 4C5IA 4JJNK 1WHHA 2F5KA 5CAIA 4EMKB 3MEWA 5GMKh 1UUEA 4JDSA 4BI8B 1QVPA 4LDYA 4PJLA 1Z9ZA 2WSCE 4XK8E 1YJWA 1JJ2P 3I55A 1PNJA 1NPRA 2L3SA 1GCPA 2OX7A 3E1SA 1GXIE 1WA7A 4XU0A 2XDBA 1RAAB 2WSFE 2QEXQ 4PFPA 4JJCA 2RQTA 2SEMA 2J6OA 4N4IA 3A8OB 4LE9A 2DXBA 4F7UE 3NGPA 3QXEB 4DBRA 4Q5WA 4M7AD 3CXCA 1VQOA 2X3XD 2P4RA 3HRSA 1YIJQ 5IH2A 1QCOA 4M78B 5LJ5e 2EPDA 2DK3A 5KYWB 4OMQA 4QW2A 1MMDA 4XTZA 1HXDA 1KQ1A 3JB9H 1ZHIA 4KGXB 1MHNA 4PJOE 2R57A 3PVLA 5FU7C 2MI6A 3I55T 1M1FA 1M1KU 4LNPA 4C0ZA 2QDYB 1VQ7A 4J9FA 3MP8A 2CSQA 3MPUB 2DEUA 4J9IA 1MMNA 1Q82C 2J06A 1IGQA 1RAFB 1TSFA 4MZPA 3VS6A 1W2BS 2YLCA 2CZ1B 1JEGA 3M9QA 4AFUC 2JM9A 4FYWB 5EG2A 3S6WA 5DY9A 4C92A 2A7YA 2EQJA 4RTYA 1JXOA 2MMPA 1Q7YU 3UF4A 1OI1A 1AWOA 2RHUA 3CCQT 2CZ7B 3CCEA 4NL2A 4M77D 3PVQA 4C92D 2XU8A 5FLXE 1AHJB 2DXTA 2MOXA 2QAZA 1ZSZC 2EJGA 2RMOA 3VS1A 3H0IA 4C92F 2LNHB 2XMFA 1X69A 1S1NA 2KVQG 4WTOB 4DBHA 1WFWA 2F5TX 1YIJA 5IHNA 1WPYA 1H3ZA 4M78E 4F16A 1EX4A 2DL3A 2J6FA 4B6MA 3OQ5A 5CKEA 5CKBA 1YI2Q 1FX7A 1O75A 1YJNQ 1WHLA 4XU3A 2ROLA 4ZTJA 2K57A 1BIAA 4N4HA 4KUDK 3EHQA 2AKKA 2D8JA 1Q86C 4P5NA 1B34A 4KT0E 5M9OA 3CMAA 1RADB 1BYMA 2ED1A 1X01A 3CCUQ 3JCMX 3QHSA 1GRIA 2R5MA 3CCLQ 4M77E 3J81E 2XDDA 3ER0A 1G2BA 2E3IA 1KIKA 3JB9F 4RCBA 1PC0A 3FB9A 1EZZB 5FW9A 4FYYB 4II1A 1UHFA 2VVKA 3ME9A 2LRQA 1CSKA 4OMMA 1C6VX 1D1CA 1YNZA 2EKOA 4XU2A 1QP3A 3MEVA 4L5GA 1OPLA 3AT1B 2SRCA 2LJ1A 1FMKA 1VQ4T 1X43A 5FROA 4M78C 2E5QA 4OB1B 3SWNA 1KSWA 2O31A 2LT1A 3INZA 2KI7A 2YT6A 5J26A 1VYVA 3LW5E 4PJMA 3CCQA 3RESA 2HL3A 2LTOA 4F7UB 2ZAEA 1X75C 2FPFA 1WX6A 4IUUA 2M1HA 2ZZDA 2NWMA 2QK0A 2FZKB 4ZGDB 3M56A 4DOWA 2QTXA 3CC7T 2R58A 3A8MB 2AZSA 2CH4W 2DF6A 2E6ZA 1R8OB 5LL6S 4GY5A 1K1ZA 3CXCP 2MIOA 5KYXB 1U5SA 2KYBA 1Y71A 5CR2A 3OS1A 2GFUA 2OTJQ 1M2VA 4M75B 2K2VA 4F7UG 2DL4A 1AT1B 1M3AA 1YHQQ 1SHFA 4HXJA 2KK4A 4BUGA 1M1GA 4PLIA 1Z9QA 1X2KA 3OB9A 3G71T 1JJ2A 1AD5A 2H3EB 4FL6A 3OMCA 4OMNA 4ORZA 4HA8A 1WHGA 4DBQA 3ULRB 4FU6A 4C92B 2FL7A 1AWWA 3I56A 3CCJT 2GTOA 4RKUE 4OVAA 4FSXA 2L8DA 1H92A 1OV3A 3Q1JA 3V8LA 4M75C 3H8ZA 3P8DA 2M02A 1RUWA 1TOVA 5LJ5g 5KE3A 3CPWA 4X1VA 5CVIA 1BB9A 1RI0A 4MZMA 1CKAA 2OTLQ 3BE3A 2DKGA 1BI3A 1JU5C 4CC7A 2CP7A 4R56A 2HBPA 3S3MA 3KFVA 3VJPA 3E2UA 4OGEA 4M7AB 2HBWA 1OEBA 1PKTA 4JRQA 3I35A 2FZGB 1JO8A 2BIVA 3EHRA 1VQ6Q 3M59A 4RCCA 3JCMc 3RNJA 1TUCA 3MHXA 3I9QA 3KBGA 4O6JA 2KRMA 4J6WA 5I11A 3CCRT 3OYKA 3OYMA 1VQ9Q 4PNOA 1T0JA 2AT1B 5CK9A 1C0MA 3OBYA 1SEMA 4BY6C 4HVUA 2LJ3A 1IGUA 5LJ3g 2LDMA 1OX9A 3JCMJ 1M90R 4PL6A 2JNGA 4J9DA 2O4XA 1FYNA 3G4SQ 2K5IA 1NJIR 3FRNA 4AG2C 4J5YA 4M7AA 3D7SB 2EW3A 5CKHA 3L1AA 3MJXA 4JLGA 2CP0A 2KEAA 2X4XA 3VRYA 1OULA 2FRWA 5IXBA 3M57A 5LJ3e 2E64A 4A4GA 1T3SA 2RQUA 1QMCA 5I2MA 3X24B 5C0MA 2M0OA 3UWNA 3JB9I 4M77G 3RDVA 4QQGA 3SWNC 1D0ZA 4LDVA 3OMGA 5GAOm 2AK5A 3OYDA 1NBEB 4JUVA 3O8VA 4A4EA 4X9DA 5GAOl 1QCNA 2OTLA 3EH1A 4Y91A 1NJIU 3G71A 2YXYA 1EFNA 1UB4A 3UA6A 2MPXC 1Q7YR 1UGPB 2DBMA 1NLPC 1BK2A 2EQIA 2M0YA 1VQLA 4TVRA 2DL7A 3ZL7C 3OY9A 1DJ7B 3X20B 3JB9J 3QKJA 1M1KR 2XK0A 1KQSS 1ABOA 2QG9B 5GJWB 3RIRA 3M0UA 2LCLA 4PJOF 3V7RA 3CQTA 1LNXA 1YIJT 2HNIA 2XICA 5L23A 4E7JA 2DMOA 1ZBXA 2COWA 4DBFA 2JUFA 5GMKi 4PJOD 3M4GA 3GIBA 2A36A 2RHXA 1Y96A 2LX7A 4RMOA 3HHTB 2BKDN 4DEXA 1G3WA 1ZSZB 4FT4A 3KXTA 3QZ9B 2KXDA 4ZN1A 5GAMj 1P92A 2F2VA 4ZNXA 3UA7A 1WLPB 1WGSA 2RD1A 4PJOC 1WNLA 2ZPHB 2EYYA 1WQWA 1C1AA 1XNIA 2O2OA 3S3OA 1VQNQ 2RQWA 4PFOA 1ZUYA 3MKDA 1Y57A 1G5VA 2CP2A 3EGDA 4N4GA 4D6WA 2DA9A 1WJQA 2EKHA 2X51A 3S3NA 3OYYA 3RERA 2HEQA 1X6OA 2KSSA 4JRIA 5KYWA 4J83A 2MAMA 5GAN7 2WACA 3CCQQ 1Q82R 4XQ3A 1T0HA 5GANe 1K9MR 3EGXA 2KR3A 1YJ9Q 1VQ6A 4K11A 3TVTA 2KQWA 5LJ3j 2HMAA 4HCCA 2A28A 1D1AA 2FEIA 3CCSQ 5GJVB 1PRMC 1XQHA 2DJQA 3C0CA 2X4WA 3TREA 2FB7A 1S72Q 4LDWA 5A0GA 2BZYA 1BCMA 2V8KA 2AHJB 4FYXB 3CMAQ 2HKNA 4FIBA 1UDLA 5FU6B 4M78D 1VQKQ 1UEBA 2RF0A 2EYXA 1RAHB 2G3RA 2XKOC 4N0AC 2YUNA 4M78F 5ECAA 4HVWA 4OMFB 1E6GA 1E7OA 2RB6A 1M3BA 3NTIA 2CP3A 3C12A 3VS2A 3CCVA 4J9BA 2IG0A 2DTHA 3CEYA 3DLMA 1W70A 2KRNA 4FCYA 1N8RR 2B86A 5IN1A 3CCLA 1K73U 3VS4A 2GQVA 1YCYA 3EG2A 1QP2A 2ESWA 4BD3A 3J7AF 1Q95G 2K4YA 1OU8A 1VQLT 3QDFA 4WCIA 4MMLA 1KFZA 4RTZA 2YHTA 3UPUA 2XI9A 1HYOA 2XD0A 2DVJA 4J6XA 5GAOn 1D3BB 3CC2A 1YJ9A 3C4SA 3JRZA 4IUVA 3JCMd 3OYIA 3X26B 4E2FB 2KDSA 3EH2A 2DETA 4AMCA 3L2VA 4Z89A 1JB0E 1N5ZA 3OYNA 5GAMe 1OOTA 2H8HA 3G6EQ 1K4US 1M8VA 1SRMA 4M77C 1I0CA 2JVVA 2XHCA 2K9GA 2M51A 4OB3B 1KC8C 5IAYA 3QWXX 2X4YA 2D0NA 1UJ0A 2DIQA 2QQBA 5LJ3f 4E7ZA 3OYJA 1SSFA 2MWOA 4HCBA 2RK1A 2X4JA 2P0QA 2O01E 3QPHA 4M7AG 3GOXA 1QVFP 2DZCA 2L3PA 4J7FA 2EGCA 1XOVA 4JZ3A 2HZYA 4MDXA 5KCHA 1VQ4A 1TXQA 4BACA 3CMET 2KBTA 2CP5A 3SDZA 5FRMA 2PVGB 4RG8A 1VQPT 2YSQA 2F1LA 4NS5A 1WHKA 4QVCA 1PG5B 2OAWA 2ATCB 4OB0B 2O4XB 1MUZA 4MDWA 3OS0A 1RABB 4LD9K 2JZ2A 2RJFA 4LUDA 4C5GA 1K9AA 3GPLA 2EJ9A 4KULA 3OBWA 2QA4Q 5IHIA 2F2WA 3JCMh 4PJJA 4DQ2A 1ARKA 4FW1A 3META 4NOYA 3UT1A 2QQSA 3JCMW 1VYTA 1KC8U 2EJFA 4E7KA 1KHCA 2WSEE 2X35A 4CC4B 3MP6A 3G71Q 3CD6T 2IIMA 1VQKA 3RKWA 7AT1B 4CC3A 4CRIA 2EBPA 3MO8A 4HT8A 4DOVA 1M30A 1VQOT 4GBQA 4FYVB 1ZUUA 2Z0WA 3JAME 2FG0A 1HSQA 4ZN3A 4JS5A 4C8QD 2GNCA 3CCJQ 1YBYA 5CCAA 2HQEA 2PUOB 3VS7A 2HQXA 2L3RA 2QA4A 4ZGJB 2HD0A 2XDPA 1Y7XA 3QUIA 1HD3A 2CZ6B 3QDRB 2GQIA 1BI2A 1YJWT 3EG1A 4J6YA 4E7HA 2NLUA 3M0QA 2ZPGB 1R77A 3CBOA 2D6FA 1VQ5T 4XTXA 1VQMA 2JS0A 2LVMA 1KK7A 2A3LA 2E1HA 5A0LA 1IZ6A 3OYBA 2K3XA 3QJYA 1D1BA 3OW2P 1FWZA 3CPWS 2DE0X 4L59A 5KCOA 3L2RA 1OZ3A 2EGAA 4B9XA 3RBBB 2RQRA 2VB6A 3CC4T 4M7DC 2V1RA 3CCRQ 3WXMB 4FW2A 2PNIA 2HAXA 4LD6A 4M77F 1VQ9T 1QVGA 2MK5A 5GANf 2DAQA 2D1XA 2RH2A 3OYGA 1IHVA 1I4K1 1Q7YC 3CBPA 4C0DC 3G6EA 3M54A 4JRPA 3OYCA 4DEYA 2JTMA 1VQNA 3A5ZB 1F1BB 4M77A 3H9NA 3CC2Q 5GAMg 4QT7A 1Y0MA 3HKSA 5FU7B 1VQ7T 1NLOC 3GNGA 4AFQC 4EMGA 1ZSGA 3NPFA 2BE9B 1AOJA 2PUKB 1NE8A 1I8FA 2HSEB 5CQXA 3OYAA 2YWWA 3LYIA 1UE9A 2VXEA 3ZFJA 4A4KA 1TU0B 5HK0A 3E19A 2LCSA 3QYGB 2DJZA 3CCVQ 2DERA 2RI3A 2L2PA 3CD6A 3REAB 1H8KA 1AZEA 3VU3C 1QKXA 1GFCA 1RACB 4R0KA 3RMQA 5GAN2 3R6NA 3L2QA 3LLRA 1VIEA 4M7DB 4A54A 5GAN5 2PU9B 2KRSA 3CBMA 2E5KA 1KG1A 2F69A 3HFNA 1LJOA 1SF9A 1RL2A 1S72A 3SB2A 3EG9A 2LT4A 2L0AA 2MF2A 3QZ5B 1IXDA 2CT3A 3H0HA 1VIFA 4KGVB 1WI7A 1M4ZA 2VXFA 4GLKA 2Y90A 2QXFA 5GMKl 3TU4K 1NJIC 1WHMA 1GBQA 1OYXA 5I2SA 2KT8A 3CPFA 1D3BA 5IXFA 3J80E 4E7IA 3CCSA 3CCMQ 4RTVA 4PJNA 3EAEA 2D8HA 2DXUA 1HK9A 4HCKA 4IKFA 3I5SA 2G6FX 3EG3A 2QQ9A 3PMIA 1ZA1B 4X9CA 1KJWA 2PVOB 1BI1A 2YRDA 3EGUA 5KYYA 1PSFA 2HL5C 2VGMA 3EFOB 3QIIA 4RUGA 2RI2A 4KRTA 2HQHA 2RPNA 9ATCB 1TG0A 3HPWA 4C8QB 1SSHA 4BB7A 1QVGP 3I56Q 4EMHA 5GAMd 2CYZB 1X6BA 2K3YA 4ME7A 1S72T 2VWFA 1Y96B 2PZ1A 5FRNA 3BDLA 4LXCA 1YITT 2EVRA 2KE9A 1G83A 2K5FA 3CCUA 3P8BB 1RLQC 2X9HA 1ZSZA 1WXUA 2OJ2A 4PJOA 1MGQA 1G8XA 3DLLA 4M7AC 4QVDA 1YHQT 2W0ZA 4JJBA 3L2UA 4FSSA 2I0NA 2DX1A 3HFOA 5CO7A 3OYLA 2L89A 4C8QA 2ZPFB 1M90U 2LMJA 1LCKA 2KROA 5GAMh 1YI2A 2ZPIB 2CZ0B 3U23A 3G7ZA 4JPBW 2C0TA 2FPEA 1KC8R 1OZ2A 2OTJA 3NFCA 2MWPA 3FJPA 1VQLQ 5GANh 4C92E 4PFZA 1W2BP 2EWNA 3EGDB 4F17A 3AHUA 1UFFA 3L2ZA 2CKKA 5KYXA 8AT1B 2FYKA 1FXXA 1WXBA 2JXBA 4C92C 3OS2A 1W2BA 3HRUA 4M7AE 1RI9A 5GAN4 1U1TA 3H0FA 2DLPA 2I2LA 1U3OA 1SKUB 3RUXA 3LWIA 1QWFA 1MV0B 2EYQA 2J05A 1KQ2A 2O9VA 2K6DA 1VQ6T 2VC8A 3SD4A 1UHCA 1ZLMA 2JMAA 3REBB 4ATOA 3EFRA 2HSPA 3CCMA 1M2VB 3FLGA 4XU1A 3HL8A 3JCMb 4OB2B 3VKIA 3H41A 2DD5A 2K7AA 2QDLA 3VS3A 3JCMe 2HKQB 3G4SA 2KXCA 2ZPEB 3M0SA 4UC4A 2GGRA 4PLLA 3JV3A 1YN8A 1K8AU 4M78A 3PE0A 4BE1A 4FT2A 4IIOA 2E3HA 1D0YA 5DM7R 2YUOA 2DRMA 1AVZC 3KUFA 1TWBA 1I5OB 4BI4A 1R0CB 3QBYA 2DD4A 2DBKA 3SFMA 4E7LA 4F7UA 1KD1C 2OI3A 1VQ8T 3FJ5A 5I21A 1B34B 1YWPA 2D9TA 3EG9B 3X28B 2LC4A 3C95A 4OMPA 3QYHB 5J39A 5CKDA 1RAEB 1K76A 2H3JA 3GF5A 3OS5A 2FHDA 2QEXT 1WJRA
chains in the Genus database with same CATH topology
1G3SA 3CMET 4L6V5 1VQ4T 1Q81U 2KMTA 5FROA 4M78C 2QA4T 3SDZA 2E5QA 5FRMA 3E9FA 4OB1B 2PVGB 4RG8A 3SWNA 1VQPT 2LT1A 2DXCA 3F70A 1UGQB 3INZA 4IURA 4NS5A 4QVCA 4CI0C 5J26A 4C92G 2FVUA 3LW5E 1N8RC 2EQUA 1KD1U 5KH6A 4OB0B 4C5EA 2O4XB 4MDWA 3OS0A 1JRIA 3CCQA 3RESA 4M75A 3DB4A 3V7SA 2DPPB 4KBMB 1O9SA 2JZ2A 2LTOA 2RJFA 4F7UB 4LD9K 3VYGA 4C5GA 1X75C 4E47A 3GPLA 4C0FA 2EJ9A 4RG2A 4KULA 4M7AF 2GF7A 3OBWA 1M5Q1 4M7DE 1N27A 3JCMh 5GAN8 4DQ2A 2LQKA 4LDUA 1JJ2S 4IUUA 1VQNT 3META 2M1HA 2EAYA 2ZZDA 2VYTA 2QQSA 4NOYA 3BY7A 2YLBA 3UT1A 3OYHA 2EJFA 4E7KA 3JCMW 4IUPA 1KC8U 1KHCA 2WSEE 3CC7A 4ZGDB 3M56A 4DOWA 2M16A 2QTXA 2X35A 3ZEHA 1YJ9T 2R58A 3A8MB 3CC7T 3HP9A 4O5VA 4WF2A 4QQDA 2E6ZA 1R8OB 3MP6A 4IUQA 5LL6S 4C8QC 5CQYA 3OW2A 2RO0A 4GY5A 3CD6T 1QVFA 1VQKA 3RKWA 3FEOA 4C8QE 1YITA 4EMKC 2RM4A 4M75E 1Y71A 1VQ9A 5CR2A 3JCMP 3OS1A 4CRIA 4A53A 1U1SA 3MO8A 4HT8A 4DOVA 2GFUA 4PKCC 1VQOT 2VGNA 5GAN3 3CCMT 2PVDB 4BE0A 2LCCA 3JAME 3OW2S 1QW1A 4M75B 2K2VA 4OP0A 4F7UG 1BI0A 4C8QD 2QI2A 2Y4XA 4ZN3A 3M55A 4JLIA 4JS5A 3MCAB 3C94A 5GANj 3V8KA 1YBYA 5CCAA 2KK4A 2HQEA 2PUOB 1M1GA 2RHZA 4PLIA 4BUGA 3CCST 2HQXA 1N9RA 2L3RA 5D6WA 2QA4A 3OB9A 5GANg 4ZGJB 3G71T 2GFAA 3CMEA 1JJ2A 2HD0A 3M53A 2XDPA 3X25B 4XTYA 1Y7XA 4FL6A 5L8RE 3OMCA 3QUIA 1V29B 3BW1A 4HA8A 2CZ6B 3QDRB 2RHIA 2C06A 4M7DA 1BI2A 3PNWC 2ZPBB 4J6YA 3OA6A 4E7HA 1YJWT 2NLUA 4FU6A 2ZPGB 3PFSA 4C92B 1VUBA 3LH0A 3FIFA 3UDCA 3H6ZA 3CBOA 2CS7A 2FL7A 2D6FA 3I56A 1VQMT 1VQ5T 3CCJT 4XTXA 4RKUE 3CCJA 4OVAA 4XTWA 3I56T 4FSXA 1VQMA 1VQ5A 2L8DA 3NTHA 2RI5A 2B8AA 2LVMA 2P4TA 1WJSA 2A3LA 3PIOA 2E1HA 3QJ6A 1IZ6A 5A0LA 3LWHA 5GAN6 3OYBA 3Q1JA 3V8LA 4M75C 3N5BB 2K3XA 3H8ZA 4JS4A 1TH7A 3P8DA 3QJYA 1G3YA 4JRKA 5DLQE 5C6SA 3CCRA 1PSEA 5IT9E 1FWZA 3CPWS 5LJ5g 1W4SA 4L59A 2LQ8A 5KE3A 1BYMA 3CPWA 5CVIA 5KCOA 5LJ5h 3L2RA 3BFMA 1OZ3A 1RI0A 4B9XA 4MZMA 2L5QA 3CC4T 4M7DC 2DKGA 2DO3A 1BI3A 3WXMB 4BY6B 3S3MA 4R56A 2HBPA 2HAXA 2JN0A 4LD6A 4M77F 1VQ9T 1YI2T 1QVGA 4J8OA 1YJNT 3VJPA 1YJNA 4OGEA 4M7AB 3CC2T 1BKBA 2E70A 3LGFA 4ZGEB 5GANf 2DAQA 4XTUA 2RH2A 4JRQA 1I5LA 3CMAT 4BI3A 2DVEA 1VQKT 5GAOp 2BIVA 3WVEB 3M59A 3OYGA 1YHQA 4RCCA 3SWNB 3JCMc 2V8IA 4Z02A 3MHXA 1I4K1 1Q81C 1Q7YC 3CBPA 4M7DG 3KBGA 1K8AC 4O6JA 5HKCA 4C0DC 3G6EA 3M54A 4A4HA 3RKYA 4JRPA 3OYCA 3OYFA 4J6WA 1U8RA 2JTMA 1UGSB 1VQNA 3CCRT 3A5ZB 3OYKA 3OYMA 3P8HA 4PNOA 4FM4B 4KUIA 5CK9A 4HCZA 4M75D 3CCUT 2M9UA 3OBYA 4M77A 2D0QB 3TEEA 1NPPA 4BY6C 2QEXA 5GAMg 3LX7A 5LJ3g 2LDMA 3JCMQ 3CCLT 2IVWA 3HKSA 3JCMJ 5FU7B 4OGCA 4PL6A 2JNGA 4M75F 1VQ7T 2O4XA 3GNGA 3R6OA 2K5IA 1WQ7A 3A8GB 4EDUA 5LJ5f 5A2QE 4PJOB 4B9WA 4EMGA 3FRNA 4J5YA 4M7AA 3TCJA 5CKHA 2VV5A 2PUKB 1NE8A 4PJOG 1I8FA 4XTVA 5CQXA 4DA4A 3L1AA 4JLGA 5LJ3d 2E41A 2Y4YA 3A8LB 3LYIA 3OYAA 3HSBA 2QQRA 2X4XA 3L2WA 1N9SA 3RMSA 2DEQA 3M57A 5LJ3e 2E64A 1K9MU 3EFSA 2VXEA 4A4GA 3OYEA 3T9NA 3ZFJA 4A4KA 5HK0A 3JB9D 5I2MA 3X24B 3E19A 2DZ9A 4C8QG 5C0MA 4J7IA 4V2SA 4HKEA 2KAFA 4QVZA 2M0OA 5GANd 5GAOq 3UWNA 3QYGB 3JB9I 4M77G 2DJZA 2OAUA 2JTFA 4QQGA 2XIDA 3SWNC 4MZTA 3GP8A 3CCET 3WVDB 4LDVA 4EMKA 4BDZA 3OMGA 4M77B 2RI3A 5GAOm 1EIFA 5J3BA 2RA2A 3OSSC 3OYDA 1UGRB 3VUZA 3CD6A 3BDUA 3DB3A 3URGA 4JUVA 4M75G 3VU3C 3O8VA 4A4EA 2GCXA 2RK2A 4X9DA 5KE2A 5GAOl 2OTLA 5GAN2 1ZQ1A 2RJEA 3RMQA 4ELZC 3L2QA 2EFIA 4Y91A 2EIFA 1NJIU 3G6ET 5GMKe 2YRVA 3LLRA 1VIEA 3G71A 4M7DB 4M7DD 3ZBDA 3PT9A 1UB4A 4A54A 4LDXA 5GAN5 2PU9B 1UGPB 4C5IA 1N6AA 4JJNK 3CBMA 3GNFB 1KG1A 2F69A 5GAOr 3HFNA 2F5KA 1VQLA 1LJOA 4TVRA 5CAIA 4M7DF 3OY9A 4EMKB 1RL2A 1DJ7B 3MEWA 3X20B 3JB9J 3QKJA 5GMKh 2XK0A 1S72A 3SB2A 2RJCA 4ZTFA 4JDSA 4HT9A 1KQSS 2LT4A 4BI8B 1QVPA 3NTKA 3PGGA 4LDYA 3JCMV 3CC4A 3OYIA 2DTIA 2MF2A 3QZ5B 2WSCE 3RIRA 1VIFA 4XK8E 1YJWA 1M4ZA 2LCLA 2VXFA 4GLKA 2Y90A 3MP1A 4PJOF 3V7RA 3I55A 2QXFA 5GMKl 1NPRA 3TU4K 1LNXA 1NJIC 1YIJT 1OYXA 2HNIA 3E1SA 3FC3A 2XICA 5I2SA 4E7JA 2LNVA 1GXIE 4XU0A 1ZBXA 3CPFA 2XDBA 2JUFA 1D3BA 2WSFE 5GMKi 3J80E 4E7IA 3CCSA 4PJOD 3M4GA 3QG1A 3GIBA 4N4IA 5DLOA 3A8OB 3A8HB 2RHXA 2DXBA 2OTJT 4F7UE 1Y96A 3EAEA 4RMOA 3HHTB 3QXEB 2BKDN 4M7AD 4Q5WA 1G3WA 3CXCA 1VQOA 4FT4A 3KXTA 1K73C 3QZ9B 4ZN1A 2DXUA 1HK9A 3HRSA 5GAMj 4M78B 4IKFA 1P92A 5LJ5e 2DK3A 2QQ9A 1WGSA 2V8JA 2RD1A 2PVOB 3PMIA 4QW2A 4X9CA 1BI1A 5LJ5j 2RJDA 3CMAA 4PJOC 1WNLA 2ZPHB 4XTZA 1HXDA 1KQ1A 1PSFA 1ZHIA 1WQWA 2VGMA 5FU6C 1M90C 3JB9H 1MHNA 2P0KA 2VUBA 1XNIA 2EQKA 5HK3A 3QIIA 3M5AA 3S3OA 2RI2A 2R57A 4PJOE 1K9MC 5FU7C 2MI6A 2E10A 3I55T 1M1FA 4C8QB 3HPWA 4EPCA 1M1KU 5CIUA 5HY6A 4BB7A 1IREB 4VUBA 4C0ZA 2QDYB 4C5HA 5AYFA 1VQ7A 2CGHA 3CXCS 1G5VA 4N4GA 4D6WA 2DTOA 1WJQA 4EMHA 5GAMd 2CYZB 3MP8A 3S3NA 3OYYA 1M9SA 2K3YA 4ME7A 3RERA 1S72T 4C8QF 1Y96B 2KSSA 1X6OA 4JRIA 4ELYC 3BDLA 1Q82C 5FRNA 1YITT 3V8JA 4C0DB 3OSVA 1NZ9A 4J83A 2MAMA 5GAN7 4MZPA 2WACA 2K5FA 4XQ3A 3CCUA 1W2BS 5GANe 3P8BB 2YLCA 2CZ1B 2DIGA 3M9QA 3JCMg 5D6YA 4PJOA 1MGQA 5EG2A 3JCMf 2E6NA 3S6WA 3DLLA 1VQ6A 3DKMA 4M7AC 4QVDA 1YHQT 2KQWA 2OTLT 5LJ3j 4HCCA 3VUBA 5DY9A 4C92A 3L2UA 3QSUA 2A7YA 2EQJA 1XQHA 2X4WA 1Y07A 1BIBA 2FB7A 3TREA 4LDWA 2MMPA 5A0GA 1Q7YU 3HFOA 2V8KA 1OI1A 5CO7A 3OYLA 2AHJB 2L89A 4C8QA 2ZPFB 1M90U 2RHUA 3VYHB 2EQMA 3CCQT 4FIBA 5GAMh 5FU6B 4M78D 1YI2A 2CZ7B 2ZPIB 3CCEA 1UEBA 2CZ0B 3VV0A 3V7CA 2E12A 5GMKm 3G7ZA 4NL2A 4M77D 2G3RA 4BE2A 5A0DA 4C92D 2XKOC 2XU8A 2RHYA 1AHJB 5FLXE 2DXTA 1QVFS 4N0AC 1OZ2A 4M78F 2OTJA 1VQPA 3NFCA 5GMKj 2MWPA 2EJGA 2XG8D 4OMFB 4C92F 3FJPA 3E9GA 3NTIA 2RB6A 5GANh 4C92E 2EWNA 3AHUA 3C12A 2PQWA 2KVQG 3L2ZA 2CKKA 2BUDA 4NL3A 2FYKA 1FXXA 4C92C 2F5TX 3CCVA 1YIJA 2QQAA 1WPYA 3LGLA 2IG0A 3OS2A 2DTHA 3CEYA 3DLMA 5CKFA 1JBMA 1W2BA 1H3ZA 3HRUA 4M7AE 1Q86U 3G4ST 4M78E 2ZGWA 5GAN4 3M58A 5IN1A 1U1TA 2JOYA 4C0GA 4X34A 5LJ3h 1K73U 3CCLA 2E65A 4A4FA 2GQVA 3OQ5A 4M78G 4MMKA 5CKEA 1YCYA 2I2LA 1H641 4XAXB 1N8RU 1QP2A 3J7AF 4BD3A 5CKBA 2K4YA 1FX7A 1O75A 3RUXA 4R55A 1VQLT 3QO3A 3LWIA 5GAMf 2EYQA 1KQ2A 4XU3A 4MMLA 4ZTJA 3MEUA 2K57A 1VQ6T 1BIAA 2VC8A 2YHTA 3SD4A 4N4HA 3UPUA 4KUDK 2XI9A 2XD0A 2R5AA 4ATOA 3EFRA 4J6XA 5GAOn 1D3BB 3PMTA 3CCMA 1Q86C 4P5NA 3MEAA 3FLGA 4IUTA 1YJ9A 3CC2A 1B34A 3C4SA 4KT0E 3JRZA 4IUVA 5M9OA 1KHIA 4XU1A 3JCMd 3HL8A 3X26B 4N0AA 2KDSA 1I81A 4OB2B 3M4YA 3VKIA 1X01A 4F7UF 3JCMb 2DD5A 3L2VA 5D6XA 1JB0E 3JCMe 1M1KC 3JCMX 2K5LA 3QHSA 4Y28E 3OYNA 2R5MA 5GAMe 3G4SA 1Q82U 2ZPEB 3L42A 4M77E 3J81E 1XTDA 4UC4A 2XDDA 1M8VA 4PLLA 3PTAA 3FDRA 3ASKA 2JVVA 3JSCA 2KY9A 2XHCA 3ER0A 4M77C 4M78A 1K8AU 4OB3B 4BE1A 4FT2A 1KC8C 5IAYA 1G3TA 3JB9F 2X4YA 4RCBA 5DM7R 4QQ6A 1LOJA 2DIQA 3KUFA 2QQBA 5LJ3f 4BI4A 3FB9A 3QBYA 2DD4A 3OYJA 3SFMA 1SSFA 5LJ5d 4E7LA 4F7UA 1QVGS 2MWOA 3PIPA 4HCBA 2RK1A 4II1A 2X4JA 2P0QA 4YTLA 1KD1C 3ME9A 2LRQA 2O01E 3QPHA 4M7AG 3HRTA 3GOXA 1VQ8T 2DZCA 2LX9A 1KQSA 2EKOA 1VQ8A 4J7FA 4XU2A 1QP3A 1B34B 1XOVA 2P0PA 3MEVA 5I21A 2D9TA 3CCVT 3X28B 2LC4A 3C95A 4BDYA 2ZCFB 3QYHB 5J39A 5CKDA 2H3JA 3OS5A 3GF5A 3JB9G 4MDXA 4OF1A 4L5GA 3GLXA 5KCHA 2FHDA 2QEXT 1WJRA 3RKXA 1VQ4A 4BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZFJ A;  2CS7 A; 
#chains in the Genus database with same CATH topology
 1G3S A;  4L6V 5;  2KMT A;  2QA4 T;  3M0R A;  1HJD A;  2DXC A;  2DYB A;  1UGQ B;  2EYZ A;  4C92 G;  1I07 A;  2FVU A;  2EQU A;  4Y92 A;  5KH6 A;  4C5E A;  1AWX A;  3DB4 A;  2X3W D;  3CD6 Q;  3V7S A;  2NUP B;  2DPP B;  4KBM B;  2GTJ A;  1B3Q A;  1WZO A;  2NUZ A;  1GBR A;  4M7A F;  2GF7 A;  1PWT A;  4GLM A;  1N27 A;  5GAN 8;  2LQK A;  2DL8 A;  1JJ2 S;  4AFZ C;  1E6H A;  1PHT A;  2EAY A;  2J6K A;  3BY7 A;  2YLB A;  3OYH A;  4IUP A;  2M16 A;  3ZEH A;  3HP9 A;  4IUQ A;  4LN2 A;  1VA7 A;  1NG2 A;  2AKL A;  1YIT A;  3FEO A;  4C8Q E;  4EMK C;  3CPW P;  2RM4 A;  2A37 A;  1A0N B;  1QKW A;  1MMA A;  4A53 A;  1U1S A;  2YUP A;  2BTT A;  4QKU A;  5GAN 3;  1TUG B;  1W6X A;  1B7T A;  4OP0 A;  2ROT A;  3GP8 A;  4M4Z A;  1BI0 A;  3M55 A;  3MCA B;  3C94 A;  5GAN j;  1VQ5 Q;  3V8K A;  2DFU A;  4KH0 B;  2RHZ A;  1MV3 A;  1WDX A;  1N9R A;  3CME A;  1OU9 A;  2DM1 A;  3M53 A;  2QGG A;  3X25 B;  4XTY A;  5L8R E;  1D09 B;  2BE7 D;  1IB8 A;  2C06 A;  3UAT A;  3PNW C;  3TSZ A;  3OA6 A;  3PFS A;  2W10 A;  3H6Z A;  2CS7 A;  1VQM T;  4XTW A;  1VQ5 A;  3CC4 Q;  1X6G A;  1MNE A;  2ED0 A;  3GBQ A;  1YCS B;  3QJ6 A;  5GAN 6;  2QGF B;  4KGZ B;  1KD1 R;  3N5B B;  4JS4 A;  5DLQ E;  4JRK A;  1G3Y A;  5C6S A;  3CCR A;  1K0X A;  1J3T A;  1W4S A;  2LQ8 A;  2CP6 A;  2KNB B;  3RR6 A;  5LJ5 h;  1SRL A;  1Q81 R;  3BFM A;  4J9C A;  2GBQ A;  2L5Q A;  4BY6 B;  1BBZ A;  1YI2 T;  4J8O A;  1YJN T;  3CC2 T;  4Z88 A;  3LGF A;  4ZGE B;  3CMA T;  2COY A;  2JTE A;  1VQK T;  1BCO A;  3WVE B;  3SWN B;  1VQ7 Q;  2V8I A;  4Z02 A;  4E6R A;  4RTU A;  1Q81 C;  1K8A C;  2C0O A;  5HKC A;  2QTV A;  4A4H A;  1TTH B;  1UTI A;  1UGS B;  2NUT B;  1SHG A;  3P8H A;  4FM4 B;  1FMV A;  4KUI A;  4D8D A;  4HCZ A;  4M75 D;  3CCU T;  4J9H A;  2M9U A;  1MMG A;  2D0Q B;  2V26 A;  3TEE A;  2QEX A;  2NYS A;  1RAI B;  3LX7 A;  3CCL T;  4M75 F;  5KYY B;  1WQ7 A;  4EDU A;  5LJ5 f;  4B9W A;  3TCJ A;  2VV5 A;  4LUE A;  5LJ3 d;  3A8L B;  3HSB A;  3L2W A;  1N9S A;  3RMS A;  3IQL A;  2JW4 A;  1K9M U;  3NHN A;  3T9N A;  3JB9 D;  1K8A R;  2DZ9 A;  4V2S A;  4J7I A;  4HKE A;  2KAF A;  4QVZ A;  5GAO q;  4MZT A;  4AT1 B;  3CCE T;  4EMK A;  4BDZ A;  4M77 B;  1EIF A;  2RA2 A;  3OSS C;  2ECZ A;  3VUZ A;  1VQ4 Q;  4M75 G;  2O88 A;  5KE2 A;  1PM3 A;  2GCX A;  2RK2 A;  1ZQ1 A;  4ELZ C;  5I22 A;  3G6E T;  4M7D D;  1U06 A;  1YWO A;  1N6A A;  3GNF B;  2K3B A;  5GAO r;  4JZ4 A;  4M7D F;  1NEG A;  4IIM A;  2DRK A;  2RJC A;  4ZTF A;  4HT9 A;  4AG1 C;  3NTK A;  3PGG A;  3JCM V;  3CC4 A;  2DTI A;  1QWE A;  3I5R A;  4RTW A;  2JT4 A;  2PTK A;  3MP1 A;  4Z8A A;  1V76 A;  1UG1 A;  1YFN A;  3FC3 A;  2LNV A;  2VKN A;  3CME Q;  3QG1 A;  5DLO A;  1PKS A;  3A8H B;  2RNA A;  1R0B G;  2LJ0 A;  1JXM A;  2OTJ T;  5AT1 B;  1LPL A;  1AWJ A;  4EIK A;  1K73 C;  1X2Q A;  1UGV A;  2V8J A;  5LJ5 j;  1KQS P;  1M3C A;  2RJD A;  1YIT Q;  1M90 C;  5FU6 C;  2P0K A;  2VUB A;  2EQK A;  5HK3 A;  3M5A A;  1BU1 A;  1K9M C;  2A0F B;  2E10 A;  2L3Q A;  4PK4 A;  1PD0 A;  4EPC A;  2CH4 A;  5CIU A;  5HY6 A;  1IRE B;  4VUB A;  4C5H A;  3LH5 A;  5AYF A;  2CGH A;  3CXC S;  2AZV A;  2DTO A;  1AEY A;  3G1J A;  1M9S A;  4C8Q F;  1ZUK A;  3VS5 A;  4ELY C;  3V8J A;  3A1P A;  4C0D B;  3OSV A;  1NZ9 A;  4RTX A;  1WXT A;  1VQO Q;  2YRC A;  3EFO A;  3I55 Q;  2DIG A;  3JCM g;  5D6Y A;  3JCM f;  2BZ8 A;  2E6N A;  3DKM A;  2FO0 A;  1YP5 A;  2COZ A;  4CC2 A;  2OTL T;  2C0I A;  2EGE A;  3VUB A;  1QLY A;  3QSU A;  1ZX6 A;  2HCK A;  2KT1 A;  2FZC B;  1Y07 A;  1BIB A;  4AFS C;  3VYH B;  3M0T A;  2EQM A;  1YJW Q;  3VS0 A;  3VV0 A;  2JJ9 A;  2E12 A;  3V7C A;  5IHK A;  5GMK m;  1UEC A;  4BE2 A;  5A0D A;  1QVF S;  2RHY A;  1VQP A;  5GMK j;  5FWC A;  2XG8 D;  2AIR B;  1H3H A;  3E9G A;  1ACM B;  2PQW A;  2BUD A;  4NL3 A;  4F04 B;  3NMZ C;  2QQA A;  3LGL A;  3A98 A;  5CKF A;  1JBM A;  2CSI A;  1Q86 U;  8ATC B;  3G4S T;  2K2M A;  2ZGW A;  3SEM A;  3HTR A;  3M58 A;  2KYM A;  4C0G A;  2JOY A;  4X34 A;  5LJ3 h;  2E65 A;  4A4F A;  4M78 G;  4MMK A;  5KYN A;  1H64 1;  4XAX B;  1N8R U;  2J7I A;  2CUB A;  4R55 A;  2CUD A;  1M27 C;  2MCN A;  3QO3 A;  5GAM f;  1CKB A;  3MEU A;  2A08 A;  2BZX A;  4JJD A;  1I1J A;  1NM7 A;  2R5A A;  1W1F A;  3O5Z A;  4F14 A;  2YUQ A;  3PMT A;  4ANJ A;  1QCF A;  1B07 A;  3MEA A;  4IUT A;  1KHI A;  4N0A A;  1I81 A;  3M4Y A;  4F7U F;  5D6X A;  1M1K C;  2K5L A;  2LQW A;  4Y28 E;  1Q82 U;  3L42 A;  1XTD A;  3PTA A;  2CDT A;  1VQ8 Q;  3FDR A;  4J9E A;  3ASK A;  3JSC A;  2KY9 A;  5HCK A;  1G3T A;  1NYG A;  4QQ6 A;  1LOJ A;  1M8M A;  2KGT A;  1X27 A;  5LJ5 d;  1IRX A;  1QVG S;  3PIP A;  4YTL A;  1QQJ A;  3HRT A;  2LX9 A;  1KQS A;  1VQ8 A;  2P0P A;  3CCV T;  4BDY A;  2JMC A;  2ZCF B;  3M0P A;  1OQK A;  3JB9 G;  1FMW A;  4OF1 A;  3GLX A;  1JQQ A;  3RKX A;  2NUT A;  4RTT A;  1Q81 U;  3E9F A;  2IPO B;  3F70 A;  4IUR A;  4CI0 C;  1N8R C;  1Q86 R;  1KD1 U;  1JRI A;  1UJY A;  4J9G A;  4M75 A;  1GCQ A;  1O9S A;  3VYG A;  4E47 A;  4C0F A;  4RG2 A;  2E4H A;  1M5Q 1;  4M7D E;  1WHJ A;  4LDU A;  1VQN T;  1TUD A;  1ZA2 B;  2VYT A;  4HVV A;  3CC7 A;  2DYI A;  3VRZ A;  4O5V A;  4WF2 A;  4QQD A;  4C8Q C;  5CQY A;  1OPK A;  3OW2 A;  2RO0 A;  1QVF A;  1AZG B;  4M75 E;  1VQ9 A;  3JCM P;  4PKC C;  2VGN A;  3CCM T;  2PVD B;  4BE0 A;  2LCC A;  3OW2 S;  1QW1 A;  1YJ9 T;  2QI2 A;  2Y4X A;  2LQN A;  4JLI A;  2NUP A;  3CC7 Q;  1VQM Q;  6AT1 B;  1GL5 A;  3CCS T;  1IO6 A;  5D6W A;  4KH1 B;  5GAN g;  2GFA A;  1ZBJ A;  1SG5 A;  1RLP C;  1V29 B;  3BW1 A;  2F2X A;  2RHI A;  1XJW B;  4M7D A;  5D7U A;  2ZPB B;  1VUB A;  3LH0 A;  3FIF A;  1M2O A;  3UDC A;  2DIL A;  3CCJ A;  3I56 T;  2DNU A;  3NTH A;  1WYX A;  2RI5 A;  2B8A A;  2P4T A;  1WJS A;  3PIO A;  3LWH A;  2RN8 A;  1TH7 A;  1D0X A;  2RQV A;  5FWB A;  5IT9 E;  1PSE A;  5KYU A;  2VAS A;  2DL5 A;  2LP5 A;  2QYZ A;  2ENM A;  1SPK A;  1OX8 A;  1VYU A;  2DO3 A;  4D8K A;  3EG0 A;  2JN0 A;  2QAS A;  2O9S A;  1WIE A;  1PCX A;  1YJN A;  1BKB A;  2E70 A;  4XTU A;  1I5L A;  4BI3 A;  2DVE A;  2K79 A;  2MYS A;  5GAO p;  1YHQ A;  1PD1 A;  4M7D G;  2CRE A;  3RKY A;  3OYF A;  1U8R A;  4A63 B;  1TS9 A;  3TSW A;  4E7S A;  4OML A;  1NPP A;  2LZ6 B;  3JCM Q;  1LVK A;  2IVW A;  4OGC A;  3R6O A;  3QWY A;  1MND A;  3A8G B;  3THK A;  5EC7 A;  5KYU B;  5A2Q E;  4PJO B;  3SHW A;  3CCE Q;  4PJO G;  4XTV A;  4DA4 A;  1ABQ A;  2E41 A;  2Y4Y A;  1K0S A;  1NYF A;  2QQR A;  2CT4 A;  2DEQ A;  3EGX B;  4ESR A;  2EYW A;  2JM8 A;  3EFS A;  4OMO A;  3OYE A;  1GFD A;  1V1C A;  2V1Q A;  4C8Q G;  2FRY A;  5GAN d;  1GCQ C;  1NEB A;  2OAU A;  2JTF A;  2XID A;  3WVD B;  2HDA A;  1PRL C;  1K73 R;  5J3B A;  1UGR B;  3BDU A;  1T3L A;  3DB3 A;  3URG A;  1IHW A;  1VQP Q;  2YDL A;  2RJE A;  2P84 A;  2EFI A;  2EIF A;  1VOM A;  2JS2 A;  5GMK e;  2YRV A;  1RAG B;  2FPD A;  3ZBD A;  3PT9 A;  3TQ7 P;  4LDX A;  2ABL A;  4C5I A;  4JJN K;  1WHH A;  2F5K A;  5CAI A;  4EMK B;  3MEW A;  5GMK h;  1UUE A;  4JDS A;  4BI8 B;  1QVP A;  4LDY A;  4PJL A;  1Z9Z A;  2WSC E;  4XK8 E;  1YJW A;  1JJ2 P;  3I55 A;  1PNJ A;  1NPR A;  2L3S A;  1GCP A;  2OX7 A;  3E1S A;  1GXI E;  1WA7 A;  4XU0 A;  2XDB A;  1RAA B;  2WSF E;  2QEX Q;  4PFP A;  4JJC A;  2RQT A;  2SEM A;  2J6O A;  4N4I A;  3A8O B;  4LE9 A;  2DXB A;  4F7U E;  3NGP A;  3QXE B;  4DBR A;  4Q5W A;  4M7A D;  3CXC A;  1VQO A;  2X3X D;  2P4R A;  3HRS A;  1YIJ Q;  5IH2 A;  1QCO A;  4M78 B;  5LJ5 e;  2EPD A;  2DK3 A;  5KYW B;  4OMQ A;  4QW2 A;  1MMD A;  4XTZ A;  1HXD A;  1KQ1 A;  3JB9 H;  1ZHI A;  4KGX B;  1MHN A;  4PJO E;  2R57 A;  3PVL A;  5FU7 C;  2MI6 A;  3I55 T;  1M1F A;  1M1K U;  4LNP A;  4C0Z A;  2QDY B;  1VQ7 A;  4J9F A;  3MP8 A;  2CSQ A;  3MPU B;  2DEU A;  4J9I A;  1MMN A;  1Q82 C;  2J06 A;  1IGQ A;  1RAF B;  1TSF A;  4MZP A;  3VS6 A;  1W2B S;  2YLC A;  2CZ1 B;  1JEG A;  3M9Q A;  4AFU C;  2JM9 A;  4FYW B;  5EG2 A;  3S6W A;  5DY9 A;  4C92 A;  2A7Y A;  2EQJ A;  4RTY A;  1JXO A;  2MMP A;  1Q7Y U;  3UF4 A;  1OI1 A;  1AWO A;  2RHU A;  3CCQ T;  2CZ7 B;  3CCE A;  4NL2 A;  4M77 D;  3PVQ A;  4C92 D;  2XU8 A;  5FLX E;  1AHJ B;  2DXT A;  2MOX A;  2QAZ A;  1ZSZ C;  2EJG A;  2RMO A;  3VS1 A;  3H0I A;  4C92 F;  2LNH B;  2XMF A;  1X69 A;  1S1N A;  2KVQ G;  4WTO B;  4DBH A;  1WFW A;  2F5T X;  1YIJ A;  5IHN A;  1WPY A;  1H3Z A;  4M78 E;  4F16 A;  1EX4 A;  2DL3 A;  2J6F A;  4B6M A;  3OQ5 A;  5CKE A;  5CKB A;  1YI2 Q;  1FX7 A;  1O75 A;  1YJN Q;  1WHL A;  4XU3 A;  2ROL A;  4ZTJ A;  2K57 A;  1BIA A;  4N4H A;  4KUD K;  3EHQ A;  2AKK A;  2D8J A;  1Q86 C;  4P5N A;  1B34 A;  4KT0 E;  5M9O A;  3CMA A;  1RAD B;  1BYM A;  2ED1 A;  1X01 A;  3CCU Q;  3JCM X;  3QHS A;  1GRI A;  2R5M A;  3CCL Q;  4M77 E;  3J81 E;  2XDD A;  3ER0 A;  1G2B A;  2E3I A;  1KIK A;  3JB9 F;  4RCB A;  1PC0 A;  3FB9 A;  1EZZ B;  5FW9 A;  4FYY B;  4II1 A;  1UHF A;  2VVK A;  3ME9 A;  2LRQ A;  1CSK A;  4OMM A;  1C6V X;  1D1C A;  1YNZ A;  2EKO A;  4XU2 A;  1QP3 A;  3MEV A;  4L5G A;  1OPL A;  3AT1 B;  2SRC A;  2LJ1 A;  1FMK A;  1VQ4 T;  1X43 A;  5FRO A;  4M78 C;  2E5Q A;  4OB1 B;  3SWN A;  1KSW A;  2O31 A;  2LT1 A;  3INZ A;  2KI7 A;  2YT6 A;  5J26 A;  1VYV A;  3LW5 E;  4PJM A;  3CCQ A;  3RES A;  2HL3 A;  2LTO A;  4F7U B;  2ZAE A;  1X75 C;  2FPF A;  1WX6 A;  4IUU A;  2M1H A;  2ZZD A;  2NWM A;  2QK0 A;  2FZK B;  4ZGD B;  3M56 A;  4DOW A;  2QTX A;  3CC7 T;  2R58 A;  3A8M B;  2AZS A;  2CH4 W;  2DF6 A;  2E6Z A;  1R8O B;  5LL6 S;  4GY5 A;  1K1Z A;  3CXC P;  2MIO A;  5KYX B;  1U5S A;  2KYB A;  1Y71 A;  5CR2 A;  3OS1 A;  2GFU A;  2OTJ Q;  1M2V A;  4M75 B;  2K2V A;  4F7U G;  2DL4 A;  1AT1 B;  1M3A A;  1YHQ Q;  1SHF A;  4HXJ A;  2KK4 A;  4BUG A;  1M1G A;  4PLI A;  1Z9Q A;  1X2K A;  3OB9 A;  3G71 T;  1JJ2 A;  1AD5 A;  2H3E B;  4FL6 A;  3OMC A;  4OMN A;  4ORZ A;  4HA8 A;  1WHG A;  4DBQ A;  3ULR B;  4FU6 A;  4C92 B;  2FL7 A;  1AWW A;  3I56 A;  3CCJ T;  2GTO A;  4RKU E;  4OVA A;  4FSX A;  2L8D A;  1H92 A;  1OV3 A;  3Q1J A;  3V8L A;  4M75 C;  3H8Z A;  3P8D A;  2M02 A;  1RUW A;  1TOV A;  5LJ5 g;  5KE3 A;  3CPW A;  4X1V A;  5CVI A;  1BB9 A;  1RI0 A;  4MZM A;  1CKA A;  2OTL Q;  3BE3 A;  2DKG A;  1BI3 A;  1JU5 C;  4CC7 A;  2CP7 A;  4R56 A;  2HBP A;  3S3M A;  3KFV A;  3VJP A;  3E2U A;  4OGE A;  4M7A B;  2HBW A;  1OEB A;  1PKT A;  4JRQ A;  3I35 A;  2FZG B;  1JO8 A;  2BIV A;  3EHR A;  1VQ6 Q;  3M59 A;  4RCC A;  3JCM c;  3RNJ A;  1TUC A;  3MHX A;  3I9Q A;  3KBG A;  4O6J A;  2KRM A;  4J6W A;  5I11 A;  3CCR T;  3OYK A;  3OYM A;  1VQ9 Q;  4PNO A;  1T0J A;  2AT1 B;  5CK9 A;  1C0M A;  3OBY A;  1SEM A;  4BY6 C;  4HVU A;  2LJ3 A;  1IGU A;  5LJ3 g;  2LDM A;  1OX9 A;  3JCM J;  1M90 R;  4PL6 A;  2JNG A;  4J9D A;  2O4X A;  1FYN A;  3G4S Q;  2K5I A;  1NJI R;  3FRN A;  4AG2 C;  4J5Y A;  4M7A A;  3D7S B;  2EW3 A;  5CKH A;  3L1A A;  3MJX A;  4JLG A;  2CP0 A;  2KEA A;  2X4X A;  3VRY A;  1OUL A;  2FRW A;  5IXB A;  3M57 A;  5LJ3 e;  2E64 A;  4A4G A;  1T3S A;  2RQU A;  1QMC A;  5I2M A;  3X24 B;  5C0M A;  2M0O A;  3UWN A;  3JB9 I;  4M77 G;  3RDV A;  4QQG A;  3SWN C;  1D0Z A;  4LDV A;  3OMG A;  5GAO m;  2AK5 A;  3OYD A;  1NBE B;  4JUV A;  3O8V A;  4A4E A;  4X9D A;  5GAO l;  1QCN A;  2OTL A;  3EH1 A;  4Y91 A;  1NJI U;  3G71 A;  2YXY A;  1EFN A;  1UB4 A;  3UA6 A;  2MPX C;  1Q7Y R;  1UGP B;  2DBM A;  1NLP C;  1BK2 A;  2EQI A;  2M0Y A;  1VQL A;  4TVR A;  2DL7 A;  3ZL7 C;  3OY9 A;  1DJ7 B;  3X20 B;  3JB9 J;  3QKJ A;  1M1K R;  2XK0 A;  1KQS S;  1ABO A;  2QG9 B;  5GJW B;  3RIR A;  3M0U A;  2LCL A;  4PJO F;  3V7R A;  3CQT A;  1LNX A;  1YIJ T;  2HNI A;  2XIC A;  5L23 A;  4E7J A;  2DMO A;  1ZBX A;  2COW A;  4DBF A;  2JUF A;  5GMK i;  4PJO D;  3M4G A;  3GIB A;  2A36 A;  2RHX A;  1Y96 A;  2LX7 A;  4RMO A;  3HHT B;  2BKD N;  4DEX A;  1G3W A;  1ZSZ B;  4FT4 A;  3KXT A;  3QZ9 B;  2KXD A;  4ZN1 A;  5GAM j;  1P92 A;  2F2V A;  4ZNX A;  3UA7 A;  1WLP B;  1WGS A;  2RD1 A;  4PJO C;  1WNL A;  2ZPH B;  2EYY A;  1WQW A;  1C1A A;  1XNI A;  2O2O A;  3S3O A;  1VQN Q;  2RQW A;  4PFO A;  1ZUY A;  3MKD A;  1Y57 A;  1G5V A;  2CP2 A;  3EGD A;  4N4G A;  4D6W A;  2DA9 A;  1WJQ A;  2EKH A;  2X51 A;  3S3N A;  3OYY A;  3RER A;  2HEQ A;  1X6O A;  2KSS A;  4JRI A;  5KYW A;  4J83 A;  2MAM A;  5GAN 7;  2WAC A;  3CCQ Q;  1Q82 R;  4XQ3 A;  1T0H A;  5GAN e;  1K9M R;  3EGX A;  2KR3 A;  1YJ9 Q;  1VQ6 A;  4K11 A;  3TVT A;  2KQW A;  5LJ3 j;  2HMA A;  4HCC A;  2A28 A;  1D1A A;  2FEI A;  3CCS Q;  5GJV B;  1PRM C;  1XQH A;  2DJQ A;  3C0C A;  2X4W A;  3TRE A;  2FB7 A;  1S72 Q;  4LDW A;  5A0G A;  2BZY A;  1BCM A;  2V8K A;  2AHJ B;  4FYX B;  3CMA Q;  2HKN A;  4FIB A;  1UDL A;  5FU6 B;  4M78 D;  1VQK Q;  1UEB A;  2RF0 A;  2EYX A;  1RAH B;  2G3R A;  2XKO C;  4N0A C;  2YUN A;  4M78 F;  5ECA A;  4HVW A;  4OMF B;  1E6G A;  1E7O A;  2RB6 A;  1M3B A;  3NTI A;  2CP3 A;  3C12 A;  3VS2 A;  3CCV A;  4J9B A;  2IG0 A;  2DTH A;  3CEY A;  3DLM A;  1W70 A;  2KRN A;  4FCY A;  1N8R R;  2B86 A;  5IN1 A;  3CCL A;  1K73 U;  3VS4 A;  2GQV A;  1YCY A;  3EG2 A;  1QP2 A;  2ESW A;  4BD3 A;  3J7A F;  1Q95 G;  2K4Y A;  1OU8 A;  1VQL T;  3QDF A;  4WCI A;  4MML A;  1KFZ A;  4RTZ A;  2YHT A;  3UPU A;  2XI9 A;  1HYO A;  2XD0 A;  2DVJ A;  4J6X A;  5GAO n;  1D3B B;  3CC2 A;  1YJ9 A;  3C4S A;  3JRZ A;  4IUV A;  3JCM d;  3OYI A;  3X26 B;  4E2F B;  2KDS A;  3EH2 A;  2DET A;  4AMC A;  3L2V A;  4Z89 A;  1JB0 E;  1N5Z A;  3OYN A;  5GAM e;  1OOT A;  2H8H A;  3G6E Q;  1K4U S;  1M8V A;  1SRM A;  4M77 C;  1I0C A;  2JVV A;  2XHC A;  2K9G A;  2M51 A;  4OB3 B;  1KC8 C;  5IAY A;  3QWX X;  2X4Y A;  2D0N A;  1UJ0 A;  2DIQ A;  2QQB A;  5LJ3 f;  4E7Z A;  3OYJ A;  1SSF A;  2MWO A;  4HCB A;  2RK1 A;  2X4J A;  2P0Q A;  2O01 E;  3QPH A;  4M7A G;  3GOX A;  1QVF P;  2DZC A;  2L3P A;  4J7F A;  2EGC A;  1XOV A;  4JZ3 A;  2HZY A;  4MDX A;  5KCH A;  1VQ4 A;  1TXQ A;  4BAC A;  3CME T;  2KBT A;  2CP5 A;  3SDZ A;  5FRM A;  2PVG B;  4RG8 A;  1VQP T;  2YSQ A;  2F1L A;  4NS5 A;  1WHK A;  4QVC A;  1PG5 B;  2OAW A;  2ATC B;  4OB0 B;  2O4X B;  1MUZ A;  4MDW A;  3OS0 A;  1RAB B;  4LD9 K;  2JZ2 A;  2RJF A;  4LUD A;  4C5G A;  1K9A A;  3GPL A;  2EJ9 A;  4KUL A;  3OBW A;  2QA4 Q;  5IHI A;  2F2W A;  3JCM h;  4PJJ A;  4DQ2 A;  1ARK A;  4FW1 A;  3MET A;  4NOY A;  3UT1 A;  2QQS A;  3JCM W;  1VYT A;  1KC8 U;  2EJF A;  4E7K A;  1KHC A;  2WSE E;  2X35 A;  4CC4 B;  3MP6 A;  3G71 Q;  3CD6 T;  2IIM A;  1VQK A;  3RKW A;  7AT1 B;  4CC3 A;  4CRI A;  2EBP A;  3MO8 A;  4HT8 A;  4DOV A;  1M30 A;  1VQO T;  4GBQ A;  4FYV B;  1ZUU A;  2Z0W A;  3JAM E;  2FG0 A;  1HSQ A;  4ZN3 A;  4JS5 A;  4C8Q D;  2GNC A;  3CCJ Q;  1YBY A;  5CCA A;  2HQE A;  2PUO B;  3VS7 A;  2HQX A;  2L3R A;  2QA4 A;  4ZGJ B;  2HD0 A;  2XDP A;  1Y7X A;  3QUI A;  1HD3 A;  2CZ6 B;  3QDR B;  2GQI A;  1BI2 A;  1YJW T;  3EG1 A;  4J6Y A;  4E7H A;  2NLU A;  3M0Q A;  2ZPG B;  1R77 A;  3CBO A;  2D6F A;  1VQ5 T;  4XTX A;  1VQM A;  2JS0 A;  2LVM A;  1KK7 A;  2A3L A;  2E1H A;  5A0L A;  1IZ6 A;  3OYB A;  2K3X A;  3QJY A;  1D1B A;  3OW2 P;  1FWZ A;  3CPW S;  2DE0 X;  4L59 A;  5KCO A;  3L2R A;  1OZ3 A;  2EGA A;  4B9X A;  3RBB B;  2RQR A;  2VB6 A;  3CC4 T;  4M7D C;  2V1R A;  3CCR Q;  3WXM B;  4FW2 A;  2PNI A;  2HAX A;  4LD6 A;  4M77 F;  1VQ9 T;  1QVG A;  2MK5 A;  5GAN f;  2DAQ A;  2D1X A;  2RH2 A;  3OYG A;  1IHV A;  1I4K 1;  1Q7Y C;  3CBP A;  4C0D C;  3G6E A;  3M54 A;  4JRP A;  3OYC A;  4DEY A;  2JTM A;  1VQN A;  3A5Z B;  1F1B B;  4M77 A;  3H9N A;  3CC2 Q;  5GAM g;  4QT7 A;  1Y0M A;  3HKS A;  5FU7 B;  1VQ7 T;  1NLO C;  3GNG A;  4AFQ C;  4EMG A;  1ZSG A;  3NPF A;  2BE9 B;  1AOJ A;  2PUK B;  1NE8 A;  1I8F A;  2HSE B;  5CQX A;  3OYA A;  2YWW A;  3LYI A;  1UE9 A;  2VXE A;  3ZFJ A;  4A4K A;  1TU0 B;  5HK0 A;  3E19 A;  2LCS A;  3QYG B;  2DJZ A;  3CCV Q;  2DER A;  2RI3 A;  2L2P A;  3CD6 A;  3REA B;  1H8K A;  1AZE A;  3VU3 C;  1QKX A;  1GFC A;  1RAC B;  4R0K A;  3RMQ A;  5GAN 2;  3R6N A;  3L2Q A;  3LLR A;  1VIE A;  4M7D B;  4A54 A;  5GAN 5;  2PU9 B;  2KRS A;  3CBM A;  2E5K A;  1KG1 A;  2F69 A;  3HFN A;  1LJO A;  1SF9 A;  1RL2 A;  1S72 A;  3SB2 A;  3EG9 A;  2LT4 A;  2L0A A;  2MF2 A;  3QZ5 B;  1IXD A;  2CT3 A;  3H0H A;  1VIF A;  4KGV B;  1WI7 A;  1M4Z A;  2VXF A;  4GLK A;  2Y90 A;  2QXF A;  5GMK l;  3TU4 K;  1NJI C;  1WHM A;  1GBQ A;  1OYX A;  5I2S A;  2KT8 A;  3CPF A;  1D3B A;  5IXF A;  3J80 E;  4E7I A;  3CCS A;  3CCM Q;  4RTV A;  4PJN A;  3EAE A;  2D8H A;  2DXU A;  1HK9 A;  4HCK A;  4IKF A;  3I5S A;  2G6F X;  3EG3 A;  2QQ9 A;  3PMI A;  1ZA1 B;  4X9C A;  1KJW A;  2PVO B;  1BI1 A;  2YRD A;  3EGU A;  5KYY A;  1PSF A;  2HL5 C;  2VGM A;  3EFO B;  3QII A;  4RUG A;  2RI2 A;  4KRT A;  2HQH A;  2RPN A;  9ATC B;  1TG0 A;  3HPW A;  4C8Q B;  1SSH A;  4BB7 A;  1QVG P;  3I56 Q;  4EMH A;  5GAM d;  2CYZ B;  1X6B A;  2K3Y A;  4ME7 A;  1S72 T;  2VWF A;  1Y96 B;  2PZ1 A;  5FRN A;  3BDL A;  4LXC A;  1YIT T;  2EVR A;  2KE9 A;  1G83 A;  2K5F A;  3CCU A;  3P8B B;  1RLQ C;  2X9H A;  1ZSZ A;  1WXU A;  2OJ2 A;  4PJO A;  1MGQ A;  1G8X A;  3DLL A;  4M7A C;  4QVD A;  1YHQ T;  2W0Z A;  4JJB A;  3L2U A;  4FSS A;  2I0N A;  2DX1 A;  3HFO A;  5CO7 A;  3OYL A;  2L89 A;  4C8Q A;  2ZPF B;  1M90 U;  2LMJ A;  1LCK A;  2KRO A;  5GAM h;  1YI2 A;  2ZPI B;  2CZ0 B;  3U23 A;  3G7Z A;  4JPB W;  2C0T A;  2FPE A;  1KC8 R;  1OZ2 A;  2OTJ A;  3NFC A;  2MWP A;  3FJP A;  1VQL Q;  5GAN h;  4C92 E;  4PFZ A;  1W2B P;  2EWN A;  3EGD B;  4F17 A;  3AHU A;  1UFF A;  3L2Z A;  2CKK A;  5KYX A;  8AT1 B;  2FYK A;  1FXX A;  1WXB A;  2JXB A;  4C92 C;  3OS2 A;  1W2B A;  3HRU A;  4M7A E;  1RI9 A;  5GAN 4;  1U1T A;  3H0F A;  2DLP A;  2I2L A;  1U3O A;  1SKU B;  3RUX A;  3LWI A;  1QWF A;  1MV0 B;  2EYQ A;  2J05 A;  1KQ2 A;  2O9V A;  2K6D A;  1VQ6 T;  2VC8 A;  3SD4 A;  1UHC A;  1ZLM A;  2JMA A;  3REB B;  4ATO A;  3EFR A;  2HSP A;  3CCM A;  1M2V B;  3FLG A;  4XU1 A;  3HL8 A;  3JCM b;  4OB2 B;  3VKI A;  3H41 A;  2DD5 A;  2K7A A;  2QDL A;  3VS3 A;  3JCM e;  2HKQ B;  3G4S A;  2KXC A;  2ZPE B;  3M0S A;  4UC4 A;  2GGR A;  4PLL A;  3JV3 A;  1YN8 A;  1K8A U;  4M78 A;  3PE0 A;  4BE1 A;  4FT2 A;  4IIO A;  2E3H A;  1D0Y A;  5DM7 R;  2YUO A;  2DRM A;  1AVZ C;  3KUF A;  1TWB A;  1I5O B;  4BI4 A;  1R0C B;  3QBY A;  2DD4 A;  2DBK A;  3SFM A;  4E7L A;  4F7U A;  1KD1 C;  2OI3 A;  1VQ8 T;  3FJ5 A;  5I21 A;  1B34 B;  1YWP A;  2D9T A;  3EG9 B;  3X28 B;  2LC4 A;  3C95 A;  4OMP A;  3QYH B;  5J39 A;  5CKD A;  1RAE B;  1K76 A;  2H3J A;  3GF5 A;  3OS5 A;  2FHD A;  2QEX T;  1WJR A; 
#chains in the Genus database with same CATH homology
 1G3S A;  3CME T;  4L6V 5;  1VQ4 T;  1Q81 U;  2KMT A;  5FRO A;  4M78 C;  2QA4 T;  3SDZ A;  2E5Q A;  5FRM A;  3E9F A;  4OB1 B;  2PVG B;  4RG8 A;  3SWN A;  1VQP T;  2LT1 A;  2DXC A;  3F70 A;  1UGQ B;  3INZ A;  4IUR A;  4NS5 A;  4QVC A;  4CI0 C;  5J26 A;  4C92 G;  2FVU A;  3LW5 E;  1N8R C;  2EQU A;  1KD1 U;  5KH6 A;  4OB0 B;  4C5E A;  2O4X B;  4MDW A;  3OS0 A;  1JRI A;  3CCQ A;  3RES A;  4M75 A;  3DB4 A;  3V7S A;  2DPP B;  4KBM B;  1O9S A;  2JZ2 A;  2LTO A;  2RJF A;  4F7U B;  4LD9 K;  3VYG A;  4C5G A;  1X75 C;  4E47 A;  3GPL A;  4C0F A;  2EJ9 A;  4RG2 A;  4KUL A;  4M7A F;  2GF7 A;  3OBW A;  1M5Q 1;  4M7D E;  1N27 A;  3JCM h;  5GAN 8;  4DQ2 A;  2LQK A;  4LDU A;  1JJ2 S;  4IUU A;  1VQN T;  3MET A;  2M1H A;  2EAY A;  2ZZD A;  2VYT A;  2QQS A;  4NOY A;  3BY7 A;  2YLB A;  3UT1 A;  3OYH A;  2EJF A;  4E7K A;  3JCM W;  4IUP A;  1KC8 U;  1KHC A;  2WSE E;  3CC7 A;  4ZGD B;  3M56 A;  4DOW A;  2M16 A;  2QTX A;  2X35 A;  3ZEH A;  1YJ9 T;  2R58 A;  3A8M B;  3CC7 T;  3HP9 A;  4O5V A;  4WF2 A;  4QQD A;  2E6Z A;  1R8O B;  3MP6 A;  4IUQ A;  5LL6 S;  4C8Q C;  5CQY A;  3OW2 A;  2RO0 A;  4GY5 A;  3CD6 T;  1QVF A;  1VQK A;  3RKW A;  3FEO A;  4C8Q E;  1YIT A;  4EMK C;  2RM4 A;  4M75 E;  1Y71 A;  1VQ9 A;  5CR2 A;  3JCM P;  3OS1 A;  4CRI A;  4A53 A;  1U1S A;  3MO8 A;  4HT8 A;  4DOV A;  2GFU A;  4PKC C;  1VQO T;  2VGN A;  5GAN 3;  3CCM T;  2PVD B;  4BE0 A;  2LCC A;  3JAM E;  3OW2 S;  1QW1 A;  4M75 B;  2K2V A;  4OP0 A;  4F7U G;  1BI0 A;  4C8Q D;  2QI2 A;  2Y4X A;  4ZN3 A;  3M55 A;  4JLI A;  4JS5 A;  3MCA B;  3C94 A;  5GAN j;  3V8K A;  1YBY A;  5CCA A;  2KK4 A;  2HQE A;  2PUO B;  1M1G A;  2RHZ A;  4PLI A;  4BUG A;  3CCS T;  2HQX A;  1N9R A;  2L3R A;  5D6W A;  2QA4 A;  3OB9 A;  5GAN g;  4ZGJ B;  3G71 T;  2GFA A;  3CME A;  1JJ2 A;  2HD0 A;  3M53 A;  2XDP A;  3X25 B;  4XTY A;  1Y7X A;  4FL6 A;  5L8R E;  3OMC A;  3QUI A;  1V29 B;  3BW1 A;  4HA8 A;  2CZ6 B;  3QDR B;  2RHI A;  2C06 A;  4M7D A;  1BI2 A;  3PNW C;  2ZPB B;  4J6Y A;  3OA6 A;  4E7H A;  1YJW T;  2NLU A;  4FU6 A;  2ZPG B;  3PFS A;  4C92 B;  1VUB A;  3LH0 A;  3FIF A;  3UDC A;  3H6Z A;  3CBO A;  2CS7 A;  2FL7 A;  2D6F A;  3I56 A;  1VQM T;  1VQ5 T;  3CCJ T;  4XTX A;  4RKU E;  3CCJ A;  4OVA A;  4XTW A;  3I56 T;  4FSX A;  1VQM A;  1VQ5 A;  2L8D A;  3NTH A;  2RI5 A;  2B8A A;  2LVM A;  2P4T A;  1WJS A;  2A3L A;  3PIO A;  2E1H A;  3QJ6 A;  1IZ6 A;  5A0L A;  3LWH A;  5GAN 6;  3OYB A;  3Q1J A;  3V8L A;  4M75 C;  3N5B B;  2K3X A;  3H8Z A;  4JS4 A;  1TH7 A;  3P8D A;  3QJY A;  1G3Y A;  4JRK A;  5DLQ E;  5C6S A;  3CCR A;  1PSE A;  5IT9 E;  1FWZ A;  3CPW S;  5LJ5 g;  1W4S A;  4L59 A;  2LQ8 A;  5KE3 A;  1BYM A;  3CPW A;  5CVI A;  5KCO A;  5LJ5 h;  3L2R A;  3BFM A;  1OZ3 A;  1RI0 A;  4B9X A;  4MZM A;  2L5Q A;  3CC4 T;  4M7D C;  2DKG A;  2DO3 A;  1BI3 A;  3WXM B;  4BY6 B;  3S3M A;  4R56 A;  2HBP A;  2HAX A;  2JN0 A;  4LD6 A;  4M77 F;  1VQ9 T;  1YI2 T;  1QVG A;  4J8O A;  1YJN T;  3VJP A;  1YJN A;  4OGE A;  4M7A B;  3CC2 T;  1BKB A;  2E70 A;  3LGF A;  4ZGE B;  5GAN f;  2DAQ A;  4XTU A;  2RH2 A;  4JRQ A;  1I5L A;  3CMA T;  4BI3 A;  2DVE A;  1VQK T;  5GAO p;  2BIV A;  3WVE B;  3M59 A;  3OYG A;  1YHQ A;  4RCC A;  3SWN B;  3JCM c;  2V8I A;  4Z02 A;  3MHX A;  1I4K 1;  1Q81 C;  1Q7Y C;  3CBP A;  4M7D G;  3KBG A;  1K8A C;  4O6J A;  5HKC A;  4C0D C;  3G6E A;  3M54 A;  4A4H A;  3RKY A;  4JRP A;  3OYC A;  3OYF A;  4J6W A;  1U8R A;  2JTM A;  1UGS B;  1VQN A;  3CCR T;  3A5Z B;  3OYK A;  3OYM A;  3P8H A;  4PNO A;  4FM4 B;  4KUI A;  5CK9 A;  4HCZ A;  4M75 D;  3CCU T;  2M9U A;  3OBY A;  4M77 A;  2D0Q B;  3TEE A;  1NPP A;  4BY6 C;  2QEX A;  5GAM g;  3LX7 A;  5LJ3 g;  2LDM A;  3JCM Q;  3CCL T;  2IVW A;  3HKS A;  3JCM J;  5FU7 B;  4OGC A;  4PL6 A;  2JNG A;  4M75 F;  1VQ7 T;  2O4X A;  3GNG A;  3R6O A;  2K5I A;  1WQ7 A;  3A8G B;  4EDU A;  5LJ5 f;  5A2Q E;  4PJO B;  4B9W A;  4EMG A;  3FRN A;  4J5Y A;  4M7A A;  3TCJ A;  5CKH A;  2VV5 A;  2PUK B;  1NE8 A;  4PJO G;  1I8F A;  4XTV A;  5CQX A;  4DA4 A;  3L1A A;  4JLG A;  5LJ3 d;  2E41 A;  2Y4Y A;  3A8L B;  3LYI A;  3OYA A;  3HSB A;  2QQR A;  2X4X A;  3L2W A;  1N9S A;  3RMS A;  2DEQ A;  3M57 A;  5LJ3 e;  2E64 A;  1K9M U;  3EFS A;  2VXE A;  4A4G A;  3OYE A;  3T9N A;  3ZFJ A;  4A4K A;  5HK0 A;  3JB9 D;  5I2M A;  3X24 B;  3E19 A;  2DZ9 A;  4C8Q G;  5C0M A;  4J7I A;  4V2S A;  4HKE A;  2KAF A;  4QVZ A;  2M0O A;  5GAN d;  5GAO q;  3UWN A;  3QYG B;  3JB9 I;  4M77 G;  2DJZ A;  2OAU A;  2JTF A;  4QQG A;  2XID A;  3SWN C;  4MZT A;  3GP8 A;  3CCE T;  3WVD B;  4LDV A;  4EMK A;  4BDZ A;  3OMG A;  4M77 B;  2RI3 A;  5GAO m;  1EIF A;  5J3B A;  2RA2 A;  3OSS C;  3OYD A;  1UGR B;  3VUZ A;  3CD6 A;  3BDU A;  3DB3 A;  3URG A;  4JUV A;  4M75 G;  3VU3 C;  3O8V A;  4A4E A;  2GCX A;  2RK2 A;  4X9D A;  5KE2 A;  5GAO l;  2OTL A;  5GAN 2;  1ZQ1 A;  2RJE A;  3RMQ A;  4ELZ C;  3L2Q A;  2EFI A;  4Y91 A;  2EIF A;  1NJI U;  3G6E T;  5GMK e;  2YRV A;  3LLR A;  1VIE A;  3G71 A;  4M7D B;  4M7D D;  3ZBD A;  3PT9 A;  1UB4 A;  4A54 A;  4LDX A;  5GAN 5;  2PU9 B;  1UGP B;  4C5I A;  1N6A A;  4JJN K;  3CBM A;  3GNF B;  1KG1 A;  2F69 A;  5GAO r;  3HFN A;  2F5K A;  1VQL A;  1LJO A;  4TVR A;  5CAI A;  4M7D F;  3OY9 A;  4EMK B;  1RL2 A;  1DJ7 B;  3MEW A;  3X20 B;  3JB9 J;  3QKJ A;  5GMK h;  2XK0 A;  1S72 A;  3SB2 A;  2RJC A;  4ZTF A;  4JDS A;  4HT9 A;  1KQS S;  2LT4 A;  4BI8 B;  1QVP A;  3NTK A;  3PGG A;  4LDY A;  3JCM V;  3CC4 A;  3OYI A;  2DTI A;  2MF2 A;  3QZ5 B;  2WSC E;  3RIR A;  1VIF A;  4XK8 E;  1YJW A;  1M4Z A;  2LCL A;  2VXF A;  4GLK A;  2Y90 A;  3MP1 A;  4PJO F;  3V7R A;  3I55 A;  2QXF A;  5GMK l;  1NPR A;  3TU4 K;  1LNX A;  1NJI C;  1YIJ T;  1OYX A;  2HNI A;  3E1S A;  3FC3 A;  2XIC A;  5I2S A;  4E7J A;  2LNV A;  1GXI E;  4XU0 A;  1ZBX A;  3CPF A;  2XDB A;  2JUF A;  1D3B A;  2WSF E;  5GMK i;  3J80 E;  4E7I A;  3CCS A;  4PJO D;  3M4G A;  3QG1 A;  3GIB A;  4N4I A;  5DLO A;  3A8O B;  3A8H B;  2RHX A;  2DXB A;  2OTJ T;  4F7U E;  1Y96 A;  3EAE A;  4RMO A;  3HHT B;  3QXE B;  2BKD N;  4M7A D;  4Q5W A;  1G3W A;  3CXC A;  1VQO A;  4FT4 A;  3KXT A;  1K73 C;  3QZ9 B;  4ZN1 A;  2DXU A;  1HK9 A;  3HRS A;  5GAM j;  4M78 B;  4IKF A;  1P92 A;  5LJ5 e;  2DK3 A;  2QQ9 A;  1WGS A;  2V8J A;  2RD1 A;  2PVO B;  3PMI A;  4QW2 A;  4X9C A;  1BI1 A;  5LJ5 j;  2RJD A;  3CMA A;  4PJO C;  1WNL A;  2ZPH B;  4XTZ A;  1HXD A;  1KQ1 A;  1PSF A;  1ZHI A;  1WQW A;  2VGM A;  5FU6 C;  1M90 C;  3JB9 H;  1MHN A;  2P0K A;  2VUB A;  1XNI A;  2EQK A;  5HK3 A;  3QII A;  3M5A A;  3S3O A;  2RI2 A;  2R57 A;  4PJO E;  1K9M C;  5FU7 C;  2MI6 A;  2E10 A;  3I55 T;  1M1F A;  4C8Q B;  3HPW A;  4EPC A;  1M1K U;  5CIU A;  5HY6 A;  4BB7 A;  1IRE B;  4VUB A;  4C0Z A;  2QDY B;  4C5H A;  5AYF A;  1VQ7 A;  2CGH A;  3CXC S;  1G5V A;  4N4G A;  4D6W A;  2DTO A;  1WJQ A;  4EMH A;  5GAM d;  2CYZ B;  3MP8 A;  3S3N A;  3OYY A;  1M9S A;  2K3Y A;  4ME7 A;  3RER A;  1S72 T;  4C8Q F;  1Y96 B;  2KSS A;  1X6O A;  4JRI A;  4ELY C;  3BDL A;  1Q82 C;  5FRN A;  1YIT T;  3V8J A;  4C0D B;  3OSV A;  1NZ9 A;  4J83 A;  2MAM A;  5GAN 7;  4MZP A;  2WAC A;  2K5F A;  4XQ3 A;  3CCU A;  1W2B S;  5GAN e;  3P8B B;  2YLC A;  2CZ1 B;  2DIG A;  3M9Q A;  3JCM g;  5D6Y A;  4PJO A;  1MGQ A;  5EG2 A;  3JCM f;  2E6N A;  3S6W A;  3DLL A;  1VQ6 A;  3DKM A;  4M7A C;  4QVD A;  1YHQ T;  2KQW A;  2OTL T;  5LJ3 j;  4HCC A;  3VUB A;  5DY9 A;  4C92 A;  3L2U A;  3QSU A;  2A7Y A;  2EQJ A;  1XQH A;  2X4W A;  1Y07 A;  1BIB A;  2FB7 A;  3TRE A;  4LDW A;  2MMP A;  5A0G A;  1Q7Y U;  3HFO A;  2V8K A;  1OI1 A;  5CO7 A;  3OYL A;  2AHJ B;  2L89 A;  4C8Q A;  2ZPF B;  1M90 U;  2RHU A;  3VYH B;  2EQM A;  3CCQ T;  4FIB A;  5GAM h;  5FU6 B;  4M78 D;  1YI2 A;  2CZ7 B;  2ZPI B;  3CCE A;  1UEB A;  2CZ0 B;  3VV0 A;  3V7C A;  2E12 A;  5GMK m;  3G7Z A;  4NL2 A;  4M77 D;  2G3R A;  4BE2 A;  5A0D A;  4C92 D;  2XKO C;  2XU8 A;  2RHY A;  1AHJ B;  5FLX E;  2DXT A;  1QVF S;  4N0A C;  1OZ2 A;  4M78 F;  2OTJ A;  1VQP A;  3NFC A;  5GMK j;  2MWP A;  2EJG A;  2XG8 D;  4OMF B;  4C92 F;  3FJP A;  3E9G A;  3NTI A;  2RB6 A;  5GAN h;  4C92 E;  2EWN A;  3AHU A;  3C12 A;  2PQW A;  2KVQ G;  3L2Z A;  2CKK A;  2BUD A;  4NL3 A;  2FYK A;  1FXX A;  4C92 C;  2F5T X;  3CCV A;  1YIJ A;  2QQA A;  1WPY A;  3LGL A;  2IG0 A;  3OS2 A;  2DTH A;  3CEY A;  3DLM A;  5CKF A;  1JBM A;  1W2B A;  1H3Z A;  3HRU A;  4M7A E;  1Q86 U;  3G4S T;  4M78 E;  2ZGW A;  5GAN 4;  3M58 A;  5IN1 A;  1U1T A;  2JOY A;  4C0G A;  4X34 A;  5LJ3 h;  1K73 U;  3CCL A;  2E65 A;  4A4F A;  2GQV A;  3OQ5 A;  4M78 G;  4MMK A;  5CKE A;  1YCY A;  2I2L A;  1H64 1;  4XAX B;  1N8R U;  1QP2 A;  3J7A F;  4BD3 A;  5CKB A;  2K4Y A;  1FX7 A;  1O75 A;  3RUX A;  4R55 A;  1VQL T;  3QO3 A;  3LWI A;  5GAM f;  2EYQ A;  1KQ2 A;  4XU3 A;  4MML A;  4ZTJ A;  3MEU A;  2K57 A;  1VQ6 T;  1BIA A;  2VC8 A;  2YHT A;  3SD4 A;  4N4H A;  3UPU A;  4KUD K;  2XI9 A;  2XD0 A;  2R5A A;  4ATO A;  3EFR A;  4J6X A;  5GAO n;  1D3B B;  3PMT A;  3CCM A;  1Q86 C;  4P5N A;  3MEA A;  3FLG A;  4IUT A;  1YJ9 A;  3CC2 A;  1B34 A;  3C4S A;  4KT0 E;  3JRZ A;  4IUV A;  5M9O A;  1KHI A;  4XU1 A;  3JCM d;  3HL8 A;  3X26 B;  4N0A A;  2KDS A;  1I81 A;  4OB2 B;  3M4Y A;  3VKI A;  1X01 A;  4F7U F;  3JCM b;  2DD5 A;  3L2V A;  5D6X A;  1JB0 E;  3JCM e;  1M1K C;  3JCM X;  2K5L A;  3QHS A;  4Y28 E;  3OYN A;  2R5M A;  5GAM e;  3G4S A;  1Q82 U;  2ZPE B;  3L42 A;  4M77 E;  3J81 E;  1XTD A;  4UC4 A;  2XDD A;  1M8V A;  4PLL A;  3PTA A;  3FDR A;  3ASK A;  2JVV A;  3JSC A;  2KY9 A;  2XHC A;  3ER0 A;  4M77 C;  4M78 A;  1K8A U;  4OB3 B;  4BE1 A;  4FT2 A;  1KC8 C;  5IAY A;  1G3T A;  3JB9 F;  2X4Y A;  4RCB A;  5DM7 R;  4QQ6 A;  1LOJ A;  2DIQ A;  3KUF A;  2QQB A;  5LJ3 f;  4BI4 A;  3FB9 A;  3QBY A;  2DD4 A;  3OYJ A;  3SFM A;  1SSF A;  5LJ5 d;  4E7L A;  4F7U A;  1QVG S;  2MWO A;  3PIP A;  4HCB A;  2RK1 A;  4II1 A;  2X4J A;  2P0Q A;  4YTL A;  1KD1 C;  3ME9 A;  2LRQ A;  2O01 E;  3QPH A;  4M7A G;  3HRT A;  3GOX A;  1VQ8 T;  2DZC A;  2LX9 A;  1KQS A;  2EKO A;  1VQ8 A;  4J7F A;  4XU2 A;  1QP3 A;  1B34 B;  1XOV A;  2P0P A;  3MEV A;  5I21 A;  2D9T A;  3CCV T;  3X28 B;  2LC4 A;  3C95 A;  4BDY A;  2ZCF B;  3QYH B;  5J39 A;  5CKD A;  2H3J A;  3OS5 A;  3GF5 A;  3JB9 G;  4MDX A;  4OF1 A;  4L5G A;  3GLX A;  5KCH A;  2FHD A;  2QEX T;  1WJR A;  3RKX A;  1VQ4 A;  4BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...