3ZFJA

N-terminal domain of pneumococcal phtd protein with bound zn(ii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
SYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PNEUMOCOCCAL HISTIDINE TRIAD PROTEIN D
publication title New Insights Into Histidine Triad Proteins: Solution Structure of a Streptococcus Pneumoniae Phtd Domain and Zinc Transfer to Adcaii.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Zinc-binding protein
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04270 Strep_his_triad Streptococcal histidine triad protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.680 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3zfjA00
2CS7A 3ZFJA
chains in the Genus database with same CATH superfamily
1KQSP 2D6FA 3OBWA 2K5IA 4PNOA 3SEMA 1I5OB 2AZVA 3HP9A 1SPKA 2FG0A 2QYZA 4PFPA 5LJ5g 4J9DA 5CK9A 3CCJQ 1EFNA 1NEBA 1KG1A 4M77A 4RG2A 3CCVA 1WHHA 4AFSC 3EG0A 5IAYA 1KQSA 4PFZA 2VGNA 5IXBA 5CQXA 1KIKA 1RAEB 1KK7A 4ZGJB 4HCZA 2AIRB 5LJ5h 2AK5A 1QKWA 2EYQA 3QZ5B 4HCBA 1M9SA 1NPPA 1QVPA 2DF6A 3FRNA 5I21A 1I1JA 1EZZB 4LDXA 4C0FA 4M7AA 2HD0A 2KMTA 1RACB 4XTXA 2Y4XA 1UUEA 2DL7A 1W2BP 1WIEA 2B8AA 3H41A 2PNIA 1YIJA 1ZHIA 3UA6A 2JTMA 2X4XA 5GAMg 2HQEA 3EFRA 2ROTA 2MYSA 4E6RA 3CXCP 2V1QA 3CC2A 2RMOA 2M0YA 2RHYA 3CC7A 2QA4A 3MJXA 5J39A 5LJ5j 1W2BA 1E6GA 1Y07A 1M2OA 1VQ8A 2DNUA 4F7UB 4QW2A 4IUPA 3QBYA 4F16A 5GMKj 1YWPA 3JCMV 5GAMh 2GQVA 1G8XA 3CXCA 1X01A 1VQKA 2HEQA 1RUWA 3T9NA 2R5AA 4LD9K 1R8OB 3NMZC 1JJ2A 1AZEA 4QQDA 4JRPA 3QZ9B 2V8JA 2P4RA 4PJOF 1K73R 4DQ2A 2MPXC 1VIFA 3UPUA 2FB7A 2NUTB 1K9MU 2JVVA 2QI2A 3A5ZB 2YDLA 2RNAA 2ZCFB 2DEUA 1RABB 5AT1B 3A8OB 3F70A 3M0SA 3OMGA 3OS2A 3QSUA 3HFNA 3OSVA 3CCVT 3EG3A 5GAN2 1Q81R 2XICA 1NLOC 2G6FX 4JRIA 2FPDA 2YRCA 2HKNA 5GAN8 2PUKB 2RQWA 2DJQA 1M8MA 4BI4A 1YP5A 1U1TA 1AWOA 4PFOA 2ENMA 2LQWA 3QPHA 1KHIA 1B3QA 4HVVA 3OYNA 1PWTA 2HQHA 1YJWA 4Y28E 5FU6B 2FL7A 2E3IA 3G4SA 1YFNA 4PLLA 2QGFB 2BZ8A 4PKCC 5A0LA 5CKEA 3CCUQ 5GANd 1Y96B 3CC2T 1MMNA 2LVMA 2R58A 4HKEA 3JAME 2QA4T 1JXOA 4Y92A 4PLIA 4JDSA 5IHKA 2RQVA 1Y0MA 1YBYA 2JT4A 3E2UA 1SG5A 1N27A 2A37A 1PSFA 2RN8A 2RD1A 2DVJA 4J6XA 2FZKB 4JJBA 2PTKA 1W1FA 2DRKA 1D09B 4OF1A 2XG8D 2GGRA 2HCKA 2EGEA 2ZPIB 1MGQA 3PIPA 4IKFA 1WJRA 2ED0A 1KD1U 2BUDA 2L8DA 4HT8A 3C12A 1UDLA 2LCSA 1SRLA 4PL6A 2GNCA 2L3SA 2EFIA 4KUIA 3M0QA 3CCRQ 2PZ1A 1Q86C 1FMKA 2FYKA 4TVRA 3EHRA 4E7IA 3WVEB 2K4YA 5A2QE 1QVGS 3OYCA 2O9SA 4JZ4A 4M7DC 1LVKA 4HA8A 4M75G 5GAN6 3RR6A 1AWWA 3PVQA 3JCMP 1TUDA 3EGXB 3JCMd 4C0DC 1X2KA 2GTJA 3PE0A 1WQWA 4FW1A 5GAOq 1KQ2A 1T0JA 4L5GA 1IHVA 4NL3A 2EKOA 4ELYC 1PD0A 3OYBA 4M7DF 3DLLA 3NTIA 3R6OA 1MMAA 2YUPA 5C0MA 2CGHA 3V8JA 2YWWA 1VQ7A 1VYUA 3G4ST 5D6WA 4KGXB 4IUUA 1PHTA 1U06A 1I5LA 1TS9A 2A28A 2FEIA 1X2QA 3CPFA 4RTYA 4NOYA 2WSFE 4PJJA 1H3HA 2QQ9A 4RTZA 2DIQA 2IVWA 3NHNA 5I11A 4OP0A 4B6MA 3GP8A 3MP8A 2L3QA 2QQBA 1WA7A 1GL5A 4OB0B 6AT1B 4J9GA 1YI2A 5GAN4 5LJ3d 1ZBJA 3EAEA 1WXUA 4RG8A 4A54A 1MNDA 4OMOA 1PKTA 3EG9A 5I2MA 1YHQA 3DKMA 2EJFA 1VQ6A 2Z0WA 1HYOA 4A63B 4D6WA 1S1NA 3RUXA 3CCQA 2K57A 2OAWA 5KE3A 2EYWA 2DTIA 4OMPA 2GF7A 2JNGA 1NJIC 1YN8A 2PQWA 3FB9A 5LJ3j 2LQKA 3M54A 1QP3A 2K2VA 3JB9H 4FSXA 1M90U 5CAIA 2P4TA 1UGRB 2YUOA 2MWOA 2QEXA 4EMKA 3TQ7P 3VKIA 1UEBA 1Q7YU 1YJ9Q 4PJOG 4K11A 4QKUA 2JMAA 3G1JA 2VB6A 1JBMA 1YITQ 2E3HA 3OS0A 4LDVA 5L8RE 1U5SA 1ZSZA 1M3BA 1M8VA 3CCEQ 1WXTA 3VS6A 4JLIA 1VQOA 2ZPGB 1WZOA 4BE0A 4J83A 3EG2A 2M0OA 1WNLA 4PJOB 1VQ7T 3OSSC 4NS5A 3CBMA 4EIKA 3JB9I 1T0HA 3BFMA 1EX4A 3HL8A 5GMKe 1M1GA 2A3LA 2EW3A 3MO8A 1VQPA 3N5BB 5IHNA 4C8QG 5CKFA 2X3WD 1RLQC 4AG2C 4DBRA 2LC4A 1XJWB 3OYHA 1NBEB 4M77C 2KXCA 2HSEB 1A0NB 1YI2T 2E5KA 3OA6A 1YJNQ 5M9OA 1JU5C 4C8QB 3JB9G 2X3XD 4M77D 1VQ6T 2O4XB 3OYYA 2WSCE 3AHUA 3EG1A 2LT4A 4PJNA 2QTVA 3CCQT 5FLXE 5KCOA 2HDAA 1H641 4LDUA 3C4SA 4XTVA 4M7AC 2EJ9A 2HNIA 4AMCA 1M2VA 2F1LA 2HQXA 2PVGB 3META 2VXFA 4MMKA 3DB4A 1G3TA 2M02A 4JRKA 5GAOp 1Q86R 1SHGA 4M75E 1OPLA 4M7AF 2CT3A 1KHCA 1QVFS 2COYA 1I07A 2P0PA 1QCOA 1OOTA 2EWNA 2DLPA 2ZAEA 4J9EA 4PK4A 3L2QA 1VQOT 5CIUA 1ABQA 2OTJT 2DX1A 1K8AC 1KC8C 4J9BA 3TREA 2GBQA 3CMAT 3M57A 4XQ3A 2KNBB 4E7SA 4C5EA 4L6V5 1N5ZA 1V76A 4KH0B 1K73U 1PG5B 3E19A 1PRLC 1LOJA 1IGQA 2DK3A 4WCIA 4KUDK 3OW2A 2RHUA 3NGPA 1W70A 1XQHA 5GANe 3HRSA 1VQPT 3VS7A 5GANf 2KDSA 1TUCA 2EGAA 2DL3A 3RMSA 5IT9E 3BW1A 3E9FA 1KQ1A 2RB6A 4M78E 3CCST 5KYUB 4FM4B 1M1FA 3LYIA 1VQ4A 2ZZDA 4Z02A 4OMLA 1D1BA 1JQQA 2B86A 3BY7A 4MDWA 5GAN3 4RCBA 4ZTFA 3GOXA 1C6VX 3G71T 3Q1JA 3X25B 4C0DB 1QVFP 1ABOA 2CZ6B 2ED1A 4NL2A 4XU3A 1HD3A 2A36A 2CKKA 3CC4A 3LLRA 2RPNA 2EAYA 3LW5E 1UGVA 1BCOA 1WHJA 2RK2A 2KRNA 2M51A 3RNJA 2FRWA 2COZA 4X9DA 1UHFA 3X24B 1QVFA 1QLYA 1VA7A 4OB1B 1GFDA 1PSEA 4KH1B 4QVDA 2MWPA 2E4HA 2O2OA 4BE1A 1NJIR 2XIDA 3A8GB 3MEWA 1S72A 2OTLT 2MCNA 4E7ZA 2XK0A 4J7FA 3JCMe 3HSBA 1LCKA 3JCMf 2KAFA 4M75D 4BD3A 3G7ZA 2KY9A 2EQKA 4DEYA 1VQNT 4C0GA 4FU6A 3ZL7C 4RCCA 2DETA 8ATCB 3V7SA 4JJNK 1QMCA 3PFSA 1E6HA 5GAOm 3EFSA 2DZCA 3M5AA 5GAOl 2IG0A 1NYGA 2EJGA 3DB3A 1G3YA 1CKBA 4BI3A 2NUZA 3CMAQ 4IIOA 3LWIA 2QDLA 1GRIA 9ATCB 2NUTA 4CC3A 3M9QA 5CO7A 4Q5WA 1UHCA 2LP5A 3QO3A 1VQMT 4B9XA 3MCAB 2CREA 2KVQG 4LE9A 1VQ9T 5ECAA 4GLMA 5GMKh 2LJ1A 3M0UA 1Q95G 4A4EA 3CD6A 3OYGA 2V1RA 1OX8A 1ZUUA 4C8QE 4C92G 3ASKA 3CCLT 1QP2A 4LUEA 1VQ4T 2L5QA 5LJ3e 4A53A 4M78D 5LJ3f 4XU0A 4F7UG 3M59A 1YCSB 3G6EA 1N9RA 1U3OA 3WXMB 5IXFA 4C92B 3G71Q 1M30A 4BY6C 1PM3A 2YUQA 2VKNA 3CC4T 3CCMT 2HAXA 3L2UA 2YUNA 1TUGB 2E41A 1XOVA 5FU7C 1QWEA 3A1PA 8AT1B 3FEOA 1R0BG 4ATOA 1I0CA 1K9MC 2L89A 4IUVA 3SDZA 4LXCA 1D3BB 1S72T 1XNIA 4FT4A 5KYWB 1SSFA 3H0FA 4HVUA 2VWFA 1MV0B 2RHXA 3PIOA 1VQLQ 2R57A 4E7KA 1LPLA 3PT9A 2DD5A 3QJ6A 2FRYA 2KQWA 2KRMA 2OI3A 3C0CA 3VS0A 5HK0A 3HFOA 4N4IA 1FYNA 4ZGDB 2XMFA 1K76A 1RL2A 3I5RA 1KJWA 5GANg 2BKDN 1BU1A 1T3SA 1G3SA 1C1AA 4XTUA 1KC8R 5CKBA 1TTHB 3MP1A 2EYXA 2LNHB 4IIMA 2JTEA 4M7AB 1VQ9Q 2RJCA 1YJ9A 1WHGA 5GANh 1YITA 3EGXA 4EMKC 4DBHA 2CDTA 3CCLQ 4RTVA 1K9AA 4C8QD 5FW9A 1YIJT 3FDRA 4XAXB 4M75A 2JOYA 1RADB 3I55A 1B7TA 1FX7A 1ZSZC 4R56A 2XI9A 4J6YA 4X1VA 3S3MA 3CC7T 3BE3A 1AZGB 3VS5A 2DA9A 2O9VA 2F5TX 2XDPA 3UF4A 3JB9D 2LT1A 2LJ0A 1M3CA 1VQ8T 2KXDA 3ZFJA 2RQUA 3CMEA 2JJ9A 2DILA 1ZUYA 1IZ6A 5AYFA 1VQKT 5GANj 3O8VA 2QTXA 2XD0A 3JCMg 3QWXX 2K9GA 1OEBA 2ABLA 2YT6A 4R0KA 3OYDA 2XDDA 1Q82C 3OYMA 3VS2A 1WJQA 3V8KA 3EFOB 1Y7XA 3GLXA 1VYVA 1YJNA 3RDVA 1WQ7A 5KE2A 2DRMA 1I4K1 4HCCA 3JCMh 1WGSA 5D6XA 4KBMB 3EGUA 4M78A 2OX7A 4V2SA 1U1SA 2GFAA 1OZ2A 3CCVQ 4OGEA 2CH4A 1CKAA 4BACA 1VIEA 2XDBA 4ZNXA 1PD1A 3H0HA 2BZXA 2JN0A 3C95A 2XHCA 2ESWA 2E5QA 2MK5A 4JS5A 4GY5A 1YJWT 1WHMA 2QG9B 2LRQA 5LJ3g 1NE8A 1O75A 2KRSA 3KBGA 3J80E 1FXXA 1G3WA 2RJDA 4C92E 3PVLA 5CQYA 2SRCA 2AHJB 4HT9A 1I81A 1UGPB 2XKOC 3I55T 1WFWA 2DYIA 3UWNA 4RTXA 2C0TA 2COWA 5LJ3h 4F7UE 2FZCB 3CC2Q 7AT1B 2QA4Q 4FIBA 1QVGP 3L2ZA 3KXTA 3ER0A 3CBOA 2K3BA 1W4SA 2PVOB 4LD6A 2CP5A 3GIBA 1M4ZA 2J05A 2I0NA 1VQKQ 1O9SA 4Z89A 2OJ2A 3QJYA 1WHLA 2AKKA 1QVGA 4EPCA 3V7CA 1M90C 2RM4A 2E6ZA 2FHDA 4AFUC 1BK2A 5KH6A 3MPUB 1BBZA 4Y91A 1K9MR 2BE9B 1PCXA 1X75C 2HMAA 1Q7YC 2CZ0B 4FYVB 2KROA 4C8QA 3JCMJ 3RKWA 1VQ5A 4AG1C 2ROLA 3TSZA 2QQSA 3GPLA 3CQTA 4A4GA 3I56A 4J5YA 3VRYA 3FJPA 3EGDB 3M0TA 3HKSA 4BY6B 5KCHA 1UGQB 2RHZA 1WLPB 3QUIA 1GCQA 4RTUA 5FU7B 2AZSA 1NJIU 2DEQA 2E10A 3H9NA 2HBPA 2K2MA 1YJWQ 1E7OA 5HK3A 3G4SQ 4CC7A 1N8RU 3UA7A 5C6SA 4E47A 3DLMA 4DOWA 1RLPC 4C92D 3CCJA 4BDZA 2C06A 4OMMA 4J9IA 1GXIE 2VYTA 1N6AA 3INZA 2V8IA 3O5ZA 1H3ZA 1Z9ZA 2K3YA 1TOVA 2C0IA 1G5VA 3VV0A 2K7AA 5I2SA 3LX7A 4E7LA 5EG2A 2A0FB 1X43A 1YHQT 1AWJA 2O31A 4JZ3A 4ME7A 1MV3A 1JB0E 4Z88A 2RQRA 3UT1A 4DA4A 4RTTA 2QQAA 4M77F 1OV3A 3QKJA 2KGTA 2LQNA 3JB9J 4UC4A 4JPBW 3S6WA 2AT1B 5KYUA 1BI2A 2E64A 2VGMA 2X9HA 2ATCB 1JRIA 1D0XA 1IO6A 3PNWC 4VUBA 1Q82R 3M4GA 2DO3A 3SWNA 2J7IA 1C0MA 2W0ZA 2DBMA 5GAMe 1B34B 2QEXT 1AD5A 2DVEA 3E1SA 2C0OA 2KEAA 3I56T 4ANJA 2JS0A 2MIOA 5FU6C 1KSWA 2X4JA 4OGCA 5KYNA 2LDMA 1K73C 4KT0E 2K3XA 3JCMc 2J6FA 4FYYB 5GAN7 4HVWA 2HZYA 2D9TA 4CC2A 4MZPA 2M9UA 5KYYB 2KSSA 5KYXB 5L23A 1VQ7Q 1BKBA 2R5MA 1X6BA 3QG1A 1UJ0A 2CUBA 1MUZA 2O88A 2F69A 2VUBA 2GTOA 1R77A 1HXDA 1ACMB 3CCJT 1M1KC 4M7DG 5FWBA 5GMKi 5FRMA 4FL6A 3NTHA 3GNFB 5D7UA 4XTZA 1BIBA 1Q81U 4BB7A 1OQKA 2BIVA 1B07A 3SHWA 4J9FA 2LJ3A 2KT1A 4M7DB 2CZ7B 3D7SB 4RMOA 1YI2Q 1MMGA 3AT1B 1KC8U 3JV3A 3QHSA 3M0PA 3TCJA 3P8HA 5J3BA 3WVDB 1YHQQ 2CP2A 3OYAA 5GAOr 1QQJA 3CPWS 4IUQA 3J81E 2VC8A 4JRQA 1VQ6Q 1OU8A 2CP0A 4N0AA 4ORZA 3MHXA 3CCQQ 5HY6A 4J7IA 2FPFA 1SKUB 2CT4A 1UE9A 1G2BA 3CCUA 1IREB 4XTYA 2L2PA 4KGVB 3REAB 1RAHB 1SF9A 1T3LA 3HRTA 3EHQA 3BDUA 1VYTA 4C92A 4M75C 4CI0C 3RIRA 4RTWA 2QEXQ 2QQRA 3RESA 3VUBA 2L0AA 2DM1A 4N4GA 4WF2A 4F04B 3C94A 2LX9A 4F7UA 2JZ2A 4RKUE 2LMJA 4PJOE 5IH2A 2RJFA 3VRZA 5FROA 3U23A 1GCPA 4M75F 1HK9A 2NYSA 1W2BS 5DM7R 1VQOQ 2OAUA 2OTJQ 1ARKA 3QYHB 1YWOA 2LQ8A 3ZEHA 1RI0A 2G3RA 5KYWA 1OX9A 2KYBA 4LN2A 3I35A 3CXCS 2QGGA 3A8MB 3CCRA 1PRMC 3CPWP 3LWHA 4MDXA 1WX6A 3VJPA 2DYBA 3HPWA 1V29B 2JMCA 1TSFA 1JJ2S 1ZSGA 3M58A 2HBWA 2CUDA 3OS5A 4FCYA 3RKXA 4D8DA 3MEAA 1VQPQ 2K79A 4ZN1A 3RKYA 1QW1A 1X6GA 4M78C 3GNGA 4QQ6A 3CPWA 3VYGA 4QT7A 1WHKA 5CR2A 1RAFB 1XTDA 4KGZB 4ZGEB 3BDLA 4YTLA 3EH2A 3CCSQ 1X27A 4BDYA 1HSQA 1TWBA 2DFUA 2FO0A 1FWZA 3NFCA 3H8ZA 2GQIA 2DZ9A 2YRVA 4QVCA 1VUBA 2YRDA 4M78F 1MMDA 3QYGB 2FVUA 5IHIA 1JO8A 3H0IA 4CC4B 5LJ5d 2RH2A 2BZYA 4A4KA 2DL5A 2NUPB 2QXFA 2LZ6B 5HKCA 5EC7A 3CCUT 2JTFA 2VVKA 2J6KA 3PTAA 3FC3A 4OVAA 1TXQA 2W10A 4R55A 1JXMA 3S3OA 4AFQC 1Y96A 3MEVA 1TH7A 4OB2B 4IURA 1NYFA 1JJ2P 2OTLQ 2BE7D 2P0QA 2YSQA 4M77G 1NZ9A 4XU1A 4PJOC 1BI3A 2RI2A 2KBTA 2CZ1B 4QQGA 2M16A 2LCLA 3P8BB 4J8OA 5DLOA 1VQNQ 1QWFA 1X6OA 4PJOD 2L3RA 2F2WA 4C0ZA 2F2XA 4E7HA 4M77B 3M56A 2E70A 2J06A 4FYWB 5GAMd 4J9CA 2FZGB 4M7AG 3EFOA 4ZN3A 3CCRT 1UECA 3FLGA 3RERA 4MZMA 3M55A 1K8AR 1K0XA 4HXJA 5CVIA 1OULA 2CS7A 2EYZA 1VQMQ 3THKA 5HCKA 2Y90A 5GAMj 4PJLA 4M7DE 1UG1A 3CD6T 2MF2A 4C8QC 2D1XA 4EMGA 3OYIA 2KT8A 1M1KR 4XK8E 2HL5C 4A4FA 3OYKA 4RUGA 4ELZC 2K6DA 5DY9A 3CCEA 1IHWA 1VQ4Q 3E9GA 3QWYA 2ECZA 5D6YA 3G6ET 4C8QF 4N4HA 4A4HA 3TSWA 1IB8A 2D0QB 2VASA 1GCQC 1ZA2B 1PC0A 3CC4Q 3CCMQ 3X20B 3PMIA 1LJOA 4FYXB 3FJ5A 3JB9F 3LGFA 4BE2A 1KD1C 4MMLA 3ME9A 4HCKA 1UJYA 3GBQA 2QAZA 2A7YA 1S72Q 1SHFA 1Y57A 2EQMA 4B9WA 2JUFA 4EDUA 4E7JA 2KI7A 1PKSA 2X4YA 2FPEA 2VXEA 2DE0X 4IUTA 5FRNA 1BB9A 3REBB 1BYMA 4DOVA 1RAAB 1Y71A 3I9QA 1GBQA 4EMHA 1WPYA 3OQ5A 3OY9A 1MHNA 1GBRA 3FIFA 1ZLMA 2DBKA 1ZA1B 5CKDA 2DKGA 2QK0A 4X9CA 2CYZB 2D8JA 5CKHA 2EQJA 1ZUKA 4XU2A 3ZBDA 3JRZA 2LNVA 1NLPC 2YXYA 2DXBA 4OMFB 1ZQ1A 4GLKA 1OPKA 2EIFA 2EKHA 1BI0A 1Q82U 1YCYA 2RO0A 4II1A 4DBFA 2WACA 1AT1B 3SWNC 1YJ9T 3CD6Q 1U8RA 2NLUA 1Q86U 1YITT 4M7DD 2KE9A 2CSIA 1WI7A 2YLCA 3OYEA 3EGDA 3CCET 4M75B 3VS3A 4FT2A 1TG0A 1YIJQ 1OYXA 2DERA 4BI8B 3V7RA 1AVZC 2DPPB 3G6EQ 1SRMA 2JW4A 2KR3A 4PJOA 3CC7Q 1BIAA 1DJ7B 1MNEA 4L59A 1GFCA 3VYHB 1VOMA 5J26A 1I8FA 4KULA 2NWMA 1VQ8Q 4F17A 2V8KA 3CMET 1W6XA 3OBYA 3J7AF 3QDFA 3I5SA 5GAOn 1SEMA 3H6ZA 2H3EB 2O01E 5CCAA 5GJVB 3VUZA 1D1CA 3X26B 4M78G 3OYJA 1WDXA 4C5GA 2JS2A 3S3NA 4OMQA 2DMOA 4CRIA 1AEYA 4P5NA 2ZPEB 1AWXA 1YJNT 2AKLA 3CEYA 5IN1A 4FW2A 2WSEE 4M77E 2RF0A 2YHTA 1FMWA 2QASA 3PMTA 3MEUA 1ZBXA 1RAIB 2H3JA 4M78B 1NM7A 3LGLA 1IXDA 2MOXA 4O6JA 2RHIA 1OZ3A 2O4XA 1N9SA 5GMKm 4J9HA 2A08A 5GMKl 3OYFA 4O5VA 1QCFA 2Y4YA 2M1HA 3GF5A 2DXCA 4Z8AA 2E65A 2RI3A 1FMVA 3OB9A 4AT1B 4N0AC 4M7AE 3TEEA 1N8RC 1AHJB 2CH4W 3QIIA 3CBPA 2CP7A 3A98A 1UFFA 2I2LA 3OS1A 3QDRB 4LNPA 3TU4K 3L42A 2RJEA 1WYXA 1B34A 1OI1A 2J6OA 2CSQA 5I22A 4F14A 3A8LB 2F5KA 4C92C 5A0GA 2EQUA 2VV5A 3JCMW 1H92A 1JEGA 3RMQA 2ZPHB 2EGCA 1D0ZA 1BCMA 3IQLA 2LTOA 2P84A 3R6NA 2X4WA 2OTJA 3M53A 2V26A 2RA2A 3I55Q 1ZX6A 2F2VA 2D8HA 1RI9A 4C92F 5LJ5e 3CMAA 1H8KA 5KYXA 5KYYA 3P8DA 1R0CB 5LJ5f 2DTHA 2DD4A 2EQIA 2X35A 2MI6A 1KFZA 5GAN5 4E2FB 3HRUA 4F7UF 3CMEQ 1G83A 4QVZA 3VS4A 3EG9B 3ULRB 4PJMA 2KK4A 1NPRA 2YLBA 4C5IA 1Z9QA 2PVDB 1PNJA 3L2VA 3JCMb 2EPDA 4MZTA 5GJWB 5FWCA 1KD1R 1J3TA 3L1AA 3CCSA 3OW2S 4ESRA 1QCNA 1OU9A 1M3AA 4M7DA 3OYLA 2D0NA 1NG2A 2PUOB 2ZPBB 1M5Q1 3G71A 3VS1A 4JJCA 4EMKB 1VQ5T 1K4US 3VU3C 1TU0B 3M0RA 5GAMf 2MAMA 2RI5A 1QKXA 2LX7A 4FSSA 2X51A 3L2WA 2QDYB 3HTRA 1ZSZB 3KUFA 4JLGA 2LCCA 2JXBA 1K0SA 4M7AD 1UB4A 2OTLA 3JSCA 2K5LA 3JCMQ 3EH1A 2DL4A 4LDYA 4KRTA 1M27C 2DXTA 5LL6S 1K1ZA 1V1CA 2RK1A 2RQTA 3KFVA 2EBPA 3L2RA 1VQLA 1Q81C 3SD4A 1D0YA 3HHTB 1VQNA 4C5HA 4XTWA 2PU9B 1IRXA 3OW2P 2DXUA 1HJDA 4J6WA 1UGSB 2DTOA 3MKDA 4D8KA 4OB3B 2ZGWA 2DJZA 1UTIA 2P0KA 4AFZC 1BI1A 3UDCA 4BUGA 2ZPFB 3M4YA 3TVTA 4JJDA 3X28B 4ZTJA 5DLQE 3QXEB 1VQMA 2IPOB 1K8AU 2JM9A 3OMCA 1CSKA 1YNZA 2H8HA 2GCXA 1VQ9A 1WJSA 3SB2A 2GFUA 3V8LA 2DAQA 3MP6A 3PGGA 2EVRA 1KQSS 2E6NA 2CP6A 2BTTA 4WTOB 2HSPA 2E12A 3CCLA 2IIMA 1F1BB 3RBBB 1NEGA 2DL8A 1M1KU 3UATA 4OMNA 1P92A 1M2VB 1AOJA 2CP3A 1M90R 3SWNB 1X69A 3JCMX 4M4ZA 1EIFA 4LDWA 1VQ5Q 3CCMA 4JUVA 2L3PA 2HKQB 2MMPA 1Q7YR 2HL3A 2SEMA 5A0DA 3LH5A 2KYMA 3URGA 3LH0A 3I56Q 4DBQA 2NUPA 3NPFA 2E1HA 2K5FA 1WXBA 4GBQA 3NTKA 4X34A 2JM8A 1RAGB 4LUDA 1LNXA 4JS4A 1D3BA 3A8HB 3SFMA 4DEXA 1SSHA 1N8RR 2EYYA 2DIGA 1D1AA 2XU8A 1IGUA 1VQLT
chains in the Genus database with same CATH topology
4ELZC 2EJ9A 5DY9A 2D6FA 1W4SA 2PVOB 2HNIA 2K5IA 3OBWA 3CCEA 4LD6A 4PNOA 2HQXA 3E9GA 2PVGB 3META 3GIBA 1M4ZA 2VXFA 4MMKA 3HP9A 3DB4A 1O9SA 5D6YA 3G6ET 1G3TA 5LJ5g 5CK9A 4C8QF 3QJYA 1KG1A 4N4HA 4A4HA 1QVGA 4JRKA 4EPCA 3V7CA 1M90C 2RM4A 4M77A 4RG2A 2E6ZA 3CCVA 2D0QB 2FHDA 5GAOp 4M75E 5IAYA 1KQSA 5KH6A 4M7AF 4Y91A 3X20B 2VGNA 1KHCA 1LJOA 3PMIA 5CQXA 1QVFS 2P0PA 2EWNA 1X75C 4ZGJB 4HCZA 1Q7YC 5LJ5h 3JB9F 2CZ0B 3LGFA 3L2QA 4BE2A 1KD1C 2EYQA 3QZ5B 5CIUA 4C8QA 1VQOT 4HCBA 1M9SA 3JCMJ 1NPPA 4MMLA 2OTJT 1QVPA 3ME9A 3FRNA 3RKWA 1VQ5A 5I21A 1K8AC 4LDXA 3GPLA 2A7YA 1KC8C 3TREA 4C0FA 4M7AA 2EQMA 2QQSA 2HD0A 2JUFA 4B9WA 2KMTA 4A4GA 4EDUA 3M57A 4XQ3A 3I56A 4E7JA 3CMAT 4J5YA 2X4YA 4XTXA 4C5EA 4L6V5 2Y4XA 2VXEA 1K73U 3FJPA 4IUTA 5FRNA 1BYMA 3E19A 2B8AA 1LOJA 1YIJA 2DK3A 3HKSA 4BY6B 4KUDK 4DOVA 1UGQB 1ZHIA 5KCHA 2RHZA 2RHUA 3OW2A 1Y71A 2JTMA 1XQHA 2X4XA 5GANe 5GAMg 3HRSA 4EMHA 1WPYA 2HQEA 3EFRA 1VQPT 5GANf 3OQ5A 3OY9A 1MHNA 2KDSA 3FIFA 3QUIA 3CC2A 5FU7B 1NJIU 2RHYA 3CC7A 2QA4A 2DEQA 2E10A 5CKDA 3RMSA 2DKGA 4X9CA 2HBPA 5J39A 5LJ5j 2CYZB 1W2BA 5IT9E 1Y07A 3BW1A 3E9FA 5CKHA 1KQ1A 2RB6A 4M78E 2EQJA 5HK3A 1VQ8A 3CCST 4F7UB 4QW2A 4XU2A 4IUPA 3QBYA 4FM4B 1M1FA 3JRZA 3LYIA 2LNVA 2ZZDA 3JCMV 3ZBDA 4E47A 2DXBA 4OMFB 2GQVA 5C6SA 4Z02A 5GAMh 1ZQ1A 4GLKA 3DLMA 2EIFA 5GAN3 3BY7A 1X01A 4MDWA 3CXCA 1VQKA 3T9NA 4RCBA 2R5AA 4DOWA 4ZTFA 3GOXA 4C92D 3CCJA 3G71T 1BI0A 3Q1JA 3X25B 4C0DB 1Q82U 4LD9K 1YCYA 4BDZA 2CZ6B 2C06A 2RO0A 1R8OB 4II1A 4NL2A 4XU3A 1JJ2A 1GXIE 2WACA 4QQDA 4JRPA 3QZ9B 2CKKA 3SWNC 1YJ9T 2VYTA 3LLRA 3CC4A 1N6AA 3INZA 2V8JA 1U8RA 2V8IA 2NLUA 1Q86U 4PJOF 1YITT 1H3ZA 4DQ2A 4M7DD 2EAYA 3LW5E 2K3YA 1VIFA 2RK2A 3UPUA 2YLCA 2FB7A 1K9MU 3OYEA 2JVVA 4X9DA 2QI2A 3VV0A 3CCET 1G5VA 3X24B 5I2SA 4M75B 3LX7A 1QVFA 3A5ZB 4OB1B 4FT2A 2ZCFB 4E7LA 1PSEA 5EG2A 4QVDA 2MWPA 1OYXA 1YHQT 3A8OB 4BE1A 4BI8B 3V7RA 2DPPB 2XIDA 3F70A 3A8GB 3OMGA 3OS2A 3QSUA 3HFNA 3MEWA 3OSVA 1S72A 2OTLT 4ME7A 3CCVT 1JB0E 5GAN2 3UT1A 2XICA 4DA4A 4PJOA 2XK0A 1BIAA 4J7FA 4JRIA 2QQAA 3JCMe 3HSBA 1DJ7B 4M77F 3QKJA 4L59A 3JCMf 5GAN8 3JB9J 2KAFA 4UC4A 2PUKB 3VYHB 3S6WA 5J26A 1I8FA 4M75D 4BD3A 3G7ZA 1BI2A 4KULA 4BI4A 2E64A 2EQKA 2KY9A 2V8KA 2VGMA 3CMET 1U1TA 1JRIA 3OBYA 4FU6A 4C0GA 1VQNT 3PNWC 4VUBA 4RCCA 3J7AF 3M4GA 2DO3A 3SWNA 3QPHA 3V7SA 1KHIA 4JJNK 5GAOn 3H6ZA 3OYNA 2O01E 5CCAA 3PFSA 5GAOm 3EFSA 3VUZA 3X26B 5GAMe 1B34B 2DZCA 3M5AA 4M78G 5GAOl 3OYJA 4Y28E 2DVEA 5FU6B 4C5GA 2IG0A 1YJWA 2FL7A 3E1SA 3S3NA 2EJGA 3G4SA 3DB3A 3I56T 1G3YA 4BI3A 4CRIA 4P5NA 2ZPEB 4PLLA 1YJNT 3LWIA 3CEYA 5IN1A 5FU6C 2WSEE 4M77E 2X4JA 3M9QA 4OGCA 5CO7A 4Q5WA 2YHTA 4PKCC 5A0LA 2LDMA 3MEUA 1ZBXA 3PMTA 3QO3A 2H3JA 4KT0E 4M78B 2K3XA 5CKEA 4B9XA 1VQMT 3MCAB 2KVQG 3LGLA 5GANd 1Y96B 3JCMc 3CC2T 1VQ9T 2LVMA 2R58A 4HKEA 5GAN7 4O6JA 3JAME 2RHIA 5GMKh 1OZ3A 2QA4T 2O4XA 4A4EA 2D9TA 3CD6A 4MZPA 4JDSA 4PLIA 3OYGA 2M9UA 1N9SA 2KSSA 5GMKm 4C8QE 4C92G 1YBYA 3ASKA 1BKBA 5GMKl 2R5MA 3OYFA 1QP2A 3CCLT 3QG1A 1N27A 4O5VA 1PSFA 2Y4YA 2M1HA 2RD1A 3GF5A 4J6XA 2F69A 2DXCA 1VQ4T 2L5QA 5LJ3e 2E65A 2VUBA 2RI3A 3OB9A 4N0AC 4A53A 4M7AE 4M78D 5LJ3f 4XU0A 1HXDA 3TEEA 4F7UG 3CCJT 1N8RC 1AHJB 3M59A 1M1KC 3QIIA 4M7DG 4OF1A 3G6EA 5GMKi 3CBPA 5FRMA 2XG8D 2I2LA 1N9RA 3OS1A 3WXMB 3QDRB 4C92B 4FL6A 3NTHA 3TU4K 3L42A 4BY6C 2RJEA 3GNFB 1VQ4A 1B34A 1OI1A 2ZPIB 1MGQA 4XTZA 3CC4T 3CCMT 2HAXA 1BIBA 3L2UA 1Q81U 3PIPA 4BB7A 4IKFA 3A8LB 1WJRA 2E41A 2BIVA 1XOVA 2F5KA 4C92C 5A0GA 5FU7C 2EQUA 1KD1U 2BUDA 2L8DA 4HT8A 1N8RU 3C12A 2VV5A 3FEOA 4PL6A 3JCMW 4M7DB 4KUIA 2EFIA 2CZ7B 1Q86C 2FYKA 4RMOA 4TVRA 4E7IA 3WVEB 2K4YA 1KC8U 5A2QE 3RMQA 2ZPHB 1QVGS 3OYCA 1K9MC 3QHSA 2LTOA 2L89A 4ATOA 2X4WA 3TCJA 4IUVA 3P8HA 5J3BA 3SDZA 3M53A 4M7DC 1D3BB 2OTJA 2RA2A 1XNIA 4M75G 4HA8A 3WVDB 1S72T 3OYAA 5GAOr 5GAN6 3CPWS 4IUQA 3J81E 2VC8A 4JRQA 4FT4A 4C92F 5LJ5e 3CMAA 3JCMP 1SSFA 4N0AA 3P8DA 5LJ5f 4C0DC 3JCMd 3MHXA 2DTHA 5HY6A 4J7IA 1WQWA 2DD4A 2X35A 2MI6A 5GAOq 1KQ2A 2RHXA 4L5GA 4NL3A 3PIOA 2EKOA 4ELYC 5GAN5 3HRUA 3OYBA 2R57A 4F7UF 1IREB 3CCUA 4XTYA 4QVZA 4M7DF 4E7KA 3DLLA 3PT9A 3NTIA 2KK4A 3R6OA 2DD5A 1NPRA 2YLBA 3HRTA 3QJ6A 4C5IA 3BDUA 2PVDB 5C0MA 2CGHA 3V8JA 2KQWA 4C92A 4M75C 4CI0C 3JCMb 5HK0A 3RIRA 3HFOA 4N4IA 3L2VA 1VQ7A 3G4ST 4MZTA 2QQRA 5D6WA 3RESA 4ZGDB 3VUBA 1RL2A 3L1AA 3CCSA 3OW2S 4N4GA 4WF2A 5GANg 2BKDN 3C94A 1G3SA 4IUUA 2LX9A 4F7UA 2JZ2A 4RKUE 4XTUA 4M7DA 3OYLA 4PJOE 2RJFA 1I5LA 2PUOB 5CKBA 3MP1A 2ZPBB 1M5Q1 3CPFA 3G71A 5FROA 4NOYA 2WSFE 4M75F 1HK9A 2QQ9A 1W2BS 5DM7R 4EMKB 1VQ5T 2DIQA 2IVWA 4M7AB 2RJCA 3VU3C 4OP0A 3GP8A 2OAUA 1YJ9A 3QYHB 3MP8A 2LQ8A 5GAMf 2MAMA 3ZEHA 1RI0A 5GANh 2G3RA 2QQBA 2RI5A 1YITA 4OB0B 4EMKC 3CXCS 3A8MB 3L2WA 3CCRA 2QDYB 3LWHA 4C8QD 1YI2A 4MDXA 3KUFA 5GAN4 3FDRA 4XAXB 5LJ3d 4JLGA 1YIJT 3VJPA 2LCCA 3EAEA 3HPWA 1V29B 4M75A 4RG8A 1JJ2S 4A54A 2JOYA 3M58A 3OS5A 3I55A 1YHQA 5I2MA 3DKMA 3RKXA 2EJFA 4M7AD 1VQ6A 1FX7A 1UB4A 3MEAA 4R56A 2XI9A 2OTLA 4J6YA 3JSCA 3S3MA 3CC7T 4ZN1A 2K5LA 3RKYA 1QW1A 3JCMQ 4D6WA 4M78C 2F5TX 2XDPA 3GNGA 2K57A 3RUXA 5KE3A 4QQ6A 3CPWA 3CCQA 3JB9D 3VYGA 2LT1A 4LDYA 5CR2A 2DTIA 2GF7A 1NJIC 2JNGA 1VQ8T 1XTDA 2PQWA 2DXTA 3FB9A 2LQKA 5LL6S 5LJ3j 3M54A 2RK1A 3BDLA 3ZFJA 1QP3A 4ZGEB 4YTLA 3L2RA 3CMEA 1Q81C 1VQLA 3SD4A 4BDYA 3HHTB 1IZ6A 5AYFA 1VQNA 2K2VA 1VQKT 3JB9H 4C5HA 5GANj 4FSXA 4XTWA 3O8VA 2QTXA 1M90U 1FWZA 2PU9B 2XD0A 1K73C 3NFCA 3H8ZA 4QVCA 2DZ9A 2DXUA 2YRVA 5CAIA 2P4TA 1UGRB 4J6WA 3JCMg 1UGSB 2DTOA 2MWOA 1VUBA 4OB3B 2ZGWA 2DJZA 4M78F 2QEXA 4EMKA 2P0KA 3OYDA 2XDDA 3VKIA 3QYGB 1UEBA 1Q82C 1BI1A 2FVUA 3OYMA 1WJQA 5LJ5d 3V8KA 2RH2A 3UDCA 1Q7YU 4A4KA 4PJOG 1Y7XA 3GLXA 4BUGA 5GMKj 1YJNA 2ZPFB 1WQ7A 1JBMA 2QXFA 3M4YA 5KE2A 3OS0A 1I4K1 5HKCA 4LDVA 3X28B 5L8RE 3CCUT 2JTFA 4ZTJA 4HCCA 5DLQE 3JCMh 1M8VA 1WGSA 3QXEB 3PTAA 3FC3A 1VQMA 4OVAA 1K8AU 4JLIA 5D6XA 3OMCA 1VQOA 2ZPGB 4KBMB 4BE0A 4J83A 2GCXA 4M78A 1WJSA 2M0OA 1VQ9A 3SB2A 1WNLA 4V2SA 4R55A 2GFUA 3V8LA 3S3OA 1Y96A 2DAQA 3MEVA 3MP6A 3PGGA 4PJOB 1VQ7T 1KQSS 1TH7A 1U1SA 2GFAA 2E6NA 4OB2B 4IURA 1OZ2A 4OGEA 2P0QA 3OSSC 2E12A 4M77G 1NZ9A 3CCLA 4NS5A 3CBMA 3JB9I 4XU1A 4BACA 1VIEA 1M1KU 1BI3A 2XDBA 4PJOC 3BFMA 2RI2A 3HL8A 1P92A 5GMKe 1M1GA 2A3LA 2JN0A 3SWNB 2CZ1B 3C95A 4QQGA 2M16A 3MO8A 2LCLA 2XHCA 1VQPA 3P8BB 4J8OA 5DLOA 3JCMX 2E5QA 1X6OA 4PJOD 2L3RA 1EIFA 4C0ZA 4E7HA 3N5BB 3M56A 4M77B 4C8QG 2E70A 4GY5A 5CKFA 4JS5A 4LDWA 1YJWT 2LRQA 3CCMA 5GAMd 4JUVA 2LC4A 5LJ3g 2MMPA 1NE8A 1O75A 3OYHA 5A0DA 3KBGA 4M7AG 4ZN3A 3J80E 3URGA 3LH0A 4M77C 3CCRT 1FXXA 1G3WA 2E1HA 2RJDA 4C92E 1YI2T 5CQYA 3OA6A 2QEXT 2AHJB 3FLGA 3RERA 1I81A 2K5FA 5M9OA 4HT9A 4MZMA 3M55A 4C8QB 3JB9G 1UGPB 2XKOC 5CVIA 3NTKA 3I55T 4X34A 2CS7A 3UWNA 4M77D 1VQ6T 2O4XB 3OYYA 5LJ3h 1LNXA 2Y90A 4F7UE 5GAMj 4JS4A 4M7DE 1D3BA 2WSCE 3AHUA 3CD6T 2MF2A 2LT4A 4C8QC 3A8HB 4FIBA 5FLXE 4EMGA 3CCQT 5KCOA 3SFMA 1H641 4LDUA 3OYIA 3C4SA 4XTVA 2DIGA 3L2ZA 4XK8E 2XU8A 3KXTA 4A4FA 3ER0A 1VQLT 3OYKA 4M7AC 3CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CS7 A;  3ZFJ A; 
#chains in the Genus database with same CATH topology
 1KQS P;  2D6F A;  3OBW A;  2K5I A;  4PNO A;  3SEM A;  1I5O B;  2AZV A;  3HP9 A;  1SPK A;  2FG0 A;  2QYZ A;  4PFP A;  5LJ5 g;  4J9D A;  5CK9 A;  3CCJ Q;  1EFN A;  1NEB A;  1KG1 A;  4M77 A;  4RG2 A;  3CCV A;  1WHH A;  4AFS C;  3EG0 A;  5IAY A;  1KQS A;  4PFZ A;  2VGN A;  5IXB A;  5CQX A;  1KIK A;  1RAE B;  1KK7 A;  4ZGJ B;  4HCZ A;  2AIR B;  5LJ5 h;  2AK5 A;  1QKW A;  2EYQ A;  3QZ5 B;  4HCB A;  1M9S A;  1NPP A;  1QVP A;  2DF6 A;  3FRN A;  5I21 A;  1I1J A;  1EZZ B;  4LDX A;  4C0F A;  4M7A A;  2HD0 A;  2KMT A;  1RAC B;  4XTX A;  2Y4X A;  1UUE A;  2DL7 A;  1W2B P;  1WIE A;  2B8A A;  3H41 A;  2PNI A;  1YIJ A;  1ZHI A;  3UA6 A;  2JTM A;  2X4X A;  5GAM g;  2HQE A;  3EFR A;  2ROT A;  2MYS A;  4E6R A;  3CXC P;  2V1Q A;  3CC2 A;  2RMO A;  2M0Y A;  2RHY A;  3CC7 A;  2QA4 A;  3MJX A;  5J39 A;  5LJ5 j;  1W2B A;  1E6G A;  1Y07 A;  1M2O A;  1VQ8 A;  2DNU A;  4F7U B;  4QW2 A;  4IUP A;  3QBY A;  4F16 A;  5GMK j;  1YWP A;  3JCM V;  5GAM h;  2GQV A;  1G8X A;  3CXC A;  1X01 A;  1VQK A;  2HEQ A;  1RUW A;  3T9N A;  2R5A A;  4LD9 K;  1R8O B;  3NMZ C;  1JJ2 A;  1AZE A;  4QQD A;  4JRP A;  3QZ9 B;  2V8J A;  2P4R A;  4PJO F;  1K73 R;  4DQ2 A;  2MPX C;  1VIF A;  3UPU A;  2FB7 A;  2NUT B;  1K9M U;  2JVV A;  2QI2 A;  3A5Z B;  2YDL A;  2RNA A;  2ZCF B;  2DEU A;  1RAB B;  5AT1 B;  3A8O B;  3F70 A;  3M0S A;  3OMG A;  3OS2 A;  3QSU A;  3HFN A;  3OSV A;  3CCV T;  3EG3 A;  5GAN 2;  1Q81 R;  2XIC A;  1NLO C;  2G6F X;  4JRI A;  2FPD A;  2YRC A;  2HKN A;  5GAN 8;  2PUK B;  2RQW A;  2DJQ A;  1M8M A;  4BI4 A;  1YP5 A;  1U1T A;  1AWO A;  4PFO A;  2ENM A;  2LQW A;  3QPH A;  1KHI A;  1B3Q A;  4HVV A;  3OYN A;  1PWT A;  2HQH A;  1YJW A;  4Y28 E;  5FU6 B;  2FL7 A;  2E3I A;  3G4S A;  1YFN A;  4PLL A;  2QGF B;  2BZ8 A;  4PKC C;  5A0L A;  5CKE A;  3CCU Q;  5GAN d;  1Y96 B;  3CC2 T;  1MMN A;  2LVM A;  2R58 A;  4HKE A;  3JAM E;  2QA4 T;  1JXO A;  4Y92 A;  4PLI A;  4JDS A;  5IHK A;  2RQV A;  1Y0M A;  1YBY A;  2JT4 A;  3E2U A;  1SG5 A;  1N27 A;  2A37 A;  1PSF A;  2RN8 A;  2RD1 A;  2DVJ A;  4J6X A;  2FZK B;  4JJB A;  2PTK A;  1W1F A;  2DRK A;  1D09 B;  4OF1 A;  2XG8 D;  2GGR A;  2HCK A;  2EGE A;  2ZPI B;  1MGQ A;  3PIP A;  4IKF A;  1WJR A;  2ED0 A;  1KD1 U;  2BUD A;  2L8D A;  4HT8 A;  3C12 A;  1UDL A;  2LCS A;  1SRL A;  4PL6 A;  2GNC A;  2L3S A;  2EFI A;  4KUI A;  3M0Q A;  3CCR Q;  2PZ1 A;  1Q86 C;  1FMK A;  2FYK A;  4TVR A;  3EHR A;  4E7I A;  3WVE B;  2K4Y A;  5A2Q E;  1QVG S;  3OYC A;  2O9S A;  4JZ4 A;  4M7D C;  1LVK A;  4HA8 A;  4M75 G;  5GAN 6;  3RR6 A;  1AWW A;  3PVQ A;  3JCM P;  1TUD A;  3EGX B;  3JCM d;  4C0D C;  1X2K A;  2GTJ A;  3PE0 A;  1WQW A;  4FW1 A;  5GAO q;  1KQ2 A;  1T0J A;  4L5G A;  1IHV A;  4NL3 A;  2EKO A;  4ELY C;  1PD0 A;  3OYB A;  4M7D F;  3DLL A;  3NTI A;  3R6O A;  1MMA A;  2YUP A;  5C0M A;  2CGH A;  3V8J A;  2YWW A;  1VQ7 A;  1VYU A;  3G4S T;  5D6W A;  4KGX B;  4IUU A;  1PHT A;  1U06 A;  1I5L A;  1TS9 A;  2A28 A;  2FEI A;  1X2Q A;  3CPF A;  4RTY A;  4NOY A;  2WSF E;  4PJJ A;  1H3H A;  2QQ9 A;  4RTZ A;  2DIQ A;  2IVW A;  3NHN A;  5I11 A;  4OP0 A;  4B6M A;  3GP8 A;  3MP8 A;  2L3Q A;  2QQB A;  1WA7 A;  1GL5 A;  4OB0 B;  6AT1 B;  4J9G A;  1YI2 A;  5GAN 4;  5LJ3 d;  1ZBJ A;  3EAE A;  1WXU A;  4RG8 A;  4A54 A;  1MND A;  4OMO A;  1PKT A;  3EG9 A;  5I2M A;  1YHQ A;  3DKM A;  2EJF A;  1VQ6 A;  2Z0W A;  1HYO A;  4A63 B;  4D6W A;  1S1N A;  3RUX A;  3CCQ A;  2K57 A;  2OAW A;  5KE3 A;  2EYW A;  2DTI A;  4OMP A;  2GF7 A;  2JNG A;  1NJI C;  1YN8 A;  2PQW A;  3FB9 A;  5LJ3 j;  2LQK A;  3M54 A;  1QP3 A;  2K2V A;  3JB9 H;  4FSX A;  1M90 U;  5CAI A;  2P4T A;  1UGR B;  2YUO A;  2MWO A;  2QEX A;  4EMK A;  3TQ7 P;  3VKI A;  1UEB A;  1Q7Y U;  1YJ9 Q;  4PJO G;  4K11 A;  4QKU A;  2JMA A;  3G1J A;  2VB6 A;  1JBM A;  1YIT Q;  2E3H A;  3OS0 A;  4LDV A;  5L8R E;  1U5S A;  1ZSZ A;  1M3B A;  1M8V A;  3CCE Q;  1WXT A;  3VS6 A;  4JLI A;  1VQO A;  2ZPG B;  1WZO A;  4BE0 A;  4J83 A;  3EG2 A;  2M0O A;  1WNL A;  4PJO B;  1VQ7 T;  3OSS C;  4NS5 A;  3CBM A;  4EIK A;  3JB9 I;  1T0H A;  3BFM A;  1EX4 A;  3HL8 A;  5GMK e;  1M1G A;  2A3L A;  2EW3 A;  3MO8 A;  1VQP A;  3N5B B;  5IHN A;  4C8Q G;  5CKF A;  2X3W D;  1RLQ C;  4AG2 C;  4DBR A;  2LC4 A;  1XJW B;  3OYH A;  1NBE B;  4M77 C;  2KXC A;  2HSE B;  1A0N B;  1YI2 T;  2E5K A;  3OA6 A;  1YJN Q;  5M9O A;  1JU5 C;  4C8Q B;  3JB9 G;  2X3X D;  4M77 D;  1VQ6 T;  2O4X B;  3OYY A;  2WSC E;  3AHU A;  3EG1 A;  2LT4 A;  4PJN A;  2QTV A;  3CCQ T;  5FLX E;  5KCO A;  2HDA A;  1H64 1;  4LDU A;  3C4S A;  4XTV A;  4M7A C;  2EJ9 A;  2HNI A;  4AMC A;  1M2V A;  2F1L A;  2HQX A;  2PVG B;  3MET A;  2VXF A;  4MMK A;  3DB4 A;  1G3T A;  2M02 A;  4JRK A;  5GAO p;  1Q86 R;  1SHG A;  4M75 E;  1OPL A;  4M7A F;  2CT3 A;  1KHC A;  1QVF S;  2COY A;  1I07 A;  2P0P A;  1QCO A;  1OOT A;  2EWN A;  2DLP A;  2ZAE A;  4J9E A;  4PK4 A;  3L2Q A;  1VQO T;  5CIU A;  1ABQ A;  2OTJ T;  2DX1 A;  1K8A C;  1KC8 C;  4J9B A;  3TRE A;  2GBQ A;  3CMA T;  3M57 A;  4XQ3 A;  2KNB B;  4E7S A;  4C5E A;  4L6V 5;  1N5Z A;  1V76 A;  4KH0 B;  1K73 U;  1PG5 B;  3E19 A;  1PRL C;  1LOJ A;  1IGQ A;  2DK3 A;  4WCI A;  4KUD K;  3OW2 A;  2RHU A;  3NGP A;  1W70 A;  1XQH A;  5GAN e;  3HRS A;  1VQP T;  3VS7 A;  5GAN f;  2KDS A;  1TUC A;  2EGA A;  2DL3 A;  3RMS A;  5IT9 E;  3BW1 A;  3E9F A;  1KQ1 A;  2RB6 A;  4M78 E;  3CCS T;  5KYU B;  4FM4 B;  1M1F A;  3LYI A;  1VQ4 A;  2ZZD A;  4Z02 A;  4OML A;  1D1B A;  1JQQ A;  2B86 A;  3BY7 A;  4MDW A;  5GAN 3;  4RCB A;  4ZTF A;  3GOX A;  1C6V X;  3G71 T;  3Q1J A;  3X25 B;  4C0D B;  1QVF P;  1ABO A;  2CZ6 B;  2ED1 A;  4NL2 A;  4XU3 A;  1HD3 A;  2A36 A;  2CKK A;  3CC4 A;  3LLR A;  2RPN A;  2EAY A;  3LW5 E;  1UGV A;  1BCO A;  1WHJ A;  2RK2 A;  2KRN A;  2M51 A;  3RNJ A;  2FRW A;  2COZ A;  4X9D A;  1UHF A;  3X24 B;  1QVF A;  1QLY A;  1VA7 A;  4OB1 B;  1GFD A;  1PSE A;  4KH1 B;  4QVD A;  2MWP A;  2E4H A;  2O2O A;  4BE1 A;  1NJI R;  2XID A;  3A8G B;  3MEW A;  1S72 A;  2OTL T;  2MCN A;  4E7Z A;  2XK0 A;  4J7F A;  3JCM e;  3HSB A;  1LCK A;  3JCM f;  2KAF A;  4M75 D;  4BD3 A;  3G7Z A;  2KY9 A;  2EQK A;  4DEY A;  1VQN T;  4C0G A;  4FU6 A;  3ZL7 C;  4RCC A;  2DET A;  8ATC B;  3V7S A;  4JJN K;  1QMC A;  3PFS A;  1E6H A;  5GAO m;  3EFS A;  2DZC A;  3M5A A;  5GAO l;  2IG0 A;  1NYG A;  2EJG A;  3DB3 A;  1G3Y A;  1CKB A;  4BI3 A;  2NUZ A;  3CMA Q;  4IIO A;  3LWI A;  2QDL A;  1GRI A;  9ATC B;  2NUT A;  4CC3 A;  3M9Q A;  5CO7 A;  4Q5W A;  1UHC A;  2LP5 A;  3QO3 A;  1VQM T;  4B9X A;  3MCA B;  2CRE A;  2KVQ G;  4LE9 A;  1VQ9 T;  5ECA A;  4GLM A;  5GMK h;  2LJ1 A;  3M0U A;  1Q95 G;  4A4E A;  3CD6 A;  3OYG A;  2V1R A;  1OX8 A;  1ZUU A;  4C8Q E;  4C92 G;  3ASK A;  3CCL T;  1QP2 A;  4LUE A;  1VQ4 T;  2L5Q A;  5LJ3 e;  4A53 A;  4M78 D;  5LJ3 f;  4XU0 A;  4F7U G;  3M59 A;  1YCS B;  3G6E A;  1N9R A;  1U3O A;  3WXM B;  5IXF A;  4C92 B;  3G71 Q;  1M30 A;  4BY6 C;  1PM3 A;  2YUQ A;  2VKN A;  3CC4 T;  3CCM T;  2HAX A;  3L2U A;  2YUN A;  1TUG B;  2E41 A;  1XOV A;  5FU7 C;  1QWE A;  3A1P A;  8AT1 B;  3FEO A;  1R0B G;  4ATO A;  1I0C A;  1K9M C;  2L89 A;  4IUV A;  3SDZ A;  4LXC A;  1D3B B;  1S72 T;  1XNI A;  4FT4 A;  5KYW B;  1SSF A;  3H0F A;  4HVU A;  2VWF A;  1MV0 B;  2RHX A;  3PIO A;  1VQL Q;  2R57 A;  4E7K A;  1LPL A;  3PT9 A;  2DD5 A;  3QJ6 A;  2FRY A;  2KQW A;  2KRM A;  2OI3 A;  3C0C A;  3VS0 A;  5HK0 A;  3HFO A;  4N4I A;  1FYN A;  4ZGD B;  2XMF A;  1K76 A;  1RL2 A;  3I5R A;  1KJW A;  5GAN g;  2BKD N;  1BU1 A;  1T3S A;  1G3S A;  1C1A A;  4XTU A;  1KC8 R;  5CKB A;  1TTH B;  3MP1 A;  2EYX A;  2LNH B;  4IIM A;  2JTE A;  4M7A B;  1VQ9 Q;  2RJC A;  1YJ9 A;  1WHG A;  5GAN h;  1YIT A;  3EGX A;  4EMK C;  4DBH A;  2CDT A;  3CCL Q;  4RTV A;  1K9A A;  4C8Q D;  5FW9 A;  1YIJ T;  3FDR A;  4XAX B;  4M75 A;  2JOY A;  1RAD B;  3I55 A;  1B7T A;  1FX7 A;  1ZSZ C;  4R56 A;  2XI9 A;  4J6Y A;  4X1V A;  3S3M A;  3CC7 T;  3BE3 A;  1AZG B;  3VS5 A;  2DA9 A;  2O9V A;  2F5T X;  2XDP A;  3UF4 A;  3JB9 D;  2LT1 A;  2LJ0 A;  1M3C A;  1VQ8 T;  2KXD A;  3ZFJ A;  2RQU A;  3CME A;  2JJ9 A;  2DIL A;  1ZUY A;  1IZ6 A;  5AYF A;  1VQK T;  5GAN j;  3O8V A;  2QTX A;  2XD0 A;  3JCM g;  3QWX X;  2K9G A;  1OEB A;  2ABL A;  2YT6 A;  4R0K A;  3OYD A;  2XDD A;  1Q82 C;  3OYM A;  3VS2 A;  1WJQ A;  3V8K A;  3EFO B;  1Y7X A;  3GLX A;  1VYV A;  1YJN A;  3RDV A;  1WQ7 A;  5KE2 A;  2DRM A;  1I4K 1;  4HCC A;  3JCM h;  1WGS A;  5D6X A;  4KBM B;  3EGU A;  4M78 A;  2OX7 A;  4V2S A;  1U1S A;  2GFA A;  1OZ2 A;  3CCV Q;  4OGE A;  2CH4 A;  1CKA A;  4BAC A;  1VIE A;  2XDB A;  4ZNX A;  1PD1 A;  3H0H A;  2BZX A;  2JN0 A;  3C95 A;  2XHC A;  2ESW A;  2E5Q A;  2MK5 A;  4JS5 A;  4GY5 A;  1YJW T;  1WHM A;  2QG9 B;  2LRQ A;  5LJ3 g;  1NE8 A;  1O75 A;  2KRS A;  3KBG A;  3J80 E;  1FXX A;  1G3W A;  2RJD A;  4C92 E;  3PVL A;  5CQY A;  2SRC A;  2AHJ B;  4HT9 A;  1I81 A;  1UGP B;  2XKO C;  3I55 T;  1WFW A;  2DYI A;  3UWN A;  4RTX A;  2C0T A;  2COW A;  5LJ3 h;  4F7U E;  2FZC B;  3CC2 Q;  7AT1 B;  2QA4 Q;  4FIB A;  1QVG P;  3L2Z A;  3KXT A;  3ER0 A;  3CBO A;  2K3B A;  1W4S A;  2PVO B;  4LD6 A;  2CP5 A;  3GIB A;  1M4Z A;  2J05 A;  2I0N A;  1VQK Q;  1O9S A;  4Z89 A;  2OJ2 A;  3QJY A;  1WHL A;  2AKK A;  1QVG A;  4EPC A;  3V7C A;  1M90 C;  2RM4 A;  2E6Z A;  2FHD A;  4AFU C;  1BK2 A;  5KH6 A;  3MPU B;  1BBZ A;  4Y91 A;  1K9M R;  2BE9 B;  1PCX A;  1X75 C;  2HMA A;  1Q7Y C;  2CZ0 B;  4FYV B;  2KRO A;  4C8Q A;  3JCM J;  3RKW A;  1VQ5 A;  4AG1 C;  2ROL A;  3TSZ A;  2QQS A;  3GPL A;  3CQT A;  4A4G A;  3I56 A;  4J5Y A;  3VRY A;  3FJP A;  3EGD B;  3M0T A;  3HKS A;  4BY6 B;  5KCH A;  1UGQ B;  2RHZ A;  1WLP B;  3QUI A;  1GCQ A;  4RTU A;  5FU7 B;  2AZS A;  1NJI U;  2DEQ A;  2E10 A;  3H9N A;  2HBP A;  2K2M A;  1YJW Q;  1E7O A;  5HK3 A;  3G4S Q;  4CC7 A;  1N8R U;  3UA7 A;  5C6S A;  4E47 A;  3DLM A;  4DOW A;  1RLP C;  4C92 D;  3CCJ A;  4BDZ A;  2C06 A;  4OMM A;  4J9I A;  1GXI E;  2VYT A;  1N6A A;  3INZ A;  2V8I A;  3O5Z A;  1H3Z A;  1Z9Z A;  2K3Y A;  1TOV A;  2C0I A;  1G5V A;  3VV0 A;  2K7A A;  5I2S A;  3LX7 A;  4E7L A;  5EG2 A;  2A0F B;  1X43 A;  1YHQ T;  1AWJ A;  2O31 A;  4JZ3 A;  4ME7 A;  1MV3 A;  1JB0 E;  4Z88 A;  2RQR A;  3UT1 A;  4DA4 A;  4RTT A;  2QQA A;  4M77 F;  1OV3 A;  3QKJ A;  2KGT A;  2LQN A;  3JB9 J;  4UC4 A;  4JPB W;  3S6W A;  2AT1 B;  5KYU A;  1BI2 A;  2E64 A;  2VGM A;  2X9H A;  2ATC B;  1JRI A;  1D0X A;  1IO6 A;  3PNW C;  4VUB A;  1Q82 R;  3M4G A;  2DO3 A;  3SWN A;  2J7I A;  1C0M A;  2W0Z A;  2DBM A;  5GAM e;  1B34 B;  2QEX T;  1AD5 A;  2DVE A;  3E1S A;  2C0O A;  2KEA A;  3I56 T;  4ANJ A;  2JS0 A;  2MIO A;  5FU6 C;  1KSW A;  2X4J A;  4OGC A;  5KYN A;  2LDM A;  1K73 C;  4KT0 E;  2K3X A;  3JCM c;  2J6F A;  4FYY B;  5GAN 7;  4HVW A;  2HZY A;  2D9T A;  4CC2 A;  4MZP A;  2M9U A;  5KYY B;  2KSS A;  5KYX B;  5L23 A;  1VQ7 Q;  1BKB A;  2R5M A;  1X6B A;  3QG1 A;  1UJ0 A;  2CUB A;  1MUZ A;  2O88 A;  2F69 A;  2VUB A;  2GTO A;  1R77 A;  1HXD A;  1ACM B;  3CCJ T;  1M1K C;  4M7D G;  5FWB A;  5GMK i;  5FRM A;  4FL6 A;  3NTH A;  3GNF B;  5D7U A;  4XTZ A;  1BIB A;  1Q81 U;  4BB7 A;  1OQK A;  2BIV A;  1B07 A;  3SHW A;  4J9F A;  2LJ3 A;  2KT1 A;  4M7D B;  2CZ7 B;  3D7S B;  4RMO A;  1YI2 Q;  1MMG A;  3AT1 B;  1KC8 U;  3JV3 A;  3QHS A;  3M0P A;  3TCJ A;  3P8H A;  5J3B A;  3WVD B;  1YHQ Q;  2CP2 A;  3OYA A;  5GAO r;  1QQJ A;  3CPW S;  4IUQ A;  3J81 E;  2VC8 A;  4JRQ A;  1VQ6 Q;  1OU8 A;  2CP0 A;  4N0A A;  4ORZ A;  3MHX A;  3CCQ Q;  5HY6 A;  4J7I A;  2FPF A;  1SKU B;  2CT4 A;  1UE9 A;  1G2B A;  3CCU A;  1IRE B;  4XTY A;  2L2P A;  4KGV B;  3REA B;  1RAH B;  1SF9 A;  1T3L A;  3HRT A;  3EHQ A;  3BDU A;  1VYT A;  4C92 A;  4M75 C;  4CI0 C;  3RIR A;  4RTW A;  2QEX Q;  2QQR A;  3RES A;  3VUB A;  2L0A A;  2DM1 A;  4N4G A;  4WF2 A;  4F04 B;  3C94 A;  2LX9 A;  4F7U A;  2JZ2 A;  4RKU E;  2LMJ A;  4PJO E;  5IH2 A;  2RJF A;  3VRZ A;  5FRO A;  3U23 A;  1GCP A;  4M75 F;  1HK9 A;  2NYS A;  1W2B S;  5DM7 R;  1VQO Q;  2OAU A;  2OTJ Q;  1ARK A;  3QYH B;  1YWO A;  2LQ8 A;  3ZEH A;  1RI0 A;  2G3R A;  5KYW A;  1OX9 A;  2KYB A;  4LN2 A;  3I35 A;  3CXC S;  2QGG A;  3A8M B;  3CCR A;  1PRM C;  3CPW P;  3LWH A;  4MDX A;  1WX6 A;  3VJP A;  2DYB A;  3HPW A;  1V29 B;  2JMC A;  1TSF A;  1JJ2 S;  1ZSG A;  3M58 A;  2HBW A;  2CUD A;  3OS5 A;  4FCY A;  3RKX A;  4D8D A;  3MEA A;  1VQP Q;  2K79 A;  4ZN1 A;  3RKY A;  1QW1 A;  1X6G A;  4M78 C;  3GNG A;  4QQ6 A;  3CPW A;  3VYG A;  4QT7 A;  1WHK A;  5CR2 A;  1RAF B;  1XTD A;  4KGZ B;  4ZGE B;  3BDL A;  4YTL A;  3EH2 A;  3CCS Q;  1X27 A;  4BDY A;  1HSQ A;  1TWB A;  2DFU A;  2FO0 A;  1FWZ A;  3NFC A;  3H8Z A;  2GQI A;  2DZ9 A;  2YRV A;  4QVC A;  1VUB A;  2YRD A;  4M78 F;  1MMD A;  3QYG B;  2FVU A;  5IHI A;  1JO8 A;  3H0I A;  4CC4 B;  5LJ5 d;  2RH2 A;  2BZY A;  4A4K A;  2DL5 A;  2NUP B;  2QXF A;  2LZ6 B;  5HKC A;  5EC7 A;  3CCU T;  2JTF A;  2VVK A;  2J6K A;  3PTA A;  3FC3 A;  4OVA A;  1TXQ A;  2W10 A;  4R55 A;  1JXM A;  3S3O A;  4AFQ C;  1Y96 A;  3MEV A;  1TH7 A;  4OB2 B;  4IUR A;  1NYF A;  1JJ2 P;  2OTL Q;  2BE7 D;  2P0Q A;  2YSQ A;  4M77 G;  1NZ9 A;  4XU1 A;  4PJO C;  1BI3 A;  2RI2 A;  2KBT A;  2CZ1 B;  4QQG A;  2M16 A;  2LCL A;  3P8B B;  4J8O A;  5DLO A;  1VQN Q;  1QWF A;  1X6O A;  4PJO D;  2L3R A;  2F2W A;  4C0Z A;  2F2X A;  4E7H A;  4M77 B;  3M56 A;  2E70 A;  2J06 A;  4FYW B;  5GAM d;  4J9C A;  2FZG B;  4M7A G;  3EFO A;  4ZN3 A;  3CCR T;  1UEC A;  3FLG A;  3RER A;  4MZM A;  3M55 A;  1K8A R;  1K0X A;  4HXJ A;  5CVI A;  1OUL A;  2CS7 A;  2EYZ A;  1VQM Q;  3THK A;  5HCK A;  2Y90 A;  5GAM j;  4PJL A;  4M7D E;  1UG1 A;  3CD6 T;  2MF2 A;  4C8Q C;  2D1X A;  4EMG A;  3OYI A;  2KT8 A;  1M1K R;  4XK8 E;  2HL5 C;  4A4F A;  3OYK A;  4RUG A;  4ELZ C;  2K6D A;  5DY9 A;  3CCE A;  1IHW A;  1VQ4 Q;  3E9G A;  3QWY A;  2ECZ A;  5D6Y A;  3G6E T;  4C8Q F;  4N4H A;  4A4H A;  3TSW A;  1IB8 A;  2D0Q B;  2VAS A;  1GCQ C;  1ZA2 B;  1PC0 A;  3CC4 Q;  3CCM Q;  3X20 B;  3PMI A;  1LJO A;  4FYX B;  3FJ5 A;  3JB9 F;  3LGF A;  4BE2 A;  1KD1 C;  4MML A;  3ME9 A;  4HCK A;  1UJY A;  3GBQ A;  2QAZ A;  2A7Y A;  1S72 Q;  1SHF A;  1Y57 A;  2EQM A;  4B9W A;  2JUF A;  4EDU A;  4E7J A;  2KI7 A;  1PKS A;  2X4Y A;  2FPE A;  2VXE A;  2DE0 X;  4IUT A;  5FRN A;  1BB9 A;  3REB B;  1BYM A;  4DOV A;  1RAA B;  1Y71 A;  3I9Q A;  1GBQ A;  4EMH A;  1WPY A;  3OQ5 A;  3OY9 A;  1MHN A;  1GBR A;  3FIF A;  1ZLM A;  2DBK A;  1ZA1 B;  5CKD A;  2DKG A;  2QK0 A;  4X9C A;  2CYZ B;  2D8J A;  5CKH A;  2EQJ A;  1ZUK A;  4XU2 A;  3ZBD A;  3JRZ A;  2LNV A;  1NLP C;  2YXY A;  2DXB A;  4OMF B;  1ZQ1 A;  4GLK A;  1OPK A;  2EIF A;  2EKH A;  1BI0 A;  1Q82 U;  1YCY A;  2RO0 A;  4II1 A;  4DBF A;  2WAC A;  1AT1 B;  3SWN C;  1YJ9 T;  3CD6 Q;  1U8R A;  2NLU A;  1Q86 U;  1YIT T;  4M7D D;  2KE9 A;  2CSI A;  1WI7 A;  2YLC A;  3OYE A;  3EGD A;  3CCE T;  4M75 B;  3VS3 A;  4FT2 A;  1TG0 A;  1YIJ Q;  1OYX A;  2DER A;  4BI8 B;  3V7R A;  1AVZ C;  2DPP B;  3G6E Q;  1SRM A;  2JW4 A;  2KR3 A;  4PJO A;  3CC7 Q;  1BIA A;  1DJ7 B;  1MNE A;  4L59 A;  1GFC A;  3VYH B;  1VOM A;  5J26 A;  1I8F A;  4KUL A;  2NWM A;  1VQ8 Q;  4F17 A;  2V8K A;  3CME T;  1W6X A;  3OBY A;  3J7A F;  3QDF A;  3I5S A;  5GAO n;  1SEM A;  3H6Z A;  2H3E B;  2O01 E;  5CCA A;  5GJV B;  3VUZ A;  1D1C A;  3X26 B;  4M78 G;  3OYJ A;  1WDX A;  4C5G A;  2JS2 A;  3S3N A;  4OMQ A;  2DMO A;  4CRI A;  1AEY A;  4P5N A;  2ZPE B;  1AWX A;  1YJN T;  2AKL A;  3CEY A;  5IN1 A;  4FW2 A;  2WSE E;  4M77 E;  2RF0 A;  2YHT A;  1FMW A;  2QAS A;  3PMT A;  3MEU A;  1ZBX A;  1RAI B;  2H3J A;  4M78 B;  1NM7 A;  3LGL A;  1IXD A;  2MOX A;  4O6J A;  2RHI A;  1OZ3 A;  2O4X A;  1N9S A;  5GMK m;  4J9H A;  2A08 A;  5GMK l;  3OYF A;  4O5V A;  1QCF A;  2Y4Y A;  2M1H A;  3GF5 A;  2DXC A;  4Z8A A;  2E65 A;  2RI3 A;  1FMV A;  3OB9 A;  4AT1 B;  4N0A C;  4M7A E;  3TEE A;  1N8R C;  1AHJ B;  2CH4 W;  3QII A;  3CBP A;  2CP7 A;  3A98 A;  1UFF A;  2I2L A;  3OS1 A;  3QDR B;  4LNP A;  3TU4 K;  3L42 A;  2RJE A;  1WYX A;  1B34 A;  1OI1 A;  2J6O A;  2CSQ A;  5I22 A;  4F14 A;  3A8L B;  2F5K A;  4C92 C;  5A0G A;  2EQU A;  2VV5 A;  3JCM W;  1H92 A;  1JEG A;  3RMQ A;  2ZPH B;  2EGC A;  1D0Z A;  1BCM A;  3IQL A;  2LTO A;  2P84 A;  3R6N A;  2X4W A;  2OTJ A;  3M53 A;  2V26 A;  2RA2 A;  3I55 Q;  1ZX6 A;  2F2V A;  2D8H A;  1RI9 A;  4C92 F;  5LJ5 e;  3CMA A;  1H8K A;  5KYX A;  5KYY A;  3P8D A;  1R0C B;  5LJ5 f;  2DTH A;  2DD4 A;  2EQI A;  2X35 A;  2MI6 A;  1KFZ A;  5GAN 5;  4E2F B;  3HRU A;  4F7U F;  3CME Q;  1G83 A;  4QVZ A;  3VS4 A;  3EG9 B;  3ULR B;  4PJM A;  2KK4 A;  1NPR A;  2YLB A;  4C5I A;  1Z9Q A;  2PVD B;  1PNJ A;  3L2V A;  3JCM b;  2EPD A;  4MZT A;  5GJW B;  5FWC A;  1KD1 R;  1J3T A;  3L1A A;  3CCS A;  3OW2 S;  4ESR A;  1QCN A;  1OU9 A;  1M3A A;  4M7D A;  3OYL A;  2D0N A;  1NG2 A;  2PUO B;  2ZPB B;  1M5Q 1;  3G71 A;  3VS1 A;  4JJC A;  4EMK B;  1VQ5 T;  1K4U S;  3VU3 C;  1TU0 B;  3M0R A;  5GAM f;  2MAM A;  2RI5 A;  1QKX A;  2LX7 A;  4FSS A;  2X51 A;  3L2W A;  2QDY B;  3HTR A;  1ZSZ B;  3KUF A;  4JLG A;  2LCC A;  2JXB A;  1K0S A;  4M7A D;  1UB4 A;  2OTL A;  3JSC A;  2K5L A;  3JCM Q;  3EH1 A;  2DL4 A;  4LDY A;  4KRT A;  1M27 C;  2DXT A;  5LL6 S;  1K1Z A;  1V1C A;  2RK1 A;  2RQT A;  3KFV A;  2EBP A;  3L2R A;  1VQL A;  1Q81 C;  3SD4 A;  1D0Y A;  3HHT B;  1VQN A;  4C5H A;  4XTW A;  2PU9 B;  1IRX A;  3OW2 P;  2DXU A;  1HJD A;  4J6W A;  1UGS B;  2DTO A;  3MKD A;  4D8K A;  4OB3 B;  2ZGW A;  2DJZ A;  1UTI A;  2P0K A;  4AFZ C;  1BI1 A;  3UDC A;  4BUG A;  2ZPF B;  3M4Y A;  3TVT A;  4JJD A;  3X28 B;  4ZTJ A;  5DLQ E;  3QXE B;  1VQM A;  2IPO B;  1K8A U;  2JM9 A;  3OMC A;  1CSK A;  1YNZ A;  2H8H A;  2GCX A;  1VQ9 A;  1WJS A;  3SB2 A;  2GFU A;  3V8L A;  2DAQ A;  3MP6 A;  3PGG A;  2EVR A;  1KQS S;  2E6N A;  2CP6 A;  2BTT A;  4WTO B;  2HSP A;  2E12 A;  3CCL A;  2IIM A;  1F1B B;  3RBB B;  1NEG A;  2DL8 A;  1M1K U;  3UAT A;  4OMN A;  1P92 A;  1M2V B;  1AOJ A;  2CP3 A;  1M90 R;  3SWN B;  1X69 A;  3JCM X;  4M4Z A;  1EIF A;  4LDW A;  1VQ5 Q;  3CCM A;  4JUV A;  2L3P A;  2HKQ B;  2MMP A;  1Q7Y R;  2HL3 A;  2SEM A;  5A0D A;  3LH5 A;  2KYM A;  3URG A;  3LH0 A;  3I56 Q;  4DBQ A;  2NUP A;  3NPF A;  2E1H A;  2K5F A;  1WXB A;  4GBQ A;  3NTK A;  4X34 A;  2JM8 A;  1RAG B;  4LUD A;  1LNX A;  4JS4 A;  1D3B A;  3A8H B;  3SFM A;  4DEX A;  1SSH A;  1N8R R;  2EYY A;  2DIG A;  1D1A A;  2XU8 A;  1IGU A;  1VQL T; 
#chains in the Genus database with same CATH homology
 4ELZ C;  2EJ9 A;  5DY9 A;  2D6F A;  1W4S A;  2PVO B;  2HNI A;  2K5I A;  3OBW A;  3CCE A;  4LD6 A;  4PNO A;  2HQX A;  3E9G A;  2PVG B;  3MET A;  3GIB A;  1M4Z A;  2VXF A;  4MMK A;  3HP9 A;  3DB4 A;  1O9S A;  5D6Y A;  3G6E T;  1G3T A;  5LJ5 g;  5CK9 A;  4C8Q F;  3QJY A;  1KG1 A;  4N4H A;  4A4H A;  1QVG A;  4JRK A;  4EPC A;  3V7C A;  1M90 C;  2RM4 A;  4M77 A;  4RG2 A;  2E6Z A;  3CCV A;  2D0Q B;  2FHD A;  5GAO p;  4M75 E;  5IAY A;  1KQS A;  5KH6 A;  4M7A F;  4Y91 A;  3X20 B;  2VGN A;  1KHC A;  1LJO A;  3PMI A;  5CQX A;  1QVF S;  2P0P A;  2EWN A;  1X75 C;  4ZGJ B;  4HCZ A;  1Q7Y C;  5LJ5 h;  3JB9 F;  2CZ0 B;  3LGF A;  3L2Q A;  4BE2 A;  1KD1 C;  2EYQ A;  3QZ5 B;  5CIU A;  4C8Q A;  1VQO T;  4HCB A;  1M9S A;  3JCM J;  1NPP A;  4MML A;  2OTJ T;  1QVP A;  3ME9 A;  3FRN A;  3RKW A;  1VQ5 A;  5I21 A;  1K8A C;  4LDX A;  3GPL A;  2A7Y A;  1KC8 C;  3TRE A;  4C0F A;  4M7A A;  2EQM A;  2QQS A;  2HD0 A;  2JUF A;  4B9W A;  2KMT A;  4A4G A;  4EDU A;  3M57 A;  4XQ3 A;  3I56 A;  4E7J A;  3CMA T;  4J5Y A;  2X4Y A;  4XTX A;  4C5E A;  4L6V 5;  2Y4X A;  2VXE A;  1K73 U;  3FJP A;  4IUT A;  5FRN A;  1BYM A;  3E19 A;  2B8A A;  1LOJ A;  1YIJ A;  2DK3 A;  3HKS A;  4BY6 B;  4KUD K;  4DOV A;  1UGQ B;  1ZHI A;  5KCH A;  2RHZ A;  2RHU A;  3OW2 A;  1Y71 A;  2JTM A;  1XQH A;  2X4X A;  5GAN e;  5GAM g;  3HRS A;  4EMH A;  1WPY A;  2HQE A;  3EFR A;  1VQP T;  5GAN f;  3OQ5 A;  3OY9 A;  1MHN A;  2KDS A;  3FIF A;  3QUI A;  3CC2 A;  5FU7 B;  1NJI U;  2RHY A;  3CC7 A;  2QA4 A;  2DEQ A;  2E10 A;  5CKD A;  3RMS A;  2DKG A;  4X9C A;  2HBP A;  5J39 A;  5LJ5 j;  2CYZ B;  1W2B A;  5IT9 E;  1Y07 A;  3BW1 A;  3E9F A;  5CKH A;  1KQ1 A;  2RB6 A;  4M78 E;  2EQJ A;  5HK3 A;  1VQ8 A;  3CCS T;  4F7U B;  4QW2 A;  4XU2 A;  4IUP A;  3QBY A;  4FM4 B;  1M1F A;  3JRZ A;  3LYI A;  2LNV A;  2ZZD A;  3JCM V;  3ZBD A;  4E47 A;  2DXB A;  4OMF B;  2GQV A;  5C6S A;  4Z02 A;  5GAM h;  1ZQ1 A;  4GLK A;  3DLM A;  2EIF A;  5GAN 3;  3BY7 A;  1X01 A;  4MDW A;  3CXC A;  1VQK A;  3T9N A;  4RCB A;  2R5A A;  4DOW A;  4ZTF A;  3GOX A;  4C92 D;  3CCJ A;  3G71 T;  1BI0 A;  3Q1J A;  3X25 B;  4C0D B;  1Q82 U;  4LD9 K;  1YCY A;  4BDZ A;  2CZ6 B;  2C06 A;  2RO0 A;  1R8O B;  4II1 A;  4NL2 A;  4XU3 A;  1JJ2 A;  1GXI E;  2WAC A;  4QQD A;  4JRP A;  3QZ9 B;  2CKK A;  3SWN C;  1YJ9 T;  2VYT A;  3LLR A;  3CC4 A;  1N6A A;  3INZ A;  2V8J A;  1U8R A;  2V8I A;  2NLU A;  1Q86 U;  4PJO F;  1YIT T;  1H3Z A;  4DQ2 A;  4M7D D;  2EAY A;  3LW5 E;  2K3Y A;  1VIF A;  2RK2 A;  3UPU A;  2YLC A;  2FB7 A;  1K9M U;  3OYE A;  2JVV A;  4X9D A;  2QI2 A;  3VV0 A;  3CCE T;  1G5V A;  3X24 B;  5I2S A;  4M75 B;  3LX7 A;  1QVF A;  3A5Z B;  4OB1 B;  4FT2 A;  2ZCF B;  4E7L A;  1PSE A;  5EG2 A;  4QVD A;  2MWP A;  1OYX A;  1YHQ T;  3A8O B;  4BE1 A;  4BI8 B;  3V7R A;  2DPP B;  2XID A;  3F70 A;  3A8G B;  3OMG A;  3OS2 A;  3QSU A;  3HFN A;  3MEW A;  3OSV A;  1S72 A;  2OTL T;  4ME7 A;  3CCV T;  1JB0 E;  5GAN 2;  3UT1 A;  2XIC A;  4DA4 A;  4PJO A;  2XK0 A;  1BIA A;  4J7F A;  4JRI A;  2QQA A;  3JCM e;  3HSB A;  1DJ7 B;  4M77 F;  3QKJ A;  4L59 A;  3JCM f;  5GAN 8;  3JB9 J;  2KAF A;  4UC4 A;  2PUK B;  3VYH B;  3S6W A;  5J26 A;  1I8F A;  4M75 D;  4BD3 A;  3G7Z A;  1BI2 A;  4KUL A;  4BI4 A;  2E64 A;  2EQK A;  2KY9 A;  2V8K A;  2VGM A;  3CME T;  1U1T A;  1JRI A;  3OBY A;  4FU6 A;  4C0G A;  1VQN T;  3PNW C;  4VUB A;  4RCC A;  3J7A F;  3M4G A;  2DO3 A;  3SWN A;  3QPH A;  3V7S A;  1KHI A;  4JJN K;  5GAO n;  3H6Z A;  3OYN A;  2O01 E;  5CCA A;  3PFS A;  5GAO m;  3EFS A;  3VUZ A;  3X26 B;  5GAM e;  1B34 B;  2DZC A;  3M5A A;  4M78 G;  5GAO l;  3OYJ A;  4Y28 E;  2DVE A;  5FU6 B;  4C5G A;  2IG0 A;  1YJW A;  2FL7 A;  3E1S A;  3S3N A;  2EJG A;  3G4S A;  3DB3 A;  3I56 T;  1G3Y A;  4BI3 A;  4CRI A;  4P5N A;  2ZPE B;  4PLL A;  1YJN T;  3LWI A;  3CEY A;  5IN1 A;  5FU6 C;  2WSE E;  4M77 E;  2X4J A;  3M9Q A;  4OGC A;  5CO7 A;  4Q5W A;  2YHT A;  4PKC C;  5A0L A;  2LDM A;  3MEU A;  1ZBX A;  3PMT A;  3QO3 A;  2H3J A;  4KT0 E;  4M78 B;  2K3X A;  5CKE A;  4B9X A;  1VQM T;  3MCA B;  2KVQ G;  3LGL A;  5GAN d;  1Y96 B;  3JCM c;  3CC2 T;  1VQ9 T;  2LVM A;  2R58 A;  4HKE A;  5GAN 7;  4O6J A;  3JAM E;  2RHI A;  5GMK h;  1OZ3 A;  2QA4 T;  2O4X A;  4A4E A;  2D9T A;  3CD6 A;  4MZP A;  4JDS A;  4PLI A;  3OYG A;  2M9U A;  1N9S A;  2KSS A;  5GMK m;  4C8Q E;  4C92 G;  1YBY A;  3ASK A;  1BKB A;  5GMK l;  2R5M A;  3OYF A;  1QP2 A;  3CCL T;  3QG1 A;  1N27 A;  4O5V A;  1PSF A;  2Y4Y A;  2M1H A;  2RD1 A;  3GF5 A;  4J6X A;  2F69 A;  2DXC A;  1VQ4 T;  2L5Q A;  5LJ3 e;  2E65 A;  2VUB A;  2RI3 A;  3OB9 A;  4N0A C;  4A53 A;  4M7A E;  4M78 D;  5LJ3 f;  4XU0 A;  1HXD A;  3TEE A;  4F7U G;  3CCJ T;  1N8R C;  1AHJ B;  3M59 A;  1M1K C;  3QII A;  4M7D G;  4OF1 A;  3G6E A;  5GMK i;  3CBP A;  5FRM A;  2XG8 D;  2I2L A;  1N9R A;  3OS1 A;  3WXM B;  3QDR B;  4C92 B;  4FL6 A;  3NTH A;  3TU4 K;  3L42 A;  4BY6 C;  2RJE A;  3GNF B;  1VQ4 A;  1B34 A;  1OI1 A;  2ZPI B;  1MGQ A;  4XTZ A;  3CC4 T;  3CCM T;  2HAX A;  1BIB A;  3L2U A;  1Q81 U;  3PIP A;  4BB7 A;  4IKF A;  3A8L B;  1WJR A;  2E41 A;  2BIV A;  1XOV A;  2F5K A;  4C92 C;  5A0G A;  5FU7 C;  2EQU A;  1KD1 U;  2BUD A;  2L8D A;  4HT8 A;  1N8R U;  3C12 A;  2VV5 A;  3FEO A;  4PL6 A;  3JCM W;  4M7D B;  4KUI A;  2EFI A;  2CZ7 B;  1Q86 C;  2FYK A;  4RMO A;  4TVR A;  4E7I A;  3WVE B;  2K4Y A;  1KC8 U;  5A2Q E;  3RMQ A;  2ZPH B;  1QVG S;  3OYC A;  1K9M C;  3QHS A;  2LTO A;  2L89 A;  4ATO A;  2X4W A;  3TCJ A;  4IUV A;  3P8H A;  5J3B A;  3SDZ A;  3M53 A;  4M7D C;  1D3B B;  2OTJ A;  2RA2 A;  1XNI A;  4M75 G;  4HA8 A;  3WVD B;  1S72 T;  3OYA A;  5GAO r;  5GAN 6;  3CPW S;  4IUQ A;  3J81 E;  2VC8 A;  4JRQ A;  4FT4 A;  4C92 F;  5LJ5 e;  3CMA A;  3JCM P;  1SSF A;  4N0A A;  3P8D A;  5LJ5 f;  4C0D C;  3JCM d;  3MHX A;  2DTH A;  5HY6 A;  4J7I A;  1WQW A;  2DD4 A;  2X35 A;  2MI6 A;  5GAO q;  1KQ2 A;  2RHX A;  4L5G A;  4NL3 A;  3PIO A;  2EKO A;  4ELY C;  5GAN 5;  3HRU A;  3OYB A;  2R57 A;  4F7U F;  1IRE B;  3CCU A;  4XTY A;  4QVZ A;  4M7D F;  4E7K A;  3DLL A;  3PT9 A;  3NTI A;  2KK4 A;  3R6O A;  2DD5 A;  1NPR A;  2YLB A;  3HRT A;  3QJ6 A;  4C5I A;  3BDU A;  2PVD B;  5C0M A;  2CGH A;  3V8J A;  2KQW A;  4C92 A;  4M75 C;  4CI0 C;  3JCM b;  5HK0 A;  3RIR A;  3HFO A;  4N4I A;  3L2V A;  1VQ7 A;  3G4S T;  4MZT A;  2QQR A;  5D6W A;  3RES A;  4ZGD B;  3VUB A;  1RL2 A;  3L1A A;  3CCS A;  3OW2 S;  4N4G A;  4WF2 A;  5GAN g;  2BKD N;  3C94 A;  1G3S A;  4IUU A;  2LX9 A;  4F7U A;  2JZ2 A;  4RKU E;  4XTU A;  4M7D A;  3OYL A;  4PJO E;  2RJF A;  1I5L A;  2PUO B;  5CKB A;  3MP1 A;  2ZPB B;  1M5Q 1;  3CPF A;  3G71 A;  5FRO A;  4NOY A;  2WSF E;  4M75 F;  1HK9 A;  2QQ9 A;  1W2B S;  5DM7 R;  4EMK B;  1VQ5 T;  2DIQ A;  2IVW A;  4M7A B;  2RJC A;  3VU3 C;  4OP0 A;  3GP8 A;  2OAU A;  1YJ9 A;  3QYH B;  3MP8 A;  2LQ8 A;  5GAM f;  2MAM A;  3ZEH A;  1RI0 A;  5GAN h;  2G3R A;  2QQB A;  2RI5 A;  1YIT A;  4OB0 B;  4EMK C;  3CXC S;  3A8M B;  3L2W A;  3CCR A;  2QDY B;  3LWH A;  4C8Q D;  1YI2 A;  4MDX A;  3KUF A;  5GAN 4;  3FDR A;  4XAX B;  5LJ3 d;  4JLG A;  1YIJ T;  3VJP A;  2LCC A;  3EAE A;  3HPW A;  1V29 B;  4M75 A;  4RG8 A;  1JJ2 S;  4A54 A;  2JOY A;  3M58 A;  3OS5 A;  3I55 A;  1YHQ A;  5I2M A;  3DKM A;  3RKX A;  2EJF A;  4M7A D;  1VQ6 A;  1FX7 A;  1UB4 A;  3MEA A;  4R56 A;  2XI9 A;  2OTL A;  4J6Y A;  3JSC A;  3S3M A;  3CC7 T;  4ZN1 A;  2K5L A;  3RKY A;  1QW1 A;  3JCM Q;  4D6W A;  4M78 C;  2F5T X;  2XDP A;  3GNG A;  2K57 A;  3RUX A;  5KE3 A;  4QQ6 A;  3CPW A;  3CCQ A;  3JB9 D;  3VYG A;  2LT1 A;  4LDY A;  5CR2 A;  2DTI A;  2GF7 A;  1NJI C;  2JNG A;  1VQ8 T;  1XTD A;  2PQW A;  2DXT A;  3FB9 A;  2LQK A;  5LL6 S;  5LJ3 j;  3M54 A;  2RK1 A;  3BDL A;  3ZFJ A;  1QP3 A;  4ZGE B;  4YTL A;  3L2R A;  3CME A;  1Q81 C;  1VQL A;  3SD4 A;  4BDY A;  3HHT B;  1IZ6 A;  5AYF A;  1VQN A;  2K2V A;  1VQK T;  3JB9 H;  4C5H A;  5GAN j;  4FSX A;  4XTW A;  3O8V A;  2QTX A;  1M90 U;  1FWZ A;  2PU9 B;  2XD0 A;  1K73 C;  3NFC A;  3H8Z A;  4QVC A;  2DZ9 A;  2DXU A;  2YRV A;  5CAI A;  2P4T A;  1UGR B;  4J6W A;  3JCM g;  1UGS B;  2DTO A;  2MWO A;  1VUB A;  4OB3 B;  2ZGW A;  2DJZ A;  4M78 F;  2QEX A;  4EMK A;  2P0K A;  3OYD A;  2XDD A;  3VKI A;  3QYG B;  1UEB A;  1Q82 C;  1BI1 A;  2FVU A;  3OYM A;  1WJQ A;  5LJ5 d;  3V8K A;  2RH2 A;  3UDC A;  1Q7Y U;  4A4K A;  4PJO G;  1Y7X A;  3GLX A;  4BUG A;  5GMK j;  1YJN A;  2ZPF B;  1WQ7 A;  1JBM A;  2QXF A;  3M4Y A;  5KE2 A;  3OS0 A;  1I4K 1;  5HKC A;  4LDV A;  3X28 B;  5L8R E;  3CCU T;  2JTF A;  4ZTJ A;  4HCC A;  5DLQ E;  3JCM h;  1M8V A;  1WGS A;  3QXE B;  3PTA A;  3FC3 A;  1VQM A;  4OVA A;  1K8A U;  4JLI A;  5D6X A;  3OMC A;  1VQO A;  2ZPG B;  4KBM B;  4BE0 A;  4J83 A;  2GCX A;  4M78 A;  1WJS A;  2M0O A;  1VQ9 A;  3SB2 A;  1WNL A;  4V2S A;  4R55 A;  2GFU A;  3V8L A;  3S3O A;  1Y96 A;  2DAQ A;  3MEV A;  3MP6 A;  3PGG A;  4PJO B;  1VQ7 T;  1KQS S;  1TH7 A;  1U1S A;  2GFA A;  2E6N A;  4OB2 B;  4IUR A;  1OZ2 A;  4OGE A;  2P0Q A;  3OSS C;  2E12 A;  4M77 G;  1NZ9 A;  3CCL A;  4NS5 A;  3CBM A;  3JB9 I;  4XU1 A;  4BAC A;  1VIE A;  1M1K U;  1BI3 A;  2XDB A;  4PJO C;  3BFM A;  2RI2 A;  3HL8 A;  1P92 A;  5GMK e;  1M1G A;  2A3L A;  2JN0 A;  3SWN B;  2CZ1 B;  3C95 A;  4QQG A;  2M16 A;  3MO8 A;  2LCL A;  2XHC A;  1VQP A;  3P8B B;  4J8O A;  5DLO A;  3JCM X;  2E5Q A;  1X6O A;  4PJO D;  2L3R A;  1EIF A;  4C0Z A;  4E7H A;  3N5B B;  3M56 A;  4M77 B;  4C8Q G;  2E70 A;  4GY5 A;  5CKF A;  4JS5 A;  4LDW A;  1YJW T;  2LRQ A;  3CCM A;  5GAM d;  4JUV A;  2LC4 A;  5LJ3 g;  2MMP A;  1NE8 A;  1O75 A;  3OYH A;  5A0D A;  3KBG A;  4M7A G;  4ZN3 A;  3J80 E;  3URG A;  3LH0 A;  4M77 C;  3CCR T;  1FXX A;  1G3W A;  2E1H A;  2RJD A;  4C92 E;  1YI2 T;  5CQY A;  3OA6 A;  2QEX T;  2AHJ B;  3FLG A;  3RER A;  1I81 A;  2K5F A;  5M9O A;  4HT9 A;  4MZM A;  3M55 A;  4C8Q B;  3JB9 G;  1UGP B;  2XKO C;  5CVI A;  3NTK A;  3I55 T;  4X34 A;  2CS7 A;  3UWN A;  4M77 D;  1VQ6 T;  2O4X B;  3OYY A;  5LJ3 h;  1LNX A;  2Y90 A;  4F7U E;  5GAM j;  4JS4 A;  4M7D E;  1D3B A;  2WSC E;  3AHU A;  3CD6 T;  2MF2 A;  2LT4 A;  4C8Q C;  3A8H B;  4FIB A;  5FLX E;  4EMG A;  3CCQ T;  5KCO A;  3SFM A;  1H64 1;  4LDU A;  3OYI A;  3C4S A;  4XTV A;  2DIG A;  3L2Z A;  4XK8 E;  2XU8 A;  3KXT A;  4A4F A;  3ER0 A;  1VQL T;  3OYK A;  4M7A C;  3CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...