3ZFJA

N-terminal domain of pneumococcal phtd protein with bound zn(ii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'SYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PNEUMOCOCCAL HISTIDINE TRIAD PROTEIN D
publication title New Insights Into Histidine Triad Proteins: Solution Structure of a Streptococcus Pneumoniae Phtd Domain and Zinc Transfer to Adcaii.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Zinc-binding protein
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04270 Strep_his_triad Streptococcal histidine triad protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.680 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3zfjA00
3ZFJA 2CS7A
chains in the Genus database with same CATH superfamily
1I1JA 1VQ5A 2VXEA 4M77E 4IUTA 1ABOA 3HPWA 5FROA 2YSQA 5KYUB 2XU8A 5A0DA 4IUUA 3VS4A 4KUDK 2E12A 2J6FA 4L6V5 2AIRB 3JB9I 1TH7A 3UF4A 4HCBA 1KQSP 2AZSA 3SDZA 3OW2P 3X28B 4VUBA 1Q7YC 2JOYA 2KNBB 2QDYB 2JVVA 3A8GB 3QDRB 5HKCA 2DXCA 2CH4A 4RMOA 2M1HA 4JS4A 4MDXA 2YUNA 4B9XA 1N8RR 3J80E 3CC7T 1C1AA 3GPLA 1K0SA 1Z9ZA 4OMQA 1YCSB 3ER0A 1WHLA 4RTYA 1U1TA 2DBKA 3ZBDA 1D1CA 3O8VA 5GAMf 4M7AG 4RCBA 1YITA 3HHTB 1WYXA 2BKDN 2FO0A 1X43A 2O01E 2OAWA 1JJ2S 2I0NA 3EG1A 3DKMA 1IO6A 4LD9K 3I35A 4FYYB 4QQGA 3A8OB 1ZA2B 2YRVA 1YJNQ 3INZA 4ATOA 3NTHA 4E7JA 2PVOB 2MWOA 1LNXA 4NOYA 1M27C 1KC8C 2OX7A 1G3TA 2JZ2A 4C8QG 2MPXC 1OZ2A 1B07A 2PQWA 2HBWA 2DBMA 4NL3A 2EFIA 1V29B 1MNEA 1M90U 3VUBA 1TU0B 3OW2A 2X51A 2LQKA 3R6OA 2L5QA 2X3XD 3EFOA 1PRLC 2DVJA 3UPUA 5GMKh 4PJOC 1YI2Q 4ELZC 1JBMA 2BE7D 3CCJA 2MYSA 3L2QA 4IIOA 4N4GA 2HNIA 2XK0A 2CYZB 4J6XA 1LOJA 2ED1A 4EMKC 2E5KA 1B3QA 1X69A 1ZBJA 3REBB 4DQ2A 5GANe 1O9SA 3JCMf 1QW1A 2V8KA 2A0FB 4M7AB 3S3NA 3RMSA 2VB6A 2EW3A 3KUFA 1PSFA 1UGPB 3CCMA 1H3HA 2CREA 3VU3C 2CZ6B 4IIMA 1WHMA 3CCRT 2E6ZA 5CKHA 3CPWS 4Y91A 4P5NA 2V1RA 3JCMX 1VQLA 2LNVA 2PUKB 1OULA 3CCQQ 2HKQB 4Z88A 2HQEA 3UA7A 2HL5C 4C8QB 2LJ0A 2GTJA 1MMNA 2H3EB 3VS0A 4FW2A 3OYKA 2DAQA 4LDWA 2DRMA 1ZQ1A 1WA7A 3KBGA 1NYGA 5IN1A 1W2BA 3QYGB 3Q1JA 1PG5B 2CT3A 4OB0B 1X6GA 4XU2A 2HCKA 1AHJB 4XTXA 1ZHIA 2R57A 2H3JA 3OMGA 2KMTA 5GJWB 1HD3A 1E6HA 1Z9QA 3CMAQ 1NEBA 2O31A 2BTTA 2CUBA 5IXFA 1VQPA 1PHTA 4XTYA 3JB9J 4C5GA 3G4SQ 2K2VA 2M16A 3A98A 4J9IA 5GAN8 2RHXA 4KBMB 2DKGA 1RAGB 1FX7A 4O5VA 1YITQ 4QQ6A 4FSXA 3CC4Q 2F1LA 4YTLA 2K3YA 3FDRA 2M0YA 3I55Q 1VQNQ 3FEOA 5IAYA 4J9GA 4ME7A 2DL5A 3OMCA 3EGDB 3EH1A 1NM7A 1WHKA 2ZPBB 2C06A 1T0HA 2PUOB 4F7UG 5I2SA 3JCMJ 4RTXA 2QDLA 4DBQA 4C5IA 1WJRA 1KD1R 3JCMV 2AT1B 3RUXA 1QCFA 2HQHA 4ZGDB 2LX7A 2X4JA 1RABB 1SG5A 2AHJB 4KUIA 1IRXA 2K57A 3L1AA 2LJ3A 2KVQG 1VYVA 4BI4A 5I21A 3CCJQ 1GL5A 2QQAA 4LN2A 3SHWA 4J5YA 2YUQA 2QEXT 2E70A 3OS2A 1FMWA 3CCET 3HFOA 2QQRA 4IUVA 4M7DE 2ROLA 1TOVA 2V26A 3M0UA 2P4RA 5KYYA 2MMPA 4JJNK 1NJIR 4M7AC 1R8OB 5KE3A 1QVFP 1TXQA 1MV3A 3RNJA 3V8KA 1FWZA 1UDLA 4LNPA 2JMCA 2ECZA 1KQSS 1N8RU 2KY9A 5GAN2 3FJ5A 5GAN7 1YHQT 2VV5A 1TUDA 3JAME 2LQNA 3EGXA 2DD5A 4ZGEB 3FLGA 1VQ6Q 1VQLQ 1C0MA 4MMKA 3X20B 2HBPA 4C0FA 3V7CA 3V8JA 4C8QC 2KDSA 1AZGB 5C0MA 3S6WA 4OVAA 2JN0A 2RHUA 3TSWA 1Y57A 3M56A 4RTZA 3A8LB 4CC2A 2K7AA 3LH5A 2DK3A 3C4SA 3CC2A 1VYTA 4M77G 1K8AR 2EQUA 5ECAA 2ED0A 5IHNA 3JCMh 2NUPB 2GFUA 2KR3A 1VUBA 1HYOA 4TVRA 2HDAA 1AWWA 4BE1A 2RQUA 1G2BA 3H0IA 1D1BA 3M57A 1VYUA 1QKXA 1XTDA 3CBPA 4K11A 4OMFB 1TS9A 4ESRA 2RI5A 1BKBA 3BE3A 2KRNA 2BIVA 3JCMQ 3HRTA 2QA4T 2E3IA 5HY6A 1S72Q 5LJ5d 3X26B 3JSCA 2O9VA 6AT1B 3LWIA 1VIFA 3CXCA 1PC0A 1I0CA 1YP5A 4F7UF 1OX8A 1D3BA 2RHYA 2XDBA 1NE8A 2RN8A 2W10A 2JTFA 4RG2A 5GANg 3M58A 1JJ2P 2EWNA 3H8ZA 4OMOA 5CKFA 1VQ7T 2RD1A 4PFOA 4XTVA 3PMIA 3JB9H 4LDXA 1D0XA 1PD0A 1IHVA 4M77B 1D1AA 2X3WD 4C92E 4N0AA 4RKUE 2VASA 2ZCFB 4QVZA 4Y28E 1PNJA 3MO8A 2DD4A 5GMKi 1YBYA 5IT9E 1WXUA 4FT4A 4DOVA 3E9FA 3DB3A 3CCLA 4KGXB 2DEQA 3VJPA 3PIPA 1PCXA 3QJYA 4Z8AA 3V7RA 4A63B 2Z0WA 3PNWC 2RQVA 4AMCA 1J3TA 2K5IA 2O4XB 2FEIA 3CC7Q 3RBBB 1RUWA 1TUCA 2ABLA 3CMEA 2OTJT 1EX4A 1ZA1B 1LJOA 1U3OA 4UC4A 2OTLA 2QTXA 3FIFA 2FZGB 2EGAA 3DLLA 2FZKB 3M0PA 3RMQA 1WPYA 2EJGA 2XICA 2KRSA 2QQBA 3UWNA 1MMDA 1FYNA 3MP1A 4IUPA 4M78E 3JB9G 1UGQB 4D8DA 1B34A 1OYXA 5KH6A 2X4WA 3CPWP 2DILA 1M2OA 1M90C 4PJLA 3P8DA 4EIKA 1KIKA 2M51A 1WXBA 4BY6B 2ROTA 1N5ZA 4X34A 1U1SA 3CCMT 3U23A 2GBQA 1MMAA 2RHIA 1RAEB 4M75F 1AD5A 4KRTA 1GCQA 3VYGA 2EVRA 1YWPA 2E64A 4M78A 4MZMA 4HCKA 5CO7A 3CCUA 2EYYA 1ARKA 4A4FA 1NZ9A 1Q82C 2QEXA 4CI0C 3OY9A 1G3SA 1NPPA 2E1HA 3CCEA 1VQKT 3J7AF 2R58A 1BIAA 2KYBA 3ZEHA 3MP8A 2VGMA 2K2MA 4QQDA 4F14A 3H0HA 4L5GA 1WHJA 1NJIU 1ABQA 1K9AA 4AFSC 3T9NA 1SKUB 1H641 4ZTJA 4J9EA 3OYHA 3CCRQ 3EHRA 1VQPT 2RPNA 4M77C 3G71Q 4E7KA 1H92A 1RADB 2PNIA 5GMKe 2LNHB 2YUPA 4F04B 1AWOA 5IHIA 4BI3A 3PVLA 1C6VX 1ZBXA 3QUIA 4JJBA 4F7UA 3OSVA 2DF6A 3P8BB 1M3BA 1RACB 1IZ6A 2KXCA 4X9DA 1M1KU 2Y90A 3BY7A 1BU1A 2HEQA 2H8HA 5IHKA 2JS0A 2D0NA 2DO3A 2X9HA 1K8AU 3I56A 4JJCA 3H6ZA 2FRYA 3KFVA 5LJ3h 2AKKA 1NBEB 4ELYC 1WJQA 2SEMA 4JRQA 4HT9A 1W70A 2LT4A 1OOTA 4M7DG 2GNCA 3OYYA 1SSFA 2CKKA 4JPBW 4KT0E 5GMKm 4AFZC 5GAN5 3OS0A 1SRMA 2NUTB 4DBHA 3M59A 3EFRA 5J26A 5I22A 4PJJA 1X01A 2F5TX 1M3CA 2QA4A 4C0ZA 1K9MU 2DETA 4GLMA 3M53A 5FLXE 4WCIA 3M0RA 3QXEB 1PKTA 2RI2A 3EG9A 2K5LA 2M02A 2LX9A 3EFSA 5FWCA 1GCPA 4BY6C 4BB7A 4PJOF 4WF2A 1Y07A 2E5QA 1VQ7A 2RJEA 4ZGJB 4C5HA 3UT1A 1G8XA 1M8MA 1VIEA 3CBOA 1JO8A 4N4HA 1M2VB 1IGQA 3ZFJA 1JEGA 2E3HA 2XD0A 2J06A 2RQTA 1NLPC 4J9HA 3NHNA 2DYBA 2RJDA 1O75A 2QEXQ 1AOJA 1HXDA 4L59A 1IHWA 1X6OA 1UJYA 2RF0A 3CCEQ 2V1QA 1KC8R 3QDFA 5LJ5g 3EGXB 1UGRB 4E7ZA 4F16A 4M7DB 1S1NA 4M75A 2PU9B 5LJ5j 2RM4A 3CC2T 3MEAA 3SEMA 4KH0B 1MV0B 2DTIA 2L2PA 1OV3A 1N6AA 2GGRA 3G1JA 2A08A 1I8FA 2G6FX 5GANd 1E7OA 2RJCA 2OTJA 1KQSA 3AHUA 2DE0X 4HXJA 4GBQA 2BZYA 1YHQQ 2ZPIB 1I4K1 3NGPA 2MOXA 1MMGA 2VGNA 2P4TA 2FPEA 2KEAA 3L2VA 1YJWA 5GAMe 1ZX6A 3ASKA 4RCCA 2RQRA 1XQHA 1T3SA 4C92D 4XAXB 3MKDA 3J81E 1XOVA 1TUGB 4OF1A 2E65A 5D6XA 1GBRA 2NUZA 2FL7A 2O2OA 1M1GA 5L8RE 2YXYA 4A4GA 4FM4B 2RMOA 1UE9A 4AG2C 4A53A 3JCMb 3BFMA 3QWYA 1I07A 1K4US 1BI2A 1VQ5Q 1A0NB 4OGCA 5KYXA 3KXTA 2L3PA 4NL2A 3MHXA 2FB7A 4OGEA 1SRLA 3QG1A 3OBYA 1RAHB 2KBTA 2K79A 3CCVT 4BI8B 1VQKA 3JCMP 2QA4Q 4X9CA 3O5ZA 2RH2A 4DBFA 1NEGA 3A8MB 2FVUA 3TU4K 3RIRA 3OYAA 1YN8A 3QO3A 1IXDA 3EG0A 1VQ9A 4FYXB 3CCLT 2C0TA 4PJMA 3JCMe 2ZGWA 4Y92A 4M78D 1KJWA 2P0KA 3N5BB 1N9RA 1VQ7Q 2Y4YA 3QHSA 4HVVA 2J6OA 4OB2B 3PIOA 3CMET 5IH2A 3OYGA 3JV3A 3UATA 2OTLT 2VYTA 4C92B 1YIJA 1LCKA 4LDYA 3QPHA 1QWEA 9ATCB 1VQOT 3PMTA 1W4SA 1Y96B 1OPLA 4M7AF 2QAZA 1LVKA 2YLBA 4PL6A 2FZCB 4PJOA 2KROA 1I5LA 4ZNXA 3OSSC 2LZ6B 3VS1A 2GQVA 2EQKA 4M7DC 1H3ZA 2DTOA 1R77A 1UUEA 3NPFA 1Q86U 4EMKA 2LVMA 2KI7A 1Q81C 2MCNA 2DXBA 3QJ6A 5FW9A 3GNGA 2JS2A 5GAOl 4C8QF 1B34B 4BACA 2OTJQ 1ZSZA 4OB3B 4HCZA 1MNDA 2RNAA 2E41A 2HQXA 2CSQA 2RK1A 4PFPA 1W6XA 2PZ1A 2JXBA 2QG9B 1AVZC 5AYFA 1NYFA 4HT8A 3CCUT 5CIUA 3CPFA 5GAMh 3OYIA 5GAOm 2B8AA 4E6RA 5KYUA 5GAN6 4QVDA 5KCOA 4FL6A 1Q7YU 3QSUA 4M78B 2LRQA 2ZPGB 4IKFA 1M1FA 2JTMA 2W0ZA 1PM3A 2CUDA 2CP6A 2MWPA 3VRYA 5GAOp 1WIEA 2DPPB 1KD1C 3QZ9B 3GOXA 2K3XA 1TG0A 1X6BA 2D6FA 1RLQC 3WVDB 2LMJA 3CCMQ 3VV0A 5CKDA 2J6KA 2X4XA 1UECA 2KYMA 1HSQA 4AFQC 1XJWB 2EJFA 3HTRA 2EYWA 1WZOA 4LUDA 3RDVA 1IGUA 3C12A 3MP6A 3RKXA 1WLPB 3C94A 3X25B 4J9FA 2B86A 4A4EA 1VQ8T 4N4IA 1VQKQ 1M1KR 2XHCA 2VWFA 1JB0E 3VYHB 1KC8U 1M8VA 2HKNA 1BBZA 2DX1A 1G5VA 1YI2T 3I56T 4BUGA 1K73C 5GAOq 2BUDA 1YWOA 2AZVA 2EGCA 2QQ9A 2J7IA 4PKCC 5CK9A 1VQPQ 2HMAA 4OMNA 1Y71A 3V7SA 2F69A 2RO0A 4ZN3A 4C92C 3QBYA 4M75D 5C6SA 2O88A 1QVFA 1FMVA 1WX6A 2YLCA 1K9MR 1EFNA 2EQIA 3GBQA 4JRKA 4D8KA 1YJ9A 2J05A 2FHDA 1ZUUA 2WSEE 5D6YA 3HL8A 1M5Q1 2JM8A 4BDZA 5LJ5f 3OYMA 2FRWA 3C0CA 2EYXA 1RAFB 2DA9A 3M54A 1UTIA 2EPDA 4FSSA 4E47A 4FYVB 3REAB 2I2LA 4M7AA 3MJXA 5DLOA 1PKSA 3FB9A 5GAOn 3EG9B 2DL4A 2DL7A 5GANj 5CCAA 5LJ3d 3FC3A 2IPOB 4EPCA 4DA4A 1W2BS 2P84A 4Z89A 3HRSA 3M4GA 2X35A 1VOMA 2FPFA 2JJ9A 3CCVA 5HCKA 1MUZA 1GCQC 4J6YA 2LDMA 4PK4A 4C8QA 1QQJA 2A7YA 2XIDA 4M78C 3QYHB 2WACA 2MK5A 2QI2A 4XTWA 1OEBA 2KAFA 2OI3A 4JJDA 4RUGA 1NPRA 5LJ3e 3AT1B 1TTHB 5FU7B 3GF5A 2KK4A 5DY9A 1UGSB 2KE9A 1D0ZA 2EGEA 3VS7A 5A0GA 1R0CB 4CC4B 4Z02A 1Y0MA 1X75C 2JMAA 1WDXA 1VQOA 3UDCA 1N27A 1AEYA 1UB4A 2XKOC 2BZXA 1OU9A 4NS5A 1YJWT 4OMPA 1OPKA 2FPDA 4MZTA 1JJ2A 5KCHA 1UG1A 3P8HA 2DL8A 3EFOB 2COZA 3OB9A 2DM1A 2L3QA 1K76A 3CC2Q 4CC3A 2O9SA 4LUEA 2KGTA 4M77F 4RG8A 1GRIA 4E7SA 2EKHA 4JZ3A 1YNZA 1BI3A 1UHFA 2DTHA 2XDDA 3LWHA 3NTIA 4PJOD 1QCOA 2KQWA 2LP5A 8AT1B 1Y7XA 3PGGA 2LCCA 2E10A 5CR2A 2QK0A 2E4HA 3VS2A 1ZSGA 2PTKA 3H0FA 3TREA 2EQMA 3WVEB 3CCST 1ZUYA 2P0QA 4F7UE 4RTUA 5FRNA 2L3SA 1NLOC 1VQ9T 2IVWA 1T0JA 3CQTA 3URGA 5D7UA 3EG2A 2JT4A 3TVTA 1QCNA 1KQ1A 3CPWA 2MAMA 1YJNA 5I11A 3G7ZA 1RI0A 1RL2A 2JUFA 5KE2A 3ULRB 4BDYA 1VQ8A 2GQIA 3CCVQ 1YIJT 2VVKA 4JZ4A 2YHTA 4JRPA 2HSEB 4QT7A 2CP3A 2LCSA 2HZYA 4DEYA 1G3WA 2DNUA 4JRIA 3EHQA 1CSKA 2JM9A 1Q86R 1CKBA 1WJSA 4FIBA 1QP2A 2QASA 2CS7A 5GMKl 1HK9A 2LJ1A 3CCLQ 1YI2A 3BDLA 3E19A 5FU7C 5LJ5h 2A3LA 1G83A 3LGLA 3L2WA 2NUPA 4J7IA 4ZN1A 1RI9A 1SPKA 1K1ZA 3HRUA 3CMEQ 3G6ET 1UGVA 2K5FA 3BW1A 1BB9A 4DOWA 2YT6A 2F2XA 2OTLQ 3NMZC 5KYNA 4EMGA 5LL6S 3CXCS 1VQOQ 2QTVA 1RAAB 3L42A 2LCLA 1ZSZB 2DEUA 2F5KA 5AT1B 1Q7YR 1M30A 2CP7A 4ANJA 3F70A 3JB9F 4HVUA 3JRZA 3TCJA 1NG2A 1IREB 1N9SA 3CCQA 2QYZA 1D09B 1M9SA 3QIIA 1WHHA 1UJ0A 1UEBA 4QW2A 4B9WA 2OJ2A 3OYNA 1SEMA 2XG8D 4M75E 1JXOA 3EGUA 5DM7R 5KYYB 3META 4X1VA 2DMOA 3MEWA 4J9CA 5M9OA 4XU0A 4J83A 1GXIE 5CQYA 3SWNA 2V8IA 1QMCA 2BZ8A 2YRDA 4DBRA 1UHCA 2L0AA 2RK2A 1OQKA 4M77A 2A36A 3CCUQ 4A54A 2E6NA 4IUQA 3CMAA 2IG0A 1V76A 2DLPA 3NFCA 3D7SB 2C0OA 4M7AD 2LQWA 2M0OA 4XK8E 3G4SA 2NYSA 5GAMd 4J9DA 4II1A 4HVWA 3V8LA 1N8RC 3E9GA 2DVEA 3CC4A 1VQMT 2A37A 2CDTA 1WXTA 1OI1A 4FT2A 3I55A 1VQNA 1KSWA 2SRCA 4C0DB 2O4XA 5LJ3g 5GANf 4C8QD 1QVGS 5KYWA 5LJ3j 3UA6A 4BE2A 5L23A 4HKEA 1XNIA 1HJDA 1KQ2A 3M9QA 1VQ8Q 3EG3A 4B6MA 4MDWA 2YWWA 3H9NA 1JU5C 2DYIA 1YJ9T 5GAOr 4WTOB 3CD6T 2ATCB 3OYFA 1WHGA 1W2BP 1SSHA 1U06A 2CSIA 4C92G 5GJVB 3I56Q 1G3YA 4CC7A 4O6JA 4PLLA 1M4ZA 1B7TA 2D8HA 2DERA 1BI0A 1TSFA 1AWXA 2EJ9A 3JCMd 1JQQA 2ZAEA 1IB8A 1Q82U 4M7DF 5FRMA 4BD3A 2CZ1B 1D3BB 1JRIA 2CGHA 2DXTA 4LE9A 3A5ZB 1U5SA 2EYQA 2RJFA 1ZSZC 2GCXA 3E1SA 4C0GA 3HKSA 3JCMW 3FRNA 4LDVA 2CP2A 8ATCB 4XTUA 4R0KA 3M5AA 1VQ4T 3PE0A 3CCSA 2C0IA 1P92A 2V8JA 3G71T 5EC7A 1VQ6A 2CP5A 4OMMA 4PJOE 1FMKA 4R55A 3RR6A 4MMLA 2CZ7B 3WXMB 3OYDA 2BE9B 4PLIA 3RERA 1Q95G 1WI7A 3LH0A 2D8JA 4M78G 2OAUA 2VUBA 1QKWA 2RQWA 3OYLA 4J6WA 4HCCA 4JUVA 2RA2A 5CAIA 3OYEA 4A4KA 4D6WA 3MPUB 3GNFB 4E2FB 1YCYA 1E6GA 2JW4A 3HFNA 2QQSA 1Q81R 2HAXA 1RAIB 3VS3A 5CKEA 5GMKj 3QKJA 1PSEA 1EIFA 2KXDA 3OYJA 1KG1A 4KH1B 1BI1A 3M0QA 2GFAA 1PRMC 4BE0A 2CZ0B 2D1XA 4R56A 4E7IA 2KRMA 4XU1A 3G6EA 4C0DC 3PVQA 1QVPA 3VS6A 1S72A 3DB4A 3SD4A 3JCMc 1PWTA 4LD6A 1X2KA 3L2ZA 1KHIA 3ZL7C 5D6WA 1WQ7A 1M3AA 3OYCA 2DFUA 3I5SA 1YJWQ 3VUZA 2EKOA 2NUTA 1H8KA 3I9QA 3LX7A 1BYMA 1F1BB 1I5OB 5A2QE 2QXFA 2DJZA 2IIMA 3A8HB 1OU8A 4PJNA 3MCAB 3GIBA 1TWBA 5FU6B 4C92F 3OBWA 2WSCE 4FCYA 3LYIA 3M0TA 4OP0A 4MZPA 3OS1A 3QZ5B 3GLXA 1WFWA 2YRCA 3H41A 1KHCA 5GANh 2NWMA 4PFZA 2EYZA 1YJNT 1M2VA 3LW5E 4AT1B 3LLRA 3MEVA 5HK0A 5J3BA 3CC7A 2VKNA 1U8RA 1I81A 1BK2A 2CT4A 4E7HA 4J9BA 5CVIA 1K73R 1NJIC 4N0AC 3CCSQ 3OW2S 2YUOA 3TEEA 3HSBA 2GF7A 4RTWA 4M7DA 4F7UB 2Y4XA 1VQ9Q 3CXCP 1VQMA 2XI9A 3GP8A 3QWXX 3RKYA 3TSZA 4M77D 4RTVA 3TQ7P 1K0XA 3BDUA 1ACMB 4M78F 2VXFA 3S3MA 2LQ8A 2HSPA 7AT1B 3I5RA 4M7AE 1M1KC 5I2MA 3VRZA 1ZUKA 3EAEA 1YIJQ 2VC8A 2LT1A 3X24B 2K3BA 4F17A 2YDLA 2ESWA 1PD1A 1K8AC 4M75G 2GTOA 1WGSA 2MIOA 3CD6A 2FG0A 4JDSA 4OMLA 2COWA 4J8OA 5GAMg 1VQ5T 2ZZDA 3IQLA 5EG2A 5GAMj 3OQ5A 4C8QE 3CCQT 1OX9A 1DJ7B 3VS5A 2L89A 2EBPA 4QVCA 1W1FA 3G6EQ 3EH2A 3DLMA 5GAN3 2EQJA 3S3OA 1R0BG 2ZPHB 4GY5A 1K9MC 4FW1A 5LJ3f 3SFMA 5J39A 1JXMA 3A1PA 4JLIA 1OZ3A 1VQ4A 1T3LA 4AG1C 1WNLA 3SWNB 3C95A 3NTKA 4AFUC 4E7LA 3CCRA 4CRIA 3CMAT 3G71A 1V1CA 4LDUA 1QVGP 2F2VA 3G4ST 2DL3A 1CKAA 1BCOA 5LJ5e 5FU6C 3M0SA 1AZEA 1BIBA 2JTEA 1YITT 2X4YA 2F2WA 2QGFB 3CC4T 1VA7A 4EMHA 4EDUA 1SHFA 4M75B 3I55T 1UFFA 1VQNT 3E2UA 3JCMg 4RTTA 2RI3A 1SF9A 3OA6A 1GBQA 2DZ9A 4XU3A 2G3RA 2M9UA 4JS5A 3CEYA 4FU6A 4C92A 1M90R 2COYA 2KSSA 1Y96A 5KYWB 2D0QB 1Q81U 3EGDA 1SHGA 3JB9D 1QWFA 2RHZA 1VQMQ 3CCJT 3RKWA 1WQWA 4LXCA 3M55A 3R6NA 1MHNA 2QGGA 4FYWB 2ZPEB 5FWBA 1QP3A 1KFZA 1Q82R 3OS5A 1FXXA 1QVGA 4KGVB 5CKBA 5CQXA 2RB6A 4DEXA 1QLYA 2KT8A 4PJOG 2PVGB 2L8DA 5HK3A 2DZCA 4J7FA 2XDPA 4C5EA 1GFDA 5IXBA 2D9TA 1KD1U 1YJ9Q 5KYXB 4PNOA 3CD6Q 2DIGA 1MGQA 1X27A 2FYKA 5A0LA 4KULA 2P0PA 1VQ6T 1VQLT 4ZTFA 2CP0A 4XQ3A 2K4YA 2DIQA 2DXUA 4QKUA 4V2SA 1RLPC 3CBMA 4HA8A 3HP9A 2K9GA 2JNGA 1AT1B 3L2UA 2R5MA 5DLQE 5GAN4 2HD0A 2AK5A 1BCMA 1ZLMA 2AKLA 3M4YA 4M4ZA 2A28A 2DJQA 3FJPA 1VQ4Q 4ORZA 3SWNC 1YHQA 2LC4A 2EIFA 4JLGA 1K73U 2NLUA 3ME9A 2DRKA 2PVDB 2HL3A 4KGZB 3MEUA 2EAYA 4A4HA 4PJOB 1GFCA 4OB1B 1QVFS 2WSFE 3PFSA 2LTOA 2XMFA 2CH4W 2MI6A 1X2QA 3SB2A 4M75C 3VKIA 2ZPFB 3OYBA 3L2RA 4EMKB 1D0YA 3PTAA 1S72T 2KT1A 3LGFA 4GLKA 2R5AA 4XTZA 3PT9A 3RESA 2K6DA 1YFNA 2L3RA 3THKA 4IURA 4M7DD 4Q5WA 1Q86C 1AWJA 1EZZB 1LPLA 1KK7A 2MF2A 2ENMA
chains in the Genus database with same CATH topology
4XTUA 3FIFA 2VXEA 1VQ5A 3M5AA 4M77E 4IUTA 3DLLA 4A4EA 1VQ8T 1VQ4T 4N4IA 3RMQA 1WPYA 3CCSA 2EJGA 3HPWA 5FROA 2XICA 2XHCA 2QQBA 1P92A 2XU8A 3UWNA 2V8JA 5A0DA 3G71T 4IUUA 3MP1A 4KUDK 1JB0E 4IUPA 3VYHB 2E12A 1KC8U 1VQ6A 4L6V5 3JB9I 4PJOE 1M8VA 4M78E 4R55A 3JB9G 1UGQB 1TH7A 4HCBA 1B34A 4MMLA 1OYXA 1G5VA 2CZ7B 5KH6A 3WXMB 2X4WA 3OYDA 4PLIA 3RERA 3SDZA 1YI2T 1M90C 3I56T 4BUGA 1K73C 3LH0A 5GAOq 3P8DA 2BUDA 2QQ9A 4M78G 3X28B 4VUBA 4PKCC 4BY6B 1Q7YC 2OAUA 2VUBA 4X34A 2JOYA 5CK9A 1U1SA 2QDYB 2JVVA 3A8GB 4J6WA 3OYLA 3CCMT 3QDRB 5HKCA 4HCCA 2DXCA 1Y71A 4JUVA 2RA2A 5CAIA 3V7SA 2F69A 2RHIA 2M1HA 4A4KA 4RMOA 3OYEA 4JS4A 4B9XA 2RO0A 4M75F 4MDXA 4ZN3A 4D6WA 4C92C 3J80E 3CC7T 3QBYA 4M75D 3VYGA 5C6SA 3GPLA 3GNFB 1QVFA 1YCYA 2E64A 4M78A 4MZMA 3HFNA 3ER0A 2YLCA 5CO7A 2QQSA 3CCUA 2HAXA 4JRKA 1U1TA 4A4FA 1NZ9A 5CKEA 3ZBDA 2FHDA 3O8VA 3QKJA 5GAMf 4CI0C 5GMKj 3OY9A 4RCBA 1G3SA 2QEXA 2WSEE 1YITA 4M7AG 5D6YA 3HHTB 1PSEA 1EIFA 1NPPA 2BKDN 2E1HA 3OYJA 3HL8A 3CCEA 1M5Q1 1BI1A 2O01E 2R58A 1BIAA 4BDZA 2GFAA 3ZEHA 1VQKT 3J7AF 3MP8A 5LJ5f 3OYMA 2VGMA 4BE0A 1JJ2S 2CZ0B 4QQDA 4R56A 4E7IA 3DKMA 1KG1A 4LD9K 4L5GA 3A8OB 4QQGA 3M54A 4XU1A 4C0DC 3G6EA 1QVPA 4E47A 3DB4A 2YRVA 3SD4A 2I2LA 3JCMc 1S72A 4M7AA 3INZA 4LD6A 1NJIU 4ATOA 5DLOA 3L2ZA 3NTHA 4E7JA 2PVOB 2MWOA 1KHIA 1LNXA 3FB9A 3T9NA 5GAOn 4NOYA 5GANj 1H641 5D6WA 5CCAA 5LJ3d 1KC8C 4ZTJA 1G3TA 2JZ2A 3FC3A 4C8QG 1WQ7A 1OZ2A 3OYHA 4EPCA 3OYCA 4DA4A 4LDVA 1YJ9A 1W2BS 3VUZA 2PQWA 2EKOA 4NL3A 2EFIA 1V29B 3HRSA 1VQPT 1M90U 3VUBA 3M4GA 4M77C 2X35A 4E7KA 3OW2A 5GMKe 3CCVA 2LQKA 3R6OA 2L5QA 3LX7A 4BI3A 1BYMA 5A2QE 3UPUA 1ZBXA 4J6YA 3QUIA 5GMKh 2LDMA 2QXFA 4C8QA 2DJZA 4F7UA 3OSVA 4PJOC 2A7YA 1JBMA 2XIDA 4M78C 3P8BB 4ELZC 3CCJA 3QYHB 2WACA 1IZ6A 3A8HB 3L2QA 4X9DA 2QI2A 3MCAB 1M1KU 3GIBA 4XTWA 2Y90A 2HNIA 2XK0A 4N4GA 5FU6B 4C92F 3OBWA 2KAFA 3BY7A 2WSCE 1NPRA 2CYZB 4J6XA 5LJ3e 1LOJA 3LYIA 4EMKC 4OP0A 5FU7B 4MZPA 3GF5A 2KK4A 5DY9A 1UGSB 2DO3A 3OS1A 3QZ5B 1K8AU 3GLXA 3I56A 4DQ2A 3H6ZA 5GANe 5LJ3h 1O9SA 3JCMf 5A0GA 1QW1A 2V8KA 4ELYC 4M7AB 1KHCA 4Z02A 1WJQA 3RMSA 5GANh 4JRQA 3S3NA 4HT9A 1X75C 3KUFA 1YJNT 3LW5E 1PSFA 1UGPB 3CCMA 3LLRA 2LT4A 3MEVA 4M7DG 3OYYA 1VQOA 3UDCA 1SSFA 1N27A 2CKKA 2CZ6B 4KT0E 3VU3C 5HK0A 5J3BA 5GMKm 5GAN5 3OS0A 3CC7A 1UB4A 1U8RA 2XKOC 1I81A 4NS5A 4E7HA 3CCRT 1YJWT 2E6ZA 5CKHA 3CPWS 4MZTA 5CVIA 4Y91A 4P5NA 5KCHA 3P8HA 4N0AC 1NJIC 1JJ2A 3M59A 3JCMX 3OW2S 1VQLA 2LNVA 3EFRA 5J26A 2PUKB 3TEEA 1X01A 2F5TX 2QA4A 2GF7A 4C0ZA 1K9MU 3HSBA 2HQEA 3OB9A 4M7DA 4C8QB 4F7UB 2Y4XA 3M53A 5FLXE 1VQMA 2XI9A 3GP8A 3OYKA 3QXEB 4M77F 4RG8A 2DAQA 3RKYA 4LDWA 4M77D 2RI2A 1ZQ1A 2K5LA 3KBGA 2LX9A 5IN1A 1BI3A 3EFSA 3QYGB 1W2BA 2DTHA 3Q1JA 2XDDA 3BDUA 4OB0B 4BY6C 4BB7A 4PJOF 3LWHA 4WF2A 3NTIA 1Y07A 4M78F 4XU2A 2E5QA 2VXFA 3S3MA 4PJOD 2LQ8A 1VQ7A 2KQWA 2RJEA 4ZGJB 4C5HA 3UT1A 4M7AE 1AHJB 4XTXA 1Y7XA 1ZHIA 2R57A 2H3JA 5I2MA 1VIEA 1M1KC 3EAEA 2VC8A 3CBOA 3OMGA 2KMTA 2LT1A 3PGGA 2LCCA 2E10A 4N4HA 3X24B 5CR2A 1Q82C 3ZFJA 2XD0A 1VQPA 4XTYA 3JB9J 4C5GA 1K8AC 4M75G 1WGSA 2K2VA 2M16A 5GAN8 3CD6A 4JDSA 2RHXA 3TREA 4KBMB 4J8OA 2RJDA 2DKGA 2EQMA 1O75A 5GAMg 1VQ5T 1HXDA 1FX7A 4L59A 2ZZDA 4O5VA 5EG2A 1X6OA 3WVEB 4QQ6A 4FSXA 5GAMj 3CCST 2P0QA 5LJ5g 1UGRB 4YTLA 3OQ5A 4C8QE 4F7UE 2K3YA 3FDRA 3CCQT 4M7DB 1DJ7B 3FEOA 5FRNA 4M75A 2PU9B 5LJ5j 5IAYA 2L89A 2RM4A 4ME7A 1VQ9T 4QVCA 3CC2T 2IVWA 3OMCA 3MEAA 3URGA 2ZPBB 2DTIA 3DLMA 2EQJA 5GAN3 3S3OA 2C06A 2PUOB 1N6AA 4F7UG 5I2SA 2ZPHB 4GY5A 1I8FA 3JCMJ 1K9MC 5LJ3f 3SFMA 5GANd 1KQ1A 4C5IA 2RJCA 2OTJA 1KQSA 5J39A 3CPWA 3AHUA 1WJRA 2MAMA 1YJNA 3JCMV 2ZPIB 3RUXA 3G7ZA 1RI0A 1I4K1 1RL2A 2JUFA 5KE2A 2VGNA 4JLIA 2P4TA 4ZGDB 4BDYA 2X4JA 1OZ3A 1VQ4A 1VQ8A 1YIJT 1WNLA 3SWNB 2YHTA 3C95A 3NTKA 2AHJB 4KUIA 3L2VA 3CCRA 4CRIA 4JRPA 2K57A 3L1AA 4E7LA 1YJWA 3CMAT 5GAMe 2KVQG 3G71A 4LDUA 4BI4A 1G3WA 5I21A 3ASKA 4JRIA 3G4ST 4RCCA 2QQAA 1XQHA 4J5YA 1WJSA 4FIBA 5LJ5e 4C92D 1QP2A 4XAXB 2CS7A 5FU6C 3J81E 2QEXT 5GMKl 1BIBA 1HK9A 1YITT 1XOVA 2E70A 2X4YA 4OF1A 1YI2A 3BDLA 3E19A 2E65A 5D6XA 5FU7C 5LJ5h 3OS2A 3HFOA 2QQRA 4IUVA 3CC4T 3CCET 4M7DE 2A3LA 2FL7A 4EMHA 4EDUA 1M1GA 4M75B 3I55T 5L8RE 3LGLA 1VQNT 3L2WA 4A4GA 2MMPA 4FM4B 4JJNK 3JCMg 4J7IA 4ZN1A 2RI3A 4M7AC 3OA6A 1R8OB 3HRUA 2DZ9A 4XU3A 3G6ET 2G3RA 4A53A 5KE3A 3JCMb 2K5FA 3BFMA 3BW1A 2M9UA 4DOWA 3V8KA 1FWZA 4JS5A 3CEYA 1BI2A 4EMGA 4OGCA 5LL6S 3CXCS 1KQSS 4FU6A 4C92A 1N8RU 3L42A 3KXTA 2LCLA 2KSSA 2KY9A 5GAN2 5GAN7 1YHQT 1Y96A 2VV5A 4NL2A 3MHXA 2FB7A 2F5KA 4OGEA 3QG1A 3JAME 3OBYA 2DD5A 2D0QB 4ZGEB 3FLGA 1Q81U 4MMKA 3X20B 3CCVT 2HBPA 4BI8B 4C0FA 3JCMP 1VQKA 3F70A 3V7CA 3V8JA 4C8QC 4X9CA 2KDSA 3JB9F 2RH2A 5C0MA 3JRZA 3TCJA 3JB9D 3S6WA 2RHZA 3A8MB 4OVAA 2JN0A 2RHUA 2FVUA 1IREB 3CCJT 3TU4K 3RKWA 3RIRA 3OYAA 1N9SA 3M56A 1WQWA 3CCQA 3QO3A 3M55A 1MHNA 1M9SA 3A8LB 3QIIA 2ZPEB 2DK3A 1QP3A 1VQ9A 1UEBA 3C4SA 3CC2A 4M77G 4QW2A 4B9WA 3CCLT 3OYNA 3JCMe 2ZGWA 2XG8D 4M78D 3OS5A 1FXXA 4M75E 1QVGA 2EQUA 2P0KA 3N5BB 1N9RA 5CKBA 5DM7R 3META 3JCMh 5CQXA 3MEWA 2GFUA 2RB6A 2Y4YA 3QHSA 5M9OA 4XU0A 4J83A 1GXIE 5CQYA 4PJOG 3SWNA 1VUBA 2PVGB 2V8IA 2L8DA 4OB2B 4TVRA 5HK3A 3PIOA 2DZCA 4J7FA 3CMET 4BE1A 2XDPA 3OYGA 4C5EA 2RK2A 4M77A 2OTLT 2D9TA 1KD1U 3M57A 1XTDA 2VYTA 4C92B 1YIJA 4A54A 4LDYA 4PNOA 3CBPA 3QPHA 1VQOT 2DIGA 3PMTA 1W4SA 1Y96B 2E6NA 4IUQA 3CMAA 2IG0A 4M7AF 2YLBA 4PL6A 3NFCA 1MGQA 4M7AD 4OMFB 4PJOA 2RI5A 1BKBA 1I5LA 2M0OA 4XK8E 2FYKA 3OSSC 5A0LA 3G4SA 4KULA 2GQVA 2EQKA 2BIVA 2P0PA 3JCMQ 5GAMd 1VQLT 1VQ6T 3HRTA 4ZTFA 4M7DC 4XQ3A 2DTOA 4II1A 3V8LA 1H3ZA 2QA4T 1N8RC 3E9GA 5HY6A 1Q86U 2K4YA 2DIQA 5LJ5d 4EMKA 2DXUA 2DVEA 3CC4A 1VQMT 4V2SA 3CBMA 3X26B 3HP9A 3JSCA 4HA8A 1OI1A 4FT2A 2LVMA 2JNGA 1VIFA 3I55A 3LWIA 1Q81C 1VQNA 2DXBA 3CXCA 3L2UA 3QJ6A 4C0DB 2R5MA 5DLQE 5GAN4 2O4XA 3GNGA 5GAOl 5LJ3g 4C8QF 4F7UF 5GANf 2HD0A 1B34B 4BACA 1D3BA 4C8QD 2RHYA 1QVGS 2XDBA 1NE8A 3M4YA 2JTFA 4OB3B 4RG2A 4HCZA 5LJ3j 5GANg 3M58A 2EWNA 2E41A 3H8ZA 5CKFA 2HQXA 4BE2A 1VQ7T 2RK1A 2RD1A 4HKEA 1XNIA 3FJPA 4XTVA 3PMIA 3M9QA 1KQ2A 3JB9H 4LDXA 3SWNC 1YHQA 4MDWA 4M77B 5AYFA 2LC4A 4HT8A 3CCUT 2EIFA 4C92E 4JLGA 4N0AA 3CPFA 5CIUA 5GAMh 4RKUE 3OYIA 5GAOm 2NLUA 3ME9A 2B8AA 5GAN6 1K73U 2PVDB 1YJ9T 5GAOr 2D6FA 2ZCFB 4QVZA 4QVDA 3MEUA 3CD6T 4Y28E 4FL6A 5KCOA 2EAYA 1Q7YU 4A4HA 3OYFA 3QSUA 4OB1B 4PJOB 1QVFS 4M78B 2WSFE 2LRQA 2ZPGB 3MO8A 3PFSA 4IKFA 2DD4A 1M1FA 2JTMA 2LTOA 5GMKi 4C92G 1YBYA 2MWPA 2MI6A 5GAOp 2DPPB 1KD1C 5IT9E 1G3YA 3SB2A 3QZ9B 4FT4A 4M75C 4O6JA 3GOXA 2K3XA 3VKIA 4PLLA 1M4ZA 4DOVA 2ZPFB 3OYBA 3E9FA 3DB3A 3L2RA 3WVDB 1BI0A 4EMKB 3PTAA 2DEQA 1S72T 3VJPA 3CCLA 3PIPA 3LGFA 3QJYA 3V7RA 4GLKA 3VV0A 2R5AA 5CKDA 2X4XA 4XTZA 3PNWC 3PT9A 2EJ9A 3RESA 3JCMd 2K5IA 1Q82U 2EJFA 2L3RA 2O4XB 4M7DF 4IURA 5FRMA 4BD3A 2CZ1B 1D3BB 4M7DD 4Q5WA 1JRIA 3CMEA 2CGHA 1Q86C 2DXTA 2OTJT 3A5ZB 1LJOA 2EYQA 2RJFA 3C12A 2GCXA 3E1SA 3MP6A 4C0GA 4UC4A 3HKSA 3RKXA 3JCMW 2OTLA 2QTXA 3C94A 3FRNA 3X25B 2MF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZFJ A;  2CS7 A; 
#chains in the Genus database with same CATH topology
 1I1J A;  1VQ5 A;  2VXE A;  4M77 E;  4IUT A;  1ABO A;  3HPW A;  5FRO A;  2YSQ A;  5KYU B;  2XU8 A;  5A0D A;  4IUU A;  3VS4 A;  4KUD K;  2E12 A;  2J6F A;  4L6V 5;  2AIR B;  3JB9 I;  1TH7 A;  3UF4 A;  4HCB A;  1KQS P;  2AZS A;  3SDZ A;  3OW2 P;  3X28 B;  4VUB A;  1Q7Y C;  2JOY A;  2KNB B;  2QDY B;  2JVV A;  3A8G B;  3QDR B;  5HKC A;  2DXC A;  2CH4 A;  4RMO A;  2M1H A;  4JS4 A;  4MDX A;  2YUN A;  4B9X A;  1N8R R;  3J80 E;  3CC7 T;  1C1A A;  3GPL A;  1K0S A;  1Z9Z A;  4OMQ A;  1YCS B;  3ER0 A;  1WHL A;  4RTY A;  1U1T A;  2DBK A;  3ZBD A;  1D1C A;  3O8V A;  5GAM f;  4M7A G;  4RCB A;  1YIT A;  3HHT B;  1WYX A;  2BKD N;  2FO0 A;  1X43 A;  2O01 E;  2OAW A;  1JJ2 S;  2I0N A;  3EG1 A;  3DKM A;  1IO6 A;  4LD9 K;  3I35 A;  4FYY B;  4QQG A;  3A8O B;  1ZA2 B;  2YRV A;  1YJN Q;  3INZ A;  4ATO A;  3NTH A;  4E7J A;  2PVO B;  2MWO A;  1LNX A;  4NOY A;  1M27 C;  1KC8 C;  2OX7 A;  1G3T A;  2JZ2 A;  4C8Q G;  2MPX C;  1OZ2 A;  1B07 A;  2PQW A;  2HBW A;  2DBM A;  4NL3 A;  2EFI A;  1V29 B;  1MNE A;  1M90 U;  3VUB A;  1TU0 B;  3OW2 A;  2X51 A;  2LQK A;  3R6O A;  2L5Q A;  2X3X D;  3EFO A;  1PRL C;  2DVJ A;  3UPU A;  5GMK h;  4PJO C;  1YI2 Q;  4ELZ C;  1JBM A;  2BE7 D;  3CCJ A;  2MYS A;  3L2Q A;  4IIO A;  4N4G A;  2HNI A;  2XK0 A;  2CYZ B;  4J6X A;  1LOJ A;  2ED1 A;  4EMK C;  2E5K A;  1B3Q A;  1X69 A;  1ZBJ A;  3REB B;  4DQ2 A;  5GAN e;  1O9S A;  3JCM f;  1QW1 A;  2V8K A;  2A0F B;  4M7A B;  3S3N A;  3RMS A;  2VB6 A;  2EW3 A;  3KUF A;  1PSF A;  1UGP B;  3CCM A;  1H3H A;  2CRE A;  3VU3 C;  2CZ6 B;  4IIM A;  1WHM A;  3CCR T;  2E6Z A;  5CKH A;  3CPW S;  4Y91 A;  4P5N A;  2V1R A;  3JCM X;  1VQL A;  2LNV A;  2PUK B;  1OUL A;  3CCQ Q;  2HKQ B;  4Z88 A;  2HQE A;  3UA7 A;  2HL5 C;  4C8Q B;  2LJ0 A;  2GTJ A;  1MMN A;  2H3E B;  3VS0 A;  4FW2 A;  3OYK A;  2DAQ A;  4LDW A;  2DRM A;  1ZQ1 A;  1WA7 A;  3KBG A;  1NYG A;  5IN1 A;  1W2B A;  3QYG B;  3Q1J A;  1PG5 B;  2CT3 A;  4OB0 B;  1X6G A;  4XU2 A;  2HCK A;  1AHJ B;  4XTX A;  1ZHI A;  2R57 A;  2H3J A;  3OMG A;  2KMT A;  5GJW B;  1HD3 A;  1E6H A;  1Z9Q A;  3CMA Q;  1NEB A;  2O31 A;  2BTT A;  2CUB A;  5IXF A;  1VQP A;  1PHT A;  4XTY A;  3JB9 J;  4C5G A;  3G4S Q;  2K2V A;  2M16 A;  3A98 A;  4J9I A;  5GAN 8;  2RHX A;  4KBM B;  2DKG A;  1RAG B;  1FX7 A;  4O5V A;  1YIT Q;  4QQ6 A;  4FSX A;  3CC4 Q;  2F1L A;  4YTL A;  2K3Y A;  3FDR A;  2M0Y A;  3I55 Q;  1VQN Q;  3FEO A;  5IAY A;  4J9G A;  4ME7 A;  2DL5 A;  3OMC A;  3EGD B;  3EH1 A;  1NM7 A;  1WHK A;  2ZPB B;  2C06 A;  1T0H A;  2PUO B;  4F7U G;  5I2S A;  3JCM J;  4RTX A;  2QDL A;  4DBQ A;  4C5I A;  1WJR A;  1KD1 R;  3JCM V;  2AT1 B;  3RUX A;  1QCF A;  2HQH A;  4ZGD B;  2LX7 A;  2X4J A;  1RAB B;  1SG5 A;  2AHJ B;  4KUI A;  1IRX A;  2K57 A;  3L1A A;  2LJ3 A;  2KVQ G;  1VYV A;  4BI4 A;  5I21 A;  3CCJ Q;  1GL5 A;  2QQA A;  4LN2 A;  3SHW A;  4J5Y A;  2YUQ A;  2QEX T;  2E70 A;  3OS2 A;  1FMW A;  3CCE T;  3HFO A;  2QQR A;  4IUV A;  4M7D E;  2ROL A;  1TOV A;  2V26 A;  3M0U A;  2P4R A;  5KYY A;  2MMP A;  4JJN K;  1NJI R;  4M7A C;  1R8O B;  5KE3 A;  1QVF P;  1TXQ A;  1MV3 A;  3RNJ A;  3V8K A;  1FWZ A;  1UDL A;  4LNP A;  2JMC A;  2ECZ A;  1KQS S;  1N8R U;  2KY9 A;  5GAN 2;  3FJ5 A;  5GAN 7;  1YHQ T;  2VV5 A;  1TUD A;  3JAM E;  2LQN A;  3EGX A;  2DD5 A;  4ZGE B;  3FLG A;  1VQ6 Q;  1VQL Q;  1C0M A;  4MMK A;  3X20 B;  2HBP A;  4C0F A;  3V7C A;  3V8J A;  4C8Q C;  2KDS A;  1AZG B;  5C0M A;  3S6W A;  4OVA A;  2JN0 A;  2RHU A;  3TSW A;  1Y57 A;  3M56 A;  4RTZ A;  3A8L B;  4CC2 A;  2K7A A;  3LH5 A;  2DK3 A;  3C4S A;  3CC2 A;  1VYT A;  4M77 G;  1K8A R;  2EQU A;  5ECA A;  2ED0 A;  5IHN A;  3JCM h;  2NUP B;  2GFU A;  2KR3 A;  1VUB A;  1HYO A;  4TVR A;  2HDA A;  1AWW A;  4BE1 A;  2RQU A;  1G2B A;  3H0I A;  1D1B A;  3M57 A;  1VYU A;  1QKX A;  1XTD A;  3CBP A;  4K11 A;  4OMF B;  1TS9 A;  4ESR A;  2RI5 A;  1BKB A;  3BE3 A;  2KRN A;  2BIV A;  3JCM Q;  3HRT A;  2QA4 T;  2E3I A;  5HY6 A;  1S72 Q;  5LJ5 d;  3X26 B;  3JSC A;  2O9V A;  6AT1 B;  3LWI A;  1VIF A;  3CXC A;  1PC0 A;  1I0C A;  1YP5 A;  4F7U F;  1OX8 A;  1D3B A;  2RHY A;  2XDB A;  1NE8 A;  2RN8 A;  2W10 A;  2JTF A;  4RG2 A;  5GAN g;  3M58 A;  1JJ2 P;  2EWN A;  3H8Z A;  4OMO A;  5CKF A;  1VQ7 T;  2RD1 A;  4PFO A;  4XTV A;  3PMI A;  3JB9 H;  4LDX A;  1D0X A;  1PD0 A;  1IHV A;  4M77 B;  1D1A A;  2X3W D;  4C92 E;  4N0A A;  4RKU E;  2VAS A;  2ZCF B;  4QVZ A;  4Y28 E;  1PNJ A;  3MO8 A;  2DD4 A;  5GMK i;  1YBY A;  5IT9 E;  1WXU A;  4FT4 A;  4DOV A;  3E9F A;  3DB3 A;  3CCL A;  4KGX B;  2DEQ A;  3VJP A;  3PIP A;  1PCX A;  3QJY A;  4Z8A A;  3V7R A;  4A63 B;  2Z0W A;  3PNW C;  2RQV A;  4AMC A;  1J3T A;  2K5I A;  2O4X B;  2FEI A;  3CC7 Q;  3RBB B;  1RUW A;  1TUC A;  2ABL A;  3CME A;  2OTJ T;  1EX4 A;  1ZA1 B;  1LJO A;  1U3O A;  4UC4 A;  2OTL A;  2QTX A;  3FIF A;  2FZG B;  2EGA A;  3DLL A;  2FZK B;  3M0P A;  3RMQ A;  1WPY A;  2EJG A;  2XIC A;  2KRS A;  2QQB A;  3UWN A;  1MMD A;  1FYN A;  3MP1 A;  4IUP A;  4M78 E;  3JB9 G;  1UGQ B;  4D8D A;  1B34 A;  1OYX A;  5KH6 A;  2X4W A;  3CPW P;  2DIL A;  1M2O A;  1M90 C;  4PJL A;  3P8D A;  4EIK A;  1KIK A;  2M51 A;  1WXB A;  4BY6 B;  2ROT A;  1N5Z A;  4X34 A;  1U1S A;  3CCM T;  3U23 A;  2GBQ A;  1MMA A;  2RHI A;  1RAE B;  4M75 F;  1AD5 A;  4KRT A;  1GCQ A;  3VYG A;  2EVR A;  1YWP A;  2E64 A;  4M78 A;  4MZM A;  4HCK A;  5CO7 A;  3CCU A;  2EYY A;  1ARK A;  4A4F A;  1NZ9 A;  1Q82 C;  2QEX A;  4CI0 C;  3OY9 A;  1G3S A;  1NPP A;  2E1H A;  3CCE A;  1VQK T;  3J7A F;  2R58 A;  1BIA A;  2KYB A;  3ZEH A;  3MP8 A;  2VGM A;  2K2M A;  4QQD A;  4F14 A;  3H0H A;  4L5G A;  1WHJ A;  1NJI U;  1ABQ A;  1K9A A;  4AFS C;  3T9N A;  1SKU B;  1H64 1;  4ZTJ A;  4J9E A;  3OYH A;  3CCR Q;  3EHR A;  1VQP T;  2RPN A;  4M77 C;  3G71 Q;  4E7K A;  1H92 A;  1RAD B;  2PNI A;  5GMK e;  2LNH B;  2YUP A;  4F04 B;  1AWO A;  5IHI A;  4BI3 A;  3PVL A;  1C6V X;  1ZBX A;  3QUI A;  4JJB A;  4F7U A;  3OSV A;  2DF6 A;  3P8B B;  1M3B A;  1RAC B;  1IZ6 A;  2KXC A;  4X9D A;  1M1K U;  2Y90 A;  3BY7 A;  1BU1 A;  2HEQ A;  2H8H A;  5IHK A;  2JS0 A;  2D0N A;  2DO3 A;  2X9H A;  1K8A U;  3I56 A;  4JJC A;  3H6Z A;  2FRY A;  3KFV A;  5LJ3 h;  2AKK A;  1NBE B;  4ELY C;  1WJQ A;  2SEM A;  4JRQ A;  4HT9 A;  1W70 A;  2LT4 A;  1OOT A;  4M7D G;  2GNC A;  3OYY A;  1SSF A;  2CKK A;  4JPB W;  4KT0 E;  5GMK m;  4AFZ C;  5GAN 5;  3OS0 A;  1SRM A;  2NUT B;  4DBH A;  3M59 A;  3EFR A;  5J26 A;  5I22 A;  4PJJ A;  1X01 A;  2F5T X;  1M3C A;  2QA4 A;  4C0Z A;  1K9M U;  2DET A;  4GLM A;  3M53 A;  5FLX E;  4WCI A;  3M0R A;  3QXE B;  1PKT A;  2RI2 A;  3EG9 A;  2K5L A;  2M02 A;  2LX9 A;  3EFS A;  5FWC A;  1GCP A;  4BY6 C;  4BB7 A;  4PJO F;  4WF2 A;  1Y07 A;  2E5Q A;  1VQ7 A;  2RJE A;  4ZGJ B;  4C5H A;  3UT1 A;  1G8X A;  1M8M A;  1VIE A;  3CBO A;  1JO8 A;  4N4H A;  1M2V B;  1IGQ A;  3ZFJ A;  1JEG A;  2E3H A;  2XD0 A;  2J06 A;  2RQT A;  1NLP C;  4J9H A;  3NHN A;  2DYB A;  2RJD A;  1O75 A;  2QEX Q;  1AOJ A;  1HXD A;  4L59 A;  1IHW A;  1X6O A;  1UJY A;  2RF0 A;  3CCE Q;  2V1Q A;  1KC8 R;  3QDF A;  5LJ5 g;  3EGX B;  1UGR B;  4E7Z A;  4F16 A;  4M7D B;  1S1N A;  4M75 A;  2PU9 B;  5LJ5 j;  2RM4 A;  3CC2 T;  3MEA A;  3SEM A;  4KH0 B;  1MV0 B;  2DTI A;  2L2P A;  1OV3 A;  1N6A A;  2GGR A;  3G1J A;  2A08 A;  1I8F A;  2G6F X;  5GAN d;  1E7O A;  2RJC A;  2OTJ A;  1KQS A;  3AHU A;  2DE0 X;  4HXJ A;  4GBQ A;  2BZY A;  1YHQ Q;  2ZPI B;  1I4K 1;  3NGP A;  2MOX A;  1MMG A;  2VGN A;  2P4T A;  2FPE A;  2KEA A;  3L2V A;  1YJW A;  5GAM e;  1ZX6 A;  3ASK A;  4RCC A;  2RQR A;  1XQH A;  1T3S A;  4C92 D;  4XAX B;  3MKD A;  3J81 E;  1XOV A;  1TUG B;  4OF1 A;  2E65 A;  5D6X A;  1GBR A;  2NUZ A;  2FL7 A;  2O2O A;  1M1G A;  5L8R E;  2YXY A;  4A4G A;  4FM4 B;  2RMO A;  1UE9 A;  4AG2 C;  4A53 A;  3JCM b;  3BFM A;  3QWY A;  1I07 A;  1K4U S;  1BI2 A;  1VQ5 Q;  1A0N B;  4OGC A;  5KYX A;  3KXT A;  2L3P A;  4NL2 A;  3MHX A;  2FB7 A;  4OGE A;  1SRL A;  3QG1 A;  3OBY A;  1RAH B;  2KBT A;  2K79 A;  3CCV T;  4BI8 B;  1VQK A;  3JCM P;  2QA4 Q;  4X9C A;  3O5Z A;  2RH2 A;  4DBF A;  1NEG A;  3A8M B;  2FVU A;  3TU4 K;  3RIR A;  3OYA A;  1YN8 A;  3QO3 A;  1IXD A;  3EG0 A;  1VQ9 A;  4FYX B;  3CCL T;  2C0T A;  4PJM A;  3JCM e;  2ZGW A;  4Y92 A;  4M78 D;  1KJW A;  2P0K A;  3N5B B;  1N9R A;  1VQ7 Q;  2Y4Y A;  3QHS A;  4HVV A;  2J6O A;  4OB2 B;  3PIO A;  3CME T;  5IH2 A;  3OYG A;  3JV3 A;  3UAT A;  2OTL T;  2VYT A;  4C92 B;  1YIJ A;  1LCK A;  4LDY A;  3QPH A;  1QWE A;  9ATC B;  1VQO T;  3PMT A;  1W4S A;  1Y96 B;  1OPL A;  4M7A F;  2QAZ A;  1LVK A;  2YLB A;  4PL6 A;  2FZC B;  4PJO A;  2KRO A;  1I5L A;  4ZNX A;  3OSS C;  2LZ6 B;  3VS1 A;  2GQV A;  2EQK A;  4M7D C;  1H3Z A;  2DTO A;  1R77 A;  1UUE A;  3NPF A;  1Q86 U;  4EMK A;  2LVM A;  2KI7 A;  1Q81 C;  2MCN A;  2DXB A;  3QJ6 A;  5FW9 A;  3GNG A;  2JS2 A;  5GAO l;  4C8Q F;  1B34 B;  4BAC A;  2OTJ Q;  1ZSZ A;  4OB3 B;  4HCZ A;  1MND A;  2RNA A;  2E41 A;  2HQX A;  2CSQ A;  2RK1 A;  4PFP A;  1W6X A;  2PZ1 A;  2JXB A;  2QG9 B;  1AVZ C;  5AYF A;  1NYF A;  4HT8 A;  3CCU T;  5CIU A;  3CPF A;  5GAM h;  3OYI A;  5GAO m;  2B8A A;  4E6R A;  5KYU A;  5GAN 6;  4QVD A;  5KCO A;  4FL6 A;  1Q7Y U;  3QSU A;  4M78 B;  2LRQ A;  2ZPG B;  4IKF A;  1M1F A;  2JTM A;  2W0Z A;  1PM3 A;  2CUD A;  2CP6 A;  2MWP A;  3VRY A;  5GAO p;  1WIE A;  2DPP B;  1KD1 C;  3QZ9 B;  3GOX A;  2K3X A;  1TG0 A;  1X6B A;  2D6F A;  1RLQ C;  3WVD B;  2LMJ A;  3CCM Q;  3VV0 A;  5CKD A;  2J6K A;  2X4X A;  1UEC A;  2KYM A;  1HSQ A;  4AFQ C;  1XJW B;  2EJF A;  3HTR A;  2EYW A;  1WZO A;  4LUD A;  3RDV A;  1IGU A;  3C12 A;  3MP6 A;  3RKX A;  1WLP B;  3C94 A;  3X25 B;  4J9F A;  2B86 A;  4A4E A;  1VQ8 T;  4N4I A;  1VQK Q;  1M1K R;  2XHC A;  2VWF A;  1JB0 E;  3VYH B;  1KC8 U;  1M8V A;  2HKN A;  1BBZ A;  2DX1 A;  1G5V A;  1YI2 T;  3I56 T;  4BUG A;  1K73 C;  5GAO q;  2BUD A;  1YWO A;  2AZV A;  2EGC A;  2QQ9 A;  2J7I A;  4PKC C;  5CK9 A;  1VQP Q;  2HMA A;  4OMN A;  1Y71 A;  3V7S A;  2F69 A;  2RO0 A;  4ZN3 A;  4C92 C;  3QBY A;  4M75 D;  5C6S A;  2O88 A;  1QVF A;  1FMV A;  1WX6 A;  2YLC A;  1K9M R;  1EFN A;  2EQI A;  3GBQ A;  4JRK A;  4D8K A;  1YJ9 A;  2J05 A;  2FHD A;  1ZUU A;  2WSE E;  5D6Y A;  3HL8 A;  1M5Q 1;  2JM8 A;  4BDZ A;  5LJ5 f;  3OYM A;  2FRW A;  3C0C A;  2EYX A;  1RAF B;  2DA9 A;  3M54 A;  1UTI A;  2EPD A;  4FSS A;  4E47 A;  4FYV B;  3REA B;  2I2L A;  4M7A A;  3MJX A;  5DLO A;  1PKS A;  3FB9 A;  5GAO n;  3EG9 B;  2DL4 A;  2DL7 A;  5GAN j;  5CCA A;  5LJ3 d;  3FC3 A;  2IPO B;  4EPC A;  4DA4 A;  1W2B S;  2P84 A;  4Z89 A;  3HRS A;  3M4G A;  2X35 A;  1VOM A;  2FPF A;  2JJ9 A;  3CCV A;  5HCK A;  1MUZ A;  1GCQ C;  4J6Y A;  2LDM A;  4PK4 A;  4C8Q A;  1QQJ A;  2A7Y A;  2XID A;  4M78 C;  3QYH B;  2WAC A;  2MK5 A;  2QI2 A;  4XTW A;  1OEB A;  2KAF A;  2OI3 A;  4JJD A;  4RUG A;  1NPR A;  5LJ3 e;  3AT1 B;  1TTH B;  5FU7 B;  3GF5 A;  2KK4 A;  5DY9 A;  1UGS B;  2KE9 A;  1D0Z A;  2EGE A;  3VS7 A;  5A0G A;  1R0C B;  4CC4 B;  4Z02 A;  1Y0M A;  1X75 C;  2JMA A;  1WDX A;  1VQO A;  3UDC A;  1N27 A;  1AEY A;  1UB4 A;  2XKO C;  2BZX A;  1OU9 A;  4NS5 A;  1YJW T;  4OMP A;  1OPK A;  2FPD A;  4MZT A;  1JJ2 A;  5KCH A;  1UG1 A;  3P8H A;  2DL8 A;  3EFO B;  2COZ A;  3OB9 A;  2DM1 A;  2L3Q A;  1K76 A;  3CC2 Q;  4CC3 A;  2O9S A;  4LUE A;  2KGT A;  4M77 F;  4RG8 A;  1GRI A;  4E7S A;  2EKH A;  4JZ3 A;  1YNZ A;  1BI3 A;  1UHF A;  2DTH A;  2XDD A;  3LWH A;  3NTI A;  4PJO D;  1QCO A;  2KQW A;  2LP5 A;  8AT1 B;  1Y7X A;  3PGG A;  2LCC A;  2E10 A;  5CR2 A;  2QK0 A;  2E4H A;  3VS2 A;  1ZSG A;  2PTK A;  3H0F A;  3TRE A;  2EQM A;  3WVE B;  3CCS T;  1ZUY A;  2P0Q A;  4F7U E;  4RTU A;  5FRN A;  2L3S A;  1NLO C;  1VQ9 T;  2IVW A;  1T0J A;  3CQT A;  3URG A;  5D7U A;  3EG2 A;  2JT4 A;  3TVT A;  1QCN A;  1KQ1 A;  3CPW A;  2MAM A;  1YJN A;  5I11 A;  3G7Z A;  1RI0 A;  1RL2 A;  2JUF A;  5KE2 A;  3ULR B;  4BDY A;  1VQ8 A;  2GQI A;  3CCV Q;  1YIJ T;  2VVK A;  4JZ4 A;  2YHT A;  4JRP A;  2HSE B;  4QT7 A;  2CP3 A;  2LCS A;  2HZY A;  4DEY A;  1G3W A;  2DNU A;  4JRI A;  3EHQ A;  1CSK A;  2JM9 A;  1Q86 R;  1CKB A;  1WJS A;  4FIB A;  1QP2 A;  2QAS A;  2CS7 A;  5GMK l;  1HK9 A;  2LJ1 A;  3CCL Q;  1YI2 A;  3BDL A;  3E19 A;  5FU7 C;  5LJ5 h;  2A3L A;  1G83 A;  3LGL A;  3L2W A;  2NUP A;  4J7I A;  4ZN1 A;  1RI9 A;  1SPK A;  1K1Z A;  3HRU A;  3CME Q;  3G6E T;  1UGV A;  2K5F A;  3BW1 A;  1BB9 A;  4DOW A;  2YT6 A;  2F2X A;  2OTL Q;  3NMZ C;  5KYN A;  4EMG A;  5LL6 S;  3CXC S;  1VQO Q;  2QTV A;  1RAA B;  3L42 A;  2LCL A;  1ZSZ B;  2DEU A;  2F5K A;  5AT1 B;  1Q7Y R;  1M30 A;  2CP7 A;  4ANJ A;  3F70 A;  3JB9 F;  4HVU A;  3JRZ A;  3TCJ A;  1NG2 A;  1IRE B;  1N9S A;  3CCQ A;  2QYZ A;  1D09 B;  1M9S A;  3QII A;  1WHH A;  1UJ0 A;  1UEB A;  4QW2 A;  4B9W A;  2OJ2 A;  3OYN A;  1SEM A;  2XG8 D;  4M75 E;  1JXO A;  3EGU A;  5DM7 R;  5KYY B;  3MET A;  4X1V A;  2DMO A;  3MEW A;  4J9C A;  5M9O A;  4XU0 A;  4J83 A;  1GXI E;  5CQY A;  3SWN A;  2V8I A;  1QMC A;  2BZ8 A;  2YRD A;  4DBR A;  1UHC A;  2L0A A;  2RK2 A;  1OQK A;  4M77 A;  2A36 A;  3CCU Q;  4A54 A;  2E6N A;  4IUQ A;  3CMA A;  2IG0 A;  1V76 A;  2DLP A;  3NFC A;  3D7S B;  2C0O A;  4M7A D;  2LQW A;  2M0O A;  4XK8 E;  3G4S A;  2NYS A;  5GAM d;  4J9D A;  4II1 A;  4HVW A;  3V8L A;  1N8R C;  3E9G A;  2DVE A;  3CC4 A;  1VQM T;  2A37 A;  2CDT A;  1WXT A;  1OI1 A;  4FT2 A;  3I55 A;  1VQN A;  1KSW A;  2SRC A;  4C0D B;  2O4X A;  5LJ3 g;  5GAN f;  4C8Q D;  1QVG S;  5KYW A;  5LJ3 j;  3UA6 A;  4BE2 A;  5L23 A;  4HKE A;  1XNI A;  1HJD A;  1KQ2 A;  3M9Q A;  1VQ8 Q;  3EG3 A;  4B6M A;  4MDW A;  2YWW A;  3H9N A;  1JU5 C;  2DYI A;  1YJ9 T;  5GAO r;  4WTO B;  3CD6 T;  2ATC B;  3OYF A;  1WHG A;  1W2B P;  1SSH A;  1U06 A;  2CSI A;  4C92 G;  5GJV B;  3I56 Q;  1G3Y A;  4CC7 A;  4O6J A;  4PLL A;  1M4Z A;  1B7T A;  2D8H A;  2DER A;  1BI0 A;  1TSF A;  1AWX A;  2EJ9 A;  3JCM d;  1JQQ A;  2ZAE A;  1IB8 A;  1Q82 U;  4M7D F;  5FRM A;  4BD3 A;  2CZ1 B;  1D3B B;  1JRI A;  2CGH A;  2DXT A;  4LE9 A;  3A5Z B;  1U5S A;  2EYQ A;  2RJF A;  1ZSZ C;  2GCX A;  3E1S A;  4C0G A;  3HKS A;  3JCM W;  3FRN A;  4LDV A;  2CP2 A;  8ATC B;  4XTU A;  4R0K A;  3M5A A;  1VQ4 T;  3PE0 A;  3CCS A;  2C0I A;  1P92 A;  2V8J A;  3G71 T;  5EC7 A;  1VQ6 A;  2CP5 A;  4OMM A;  4PJO E;  1FMK A;  4R55 A;  3RR6 A;  4MML A;  2CZ7 B;  3WXM B;  3OYD A;  2BE9 B;  4PLI A;  3RER A;  1Q95 G;  1WI7 A;  3LH0 A;  2D8J A;  4M78 G;  2OAU A;  2VUB A;  1QKW A;  2RQW A;  3OYL A;  4J6W A;  4HCC A;  4JUV A;  2RA2 A;  5CAI A;  3OYE A;  4A4K A;  4D6W A;  3MPU B;  3GNF B;  4E2F B;  1YCY A;  1E6G A;  2JW4 A;  3HFN A;  2QQS A;  1Q81 R;  2HAX A;  1RAI B;  3VS3 A;  5CKE A;  5GMK j;  3QKJ A;  1PSE A;  1EIF A;  2KXD A;  3OYJ A;  1KG1 A;  4KH1 B;  1BI1 A;  3M0Q A;  2GFA A;  1PRM C;  4BE0 A;  2CZ0 B;  2D1X A;  4R56 A;  4E7I A;  2KRM A;  4XU1 A;  3G6E A;  4C0D C;  3PVQ A;  1QVP A;  3VS6 A;  1S72 A;  3DB4 A;  3SD4 A;  3JCM c;  1PWT A;  4LD6 A;  1X2K A;  3L2Z A;  1KHI A;  3ZL7 C;  5D6W A;  1WQ7 A;  1M3A A;  3OYC A;  2DFU A;  3I5S A;  1YJW Q;  3VUZ A;  2EKO A;  2NUT A;  1H8K A;  3I9Q A;  3LX7 A;  1BYM A;  1F1B B;  1I5O B;  5A2Q E;  2QXF A;  2DJZ A;  2IIM A;  3A8H B;  1OU8 A;  4PJN A;  3MCA B;  3GIB A;  1TWB A;  5FU6 B;  4C92 F;  3OBW A;  2WSC E;  4FCY A;  3LYI A;  3M0T A;  4OP0 A;  4MZP A;  3OS1 A;  3QZ5 B;  3GLX A;  1WFW A;  2YRC A;  3H41 A;  1KHC A;  5GAN h;  2NWM A;  4PFZ A;  2EYZ A;  1YJN T;  1M2V A;  3LW5 E;  4AT1 B;  3LLR A;  3MEV A;  5HK0 A;  5J3B A;  3CC7 A;  2VKN A;  1U8R A;  1I81 A;  1BK2 A;  2CT4 A;  4E7H A;  4J9B A;  5CVI A;  1K73 R;  1NJI C;  4N0A C;  3CCS Q;  3OW2 S;  2YUO A;  3TEE A;  3HSB A;  2GF7 A;  4RTW A;  4M7D A;  4F7U B;  2Y4X A;  1VQ9 Q;  3CXC P;  1VQM A;  2XI9 A;  3GP8 A;  3QWX X;  3RKY A;  3TSZ A;  4M77 D;  4RTV A;  3TQ7 P;  1K0X A;  3BDU A;  1ACM B;  4M78 F;  2VXF A;  3S3M A;  2LQ8 A;  2HSP A;  7AT1 B;  3I5R A;  4M7A E;  1M1K C;  5I2M A;  3VRZ A;  1ZUK A;  3EAE A;  1YIJ Q;  2VC8 A;  2LT1 A;  3X24 B;  2K3B A;  4F17 A;  2YDL A;  2ESW A;  1PD1 A;  1K8A C;  4M75 G;  2GTO A;  1WGS A;  2MIO A;  3CD6 A;  2FG0 A;  4JDS A;  4OML A;  2COW A;  4J8O A;  5GAM g;  1VQ5 T;  2ZZD A;  3IQL A;  5EG2 A;  5GAM j;  3OQ5 A;  4C8Q E;  3CCQ T;  1OX9 A;  1DJ7 B;  3VS5 A;  2L89 A;  2EBP A;  4QVC A;  1W1F A;  3G6E Q;  3EH2 A;  3DLM A;  5GAN 3;  2EQJ A;  3S3O A;  1R0B G;  2ZPH B;  4GY5 A;  1K9M C;  4FW1 A;  5LJ3 f;  3SFM A;  5J39 A;  1JXM A;  3A1P A;  4JLI A;  1OZ3 A;  1VQ4 A;  1T3L A;  4AG1 C;  1WNL A;  3SWN B;  3C95 A;  3NTK A;  4AFU C;  4E7L A;  3CCR A;  4CRI A;  3CMA T;  3G71 A;  1V1C A;  4LDU A;  1QVG P;  2F2V A;  3G4S T;  2DL3 A;  1CKA A;  1BCO A;  5LJ5 e;  5FU6 C;  3M0S A;  1AZE A;  1BIB A;  2JTE A;  1YIT T;  2X4Y A;  2F2W A;  2QGF B;  3CC4 T;  1VA7 A;  4EMH A;  4EDU A;  1SHF A;  4M75 B;  3I55 T;  1UFF A;  1VQN T;  3E2U A;  3JCM g;  4RTT A;  2RI3 A;  1SF9 A;  3OA6 A;  1GBQ A;  2DZ9 A;  4XU3 A;  2G3R A;  2M9U A;  4JS5 A;  3CEY A;  4FU6 A;  4C92 A;  1M90 R;  2COY A;  2KSS A;  1Y96 A;  5KYW B;  2D0Q B;  1Q81 U;  3EGD A;  1SHG A;  3JB9 D;  1QWF A;  2RHZ A;  1VQM Q;  3CCJ T;  3RKW A;  1WQW A;  4LXC A;  3M55 A;  3R6N A;  1MHN A;  2QGG A;  4FYW B;  2ZPE B;  5FWB A;  1QP3 A;  1KFZ A;  1Q82 R;  3OS5 A;  1FXX A;  1QVG A;  4KGV B;  5CKB A;  5CQX A;  2RB6 A;  4DEX A;  1QLY A;  2KT8 A;  4PJO G;  2PVG B;  2L8D A;  5HK3 A;  2DZC A;  4J7F A;  2XDP A;  4C5E A;  1GFD A;  5IXB A;  2D9T A;  1KD1 U;  1YJ9 Q;  5KYX B;  4PNO A;  3CD6 Q;  2DIG A;  1MGQ A;  1X27 A;  2FYK A;  5A0L A;  4KUL A;  2P0P A;  1VQ6 T;  1VQL T;  4ZTF A;  2CP0 A;  4XQ3 A;  2K4Y A;  2DIQ A;  2DXU A;  4QKU A;  4V2S A;  1RLP C;  3CBM A;  4HA8 A;  3HP9 A;  2K9G A;  2JNG A;  1AT1 B;  3L2U A;  2R5M A;  5DLQ E;  5GAN 4;  2HD0 A;  2AK5 A;  1BCM A;  1ZLM A;  2AKL A;  3M4Y A;  4M4Z A;  2A28 A;  2DJQ A;  3FJP A;  1VQ4 Q;  4ORZ A;  3SWN C;  1YHQ A;  2LC4 A;  2EIF A;  4JLG A;  1K73 U;  2NLU A;  3ME9 A;  2DRK A;  2PVD B;  2HL3 A;  4KGZ B;  3MEU A;  2EAY A;  4A4H A;  4PJO B;  1GFC A;  4OB1 B;  1QVF S;  2WSF E;  3PFS A;  2LTO A;  2XMF A;  2CH4 W;  2MI6 A;  1X2Q A;  3SB2 A;  4M75 C;  3VKI A;  2ZPF B;  3OYB A;  3L2R A;  4EMK B;  1D0Y A;  3PTA A;  1S72 T;  2KT1 A;  3LGF A;  4GLK A;  2R5A A;  4XTZ A;  3PT9 A;  3RES A;  2K6D A;  1YFN A;  2L3R A;  3THK A;  4IUR A;  4M7D D;  4Q5W A;  1Q86 C;  1AWJ A;  1EZZ B;  1LPL A;  1KK7 A;  2MF2 A;  2ENM A; 
#chains in the Genus database with same CATH homology
 4XTU A;  3FIF A;  2VXE A;  1VQ5 A;  3M5A A;  4M77 E;  4IUT A;  3DLL A;  4A4E A;  1VQ8 T;  1VQ4 T;  4N4I A;  3RMQ A;  1WPY A;  3CCS A;  2EJG A;  3HPW A;  5FRO A;  2XIC A;  2XHC A;  2QQB A;  1P92 A;  2XU8 A;  3UWN A;  2V8J A;  5A0D A;  3G71 T;  4IUU A;  3MP1 A;  4KUD K;  1JB0 E;  4IUP A;  3VYH B;  2E12 A;  1KC8 U;  1VQ6 A;  4L6V 5;  3JB9 I;  4PJO E;  1M8V A;  4M78 E;  4R55 A;  3JB9 G;  1UGQ B;  1TH7 A;  4HCB A;  1B34 A;  4MML A;  1OYX A;  1G5V A;  2CZ7 B;  5KH6 A;  3WXM B;  2X4W A;  3OYD A;  4PLI A;  3RER A;  3SDZ A;  1YI2 T;  1M90 C;  3I56 T;  4BUG A;  1K73 C;  3LH0 A;  5GAO q;  3P8D A;  2BUD A;  2QQ9 A;  4M78 G;  3X28 B;  4VUB A;  4PKC C;  4BY6 B;  1Q7Y C;  2OAU A;  2VUB A;  4X34 A;  2JOY A;  5CK9 A;  1U1S A;  2QDY B;  2JVV A;  3A8G B;  4J6W A;  3OYL A;  3CCM T;  3QDR B;  5HKC A;  4HCC A;  2DXC A;  1Y71 A;  4JUV A;  2RA2 A;  5CAI A;  3V7S A;  2F69 A;  2RHI A;  2M1H A;  4A4K A;  4RMO A;  3OYE A;  4JS4 A;  4B9X A;  2RO0 A;  4M75 F;  4MDX A;  4ZN3 A;  4D6W A;  4C92 C;  3J80 E;  3CC7 T;  3QBY A;  4M75 D;  3VYG A;  5C6S A;  3GPL A;  3GNF B;  1QVF A;  1YCY A;  2E64 A;  4M78 A;  4MZM A;  3HFN A;  3ER0 A;  2YLC A;  5CO7 A;  2QQS A;  3CCU A;  2HAX A;  4JRK A;  1U1T A;  4A4F A;  1NZ9 A;  5CKE A;  3ZBD A;  2FHD A;  3O8V A;  3QKJ A;  5GAM f;  4CI0 C;  5GMK j;  3OY9 A;  4RCB A;  1G3S A;  2QEX A;  2WSE E;  1YIT A;  4M7A G;  5D6Y A;  3HHT B;  1PSE A;  1EIF A;  1NPP A;  2BKD N;  2E1H A;  3OYJ A;  3HL8 A;  3CCE A;  1M5Q 1;  1BI1 A;  2O01 E;  2R58 A;  1BIA A;  4BDZ A;  2GFA A;  3ZEH A;  1VQK T;  3J7A F;  3MP8 A;  5LJ5 f;  3OYM A;  2VGM A;  4BE0 A;  1JJ2 S;  2CZ0 B;  4QQD A;  4R56 A;  4E7I A;  3DKM A;  1KG1 A;  4LD9 K;  4L5G A;  3A8O B;  4QQG A;  3M54 A;  4XU1 A;  4C0D C;  3G6E A;  1QVP A;  4E47 A;  3DB4 A;  2YRV A;  3SD4 A;  2I2L A;  3JCM c;  1S72 A;  4M7A A;  3INZ A;  4LD6 A;  1NJI U;  4ATO A;  5DLO A;  3L2Z A;  3NTH A;  4E7J A;  2PVO B;  2MWO A;  1KHI A;  1LNX A;  3FB9 A;  3T9N A;  5GAO n;  4NOY A;  5GAN j;  1H64 1;  5D6W A;  5CCA A;  5LJ3 d;  1KC8 C;  4ZTJ A;  1G3T A;  2JZ2 A;  3FC3 A;  4C8Q G;  1WQ7 A;  1OZ2 A;  3OYH A;  4EPC A;  3OYC A;  4DA4 A;  4LDV A;  1YJ9 A;  1W2B S;  3VUZ A;  2PQW A;  2EKO A;  4NL3 A;  2EFI A;  1V29 B;  3HRS A;  1VQP T;  1M90 U;  3VUB A;  3M4G A;  4M77 C;  2X35 A;  4E7K A;  3OW2 A;  5GMK e;  3CCV A;  2LQK A;  3R6O A;  2L5Q A;  3LX7 A;  4BI3 A;  1BYM A;  5A2Q E;  3UPU A;  1ZBX A;  4J6Y A;  3QUI A;  5GMK h;  2LDM A;  2QXF A;  4C8Q A;  2DJZ A;  4F7U A;  3OSV A;  4PJO C;  2A7Y A;  1JBM A;  2XID A;  4M78 C;  3P8B B;  4ELZ C;  3CCJ A;  3QYH B;  2WAC A;  1IZ6 A;  3A8H B;  3L2Q A;  4X9D A;  2QI2 A;  3MCA B;  1M1K U;  3GIB A;  4XTW A;  2Y90 A;  2HNI A;  2XK0 A;  4N4G A;  5FU6 B;  4C92 F;  3OBW A;  2KAF A;  3BY7 A;  2WSC E;  1NPR A;  2CYZ B;  4J6X A;  5LJ3 e;  1LOJ A;  3LYI A;  4EMK C;  4OP0 A;  5FU7 B;  4MZP A;  3GF5 A;  2KK4 A;  5DY9 A;  1UGS B;  2DO3 A;  3OS1 A;  3QZ5 B;  1K8A U;  3GLX A;  3I56 A;  4DQ2 A;  3H6Z A;  5GAN e;  5LJ3 h;  1O9S A;  3JCM f;  5A0G A;  1QW1 A;  2V8K A;  4ELY C;  4M7A B;  1KHC A;  4Z02 A;  1WJQ A;  3RMS A;  5GAN h;  4JRQ A;  3S3N A;  4HT9 A;  1X75 C;  3KUF A;  1YJN T;  3LW5 E;  1PSF A;  1UGP B;  3CCM A;  3LLR A;  2LT4 A;  3MEV A;  4M7D G;  3OYY A;  1VQO A;  3UDC A;  1SSF A;  1N27 A;  2CKK A;  2CZ6 B;  4KT0 E;  3VU3 C;  5HK0 A;  5J3B A;  5GMK m;  5GAN 5;  3OS0 A;  3CC7 A;  1UB4 A;  1U8R A;  2XKO C;  1I81 A;  4NS5 A;  4E7H A;  3CCR T;  1YJW T;  2E6Z A;  5CKH A;  3CPW S;  4MZT A;  5CVI A;  4Y91 A;  4P5N A;  5KCH A;  3P8H A;  4N0A C;  1NJI C;  1JJ2 A;  3M59 A;  3JCM X;  3OW2 S;  1VQL A;  2LNV A;  3EFR A;  5J26 A;  2PUK B;  3TEE A;  1X01 A;  2F5T X;  2QA4 A;  2GF7 A;  4C0Z A;  1K9M U;  3HSB A;  2HQE A;  3OB9 A;  4M7D A;  4C8Q B;  4F7U B;  2Y4X A;  3M53 A;  5FLX E;  1VQM A;  2XI9 A;  3GP8 A;  3OYK A;  3QXE B;  4M77 F;  4RG8 A;  2DAQ A;  3RKY A;  4LDW A;  4M77 D;  2RI2 A;  1ZQ1 A;  2K5L A;  3KBG A;  2LX9 A;  5IN1 A;  1BI3 A;  3EFS A;  3QYG B;  1W2B A;  2DTH A;  3Q1J A;  2XDD A;  3BDU A;  4OB0 B;  4BY6 C;  4BB7 A;  4PJO F;  3LWH A;  4WF2 A;  3NTI A;  1Y07 A;  4M78 F;  4XU2 A;  2E5Q A;  2VXF A;  3S3M A;  4PJO D;  2LQ8 A;  1VQ7 A;  2KQW A;  2RJE A;  4ZGJ B;  4C5H A;  3UT1 A;  4M7A E;  1AHJ B;  4XTX A;  1Y7X A;  1ZHI A;  2R57 A;  2H3J A;  5I2M A;  1VIE A;  1M1K C;  3EAE A;  2VC8 A;  3CBO A;  3OMG A;  2KMT A;  2LT1 A;  3PGG A;  2LCC A;  2E10 A;  4N4H A;  3X24 B;  5CR2 A;  1Q82 C;  3ZFJ A;  2XD0 A;  1VQP A;  4XTY A;  3JB9 J;  4C5G A;  1K8A C;  4M75 G;  1WGS A;  2K2V A;  2M16 A;  5GAN 8;  3CD6 A;  4JDS A;  2RHX A;  3TRE A;  4KBM B;  4J8O A;  2RJD A;  2DKG A;  2EQM A;  1O75 A;  5GAM g;  1VQ5 T;  1HXD A;  1FX7 A;  4L59 A;  2ZZD A;  4O5V A;  5EG2 A;  1X6O A;  3WVE B;  4QQ6 A;  4FSX A;  5GAM j;  3CCS T;  2P0Q A;  5LJ5 g;  1UGR B;  4YTL A;  3OQ5 A;  4C8Q E;  4F7U E;  2K3Y A;  3FDR A;  3CCQ T;  4M7D B;  1DJ7 B;  3FEO A;  5FRN A;  4M75 A;  2PU9 B;  5LJ5 j;  5IAY A;  2L89 A;  2RM4 A;  4ME7 A;  1VQ9 T;  4QVC A;  3CC2 T;  2IVW A;  3OMC A;  3MEA A;  3URG A;  2ZPB B;  2DTI A;  3DLM A;  2EQJ A;  5GAN 3;  3S3O A;  2C06 A;  2PUO B;  1N6A A;  4F7U G;  5I2S A;  2ZPH B;  4GY5 A;  1I8F A;  3JCM J;  1K9M C;  5LJ3 f;  3SFM A;  5GAN d;  1KQ1 A;  4C5I A;  2RJC A;  2OTJ A;  1KQS A;  5J39 A;  3CPW A;  3AHU A;  1WJR A;  2MAM A;  1YJN A;  3JCM V;  2ZPI B;  3RUX A;  3G7Z A;  1RI0 A;  1I4K 1;  1RL2 A;  2JUF A;  5KE2 A;  2VGN A;  4JLI A;  2P4T A;  4ZGD B;  4BDY A;  2X4J A;  1OZ3 A;  1VQ4 A;  1VQ8 A;  1YIJ T;  1WNL A;  3SWN B;  2YHT A;  3C95 A;  3NTK A;  2AHJ B;  4KUI A;  3L2V A;  3CCR A;  4CRI A;  4JRP A;  2K57 A;  3L1A A;  4E7L A;  1YJW A;  3CMA T;  5GAM e;  2KVQ G;  3G71 A;  4LDU A;  4BI4 A;  1G3W A;  5I21 A;  3ASK A;  4JRI A;  3G4S T;  4RCC A;  2QQA A;  1XQH A;  4J5Y A;  1WJS A;  4FIB A;  5LJ5 e;  4C92 D;  1QP2 A;  4XAX B;  2CS7 A;  5FU6 C;  3J81 E;  2QEX T;  5GMK l;  1BIB A;  1HK9 A;  1YIT T;  1XOV A;  2E70 A;  2X4Y A;  4OF1 A;  1YI2 A;  3BDL A;  3E19 A;  2E65 A;  5D6X A;  5FU7 C;  5LJ5 h;  3OS2 A;  3HFO A;  2QQR A;  4IUV A;  3CC4 T;  3CCE T;  4M7D E;  2A3L A;  2FL7 A;  4EMH A;  4EDU A;  1M1G A;  4M75 B;  3I55 T;  5L8R E;  3LGL A;  1VQN T;  3L2W A;  4A4G A;  2MMP A;  4FM4 B;  4JJN K;  3JCM g;  4J7I A;  4ZN1 A;  2RI3 A;  4M7A C;  3OA6 A;  1R8O B;  3HRU A;  2DZ9 A;  4XU3 A;  3G6E T;  2G3R A;  4A53 A;  5KE3 A;  3JCM b;  2K5F A;  3BFM A;  3BW1 A;  2M9U A;  4DOW A;  3V8K A;  1FWZ A;  4JS5 A;  3CEY A;  1BI2 A;  4EMG A;  4OGC A;  5LL6 S;  3CXC S;  1KQS S;  4FU6 A;  4C92 A;  1N8R U;  3L42 A;  3KXT A;  2LCL A;  2KSS A;  2KY9 A;  5GAN 2;  5GAN 7;  1YHQ T;  1Y96 A;  2VV5 A;  4NL2 A;  3MHX A;  2FB7 A;  2F5K A;  4OGE A;  3QG1 A;  3JAM E;  3OBY A;  2DD5 A;  2D0Q B;  4ZGE B;  3FLG A;  1Q81 U;  4MMK A;  3X20 B;  3CCV T;  2HBP A;  4BI8 B;  4C0F A;  3JCM P;  1VQK A;  3F70 A;  3V7C A;  3V8J A;  4C8Q C;  4X9C A;  2KDS A;  3JB9 F;  2RH2 A;  5C0M A;  3JRZ A;  3TCJ A;  3JB9 D;  3S6W A;  2RHZ A;  3A8M B;  4OVA A;  2JN0 A;  2RHU A;  2FVU A;  1IRE B;  3CCJ T;  3TU4 K;  3RKW A;  3RIR A;  3OYA A;  1N9S A;  3M56 A;  1WQW A;  3CCQ A;  3QO3 A;  3M55 A;  1MHN A;  1M9S A;  3A8L B;  3QII A;  2ZPE B;  2DK3 A;  1QP3 A;  1VQ9 A;  1UEB A;  3C4S A;  3CC2 A;  4M77 G;  4QW2 A;  4B9W A;  3CCL T;  3OYN A;  3JCM e;  2ZGW A;  2XG8 D;  4M78 D;  3OS5 A;  1FXX A;  4M75 E;  1QVG A;  2EQU A;  2P0K A;  3N5B B;  1N9R A;  5CKB A;  5DM7 R;  3MET A;  3JCM h;  5CQX A;  3MEW A;  2GFU A;  2RB6 A;  2Y4Y A;  3QHS A;  5M9O A;  4XU0 A;  4J83 A;  1GXI E;  5CQY A;  4PJO G;  3SWN A;  1VUB A;  2PVG B;  2V8I A;  2L8D A;  4OB2 B;  4TVR A;  5HK3 A;  3PIO A;  2DZC A;  4J7F A;  3CME T;  4BE1 A;  2XDP A;  3OYG A;  4C5E A;  2RK2 A;  4M77 A;  2OTL T;  2D9T A;  1KD1 U;  3M57 A;  1XTD A;  2VYT A;  4C92 B;  1YIJ A;  4A54 A;  4LDY A;  4PNO A;  3CBP A;  3QPH A;  1VQO T;  2DIG A;  3PMT A;  1W4S A;  1Y96 B;  2E6N A;  4IUQ A;  3CMA A;  2IG0 A;  4M7A F;  2YLB A;  4PL6 A;  3NFC A;  1MGQ A;  4M7A D;  4OMF B;  4PJO A;  2RI5 A;  1BKB A;  1I5L A;  2M0O A;  4XK8 E;  2FYK A;  3OSS C;  5A0L A;  3G4S A;  4KUL A;  2GQV A;  2EQK A;  2BIV A;  2P0P A;  3JCM Q;  5GAM d;  1VQL T;  1VQ6 T;  3HRT A;  4ZTF A;  4M7D C;  4XQ3 A;  2DTO A;  4II1 A;  3V8L A;  1H3Z A;  2QA4 T;  1N8R C;  3E9G A;  5HY6 A;  1Q86 U;  2K4Y A;  2DIQ A;  5LJ5 d;  4EMK A;  2DXU A;  2DVE A;  3CC4 A;  1VQM T;  4V2S A;  3CBM A;  3X26 B;  3HP9 A;  3JSC A;  4HA8 A;  1OI1 A;  4FT2 A;  2LVM A;  2JNG A;  1VIF A;  3I55 A;  3LWI A;  1Q81 C;  1VQN A;  2DXB A;  3CXC A;  3L2U A;  3QJ6 A;  4C0D B;  2R5M A;  5DLQ E;  5GAN 4;  2O4X A;  3GNG A;  5GAO l;  5LJ3 g;  4C8Q F;  4F7U F;  5GAN f;  2HD0 A;  1B34 B;  4BAC A;  1D3B A;  4C8Q D;  2RHY A;  1QVG S;  2XDB A;  1NE8 A;  3M4Y A;  2JTF A;  4OB3 B;  4RG2 A;  4HCZ A;  5LJ3 j;  5GAN g;  3M58 A;  2EWN A;  2E41 A;  3H8Z A;  5CKF A;  2HQX A;  4BE2 A;  1VQ7 T;  2RK1 A;  2RD1 A;  4HKE A;  1XNI A;  3FJP A;  4XTV A;  3PMI A;  3M9Q A;  1KQ2 A;  3JB9 H;  4LDX A;  3SWN C;  1YHQ A;  4MDW A;  4M77 B;  5AYF A;  2LC4 A;  4HT8 A;  3CCU T;  2EIF A;  4C92 E;  4JLG A;  4N0A A;  3CPF A;  5CIU A;  5GAM h;  4RKU E;  3OYI A;  5GAO m;  2NLU A;  3ME9 A;  2B8A A;  5GAN 6;  1K73 U;  2PVD B;  1YJ9 T;  5GAO r;  2D6F A;  2ZCF B;  4QVZ A;  4QVD A;  3MEU A;  3CD6 T;  4Y28 E;  4FL6 A;  5KCO A;  2EAY A;  1Q7Y U;  4A4H A;  3OYF A;  3QSU A;  4OB1 B;  4PJO B;  1QVF S;  4M78 B;  2WSF E;  2LRQ A;  2ZPG B;  3MO8 A;  3PFS A;  4IKF A;  2DD4 A;  1M1F A;  2JTM A;  2LTO A;  5GMK i;  4C92 G;  1YBY A;  2MWP A;  2MI6 A;  5GAO p;  2DPP B;  1KD1 C;  5IT9 E;  1G3Y A;  3SB2 A;  3QZ9 B;  4FT4 A;  4M75 C;  4O6J A;  3GOX A;  2K3X A;  3VKI A;  4PLL A;  1M4Z A;  4DOV A;  2ZPF B;  3OYB A;  3E9F A;  3DB3 A;  3L2R A;  3WVD B;  1BI0 A;  4EMK B;  3PTA A;  2DEQ A;  1S72 T;  3VJP A;  3CCL A;  3PIP A;  3LGF A;  3QJY A;  3V7R A;  4GLK A;  3VV0 A;  2R5A A;  5CKD A;  2X4X A;  4XTZ A;  3PNW C;  3PT9 A;  2EJ9 A;  3RES A;  3JCM d;  2K5I A;  1Q82 U;  2EJF A;  2L3R A;  2O4X B;  4M7D F;  4IUR A;  5FRM A;  4BD3 A;  2CZ1 B;  1D3B B;  4M7D D;  4Q5W A;  1JRI A;  3CME A;  2CGH A;  1Q86 C;  2DXT A;  2OTJ T;  3A5Z B;  1LJO A;  2EYQ A;  2RJF A;  3C12 A;  2GCX A;  3E1S A;  3MP6 A;  4C0G A;  4UC4 A;  3HKS A;  3RKX A;  3JCM W;  2OTL A;  2QTX A;  3C94 A;  3FRN A;  3X25 B;  2MF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...