3ZGGA

Crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with npe caged udp-gal (c222(1) space group)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
284
structure length
274
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVDVSMRRMEMISDFCFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTO-BLOOD GROUP ABO SYSTEM TRANSFERASE
publication title Structures of a Human Blood Group Glycosyltransferase in Complex with a Photo-Activatable Udp-Gal Derivative Reveal Two Different Binding Conformations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 274
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3zggA00
1TW5A 4HO4A 1H5RA 1ZDFA 3ZGFA 1HM9A 5C4FA 2BO4A 3TQDA 5C36A 2E8BA 1VZTA 3USRA 1JV3A 1K4VA 1YROB 1ZI4A 1ZI5A 1G9RA 1LZ0A 1ZCVA 2D0JA 2Y4JA 4IRPA 2AGDA 4ASYA 3V0MA 1JYLA 5EJZA 1R7YA 3NGWA 1R82A 4Y64A 2Q4JA 4HOCA 4KC1A 5IFYA 3ZGGA 4CVHA 4Y7TA 5I1FA 5C3AA 2FFUA 5HS2A 1FOAA 4AYLA 3I0EA 1MC3A 5L6VA 1QG8A 5C4BA 5C1LA 2V0HA 3V90A 2Y4LA 3U2VA 2YC3A 2O1FA 1V82A 2YESA 4HO3A 4M2BA 4Y7VA 5C8RA 2O1HA 2AM4A 3I0JA 1H7FA 2RIYA 3V0NA 5CQOA 2VS5A 5L6SA 1G93A 1V84A 2VSIA 1HM0A 1WT2A 4KC4A 2NXVA 1FXOA 2WE9A 1MP4A 1O23B 5BXCA 4B4GA 2YQJA 1JVGA 2I5EA 1H7HA 1NF5B 1WT1A 4KC2A 4FRMA 3I0KA 1INIA 1YP4A 2AM5A 3FOQA 1ZJOA 4FRAA 3Q4SA 5CMHA 1H5RB 1XHBA 4JD0A 3CKQA 3SX5A 2AH9A 2QGIA 4YS8A 2X5SA 1OMXA 3FWWA 1JV1A 1MP5A 1H4DA 1G97A 2W0WA 3Q80A 3SXGA 1NKHB 4NALA 2WVMA 2WEEA 4FQWA 2JCKA 3RMWA 1W55A 3E26A 4HG6A 4Y7FA 5JQQA 1INJA 4ZDQA 4AAWA 5C3DA 1GX4A 1ZCYA 1VM8A 2YQCA 5CQLX 1G95A 1QGSA 1LL2A 4B42A 4MNDA 2O1GA 5AJPA 1ZJPA 1XZ6A 3CKVA 2E3DA 4JISA 3ST8A 1VGUA 2A8UA 2X65A 1R7XA 2BO7A 1I52A 3V0QA 4CJBA 5IDTA 4Y63A 2XWMA 2DPWA 4M2AA 1IIMA 4FRPA 1WT0A 3V8YA 3U0YA 1VGZA 2XMHA 3V91A 1GX0A 1LVWA 2Y4MA 5CQPA 5C4EA 1FRWA 5FYEA 2RIZA 2APCA 3F1CA 1G0RA 1LL0A 4J18A 3BCVA 4EE5A 1FO8A 3CKOA 2ZU7A 4FCUA 3I0HA 4UEGA 5IDSA 3SX7A 1G23A 2OEFA 2GGQA 3DK5A 4D0TA 1FG5N 1YP3A 2VS4A 1ZJ3A 2WGZA 5FU0A 4HO6A 1GQ9A 1ZJ1A 4FCEA 4FRHA 3SX8A 3I0DA 5FUHA 4EEGA 3D8VA 2Y4KA 5C38A 1FR8A 3ZLKA 1OMZA 4EE4A 4DDZA 5C1GA 1GA8A 1TW1A 3OH3A 3F1YA 1FGGA 4Y6UA 3CKNA 5FU8A 2OEGA 4KPZA 1G2VA 4Y62A 1E5KA 1H7TA 3I0LA 4LW6A 4KPXA 3TZTA 2D7IA 3IOJA 2P6WA 1VPAA 2YCMA 2BO8A 4G3PA 1S4OA 1G8OA 2FYDB 4FROA 1H7GA 1TZFA 5CQNX 1HJLA 4XWIA 4G87A 4E1KA 3GUEA 2RJ0A 3SPTA 4B2XA 3KIAA 4L41C 3OH2A 4KNXA 3U2UA 5C1HA 2RJ6A 3IOIA 2WVLA 1NMMB 4NANA 5J49A 3R2WA 3PKQA 2JCOA 4KQLA 5DDVA 3SXEA 1PZYB 3T7OA 3V8ZA 1ZCTA 3BRKX 2VFZA 3OAMA 3SXAA 5FTVA 4BMAA 1R81A 2FFVA 3K8EA 5CMIA 1JVDA 2ICYA 3PNNA 1HV9A 1W57A 3JTJA 3JUKA 3U2TA 4AYJA 4Y9XA 3DJ4A 1H5SC 1H3MA 1HJJA 4M28A 2QH5A 3U2XA 1H4EA 1GWWA 4B3UA 2FYCB 1GQCA 4BQHA 1ZHJA 1MP3A 4GBPA 2V0KA 1ON6A 3SXBA 3DUVA 1SS9A 2YQHA 2I7BA 3Q7UA 1GWVA 2JCLA 3CGXA 3T7MA 2ICXA 1QWJA 4EEAA 2GGOA 4KXOA 4NAIA 4HCQA 2P72A 3PKPA 1O7OA 2P73A 2RJ8A 1OQMB 3CU0A 1H5TA 3O3PA 2RJ4A 3U2WA 1R7UA 1R7TA 3R3IA 3U0XA 4C2SA 1FWYA 3ZF8A 1Z90A 1G1LA 4D11C 2Z86A 2BO6A 1FZWA 3JUJA 3T7NA 1NHEB 1O7QA 4CJCA 4M4KA 2RIXA 4Y7GA 1H4CA 1H5SD 1WSZA 1VZXA 1IINA 2VD4A 1LL3A 1JYKA 4IRQA 4EVWA 3OH4A 2I5KA 3RSBA 1QGQA 3V0PA 1S4PA 1FXJA 2YQSA 3V0OA 1ZJ2A 1R80A 3POLA 3SXDA 1H5SA 4ARWA 4LW3A 2PGYA 1VGTA 1H7EA 1ZDGA 2ZU9A 3OC9A 3D5NA 2AE7A 4AC3A 1LZJA 2V0LA 3SXCA 1VH3A 1W77A 2X60A 1HM8A 2RJ7A 5CMGX 5FV9A 2AM3A 2X5ZA 2W0VA 1NQIB 2OI7A 2AECA 4Y6NA 4B4BA 2YC5A 3OH0A 3ZLLA 5C48A 3RMVA 5CMJA 3SX3A 1H7LA 1WVCA 1ZI1A 1LZIA 1FGXA 1S4NA 1H7QA 3D98A 1H5TB 4FRQA 2XWLA 4DECA 1TVYA 4DE7A 1KWSA 3IOHA 2JCJA 4ECMA 3I0GA 4KT7A 1YP2A 2PGVA 2VXMA 2V0IA 3HL3A 4D11A 2AESA 1V83A 2PA4A 1PZTA 4G3QA 1WT3A 2VS3A 2FY7A 2Y7AA 5EJ1A 1ZI3A 4FRDA 3N9WA 4K6RA 3OKRA 2OI5A 3QVBA 2Y6PA 4NAKA 5CQMX 2XWNA 1R7VA 5C4CA 5DDTA 5C4DA 1VICA 2FYAA 1H5SB 1EYRA 2RITA 5FTSA 4D0ZA 1FO9A 4Y7UA 4B4MA 3LW6A 1ZJ0A 3K8DA 2RJ5A 4HO8A 2VXLA 4G3SA 1FR9A 4B2WA 1EZIA 3I0IX 1LZ7A 2Z87A 5C47A 4FREA 4KRVA 1VZUA 2A8WA 1ON8A 5AJOA 3EE5A 2FYBA 2WVKA 4EE3A 4HO5A 2UX8A 5CMFX 3OGZA 4ASJA 4FRLA 1VGWA 2OI6A 4MYBA 4B5BA 4P00A 3USQA 1VH1A 2MZBA 5C49A 3OH1A 1O0RA 2QKXA 2RJ9A 1NWGB 1ZCUA 2VSHA 3E25A 4R7PA 2RJ1A 5EIYA 2PX7A 3CKJA 3V0LA 2CU2A 1G3LA 1ZIZA 4HO9A 4HO0A 2XMEA 4EEOA 4EEMA 4D48A 3I0CA 4FRBA 2ZU8A 4KNRA 2D7RA 5C3BA 3I0FA 4HO2A 5AJNA 2V0JA 4P02A 2WAWA 4CJ8A
chains in the Genus database with same CATH superfamily
1TW5A 2C0NA 4HO4A 1H5RA 1ZDFA 3ZGFA 1HM9A 5C4FA 2BO4A 3TQDA 5C36A 2E8BA 1VZTA 3USRA 1JV3A 1K4VA 1YROB 1ZI4A 1ZI5A 1G9RA 1LZ0A 1ZCVA 2D0JA 2Y4JA 4IRPA 2AGDA 4ASYA 3V0MA 1JYLA 5EJZA 1R7YA 3NGWA 1R82A 4Y64A 2Q4JA 4HOCA 4KC1A 5IFYA 3ZGGA 4CVHA 4Y7TA 5I1FA 5C3AA 2FFUA 5HS2A 1FOAA 4AYLA 3I0EA 1MC3A 5L6VA 1QG8A 5C4BA 5C1LA 2V0HA 3V90A 2Y4LA 3U2VA 2YC3A 2O1FA 1V82A 2YESA 4HO3A 4M2BA 4Y7VA 5C8RA 2O1HA 2AM4A 3I0JA 1H7FA 2RIYA 3V0NA 5CQOA 2VS5A 5L6SA 1G93A 1V84A 2VSIA 1HM0A 1WT2A 4KC4A 2NXVA 1FXOA 2WE9A 1MP4A 1O23B 5BXCA 4B4GA 2YQJA 1JVGA 2I5EA 1H7HA 1NF5B 1WT1A 4KC2A 4FRMA 3I0KA 1INIA 1YP4A 2AM5A 3FOQA 1ZJOA 4FRAA 3Q4SA 5CMHA 1H5RB 1XHBA 4JD0A 3CKQA 3SX5A 2AH9A 2QGIA 4YS8A 2X5SA 1OMXA 3FWWA 1JV1A 1MP5A 1H4DA 1G97A 2W0WA 3Q80A 3SXGA 1NKHB 4NALA 2WVMA 2WEEA 4FQWA 2JCKA 3RMWA 1W55A 3E26A 4HG6A 4Y7FA 5JQQA 1INJA 4ZDQA 4AAWA 2VK9A 5C3DA 1GX4A 1ZCYA 1VM8A 2YQCA 5CQLX 1G95A 1QGSA 1LL2A 4B42A 4MNDA 2O1GA 5AJPA 2J0AA 1ZJPA 1XZ6A 3CKVA 2E3DA 4JISA 3ST8A 1VGUA 2A8UA 2X65A 1R7XA 2BO7A 1I52A 3V0QA 4CJBA 5IDTA 4Y63A 2XWMA 2DPWA 4M2AA 1IIMA 4FRPA 1WT0A 3V8YA 3U0YA 1VGZA 2XMHA 3V91A 1GX0A 1LVWA 2Y4MA 5CQPA 5C4EA 1FRWA 5FYEA 2RIZA 2APCA 3F1CA 1G0RA 1LL0A 4J18A 3BCVA 4EE5A 1FO8A 3CKOA 2ZU7A 4FCUA 3I0HA 4UEGA 4FIYA 5IDSA 3SX7A 1G23A 2OEFA 2GGQA 3DK5A 4D0TA 1FG5N 1YP3A 2VS4A 1ZJ3A 2WGZA 5FU0A 4HO6A 1GQ9A 1ZJ1A 4FCEA 4FRHA 3SX8A 3I0DA 5FUHA 4EEGA 3D8VA 2Y4KA 5C38A 1FR8A 3ZLKA 1OMZA 4EE4A 4DDZA 5C1GA 1GA8A 1TW1A 3OH3A 3F1YA 1FGGA 4Y6UA 3CKNA 5FU8A 2OEGA 4KPZA 1G2VA 4Y62A 1E5KA 2J0BA 1H7TA 3I0LA 4LW6A 4KPXA 3TZTA 2D7IA 3IOJA 2P6WA 1VPAA 2YCMA 2BO8A 4G3PA 1S4OA 1G8OA 2FYDB 4FROA 1H7GA 1TZFA 5CQNX 1HJLA 4XWIA 4G87A 4E1KA 3GUEA 2RJ0A 3SPTA 4B2XA 3KIAA 4L41C 3OH2A 4KNXA 3U2UA 5C1HA 2RJ6A 3IOIA 2WVLA 1NMMB 4NANA 5J49A 3R2WA 3PKQA 2JCOA 4KQLA 5DDVA 3SXEA 1PZYB 3T7OA 3V8ZA 1ZCTA 3BRKX 2VFZA 3OAMA 3SXAA 5FTVA 4BMAA 1R81A 2FFVA 3K8EA 5CMIA 1JVDA 2ICYA 3PNNA 1HV9A 1W57A 3JTJA 3JUKA 3U2TA 4AYJA 4Y9XA 3DJ4A 1H5SC 1H3MA 1HJJA 4M28A 4O6NA 2QH5A 5D91A 3U2XA 1H4EA 1GWWA 4B3UA 2FYCB 1GQCA 4BQHA 1ZHJA 1MP3A 4GBPA 2V0KA 1ON6A 3SXBA 3DUVA 1SS9A 2YQHA 2I7BA 3Q7UA 1GWVA 2JCLA 3CGXA 3T7MA 2ICXA 1QWJA 4EEAA 2GGOA 4KXOA 4NAIA 4HCQA 2P72A 3PKPA 1O7OA 2P73A 2RJ8A 1OQMB 3CU0A 1H5TA 3O3PA 2RJ4A 3U2WA 1R7UA 1R7TA 3R3IA 3U0XA 4C2SA 1FWYA 3ZF8A 1Z90A 1G1LA 4D11C 2Z86A 2BO6A 1FZWA 3JUJA 3T7NA 1NHEB 4Q7CA 1O7QA 4CJCA 4M4KA 2RIXA 4Y7GA 4MIXA 1H4CA 1H5SD 1WSZA 1VZXA 1IINA 2VD4A 1LL3A 1JYKA 4IRQA 4EVWA 3OH4A 2I5KA 3RSBA 1QGQA 3V0PA 1S4PA 1FXJA 2YQSA 3V0OA 1ZJ2A 1R80A 3POLA 4O6MA 3SXDA 1H5SA 4ARWA 4LW3A 2PGYA 1VGTA 1H7EA 1ZDGA 2ZU9A 3OC9A 3D5NA 2AE7A 4AC3A 1LZJA 2V0LA 3SXCA 1VH3A 1W77A 2X60A 1HM8A 2RJ7A 5CMGX 5FV9A 2AM3A 2X5ZA 2W0VA 1NQIB 2OI7A 2AECA 4Y6NA 4B4BA 2YC5A 3OH0A 3ZLLA 5C48A 3RMVA 5CMJA 3SX3A 1H7LA 1WVCA 1ZI1A 1LZIA 1FGXA 1S4NA 1H7QA 3D98A 1H5TB 4FRQA 2XWLA 4DECA 1TVYA 4DE7A 5D92A 1KWSA 3IOHA 2JCJA 4ECMA 3I0GA 4KT7A 1YP2A 2PGVA 2VXMA 2V0IA 3HL3A 4D11A 2AESA 1V83A 2PA4A 1PZTA 4G3QA 4FIXA 1WT3A 2VS3A 2FY7A 2Y7AA 5EJ1A 1ZI3A 4FRDA 3N9WA 4K6RA 3OKRA 2OI5A 3QVBA 2Y6PA 4NAKA 5CQMX 2XWNA 1R7VA 5C4CA 5DDTA 5C4DA 1VICA 2FYAA 1H5SB 1EYRA 2RITA 5FTSA 4D0ZA 1FO9A 4Y7UA 4B4MA 3LW6A 1ZJ0A 3K8DA 2RJ5A 4HO8A 2VXLA 4G3SA 1FR9A 4B2WA 1EZIA 3I0IX 1LZ7A 2Z87A 5C47A 4FREA 4KRVA 1VZUA 2A8WA 1ON8A 5AJOA 3EE5A 2FYBA 2WVKA 4EE3A 4HO5A 2UX8A 5CMFX 3OGZA 4ASJA 4FRLA 1VGWA 2OI6A 4MYBA 4B5BA 4P00A 3USQA 1VH1A 2MZBA 5C49A 3OH1A 1O0RA 2QKXA 2RJ9A 1NWGB 1ZCUA 2VSHA 3E25A 4R7PA 2RJ1A 5EIYA 2PX7A 3CKJA 3V0LA 2CU2A 1G3LA 1ZIZA 4HO9A 4HO0A 2XMEA 4EEOA 4EEMA 4D48A 3I0CA 4FRBA 2ZU8A 4KNRA 2D7RA 5C3BA 3I0FA 4HO2A 5AJNA 2V0JA 4P02A 2WAWA 4CJ8A
chains in the Genus database with same CATH topology
1TW5A 2C0NA 4HO4A 1H5RA 1ZDFA 3ZGFA 1HM9A 5C4FA 2BO4A 3TQDA 5C36A 2E8BA 1VZTA 3USRA 1JV3A 1K4VA 1YROB 1ZI4A 1ZI5A 1G9RA 1LZ0A 1ZCVA 2D0JA 2Y4JA 4IRPA 2AGDA 4ASYA 3V0MA 1JYLA 5EJZA 1R7YA 3NGWA 1R82A 4Y64A 2Q4JA 4HOCA 4KC1A 5IFYA 3ZGGA 4CVHA 4Y7TA 5I1FA 5C3AA 2FFUA 5HS2A 1FOAA 4AYLA 3I0EA 1MC3A 5L6VA 1QG8A 5C4BA 5C1LA 2V0HA 3V90A 2Y4LA 3U2VA 2YC3A 2O1FA 1V82A 2YESA 4HO3A 4M2BA 4Y7VA 5C8RA 2O1HA 2AM4A 3I0JA 1H7FA 2RIYA 3V0NA 5CQOA 2VS5A 5L6SA 1G93A 1V84A 2VSIA 1HM0A 1WT2A 4KC4A 2NXVA 1FXOA 2WE9A 1MP4A 1O23B 5BXCA 4B4GA 2YQJA 1JVGA 2I5EA 1H7HA 1NF5B 1WT1A 4KC2A 4FRMA 3I0KA 1INIA 1YP4A 2AM5A 3FOQA 1ZJOA 4FRAA 3Q4SA 5CMHA 1H5RB 1XHBA 4JD0A 3CKQA 3SX5A 2AH9A 2QGIA 4YS8A 2X5SA 1OMXA 3FWWA 1JV1A 1MP5A 1H4DA 1G97A 2W0WA 3Q80A 3SXGA 1NKHB 4NALA 2WVMA 2WEEA 4FQWA 2JCKA 3RMWA 1W55A 3E26A 4HG6A 4Y7FA 5JQQA 1INJA 4ZDQA 4AAWA 2VK9A 5C3DA 1GX4A 1ZCYA 1VM8A 2YQCA 5CQLX 1G95A 1QGSA 1LL2A 4B42A 4MNDA 2O1GA 5AJPA 2J0AA 1ZJPA 1XZ6A 3CKVA 2E3DA 4JISA 3ST8A 1VGUA 2A8UA 2X65A 1R7XA 2BO7A 1I52A 3V0QA 4CJBA 5IDTA 4Y63A 2XWMA 2DPWA 4M2AA 1IIMA 4FRPA 1WT0A 3V8YA 3U0YA 1VGZA 2XMHA 3V91A 1GX0A 1LVWA 2Y4MA 5CQPA 5C4EA 1FRWA 5FYEA 2RIZA 2APCA 3F1CA 1G0RA 1LL0A 4J18A 3BCVA 4EE5A 1FO8A 3CKOA 2ZU7A 4FCUA 3I0HA 4UEGA 4FIYA 5IDSA 3SX7A 1G23A 2OEFA 2GGQA 3DK5A 4D0TA 1FG5N 1YP3A 2VS4A 1ZJ3A 2WGZA 5FU0A 4HO6A 1GQ9A 1ZJ1A 4FCEA 4FRHA 3SX8A 3I0DA 5FUHA 4EEGA 3D8VA 2Y4KA 5C38A 1FR8A 3ZLKA 1OMZA 4EE4A 4DDZA 5C1GA 1GA8A 1TW1A 3OH3A 3F1YA 1FGGA 4Y6UA 3CKNA 5FU8A 2OEGA 4KPZA 1G2VA 4Y62A 1E5KA 2J0BA 1H7TA 3I0LA 4LW6A 4KPXA 3TZTA 2D7IA 3IOJA 2P6WA 1VPAA 2YCMA 2BO8A 4G3PA 1S4OA 1G8OA 2FYDB 4FROA 1H7GA 1TZFA 5CQNX 1HJLA 4XWIA 4G87A 4E1KA 3GUEA 2RJ0A 3SPTA 4B2XA 3KIAA 4L41C 3OH2A 4KNXA 3U2UA 5C1HA 2RJ6A 3IOIA 2WVLA 1NMMB 4NANA 5J49A 3R2WA 3PKQA 2JCOA 4KQLA 5DDVA 3SXEA 1PZYB 3T7OA 3V8ZA 1ZCTA 3BRKX 2VFZA 3OAMA 3SXAA 5FTVA 4BMAA 1R81A 2FFVA 3K8EA 5CMIA 1JVDA 2ICYA 3PNNA 1HV9A 1W57A 3JTJA 3JUKA 3U2TA 4AYJA 4Y9XA 3DJ4A 1H5SC 1H3MA 1HJJA 4M28A 4O6NA 2QH5A 5D91A 3U2XA 1H4EA 1GWWA 4B3UA 2FYCB 1GQCA 4BQHA 1ZHJA 1MP3A 4GBPA 2V0KA 1ON6A 3SXBA 3DUVA 1SS9A 2YQHA 2I7BA 3Q7UA 1GWVA 2JCLA 3CGXA 3T7MA 2ICXA 1QWJA 4EEAA 2GGOA 4KXOA 4NAIA 4HCQA 2P72A 3PKPA 1O7OA 2P73A 2RJ8A 1OQMB 3CU0A 1H5TA 3O3PA 2RJ4A 3U2WA 1R7UA 1R7TA 3R3IA 3U0XA 4C2SA 1FWYA 3ZF8A 1Z90A 1G1LA 4D11C 2Z86A 2BO6A 1FZWA 3JUJA 3T7NA 1NHEB 4Q7CA 1O7QA 4CJCA 4M4KA 2RIXA 4Y7GA 4MIXA 1H4CA 1H5SD 1WSZA 1VZXA 1IINA 2VD4A 1LL3A 1JYKA 4IRQA 4EVWA 3OH4A 2I5KA 3RSBA 1QGQA 3V0PA 1S4PA 1FXJA 2YQSA 3V0OA 1ZJ2A 1R80A 3POLA 4O6MA 3SXDA 1H5SA 4ARWA 4LW3A 2PGYA 1VGTA 1H7EA 1ZDGA 2ZU9A 3OC9A 3D5NA 2AE7A 4AC3A 1LZJA 2V0LA 3SXCA 1VH3A 1W77A 2X60A 1HM8A 2RJ7A 5CMGX 5FV9A 2AM3A 2X5ZA 2W0VA 1NQIB 2OI7A 2AECA 4Y6NA 4B4BA 2YC5A 3OH0A 3ZLLA 5C48A 3RMVA 5CMJA 3SX3A 1H7LA 1WVCA 1ZI1A 1LZIA 1FGXA 1S4NA 1H7QA 3D98A 1H5TB 4FRQA 2XWLA 4DECA 1TVYA 4DE7A 5D92A 1KWSA 3IOHA 2JCJA 4ECMA 3I0GA 4KT7A 1YP2A 2PGVA 2VXMA 2V0IA 3HL3A 4D11A 2AESA 1V83A 2PA4A 1PZTA 4G3QA 4FIXA 1WT3A 2VS3A 2FY7A 2Y7AA 5EJ1A 1ZI3A 4FRDA 3N9WA 4K6RA 3OKRA 2OI5A 3QVBA 2Y6PA 4NAKA 5CQMX 2XWNA 1R7VA 5C4CA 5DDTA 5C4DA 1VICA 2FYAA 1H5SB 1EYRA 2RITA 5FTSA 4D0ZA 1FO9A 4Y7UA 4B4MA 3LW6A 1ZJ0A 3K8DA 2RJ5A 4HO8A 2VXLA 4G3SA 1FR9A 4B2WA 1EZIA 3I0IX 1LZ7A 2Z87A 5C47A 4FREA 4KRVA 1VZUA 2A8WA 1ON8A 5AJOA 3EE5A 2FYBA 2WVKA 4EE3A 4HO5A 2UX8A 5CMFX 3OGZA 4ASJA 4FRLA 1VGWA 2OI6A 4MYBA 4B5BA 4P00A 3USQA 1VH1A 2MZBA 5C49A 3OH1A 1O0RA 2QKXA 2RJ9A 1NWGB 1ZCUA 2VSHA 3E25A 4R7PA 2RJ1A 5EIYA 2PX7A 3CKJA 3V0LA 2CU2A 1G3LA 1ZIZA 4HO9A 4HO0A 2XMEA 4EEOA 4EEMA 4D48A 3I0CA 4FRBA 2ZU8A 4KNRA 2D7RA 5C3BA 3I0FA 4HO2A 5AJNA 2V0JA 4P02A 2WAWA 4CJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW5 A;  4HO4 A;  1H5R A;  1ZDF A;  3ZGF A;  1HM9 A;  5C4F A;  2BO4 A;  3TQD A;  5C36 A;  2E8B A;  1VZT A;  3USR A;  1JV3 A;  1K4V A;  1YRO B;  1ZI4 A;  1ZI5 A;  1G9R A;  1LZ0 A;  1ZCV A;  2D0J A;  2Y4J A;  4IRP A;  2AGD A;  4ASY A;  3V0M A;  1JYL A;  5EJZ A;  1R7Y A;  3NGW A;  1R82 A;  4Y64 A;  2Q4J A;  4HOC A;  4KC1 A;  5IFY A;  3ZGG A;  4CVH A;  4Y7T A;  5I1F A;  5C3A A;  2FFU A;  5HS2 A;  1FOA A;  4AYL A;  3I0E A;  1MC3 A;  5L6V A;  1QG8 A;  5C4B A;  5C1L A;  2V0H A;  3V90 A;  2Y4L A;  3U2V A;  2YC3 A;  2O1F A;  1V82 A;  2YES A;  4HO3 A;  4M2B A;  4Y7V A;  5C8R A;  2O1H A;  2AM4 A;  3I0J A;  1H7F A;  2RIY A;  3V0N A;  5CQO A;  2VS5 A;  5L6S A;  1G93 A;  1V84 A;  2VSI A;  1HM0 A;  1WT2 A;  4KC4 A;  2NXV A;  1FXO A;  2WE9 A;  1MP4 A;  1O23 B;  5BXC A;  4B4G A;  2YQJ A;  1JVG A;  2I5E A;  1H7H A;  1NF5 B;  1WT1 A;  4KC2 A;  4FRM A;  3I0K A;  1INI A;  1YP4 A;  2AM5 A;  3FOQ A;  1ZJO A;  4FRA A;  3Q4S A;  5CMH A;  1H5R B;  1XHB A;  4JD0 A;  3CKQ A;  3SX5 A;  2AH9 A;  2QGI A;  4YS8 A;  2X5S A;  1OMX A;  3FWW A;  1JV1 A;  1MP5 A;  1H4D A;  1G97 A;  2W0W A;  3Q80 A;  3SXG A;  1NKH B;  4NAL A;  2WVM A;  2WEE A;  4FQW A;  2JCK A;  3RMW A;  1W55 A;  3E26 A;  4HG6 A;  4Y7F A;  5JQQ A;  1INJ A;  4ZDQ A;  4AAW A;  5C3D A;  1GX4 A;  1ZCY A;  1VM8 A;  2YQC A;  5CQL X;  1G95 A;  1QGS A;  1LL2 A;  4B42 A;  4MND A;  2O1G A;  5AJP A;  1ZJP A;  1XZ6 A;  3CKV A;  2E3D A;  4JIS A;  3ST8 A;  1VGU A;  2A8U A;  2X65 A;  1R7X A;  2BO7 A;  1I52 A;  3V0Q A;  4CJB A;  5IDT A;  4Y63 A;  2XWM A;  2DPW A;  4M2A A;  1IIM A;  4FRP A;  1WT0 A;  3V8Y A;  3U0Y A;  1VGZ A;  2XMH A;  3V91 A;  1GX0 A;  1LVW A;  2Y4M A;  5CQP A;  5C4E A;  1FRW A;  5FYE A;  2RIZ A;  2APC A;  3F1C A;  1G0R A;  1LL0 A;  4J18 A;  3BCV A;  4EE5 A;  1FO8 A;  3CKO A;  2ZU7 A;  4FCU A;  3I0H A;  4UEG A;  5IDS A;  3SX7 A;  1G23 A;  2OEF A;  2GGQ A;  3DK5 A;  4D0T A;  1FG5 N;  1YP3 A;  2VS4 A;  1ZJ3 A;  2WGZ A;  5FU0 A;  4HO6 A;  1GQ9 A;  1ZJ1 A;  4FCE A;  4FRH A;  3SX8 A;  3I0D A;  5FUH A;  4EEG A;  3D8V A;  2Y4K A;  5C38 A;  1FR8 A;  3ZLK A;  1OMZ A;  4EE4 A;  4DDZ A;  5C1G A;  1GA8 A;  1TW1 A;  3OH3 A;  3F1Y A;  1FGG A;  4Y6U A;  3CKN A;  5FU8 A;  2OEG A;  4KPZ A;  1G2V A;  4Y62 A;  1E5K A;  1H7T A;  3I0L A;  4LW6 A;  4KPX A;  3TZT A;  2D7I A;  3IOJ A;  2P6W A;  1VPA A;  2YCM A;  2BO8 A;  4G3P A;  1S4O A;  1G8O A;  2FYD B;  4FRO A;  1H7G A;  1TZF A;  5CQN X;  1HJL A;  4XWI A;  4G87 A;  4E1K A;  3GUE A;  2RJ0 A;  3SPT A;  4B2X A;  3KIA A;  4L41 C;  3OH2 A;  4KNX A;  3U2U A;  5C1H A;  2RJ6 A;  3IOI A;  2WVL A;  1NMM B;  4NAN A;  5J49 A;  3R2W A;  3PKQ A;  2JCO A;  4KQL A;  5DDV A;  3SXE A;  1PZY B;  3T7O A;  3V8Z A;  1ZCT A;  3BRK X;  2VFZ A;  3OAM A;  3SXA A;  5FTV A;  4BMA A;  1R81 A;  2FFV A;  3K8E A;  5CMI A;  1JVD A;  2ICY A;  3PNN A;  1HV9 A;  1W57 A;  3JTJ A;  3JUK A;  3U2T A;  4AYJ A;  4Y9X A;  3DJ4 A;  1H5S C;  1H3M A;  1HJJ A;  4M28 A;  2QH5 A;  3U2X A;  1H4E A;  1GWW A;  4B3U A;  2FYC B;  1GQC A;  4BQH A;  1ZHJ A;  1MP3 A;  4GBP A;  2V0K A;  1ON6 A;  3SXB A;  3DUV A;  1SS9 A;  2YQH A;  2I7B A;  3Q7U A;  1GWV A;  2JCL A;  3CGX A;  3T7M A;  2ICX A;  1QWJ A;  4EEA A;  2GGO A;  4KXO A;  4NAI A;  4HCQ A;  2P72 A;  3PKP A;  1O7O A;  2P73 A;  2RJ8 A;  1OQM B;  3CU0 A;  1H5T A;  3O3P A;  2RJ4 A;  3U2W A;  1R7U A;  1R7T A;  3R3I A;  3U0X A;  4C2S A;  1FWY A;  3ZF8 A;  1Z90 A;  1G1L A;  4D11 C;  2Z86 A;  2BO6 A;  1FZW A;  3JUJ A;  3T7N A;  1NHE B;  1O7Q A;  4CJC A;  4M4K A;  2RIX A;  4Y7G A;  1H4C A;  1H5S D;  1WSZ A;  1VZX A;  1IIN A;  2VD4 A;  1LL3 A;  1JYK A;  4IRQ A;  4EVW A;  3OH4 A;  2I5K A;  3RSB A;  1QGQ A;  3V0P A;  1S4P A;  1FXJ A;  2YQS A;  3V0O A;  1ZJ2 A;  1R80 A;  3POL A;  3SXD A;  1H5S A;  4ARW A;  4LW3 A;  2PGY A;  1VGT A;  1H7E A;  1ZDG A;  2ZU9 A;  3OC9 A;  3D5N A;  2AE7 A;  4AC3 A;  1LZJ A;  2V0L A;  3SXC A;  1VH3 A;  1W77 A;  2X60 A;  1HM8 A;  2RJ7 A;  5CMG X;  5FV9 A;  2AM3 A;  2X5Z A;  2W0V A;  1NQI B;  2OI7 A;  2AEC A;  4Y6N A;  4B4B A;  2YC5 A;  3OH0 A;  3ZLL A;  5C48 A;  3RMV A;  5CMJ A;  3SX3 A;  1H7L A;  1WVC A;  1ZI1 A;  1LZI A;  1FGX A;  1S4N A;  1H7Q A;  3D98 A;  1H5T B;  4FRQ A;  2XWL A;  4DEC A;  1TVY A;  4DE7 A;  1KWS A;  3IOH A;  2JCJ A;  4ECM A;  3I0G A;  4KT7 A;  1YP2 A;  2PGV A;  2VXM A;  2V0I A;  3HL3 A;  4D11 A;  2AES A;  1V83 A;  2PA4 A;  1PZT A;  4G3Q A;  1WT3 A;  2VS3 A;  2FY7 A;  2Y7A A;  5EJ1 A;  1ZI3 A;  4FRD A;  3N9W A;  4K6R A;  3OKR A;  2OI5 A;  3QVB A;  2Y6P A;  4NAK A;  5CQM X;  2XWN A;  1R7V A;  5C4C A;  5DDT A;  5C4D A;  1VIC A;  2FYA A;  1H5S B;  1EYR A;  2RIT A;  5FTS A;  4D0Z A;  1FO9 A;  4Y7U A;  4B4M A;  3LW6 A;  1ZJ0 A;  3K8D A;  2RJ5 A;  4HO8 A;  2VXL A;  4G3S A;  1FR9 A;  4B2W A;  1EZI A;  3I0I X;  1LZ7 A;  2Z87 A;  5C47 A;  4FRE A;  4KRV A;  1VZU A;  2A8W A;  1ON8 A;  5AJO A;  3EE5 A;  2FYB A;  2WVK A;  4EE3 A;  4HO5 A;  2UX8 A;  5CMF X;  3OGZ A;  4ASJ A;  4FRL A;  1VGW A;  2OI6 A;  4MYB A;  4B5B A;  4P00 A;  3USQ A;  1VH1 A;  2MZB A;  5C49 A;  3OH1 A;  1O0R A;  2QKX A;  2RJ9 A;  1NWG B;  1ZCU A;  2VSH A;  3E25 A;  4R7P A;  2RJ1 A;  5EIY A;  2PX7 A;  3CKJ A;  3V0L A;  2CU2 A;  1G3L A;  1ZIZ A;  4HO9 A;  4HO0 A;  2XME A;  4EEO A;  4EEM A;  4D48 A;  3I0C A;  4FRB A;  2ZU8 A;  4KNR A;  2D7R A;  5C3B A;  3I0F A;  4HO2 A;  5AJN A;  2V0J A;  4P02 A;  2WAW A;  4CJ8 A; 
#chains in the Genus database with same CATH topology
 1TW5 A;  2C0N A;  4HO4 A;  1H5R A;  1ZDF A;  3ZGF A;  1HM9 A;  5C4F A;  2BO4 A;  3TQD A;  5C36 A;  2E8B A;  1VZT A;  3USR A;  1JV3 A;  1K4V A;  1YRO B;  1ZI4 A;  1ZI5 A;  1G9R A;  1LZ0 A;  1ZCV A;  2D0J A;  2Y4J A;  4IRP A;  2AGD A;  4ASY A;  3V0M A;  1JYL A;  5EJZ A;  1R7Y A;  3NGW A;  1R82 A;  4Y64 A;  2Q4J A;  4HOC A;  4KC1 A;  5IFY A;  3ZGG A;  4CVH A;  4Y7T A;  5I1F A;  5C3A A;  2FFU A;  5HS2 A;  1FOA A;  4AYL A;  3I0E A;  1MC3 A;  5L6V A;  1QG8 A;  5C4B A;  5C1L A;  2V0H A;  3V90 A;  2Y4L A;  3U2V A;  2YC3 A;  2O1F A;  1V82 A;  2YES A;  4HO3 A;  4M2B A;  4Y7V A;  5C8R A;  2O1H A;  2AM4 A;  3I0J A;  1H7F A;  2RIY A;  3V0N A;  5CQO A;  2VS5 A;  5L6S A;  1G93 A;  1V84 A;  2VSI A;  1HM0 A;  1WT2 A;  4KC4 A;  2NXV A;  1FXO A;  2WE9 A;  1MP4 A;  1O23 B;  5BXC A;  4B4G A;  2YQJ A;  1JVG A;  2I5E A;  1H7H A;  1NF5 B;  1WT1 A;  4KC2 A;  4FRM A;  3I0K A;  1INI A;  1YP4 A;  2AM5 A;  3FOQ A;  1ZJO A;  4FRA A;  3Q4S A;  5CMH A;  1H5R B;  1XHB A;  4JD0 A;  3CKQ A;  3SX5 A;  2AH9 A;  2QGI A;  4YS8 A;  2X5S A;  1OMX A;  3FWW A;  1JV1 A;  1MP5 A;  1H4D A;  1G97 A;  2W0W A;  3Q80 A;  3SXG A;  1NKH B;  4NAL A;  2WVM A;  2WEE A;  4FQW A;  2JCK A;  3RMW A;  1W55 A;  3E26 A;  4HG6 A;  4Y7F A;  5JQQ A;  1INJ A;  4ZDQ A;  4AAW A;  2VK9 A;  5C3D A;  1GX4 A;  1ZCY A;  1VM8 A;  2YQC A;  5CQL X;  1G95 A;  1QGS A;  1LL2 A;  4B42 A;  4MND A;  2O1G A;  5AJP A;  2J0A A;  1ZJP A;  1XZ6 A;  3CKV A;  2E3D A;  4JIS A;  3ST8 A;  1VGU A;  2A8U A;  2X65 A;  1R7X A;  2BO7 A;  1I52 A;  3V0Q A;  4CJB A;  5IDT A;  4Y63 A;  2XWM A;  2DPW A;  4M2A A;  1IIM A;  4FRP A;  1WT0 A;  3V8Y A;  3U0Y A;  1VGZ A;  2XMH A;  3V91 A;  1GX0 A;  1LVW A;  2Y4M A;  5CQP A;  5C4E A;  1FRW A;  5FYE A;  2RIZ A;  2APC A;  3F1C A;  1G0R A;  1LL0 A;  4J18 A;  3BCV A;  4EE5 A;  1FO8 A;  3CKO A;  2ZU7 A;  4FCU A;  3I0H A;  4UEG A;  4FIY A;  5IDS A;  3SX7 A;  1G23 A;  2OEF A;  2GGQ A;  3DK5 A;  4D0T A;  1FG5 N;  1YP3 A;  2VS4 A;  1ZJ3 A;  2WGZ A;  5FU0 A;  4HO6 A;  1GQ9 A;  1ZJ1 A;  4FCE A;  4FRH A;  3SX8 A;  3I0D A;  5FUH A;  4EEG A;  3D8V A;  2Y4K A;  5C38 A;  1FR8 A;  3ZLK A;  1OMZ A;  4EE4 A;  4DDZ A;  5C1G A;  1GA8 A;  1TW1 A;  3OH3 A;  3F1Y A;  1FGG A;  4Y6U A;  3CKN A;  5FU8 A;  2OEG A;  4KPZ A;  1G2V A;  4Y62 A;  1E5K A;  2J0B A;  1H7T A;  3I0L A;  4LW6 A;  4KPX A;  3TZT A;  2D7I A;  3IOJ A;  2P6W A;  1VPA A;  2YCM A;  2BO8 A;  4G3P A;  1S4O A;  1G8O A;  2FYD B;  4FRO A;  1H7G A;  1TZF A;  5CQN X;  1HJL A;  4XWI A;  4G87 A;  4E1K A;  3GUE A;  2RJ0 A;  3SPT A;  4B2X A;  3KIA A;  4L41 C;  3OH2 A;  4KNX A;  3U2U A;  5C1H A;  2RJ6 A;  3IOI A;  2WVL A;  1NMM B;  4NAN A;  5J49 A;  3R2W A;  3PKQ A;  2JCO A;  4KQL A;  5DDV A;  3SXE A;  1PZY B;  3T7O A;  3V8Z A;  1ZCT A;  3BRK X;  2VFZ A;  3OAM A;  3SXA A;  5FTV A;  4BMA A;  1R81 A;  2FFV A;  3K8E A;  5CMI A;  1JVD A;  2ICY A;  3PNN A;  1HV9 A;  1W57 A;  3JTJ A;  3JUK A;  3U2T A;  4AYJ A;  4Y9X A;  3DJ4 A;  1H5S C;  1H3M A;  1HJJ A;  4M28 A;  4O6N A;  2QH5 A;  5D91 A;  3U2X A;  1H4E A;  1GWW A;  4B3U A;  2FYC B;  1GQC A;  4BQH A;  1ZHJ A;  1MP3 A;  4GBP A;  2V0K A;  1ON6 A;  3SXB A;  3DUV A;  1SS9 A;  2YQH A;  2I7B A;  3Q7U A;  1GWV A;  2JCL A;  3CGX A;  3T7M A;  2ICX A;  1QWJ A;  4EEA A;  2GGO A;  4KXO A;  4NAI A;  4HCQ A;  2P72 A;  3PKP A;  1O7O A;  2P73 A;  2RJ8 A;  1OQM B;  3CU0 A;  1H5T A;  3O3P A;  2RJ4 A;  3U2W A;  1R7U A;  1R7T A;  3R3I A;  3U0X A;  4C2S A;  1FWY A;  3ZF8 A;  1Z90 A;  1G1L A;  4D11 C;  2Z86 A;  2BO6 A;  1FZW A;  3JUJ A;  3T7N A;  1NHE B;  4Q7C A;  1O7Q A;  4CJC A;  4M4K A;  2RIX A;  4Y7G A;  4MIX A;  1H4C A;  1H5S D;  1WSZ A;  1VZX A;  1IIN A;  2VD4 A;  1LL3 A;  1JYK A;  4IRQ A;  4EVW A;  3OH4 A;  2I5K A;  3RSB A;  1QGQ A;  3V0P A;  1S4P A;  1FXJ A;  2YQS A;  3V0O A;  1ZJ2 A;  1R80 A;  3POL A;  4O6M A;  3SXD A;  1H5S A;  4ARW A;  4LW3 A;  2PGY A;  1VGT A;  1H7E A;  1ZDG A;  2ZU9 A;  3OC9 A;  3D5N A;  2AE7 A;  4AC3 A;  1LZJ A;  2V0L A;  3SXC A;  1VH3 A;  1W77 A;  2X60 A;  1HM8 A;  2RJ7 A;  5CMG X;  5FV9 A;  2AM3 A;  2X5Z A;  2W0V A;  1NQI B;  2OI7 A;  2AEC A;  4Y6N A;  4B4B A;  2YC5 A;  3OH0 A;  3ZLL A;  5C48 A;  3RMV A;  5CMJ A;  3SX3 A;  1H7L A;  1WVC A;  1ZI1 A;  1LZI A;  1FGX A;  1S4N A;  1H7Q A;  3D98 A;  1H5T B;  4FRQ A;  2XWL A;  4DEC A;  1TVY A;  4DE7 A;  5D92 A;  1KWS A;  3IOH A;  2JCJ A;  4ECM A;  3I0G A;  4KT7 A;  1YP2 A;  2PGV A;  2VXM A;  2V0I A;  3HL3 A;  4D11 A;  2AES A;  1V83 A;  2PA4 A;  1PZT A;  4G3Q A;  4FIX A;  1WT3 A;  2VS3 A;  2FY7 A;  2Y7A A;  5EJ1 A;  1ZI3 A;  4FRD A;  3N9W A;  4K6R A;  3OKR A;  2OI5 A;  3QVB A;  2Y6P A;  4NAK A;  5CQM X;  2XWN A;  1R7V A;  5C4C A;  5DDT A;  5C4D A;  1VIC A;  2FYA A;  1H5S B;  1EYR A;  2RIT A;  5FTS A;  4D0Z A;  1FO9 A;  4Y7U A;  4B4M A;  3LW6 A;  1ZJ0 A;  3K8D A;  2RJ5 A;  4HO8 A;  2VXL A;  4G3S A;  1FR9 A;  4B2W A;  1EZI A;  3I0I X;  1LZ7 A;  2Z87 A;  5C47 A;  4FRE A;  4KRV A;  1VZU A;  2A8W A;  1ON8 A;  5AJO A;  3EE5 A;  2FYB A;  2WVK A;  4EE3 A;  4HO5 A;  2UX8 A;  5CMF X;  3OGZ A;  4ASJ A;  4FRL A;  1VGW A;  2OI6 A;  4MYB A;  4B5B A;  4P00 A;  3USQ A;  1VH1 A;  2MZB A;  5C49 A;  3OH1 A;  1O0R A;  2QKX A;  2RJ9 A;  1NWG B;  1ZCU A;  2VSH A;  3E25 A;  4R7P A;  2RJ1 A;  5EIY A;  2PX7 A;  3CKJ A;  3V0L A;  2CU2 A;  1G3L A;  1ZIZ A;  4HO9 A;  4HO0 A;  2XME A;  4EEO A;  4EEM A;  4D48 A;  3I0C A;  4FRB A;  2ZU8 A;  4KNR A;  2D7R A;  5C3B A;  3I0F A;  4HO2 A;  5AJN A;  2V0J A;  4P02 A;  2WAW A;  4CJ8 A; 
#chains in the Genus database with same CATH homology
 1TW5 A;  2C0N A;  4HO4 A;  1H5R A;  1ZDF A;  3ZGF A;  1HM9 A;  5C4F A;  2BO4 A;  3TQD A;  5C36 A;  2E8B A;  1VZT A;  3USR A;  1JV3 A;  1K4V A;  1YRO B;  1ZI4 A;  1ZI5 A;  1G9R A;  1LZ0 A;  1ZCV A;  2D0J A;  2Y4J A;  4IRP A;  2AGD A;  4ASY A;  3V0M A;  1JYL A;  5EJZ A;  1R7Y A;  3NGW A;  1R82 A;  4Y64 A;  2Q4J A;  4HOC A;  4KC1 A;  5IFY A;  3ZGG A;  4CVH A;  4Y7T A;  5I1F A;  5C3A A;  2FFU A;  5HS2 A;  1FOA A;  4AYL A;  3I0E A;  1MC3 A;  5L6V A;  1QG8 A;  5C4B A;  5C1L A;  2V0H A;  3V90 A;  2Y4L A;  3U2V A;  2YC3 A;  2O1F A;  1V82 A;  2YES A;  4HO3 A;  4M2B A;  4Y7V A;  5C8R A;  2O1H A;  2AM4 A;  3I0J A;  1H7F A;  2RIY A;  3V0N A;  5CQO A;  2VS5 A;  5L6S A;  1G93 A;  1V84 A;  2VSI A;  1HM0 A;  1WT2 A;  4KC4 A;  2NXV A;  1FXO A;  2WE9 A;  1MP4 A;  1O23 B;  5BXC A;  4B4G A;  2YQJ A;  1JVG A;  2I5E A;  1H7H A;  1NF5 B;  1WT1 A;  4KC2 A;  4FRM A;  3I0K A;  1INI A;  1YP4 A;  2AM5 A;  3FOQ A;  1ZJO A;  4FRA A;  3Q4S A;  5CMH A;  1H5R B;  1XHB A;  4JD0 A;  3CKQ A;  3SX5 A;  2AH9 A;  2QGI A;  4YS8 A;  2X5S A;  1OMX A;  3FWW A;  1JV1 A;  1MP5 A;  1H4D A;  1G97 A;  2W0W A;  3Q80 A;  3SXG A;  1NKH B;  4NAL A;  2WVM A;  2WEE A;  4FQW A;  2JCK A;  3RMW A;  1W55 A;  3E26 A;  4HG6 A;  4Y7F A;  5JQQ A;  1INJ A;  4ZDQ A;  4AAW A;  2VK9 A;  5C3D A;  1GX4 A;  1ZCY A;  1VM8 A;  2YQC A;  5CQL X;  1G95 A;  1QGS A;  1LL2 A;  4B42 A;  4MND A;  2O1G A;  5AJP A;  2J0A A;  1ZJP A;  1XZ6 A;  3CKV A;  2E3D A;  4JIS A;  3ST8 A;  1VGU A;  2A8U A;  2X65 A;  1R7X A;  2BO7 A;  1I52 A;  3V0Q A;  4CJB A;  5IDT A;  4Y63 A;  2XWM A;  2DPW A;  4M2A A;  1IIM A;  4FRP A;  1WT0 A;  3V8Y A;  3U0Y A;  1VGZ A;  2XMH A;  3V91 A;  1GX0 A;  1LVW A;  2Y4M A;  5CQP A;  5C4E A;  1FRW A;  5FYE A;  2RIZ A;  2APC A;  3F1C A;  1G0R A;  1LL0 A;  4J18 A;  3BCV A;  4EE5 A;  1FO8 A;  3CKO A;  2ZU7 A;  4FCU A;  3I0H A;  4UEG A;  4FIY A;  5IDS A;  3SX7 A;  1G23 A;  2OEF A;  2GGQ A;  3DK5 A;  4D0T A;  1FG5 N;  1YP3 A;  2VS4 A;  1ZJ3 A;  2WGZ A;  5FU0 A;  4HO6 A;  1GQ9 A;  1ZJ1 A;  4FCE A;  4FRH A;  3SX8 A;  3I0D A;  5FUH A;  4EEG A;  3D8V A;  2Y4K A;  5C38 A;  1FR8 A;  3ZLK A;  1OMZ A;  4EE4 A;  4DDZ A;  5C1G A;  1GA8 A;  1TW1 A;  3OH3 A;  3F1Y A;  1FGG A;  4Y6U A;  3CKN A;  5FU8 A;  2OEG A;  4KPZ A;  1G2V A;  4Y62 A;  1E5K A;  2J0B A;  1H7T A;  3I0L A;  4LW6 A;  4KPX A;  3TZT A;  2D7I A;  3IOJ A;  2P6W A;  1VPA A;  2YCM A;  2BO8 A;  4G3P A;  1S4O A;  1G8O A;  2FYD B;  4FRO A;  1H7G A;  1TZF A;  5CQN X;  1HJL A;  4XWI A;  4G87 A;  4E1K A;  3GUE A;  2RJ0 A;  3SPT A;  4B2X A;  3KIA A;  4L41 C;  3OH2 A;  4KNX A;  3U2U A;  5C1H A;  2RJ6 A;  3IOI A;  2WVL A;  1NMM B;  4NAN A;  5J49 A;  3R2W A;  3PKQ A;  2JCO A;  4KQL A;  5DDV A;  3SXE A;  1PZY B;  3T7O A;  3V8Z A;  1ZCT A;  3BRK X;  2VFZ A;  3OAM A;  3SXA A;  5FTV A;  4BMA A;  1R81 A;  2FFV A;  3K8E A;  5CMI A;  1JVD A;  2ICY A;  3PNN A;  1HV9 A;  1W57 A;  3JTJ A;  3JUK A;  3U2T A;  4AYJ A;  4Y9X A;  3DJ4 A;  1H5S C;  1H3M A;  1HJJ A;  4M28 A;  4O6N A;  2QH5 A;  5D91 A;  3U2X A;  1H4E A;  1GWW A;  4B3U A;  2FYC B;  1GQC A;  4BQH A;  1ZHJ A;  1MP3 A;  4GBP A;  2V0K A;  1ON6 A;  3SXB A;  3DUV A;  1SS9 A;  2YQH A;  2I7B A;  3Q7U A;  1GWV A;  2JCL A;  3CGX A;  3T7M A;  2ICX A;  1QWJ A;  4EEA A;  2GGO A;  4KXO A;  4NAI A;  4HCQ A;  2P72 A;  3PKP A;  1O7O A;  2P73 A;  2RJ8 A;  1OQM B;  3CU0 A;  1H5T A;  3O3P A;  2RJ4 A;  3U2W A;  1R7U A;  1R7T A;  3R3I A;  3U0X A;  4C2S A;  1FWY A;  3ZF8 A;  1Z90 A;  1G1L A;  4D11 C;  2Z86 A;  2BO6 A;  1FZW A;  3JUJ A;  3T7N A;  1NHE B;  4Q7C A;  1O7Q A;  4CJC A;  4M4K A;  2RIX A;  4Y7G A;  4MIX A;  1H4C A;  1H5S D;  1WSZ A;  1VZX A;  1IIN A;  2VD4 A;  1LL3 A;  1JYK A;  4IRQ A;  4EVW A;  3OH4 A;  2I5K A;  3RSB A;  1QGQ A;  3V0P A;  1S4P A;  1FXJ A;  2YQS A;  3V0O A;  1ZJ2 A;  1R80 A;  3POL A;  4O6M A;  3SXD A;  1H5S A;  4ARW A;  4LW3 A;  2PGY A;  1VGT A;  1H7E A;  1ZDG A;  2ZU9 A;  3OC9 A;  3D5N A;  2AE7 A;  4AC3 A;  1LZJ A;  2V0L A;  3SXC A;  1VH3 A;  1W77 A;  2X60 A;  1HM8 A;  2RJ7 A;  5CMG X;  5FV9 A;  2AM3 A;  2X5Z A;  2W0V A;  1NQI B;  2OI7 A;  2AEC A;  4Y6N A;  4B4B A;  2YC5 A;  3OH0 A;  3ZLL A;  5C48 A;  3RMV A;  5CMJ A;  3SX3 A;  1H7L A;  1WVC A;  1ZI1 A;  1LZI A;  1FGX A;  1S4N A;  1H7Q A;  3D98 A;  1H5T B;  4FRQ A;  2XWL A;  4DEC A;  1TVY A;  4DE7 A;  5D92 A;  1KWS A;  3IOH A;  2JCJ A;  4ECM A;  3I0G A;  4KT7 A;  1YP2 A;  2PGV A;  2VXM A;  2V0I A;  3HL3 A;  4D11 A;  2AES A;  1V83 A;  2PA4 A;  1PZT A;  4G3Q A;  4FIX A;  1WT3 A;  2VS3 A;  2FY7 A;  2Y7A A;  5EJ1 A;  1ZI3 A;  4FRD A;  3N9W A;  4K6R A;  3OKR A;  2OI5 A;  3QVB A;  2Y6P A;  4NAK A;  5CQM X;  2XWN A;  1R7V A;  5C4C A;  5DDT A;  5C4D A;  1VIC A;  2FYA A;  1H5S B;  1EYR A;  2RIT A;  5FTS A;  4D0Z A;  1FO9 A;  4Y7U A;  4B4M A;  3LW6 A;  1ZJ0 A;  3K8D A;  2RJ5 A;  4HO8 A;  2VXL A;  4G3S A;  1FR9 A;  4B2W A;  1EZI A;  3I0I X;  1LZ7 A;  2Z87 A;  5C47 A;  4FRE A;  4KRV A;  1VZU A;  2A8W A;  1ON8 A;  5AJO A;  3EE5 A;  2FYB A;  2WVK A;  4EE3 A;  4HO5 A;  2UX8 A;  5CMF X;  3OGZ A;  4ASJ A;  4FRL A;  1VGW A;  2OI6 A;  4MYB A;  4B5B A;  4P00 A;  3USQ A;  1VH1 A;  2MZB A;  5C49 A;  3OH1 A;  1O0R A;  2QKX A;  2RJ9 A;  1NWG B;  1ZCU A;  2VSH A;  3E25 A;  4R7P A;  2RJ1 A;  5EIY A;  2PX7 A;  3CKJ A;  3V0L A;  2CU2 A;  1G3L A;  1ZIZ A;  4HO9 A;  4HO0 A;  2XME A;  4EEO A;  4EEM A;  4D48 A;  3I0C A;  4FRB A;  2ZU8 A;  4KNR A;  2D7R A;  5C3B A;  3I0F A;  4HO2 A;  5AJN A;  2V0J A;  4P02 A;  2WAW A;  4CJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...