3ZGOA

Re-refined structure of the human sirt2 apoform
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
318
Chain Sequence
GSGEADMDFLRNLFSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESPPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of Human Sirt2 and its Adp-Ribose Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-2
total genus 113
structure length 318
sequence length 325
chains with identical sequence B, C
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3zgoA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zgoA01
4UTNA 3U31A 2VBFA 2A1TR 2H2DA 4Y6LA 5BWNA 1XLTC 4GM4A 1UPAA 4FEGA 3CLTD 1JSCA 2FR8C 3CLRD 2EZ9A 2VJYA 5MGNA 3RIGA 5K6RA 1ZPDA 1NM5C 4K9OA 4GM1A 4UTZA 4RJKA 2OD2A 2H2HA 4UUBA 4F56A 2Q5JA 2Q28A 3GLTA 4RMHA 4GM0A 2VBIA 1YHZA 4L2IA 3HWWA 5EJ5A 2BRUC 1OZHA 2UZ1B 3OE1A 4GP9A 4ZZIA 3EA4A 3ZGVA 4K9PA 3FSJX 2EZ8A 2FRDC 1UPBA 4X3PA 3HWX1 3D7KA 4JUFA 2H2IA 3GLRA 4UU7A 4R8MA 3IAEA 1M2NA 4FZ3A 4J16C 1M2JA 2EZ4A 4QELA 5EJ8A 4RMJA 1U28C 1Z8NA 2IHTA 2JI7A 1PT9A 1PI3A 2HJHA 1PNOA 4JU8A 1QPBA 4X3OA 3ZG6A 4F4UA 4FVTA 1OZFA 1N0HA 1POXA 1V5GA 2H2GA 1PNQA 4Y6OA 4MZXA 1ICIA 3PDHA 2JIBA 2VK4A 2WVHA 4K9QA 3JR3A 5K2OA 4RJJA 2NYRA 2JI8A 1Q6ZA 2VBGA 4IF6A 4HDAA 4MPRA 2PGOA 4C7BA 4IG9A 2QQFA 2H59A 1YC2A 2QQGA 1YBHA 4HD8A 1PYDA 2AG1A 2NXWA 2JI9A 2JLAA 4BVGA 4Q9DA 3EY9A 5BWOA 2A1UA 5EJAA 3F6EX 5EJ9A 4JUBA 1EFPA 4K9KA 2H4HA 4JD5A 1Q14A 2OD7A 1T9DA 5MF6A 1YTLA 1V5EA 4KPUA 2EZUA 2FN3A 3CLSD 1YC5A 4UTRA 2OD9A 1OZGA 1E3TA 2Q27A 1YI0A 3CF4G 3F6BX 4JU9A 4KXQA 4V1CB 5EJMA 5EJ6A 1T9AA 3GLUA 2Q5LA 4TWIA 4C78A 1Q1AA 5D7NA 5BWLA 1U2DC 4JUDX 1PTJC 2B4YA 2UZ1A 3FLMA 3U3DA 1SZCA 4K9LA 2H4JA 4V1CI 5K3SA 2VK8A 4BVHA 1Y9DA 1S5PA 1EFVA 1M2KA 1UPCA 4JT8A 1YHYA 4BV3A 1O97D 2C31A 4G1CA 2AG0A 1HZZC 4BVEA 1YI1A 2Q5QA 3PKIA 4ZP1A 4BV2A 3EYAA 5K6TA 2X7JA 5IMSA 2IHVA 1BFDA 3E9YA 1S7GA 3D81A 1MA3A 4RMGA 1T9CA 4COKA 3FZNA 4UUAA 2WVAA 4UU8A 3PKJA 4MPPA 2VK1A 5MFZA 2EZTA 1U31A 4BVBA 2H4FA 5FEMA 4JSRA 2PGNA 4UTXA 5FYQA 2Q5OA 4QQ8A 1M2HA 4L3OA 1M2GA 4BVFA 4RMIA 3JWPA 4TWJA 1D4OA 1DJLA 4JT9A 1POWA 4FEEA 4MPJA 2JI6A 1Q17A 3GLSA 2OORC 1J8FA 5AHKA 1V5FA 4D5GA 4KGDA 1MCZA 1T9BA 3RIYA 4K9NA 2JLCA 1PO7A 4GPEA 5DGTA 2OO5C 4O8ZA 2FSVC 2WVGA 4D5EA 5EJ7A 4RJIA 2PANA 2W93A 4GG1A 4BUZA 2IHUA 3CLUD 2H2FA 5EJ4A 2V3WA 1U2GC 2Q29A 3ZGOA 4J1TC 4Y6QA 2DJIA 4UTVA 2FWNA 1YNOA 1SZDA 4V1CA 1O96B 3LQ1A 4MQ5A 4QPZA 4BN4A 3D4BA 3K35A 4K9MA 5MFPA 1OVMA 5DGDA 5DEIA 4IAOA 4BN5A 1PVDA 3IAFA 4JUCA 4JUAA 4I5IA
chains in the Genus database with same CATH superfamily
5LQCA 3TLEA 1T2VA 3OQ1A 2GN1A 1TTPB 2JIDA 2CJYA 2I33A 3O9VA 4ZIRA 3RAEC 1NM5C 2BTQB 1ZNWA 3KXLA 1HT3A 3FUUA 6Q21A 3UJDA 3AERA 3Q88A 5A9RA 1EQ2A 1U8YA 2E4XA 1G8MA 2GKOA 1AUXA 2IZ7A 4MPDA 2PA0A 2NVWA 3T3GA 1JKIA 1WD7A 3UMBA 3C5HA 1OAOC 2IEZA 4V02A 4EPYA 3NB0A 2NUPB 3K5PA 3VH1A 3AV0B 2PTHA 4FGKA 2ZIXA 1CJUC 1V3UA 1KSFX 2G0NA 3W2GA 3K09C 1JSXA 2ZI5A 4HGNA 4IIEA 4YAOA 4I0WB 4CV1A 2HYIC 1U7ZA 2O8CB 4C7OB 1GZUA 3HEBA 5JALA 1POXA 2XDYA 2MSKA 5F76A 2A9RA 2JBAB 3KTOA 2WDPA 4HB4A 3Q3JB 5AVZA 2Z9BA 1NBAA 2I2FA 1JBKA 1K8QA 2PLRA 3EEIA 3KPYA 4NU5A 1MV8A 4DLUA 4OBBA 3VC3A 1RRKA 1NY5A 2Q50A 1Z6YA 3YASA 1IWBB 1H9CA 2F3TA 2VPIA 2BT4A 5A5VA 2W98A 3BXOA 3AJAA 1I94B 2JI9A 3C5EA 4YV7A 2OV2A 1HT1E 1JKJB 3WYFA 4MV8A 2IS1A 1OI2A 1X7XB 2CHUA 3GT0A 4U9HS 2QM3A 3UQZA 1GKYA 2RC5A 3ASYA 4RHYA 2DCUA 1WQ3A 4TYPA 1I6WA 2CFOA 3F6SA 4KPUA 2RAFA 4BKOA 4CF7A 2NVBA 3TQTA 1OXTA 1Y3BE 4JLUA 4X3CA 1L7QA 1MIOB 3DUFB 4KMMA 4LSZA 4PN3A 2A9KA 2QPLA 3IO5A 5L53A 1EXMA 5MHTA 1INLA 3TPFA 2VXCA 2CBZA 4I4TF 2GH1A 5ALLA 4JC0A 4L9RA 2BFDA 4E2YA 4WW0A 5JROA 5IG2A 4OBWA 3WI7A 1OHHD 1ISPA 3T7DA 1KYQA 1TAQA 2QRKA 3FSGD 4J1SA 4Q4JA 1IY2A 1WMAA 3HADA 3WB1A 4CN9A 2C8VA 3I6ZA 1RHMA 4OTZA 5I7OA 2JGDB 4D4KA 3HWSA 3JWIA 3A9UA 5TQJA 1FXWA 3JQCA 1LGYA 2BEKA 3B89A 3M9WA 1J25A 1V4NA 2BSXA 2I6FA 4Q3NA 1SG0A 5EQFA 1FIUA 3D3WA 4AJJA 4PW0A 3K31A 4QO7A 1ND6A 5L3VA 1O1YA 2UXCB 2FZGA 3GJ4A 1VBKA 4XM0A 4YT2A 2Z5VA 3GWGA 3OEEA 4C0KA 2IYRA 5F2OA 2EC5A 3OEYA 2YH2A 1TEZA 3CC8A 3CVWA 1KA9H 2Y1KA 4RVOA 2VH5R 3CLVA 3PTZA 5DYIA 1EESA 1XZJA 4BQSA 2YHBA 1X7GA 3GNTA 4F5DA 4NXNB 2X1MA 2XMPA 3C8ZA 2I3GA 4B2PA 3ACBA 3K9WA 3GUZA 3I1IA 2XMBA 1IBSA 4AO7A 2H2FA 3OG9A 3SFVA 1V45E 2ONCA 2EW1A 2V4UA 1QIFA 4ZCSA 1QGZA 1WDTA 4M53A 2F8LA 5HDBB 2J08A 3LLCA 1UBGA 4FFMA 2FXVA 3L82B 3RFTA 1QPZA 3PPVA 4CKBA 3L1HA 1G63A 4IH1A 4F8YA 1USWA 1C3XA 3EDQA 3OH8A 4MWZA 1QWOA 3ZU6A 1KGDA 4H4DA 5E4TA 2XGJA 1VA5A 3I52A 4DS3A 4EKYA 2QP4A 4LISA 1VKOA 2XYPA 1J2EA 2ZVPX 3IHWA 1DX9A 3OEHA 4CKCB 1YQWA 4M1YA 1RPAA 1SB9A 2WDZA 2VJCA 5LBUA 1KETA 3W3AD 4GNRA 5CK5A 1JKMA 3WC4A 1P3Y1 1Q95A 2C00A 1N0VC 2FMIA 3HYNA 4OATA 1NVGA 2DUMA 4NNPA 4BTLA 2OM6A 1ZC3A 4WFJA 4XRGA 3RRNA 4D57A 2WU4A 4KMOA 1G2PA 1P1JA 4GPAA 4PZAA 4GLJA 1JS1X 4EG3A 1TZMA 1S6YA 3PGLA 4K0KB 1IXYA 3MW8A 3OE5A 3RQIA 3R76A 4JT4A 3MRTA 3A3YA 5KDLA 3WMGA 2NO4A 3ZVRA 4EA9A 4IDCA 5L6LB 3CQ9A 4PHHA 2E5FA 1Y48E 3SSOA 5C1OA 4BHTA 3EWNA 1NBMD 1A2OA 4PIVA 4F9TA 4HB3A 1B16A 4AUEA 3FJ1A 1CUUA 1YQUA 1A72A 2Q9AA 3V7NA 2I2AA 2Z8ZA 3DTYA 3VI4B 2ZI9A 3P2OA 3RT1A 2B4RO 4M9SA 2EU8A 2V9PA 2YTZA 3D1VA 3R6GA 1NPDA 2YIVX 4M76B 4TRNA 5T4HA 4GL2A 4EQZA 1TEVA 2IGBA 2ZPUA 1HE4A 1C0LA 3TBHA 2O19A 5MF6A 2R8YA 2XA2A 2YV2A 3LF2A 4MB6A 4A23A 1ODTC 1QORA 3HCNA 2QZSA 3DYIA 3A58B 3GBPA 3ZXSA 3N2YA 1JLHA 3SHQA 4AJPA 3BXGA 5L4LA 4KXQA 1B14A 2ZUTA 3ZWVA 3IELA 1J0EA 5J40A 4FQ8A 2ATCA 2E4YA 2ZULA 4K9DA 5FBQB 4CIAA 5LQAA 2FUG1 1JEYA 1JLSA 3QLTA 1QVAA 2VYCA 4E13A 1RXSA 2VK8A 1YWGO 2RHOA 5HF9A 4AB1A 2ZDGA 4WOCA 3GLQA 5E6RA 5CFLA 2AI2A 4OUKX 4RZUA 3TR6A 2J9YB 4BNLA 2O5EA 1ZK0A 3O4JA 3STVA 1FUUA 2PWBA 2Q6OA 3D7SA 4IGIA 3UMSA 3IQXA 3KXDA 3KZXA 4IJWA 1Q0HA 2ZSFA 3VHXB 5G3YA 4DR6B 1DOZA 2D3WA 1QGUB 3FFWA 1L8XA 1LW7A 2HA5A 2PT5A 2X0JA 4LRYA 1VCHA 1CJVC 4ALMA 5LP6F 4ENTA 2O7NA 5AVYA 3OE7D 4RMIA 2GASA 1QTRA 1YS1X 3QSYA 2ACKA 1WHTA 4AKGA 1WW8A 4TYWA 3P0EA 5K0BA 3W79A 2ZQYA 3KU4A 4LRTB 2TMGA 5BW6B 3ZZUA 2CEKA 4OGWA 4DMUB 5KQGA 1F5SA 4M55A 4CKZA 1JQ5A 1UT5A 4FTWA 3GN2A 4JI0B 1L5OA 1ZI9A 3VNUA 1U2GC 4FMBB 3T7SA 1JMKC 1KK2A 2ZAIA 2OXTA 1CJBA 1I2BA 3PE6A 2NQTA 4PTZA 2PZLA 1CY7A 1U9ZA 3GDHA 4IY1A 3KHUA 2QRGA 3AKZA 1QC5A 2IYSA 3QNWA 1FUEA 3L8EA 4EELA 4BN5A 2QQ0A 3TCKA 1GL9B 4NYIQ 4R4JA 2KE5A 2CNBA 4KE7A 4B8ZA 4C2AA 5HTOA 2ZJZA 2QV0A 4KIUA 3EYWA 1G41A 4O4JB 3FF4A 2IYYA 1XD9A 4XM1A 4Z1OA 1NHWA 4RK4A 4ZYUA 2ZZNA 2KI5A 3JQFA 4XZ3A 4DMLA 2PGIA 2NPIA 3BK7A 3G02A 3CMCO 4H3SA 4QHTA 5C3UA 4ASUD 3WTCA 2P5TB 2JIZD 4ZI3A 3I2KA 3CSUA 1CCWA 3G0OA 4IO0A 4KWTA 4MV3A 4N40A 2Z6AA 2G71A 5EIBD 1M73E 3TS1A 4ZJUA 3HWX1 1N36B 3BWVA 3ZGLA 4OOFA 3V8RA 4ODIA 4MRMB 1VPLA 4CPDA 5F12A 1PJSA 2Z5GA 4F1KA 2MWMA 1LWOA 1YZ3A 4LYJA 4JBNA 4TYQA 5IUJC 4FD2A 4CKXA 3D6JA 4OEHA 1W5TA 1IONA 2AYZA 5HK8A 2VDQB 3PPWA 4F7DA 2QUIA 3BULA 3FI0A 1S2MA 3IDFA 4ZK6A 1N9GB 1B1CA 3VR2A 2PKXA 2V3CC 1E6WA 2C9CA 1E4EB 3GD7A 3H9BA 4LWOA 5BMVF 2PLWA 4Z4IA 2JFWA 3LPMA 1FE8A 2R5NA 3WICA 1NXVA 1YC2A 1UBUS 2BFBB 2EATA 3PNSA 4RKRA 4ZOAA 2PU5A 3VA7A 2WAAA 2X1LA 4DV5B 3D2AA 1CJKC 2FOIA 4DXAA 4MS1A 5F7OA 1I7QB 4BMCA 4H1VA 3WTBA 4HLCA 1XTIA 4EQ6A 4FDLA 4QHYA 3WK6A 4FHCA 2BH2A 5CFZA 3DDWA 1WJGA 3DMNA 3CNNA 1K7CA 3MG9A 2YV1A 2KB0A 2ZT8A 4HKTA 5CIWA 1X9IA 3AEUB 3TIVA 3AOGA 3FCAA 4KR0A 1E4VA 1IHDA 4C1NA 1VPTA 1JQAA 1I0ZA 3AU8A 3BGWA 4KX3A 3EG9A 3RTGA 1DOAA 2BEWB 1YZYA 4Q19A 4RTJA 4BVHA 4JI3B 1AHHA 3RI3A 3LTNC 1IJEA 2YWHA 1KI9A 1GPMA 1WO8A 2ZIVB 1JDBB 4EGFA 2EX0A 2QU7A 2AQHA 3T3HA 3BB1A 1E6MA 1ODSA 3DV0B 3CJQA 1PLLA 5K0FA 4F97A 3NW9A 5KWSA 3OSUA 4Y6SA 3P45A 5FB3A 3BMOB 4BU1A 4MQLA 4C0XA 3NEJA 1LS1A 1C9MA 3P2JA 1XZKA 1C4XA 3K4QA 2FQXA 1FXUA 2V7BA 4MINA 2OQVA 4YYEA 3ZI0A 1B74A 2ZZMA 3IOCA 3O26A 4JJ4A 2FSUA 4ZAWA 4E6PA 4F2HA 3I61A 1P5FA 2CUKA 3HWRA 5LM3A 5JSQA 3USCS 1NU8A 3IAM1 1N57A 5LIPA 3C48A 3P9XA 4OOEA 3PEVA 4DZTA 1IL0A 3K9HA 3HKEB 1BHO1 1OLSA 3V1LA 3WAJA 3TZCA 4FYXA 1QRAA 4TLAA 2Q3BA 2JFNA 4WOJA 5IBQA 1ULHA 2PL3A 2IXBA 2NW6A 4YAGA 4XASA 4UTVA 5F2EA 5FXMA 1CUAA 1ILWA 1NTRA 4RL4A 2BYTA 4LDRA 4EFNA 3E7DA 1J8DA 3JD1A 4O2AB 2WG2A 3PQ7A 4D3FA 3IAS1 1L5ZA 3VKWA 5KNCA 5ICFA 3V1YA 2UVDA 3S55A 4HUJA 4JA2A 3A6JA 2QE6A 4NKRA 2ZP1A 3OCZA 2C04A 1NFQA 1QQ7A 2PO5A 3E5RA 4GM1A 2OD2A 3I39X 1YZTA 3EEFA 1RBMA 3ITNA 3EQ9A 4XCQA 4YJ3F 4FWTA 4CGZA 1QYVA 5CVVA 4Z0NA 3ER9A 4D92A 1XJCA 2B8WA 3GUCA 2P9CA 1CRWG 4MWCA 4Q18A 4QOEA 4UM8B 3OO1A 3VO8A 2CNWD 2ZRKA 4E30A 2DTEA 3NAGA 2VWHA 1OYOA 2M6SA 5GVRA 4YK7A 4YT5A 4JA0A 1OR8A 2N3ZA 1IBMB 2FX3A 2W7TA 3IV9A 4NAUA 3GUUA 4AL4A 3ED5A 1V1RA 3OTIA 4INAA 5KBYA 3W2FA 5HNKA 3A0RB 3BCSA 2IYPA 4GUDA 4LNUA 4O2BF 2AS0A 2EG5A 1ZK2A 1NNLA 3PIRA 3CWQA 1VSUA 4WK0B 2C5EA 3H3JA 1GCUA 3RSGA 4O8CA 2ZRCA 4BFUA 2W6QA 4BO0A 2A5GA 2VK2A 1R0LA 3HNRA 4D74A 3THWA 4MHSA 1WUJS 1DKLA 1YS9A 4IGFA 3WL7A 5IEJA 1M1YE 3M6MD 2J8ZA 2QQFA 1YZVA 1W87A 2BC9A 1AA9A 4QNMA 3JVUA 3CJTA 3SPXA 2HHAA 3PC2A 1DQNA 2B1JA 4PX9A 5AH0A 3CKKA 3O75A 4L2IB 1T9ZA 1TM3E 4EHNA 1UOQA 3QPBA 4HNAB 4MV4A 3LUDA 1EFDN 1JZSA 3NKVA 3O3NB 2J3EA 3PLNA 4M0UA 4CV2A 1Z0DA 2CMKA 1YA8A 1T8RA 2GEFA 1UXKA 1VE9A 2IYNA 3ET5A 3E81A 4C4AA 1QQAA 2FZWA 5IN5A 3FHOA 1AKNA 3WKEA 1PQ4A 3L6RA 3WX0A 4DGQA 5L6MB 4PO1A 5IS2A 3OKAA 4BE9A 2IRWA 5T4FA 1C81A 1KAQA 1GXSB 3K09A 2FMHA 2GXQA 2WU0A 1UFVA 3DZGA 5DLQC 1UKAA 1EUDB 1DG1G 3K6KA 4MQEA 3RTEA 3UN1A 1R0BA 2XKAA 4LXQA 3NXSA 5ALVA 1X0XA 1AQNA 2HW8A 1R15A 1T9GS 2G9UA 4JROA 4M49A 5HVNA 2X9NA 5KJCA 1YQEA 4Q6WA 3GLIB 3CNLA 4BU0A 1R0YA 3D4NA 4X6LA 4CKBB 1GPJA 3ETJA 5BOVA 4CMBA 1CY4A 3TD2A 5BSWA 3GRVA 1QH8B 3NDIA 4Y98A 4ND8B 1NYLA 4BKUA 4KWEA 1SJ9A 1O0CA 1TLFA 5CYFA 4X92A 1L5WA 4YLEA 1GV0A 1MJ5A 2PZBA 2V0NA 4ZO7A 2JD1A 1H2ZA 1P72A 3L07A 5F9HA 1MCZA 1FP6A 1WKBA 2X0FA 3U26A 1XZMA 5EHXA 1BEZA 1ZGCA 3OZDA 5J4VA 3QU5A 5TMDA 2OC4A 4HOYA 4I1OA 1XHEA 2P2GA 2ZSAA 3AIKA 3AHHA 3E05A 3DEAA 3E1GA 3H5TA 4E4YA 5KYXA 1VYHA 2I76A 3HVKA 1V26A 3QOWA 4MWGA 3PC4A 3SICE 1WUHS 4BWFB 1IPEA 1XTVA 1E1MA 5I9LA 1QQBA 2BLNA 3VTZA 1A96A 3PQEA 4P0TA 1A0OA 3LXRA 3OX4A 3O8BA 2QORA 2YR0A 1ENZA 1P4GA 3BWDD 3FCXA 4ZWNA 3VO2A 4L5IA 4II2A 4QAQA 3L84A 3RF7A 2P2CA 4FFNA 1BJKA 4KO3S 4J4HA 4B3TB 2VSXA 1J9EA 3QKRB 3EXEA 3T3PB 3L5KA 3H2ZA 3ZU2A 1OI4A 4KUEA 1T3TA 4CL2A 3AVWA 3COSA 4WFQA 4FFOA 4DRZA 4B76A 3HRIA 5J43A 3RFXA 1COWA 2PN1A 1JR6A 1P33A 2W6JD 4GVLA 2QN1A 2ZTSA 2WEKA 4MQ4A 4OJMX 4AECA 2UXBB 1XLVA 1U4NA 1A8IA 1BOOA 1MNAA 1LK7A 1H1DA 1P1FA 4ZRMA 1XNRB 3TI9A 5J5AA 3KJHA 2C9BA 2FRDC 4RD4A 4RSMA 4DLYA 2ANBA 3O92A 3UMYA 2G1AA 5EXEA 3KVNA 3T94A 3MMZA 3NWOA 1SPBS 5IN4A 3GJYA 3H0EA 3S4YA 1H4SA 3B1XA 4BO7A 4WX2B 1OV6A 4H7HA 4A7PA 1SIWA 3CW9A 1WTAA 1QANA 3KQPA 3IUYA 2DMRA 1Z8DA 2EGGA 1YRBA 4WBNA 3IR5A 4ARIA 3PEYA 1MABA 1SKQA 5IAEA 4UHKA 3UT5A 4XVCA 3QVGB 3RC3A 3EAFA 1DJOA 5JNUA 1YH3A 3BSWA 1ZJ5A 3N0TA 2H1IA 3H04A 2G5GX 3WG9A 2WILA 4FDMA 2RKBA 1XV5A 4BFXA 5EKXA 3UGKA 3D2BA 4ZO4A 1CZOA 5EXTA 5JV5A 1Z6TA 3HEAA 1BXZA 4D82A 1GUYA 4HGPA 4JOQA 2Z3WA 1JH8A 3BIXA 3QTTA 3PJGA 3B1WA 4GXQA 2CXTA 3P0HA 4RACA 2RJ3A 2G5PA 1XD2A 3GMSA 2B5WA 1HDYA 2RHBA 2Z58A 1PFUA 4QJ3A 4TUYB 3OICA 5TXGA 4MGIR 2JRLA 3N53A 4F38A 3AUSA 1XCOA 1G4AE 3HYSA 4BNFA 2J3JA 4PTYA 3EN0A 4QWWA 1CY0A 1GQSA 4IWYA 3ABOB 3UT6A 3WSTA 5KI6A 5CBPA 1Z26A 3QUSA 3M6UA 1XTZA 2PSSA 4HLUA 4OXYA 4S2EA 1JQEA 3PGXA 1F9EA 4KR6A 1OBHA 5HMLA 3Q8LA 1AX9A 3DZKA 5FNVB 3TCNA 2H31A 5K0NA 4IUYA 1ZEMA 1YQQA 4ND5A 4OJKA 2QSZA 2CB0A 1FLAA 3Q8WA 2RKOA 5F7ZA 3TTTA 2Q1WA 1MQ8B 1NOJA 4AY6A 4IDFA 2HF8A 4WL0A 4KGXA 1TYZA 1S7GA 3PCXA 5JADA 3DLHA 2ZYDA 4XVHA 4MWDA 1EA7A 3NEYA 5IXYA 1Y4AE 2XYRA 3BGDA 3FDZB 1E1CA 3R0QA 4NZPA 4R68A 2XGOA 4OQ4A 3ET4A 2GYWA 3W9YA 2Q5OA 3CUKA 3NR2A 1GUZA 3IXLA 3UXMA 4BAGA 3VVCA 1L5KA 4D5GA 2LR0A 4MQ6A 2B0JA 4JNKA 1ZM3A 5EG5A 1MH9A 1QFMA 2FPXA 1YJAA 2H1RA 1Y1KE 3UJCA 4O2AA 2YFKA 3KVYA 3VYRB 5AJWA 4O2AF 2N9UA 2JCYA 4A16A 3KP1A 4KQMA 1FJXA 8GPBA 1C2TA 4FFPA 2J85A 4UHCA 4WKNA 4YAUA 2WNSA 3IXMA 2VDKB 1PWEA 3EW9A 3HUUA 3KKLA 5IC4A 3VR3A 1X7HA 3U16A 3CCFA 3HKCA 2WBLC 2P3QA 1N2SA 1SMKA 3C3PA 3CIFA 2QN2A 3OECA 4DB4A 3K9NA 3TFWA 1ZA2A 3N2GA 1EP9A 3F1KA 4KBYA 3QLVC 1ECJA 3QYJA 1WV1A 3FR8A 4S1NA 4ON9A 1JHZA 3WLTA 2XWQA 1Z5VA 3EVDA 4HDOB 4LECA 3ESRA 4BMOB 2OZPA 2IY7A 2OHOA 1CDOA 1NOKA 2NPFA 4X84A 1VL5A 4DGSA 2LGJA 2HDHA 3T7JA 3KT8A 4Y2VA 1Z18A 1U1FA 2GVNA 1JU3A 2C5BA 2QVYX 2PEYA 2P9EA 2JZNA 3JWEA 4PNZA 2CNKA 4QE3A 2QAGA 3N2EA 4QEKA 4QOGA 1EDOA 1MGPA 3Q15C 1N9GA 1W52X 5AQ1A 2LE0A 2W2QA 5DM1A 4B3BA 2JJMA 1RYYA 1P2FA 5FPTA 4QEDA 4RFLA 2IODA 3AY3A 3BDAA 2E5LB 1GVNB 2QW1A 4FZ3A 1B0PA 2NTEA 4FJ0A 1TDJA 1XRRA 2RBKA 4GR9A 4YREA 2VLIA 3PNVA 2ZRAA 3HYTA 4PYNA 2UYQA 2HJHA 1R66A 3IBGA 4JOBA 3SD7A 1L5RA 4A6PA 4C43A 2UUBB 4FONA 2QR3A 5E7MA 4ERNA 2DF8A 5KTYA 1XDSA 2IPAB 4B7UA 1X8KA 2WP0A 3OBIA 4R8SA 1FTYA 3I62A 1ICEA 1TA0A 2FGJA 3LY5A 4YEDA 1JQKA 4FBMA 5DF1A 2GWRA 3ORHA 2BCGY 1EGQA 2ZU0C 3GYGA 4AROA 5EIEA 3FMGA 2JASA 3KE8A 3H9EO 1A9ZA 3PQDA 2UVQA 3DP9A 2VZ0A 1ZIPA 1GAQA 3HM2A 4JLDA 2A0YA 3QIAA 5C1DA 5F78A 4MQUA 2PNFA 4DKJA 2H2AA 3WLIA 2ZYAA 1ZIXA 3QUBA 1ISJA 4Q9DA 1GLVA 1HQCA 5BWOA 2JCXA 4NH0A 3REGA 4JL6A 2XCSB 1LPPA 3BAFA 3MAGA 3IT2A 2M6RA 1BXRB 5DK6A 1OTYA 2WJZB 2V96A 1FQKA 2VHJA 3EBLA 3GNSA 5F1PA 4BMVA 1B23P 4FBGA 2B7CA 1UWKA 1FVXA 4QUGA 1XZPA 1P1HA 2FW9A 2REXB 5LJLA 2CLFB 4HTAA 4WN9A 1UT6A 4BVJA 2NZXA 4HNQA 2BBOA 5AHWA 1QGED 3NIGB 3K0CA 3VRHA 3WGTA 4OBXA 3D6TB 1ZNYA 4GYKA 5J9FA 4YACA 1K5PA 3HCFA 4YPOA 3BRWD 5IBRA 3BL8A 2C31A 4UBLA 3AJEA 3R0IA 3O47A 4PQGA 4JC8A 5EXPA 5AWFC 4RTQA 2CXXA 2YC4C 3OIDA 4NH4A 3ZZ0A 1L9XA 1R4AA 5JPDA 5BW8A 2EERA 4F3CA 3M6XA 1B7GO 2GEBA 2NYVA 2Z8XA 1F9AA 2OYCA 4PNEA 3MWDB 4FGJA 5LKRA 4RLFA 3GOHA 3ZNQA 1XWWA 4CTMA 4HJRA 3DOFA 2ZQ5A 3PC8A 4GEGA 1Y5LA 1NUAA 4J16A 4M0LA 1CR6A 2CFCA 3CS3A 4XW2A 5HIMA 3RC7A 4DLLA 3KJXA 3HVUA 5KSYA 3I5YA 1D2EA 3V2IA 3VTAA 2WYUA 4O1HA 1TUBA 3NHFA 4C89A 1RXIA 1QR6A 2GLXA 1XXLA 4JY7A 4LYYA 5K0JA 3OJLA 4LRWA 1ZN8A 1A9YA 1V3VA 2OHIA 2Z04A 3RRYA 4BKRA 1DC6A 3UAWA 4BLSA 3DCJA 4P7KA 3BBLA 4RNCA 4ZCTA 1KEVA 1T1SA 4AW9A 4JYCA 4QX6A 2IHBA 2V3WA 3DHWC 5K3CA 3ZGOA 4GI7A 5E6RB 4JOCA 2DJIA 2GI4A 3BJIC 2GHQA 1JRLA 1E8NA 3O8DA 4MB2A 4WA7A 4DQUA 2RHRA 2AFIE 2CD7A 1W96A 4P0PB 1F20A 2DQSA 4YRLA 4E7PA 1N5DA 2AMFA 2FR0A 4GEKA 3SKYA 4X1YA 1XLTC 3DMDA 1H05A 2ZWAA 3C6BA 5EUQB 3PTAA 3R9KA 2GEUA 2F3RA 4RQBA 2H65A 4WY5A 4IJMA 3B9RA 1QG2A 5J4LA 1V8PA 2HIGA 2QG6A 3A6KA 1FFXA 8MHTA 1P73A 3LCMA 5G53C 3WMEA 1A5ZA 2ZR7A 2NPOA 4BRUA 4WLVA 3T4UA 2G7MC 3BUSA 4XGRA 4KL8S 4UNRA 4J1NA 2GVZC 1K8YB 4ERXA 1W73A 2HB6A 4KXVA 3Q2OA 2EWVA 5FUWA 2ADFA 1QFJA 3ZWQA 5JRZA 4IJUA 3BHMA 1VIAA 1F8FA 5KJEA 4N3BA 4NONA 1U0EA 1Z36A 4D9MA 1TRKA 2DVMA 3MHPA 5LDGA 3HDGA 2IW3A 1FYFA 1TZJA 1HZZA 4CVNA 3KVRA 4TV9A 4YRCA 3F96A 1E3IA 1FNCA 1U6IA 2PH1A 5H59A 3O91A 3T54A 4DIBA 3ELWA 4BNTA 2GEKA 3WWPA 1UPUA 5TPWA 3K4PA 3FUXA 2QYOA 3KIPA 1GFSA 1D5WA 1KYVA 3E7WA 3NCHA 3NIWA 2P41A 3OIVA 4WZBA 3I45A 3KKMA 2VPPA 2Y9MB 5FBLB 3H7AA 2JLAA 2GRAA 1PUJA 1OBOA 5AI4A 2YJTD 3DT9A 3TSAA 1RXUA 2HMSA 3VO9A 2D7JA 3IQEA 1YRAA 2V55B 4DCUA 5KOJA 2R6FA 3G8DA 3PHGA 4JD5A 5U4XA 4E31A 2H08A 3PFHA 5KJ6A 2XYGA 5IKMA 1IMJA 4WFKA 2ZVDA 3FHLA 1FFYA 3OQ6A 3T9AA 5EESA 4AC9A 3BA1A 2CFRA 3HB0A 5DNVA 3VOSA 2ZAMA 2XH8A 3K0EA 4YR7A 2RSLA 2ZUVA 4H6PA 2VHWA 5A4DA 4TXMA 4LC0A 4IV0A 1F5NA 4Q82A 4EARA 4PYKA 3PNKA 2P7HA 5G41A 2ZJBA 1YQ9A 5JZ9A 2PJRA 2J7PD 1PQWA 3L02A 4IDGA 4YUXA 3CW8X 3SYKA 4GWKA 1Z4LA 3UT0A 1T2NA 2J3KA 1RBZA 3TE6A 4KFRA 1G5HA 4Y30A 5AUNB 1ZCJA 4M0MA 1TQ6A 4DWJA 4O4IB 1ZGZA 3GAFA 2FKAA 4FT4A 1RI3A 2C5AA 4AG3A 1JMYA 1JV2B 4M21A 3RASA 2ZT5A 3OCVA 5JAMA 4GGPA 3LBHA 1E5XA 2DPGA 3GA0A 4J49A 4Q1DA 5FOXA 5FI5A 9ATCA 1QYDA 2PYDA 3H0KA 1NDQA 2JFXA 3BPSA 3WLQA 4PF1A 4L73A 4Z1MD 1OA1A 3L6CA 3WLRA 3DZFA 1NY6A 1WCIA 1O89A 3IIJA 2Q4RA 1GT91 5LDHA 1RYHA 2I1LA 3BRCA 3NTVA 3NUZA 3T7RA 4E33A 4DV1B 1NULA 4G26A 5A4KA 4WN3A 2GTIA 4B2LA 3FOWA 3C39A 2VRBA 4PAOA 4FLEA 2JGIA 2RK6A 1XAHA 3FVRA 4ZV9A 1TFRA 2E5WA 4ZU6X 1E2HA 4G1UC 2A5YB 4GZ5A 4N7RA 3SIXA 3R1IA 3S68A 3PFFA 4G37A 4WXPA 5IMBA 1SVOA 2BZGA 4C29A 5JMTA 4TRRA 4CZ2A 5A9SA 2UUCB 1WEHA 2P7IA 1OLXB 2QMHA 3WGVA 1XFDA 1WKVA 4B5LA 2AB0A 3HNOA 4IS2A 2D06A 2CN1A 1Z16A 1Z56C 5H5JA 4BFWA 5I7UA 4YR9A 2W70A 3VSCA 3WFIA 2HLPA 3DL2A 3VX3A 1TM5E 4BNHA 2NU6B 4AO6A 2R751 5AKKA 2E85A 4W8OA 4ZAYA 1AOXA 1N2GA 3FZYA 2Q49A 3C3MA 4XWKA 1E6UA 2CHVA 1TD1A 1C41A 3BICA 3I9V1 4KXWA 2WHXA 3RODA 4A8JB 4FX2A 2YV4A 5T5QA 1CR1A 4OQFA 2B2NA 2PAFA 1KP9A 1E8MA 3CPHA 2WPDA 4QTTB 1M1XB 2B5VA 2RAPA 3LPAA 4OQNA 3OIFA 1EXNA 4DDUA 2C3MA 2CSXA 5K0CA 1T1JA 2FP4A 2I2BA 4GRIA 4BX9A 5LZ4A 1YR1A 2JFFA 4ARCA 1RMQA 3KJQA 1Z22A 5CVEA 4Y2QA 3RTBA 1ZW1A 1XELA 2JCSA 1D1QA 1A82A 3BN3A 1N2CB 1JE1A 2QM7A 3B1JA 2ZUCA 3AFGA 3M4NA 4FWBA 5KHAA 4EJ6A 4C14A 4RM2A 4DUZB 4B74A 1KQOA 2R8BA 2Y4OA 3FY4A 4D4IA 1XU9A 4YT4A 4XPIA 1B76A 1FEZA 2O2XA 2X8BA 2B37A 5ITZB 2HHJA 1GQQA 1LY1A 5HCIA 2CNDA 2XT0A 1X7DA 2JK1A 2P9FA 6ADHA 5CVUA 3WLKX 1O9BA 1Z7WA 3CXRA 1RSZA 1SHLA 3B1KA 4M7OA 4EHAA 2Y77A 1N9KA 4P5PA 3IBYA 3RS5A 5ECWA 1WAMA 5J2TB 1B6GA 3A6LA 5AVQA 1XMPA 3LGXA 1Q14A 2BJWA 4MLDA 5JO9A 1XQWA 1YIDA 2P77A 1X38A 4LXTA 2AFHE 1OQAA 2H2WA 5AVJA 1M5RA 2JVKA 3I9FA 2Q1XA 1W49A 1RCTE 4R2KA 3ZWDA 3WNQA 3AW9A 3T5CA 2G40A 4RFSB 1JAYA 3SVLA 3ML1A 2DQ4A 3OLZA 3VZBA 3ENVA 3HB9A 3SFTA 1GGEA 1XWIA 3BREA 1K98A 1WQ1R 3PQ3A 4KUHA 4Q0MA 1D4AA 2RAUA 3QVTA 1OZ0A 4MULA 3LCJA 5B58C 2FMTA 5DI3B 4F1WA 1NVBA 4BXOA 1NAHA 2D1RA 2IEGA 4MAFA 4X7BA 3F7OA 5FL7D 3TTWA 5CGQB 1MEOA 4EJFA 4QAJA 2HPAA 2GAAA 2POCA 3I42A 1P4SA 2RHDA 2GMWA 4F3TA 2F1HA 2QA5A 1VE3A 5SY9A 6REQB 3RBAA 1E7QA 5LNK6 2QJTA 4EG5A 3E84A 4I8DA 4KW7A 3NDPA 3OZVA 4P4SB 4KIFA 1OH6A 2J7KA 1TT5B 3SSNA 5KB3A 4UMVA 3F4KA 3SR3A 1J90A 4C0QC 1Y33E 1RS0A 3MGAA 4Q12A 3N3AC 1B4DA 1J2RA 1V2GA 3REOA 4OUDA 5I47A 3FDXA 2V7VA 1F2TA 3R0JA 4LDJA 3W3AH 1VGQA 3NCTA 3ZPXA 2P6OA 4KXLA 2NG1A 1VG0B 1ZCBA 3ZW9A 1EUDA 4MQEB 1SKYE 2XE7A 4QPZA 3ZQJA 1D7OA 5ADWA 1XZFA 5REQA 2XUOA 4HBGA 4WLEA 2P35A 3H6HA 3I5AA 4TTAA 5AK6A 1ZG3A 2C1ZA 3UK2A 4CTNA 1RQ7A 3EHDA 3PPYA 3NHRA 1L5NA 5SZJA 1P0QA 4LVUA 4MGHA 1GRCA 1NBMA 4E5YA 3G0HA 2FE1A 4AG5A 3WK7A 4D3YA 1DJPA 2XE6A 4GR4A 2PRZA 4MA0A 5YASA 5IJ0B 4ZCMA 5T7BA 1XTKA 3IAHA 5DO9A 1P7ZA 1PHRA 2AUNA 3PJFA 3TOSA 1KWKA 3PA8A 2J5XA 2WZDA 4UAJA 2R8XA 4C4TA 4FJ2A 3ZOZA 3KUKA 4C03A 1M2OB 2GT1A 1HRDA 1CRPA 2PRSA 5CXSA 3HRKA 3K1TA 3WKAA 4TV8F 1GUDA 2QNRA 1SBHA 1MP0A 2VAMA 2WIGA 4GOJA 2TSYB 2WW8A 3CUSA 3I0NA 4Q21A 1YVRA 1QO7A 4P3YA 2O2IA 4PNHA 4P31A 3ROKA 3TLGB 5JH7B 1Z63A 1MX1A 3CZAA 3N86A 5HJ7A 4O2RA 3WHLA 4L1KA 1Q15A 3LFHA 1WUKS 1W8DA 2F59A 2AE2A 2EAUA 3NBXX 1CJTC 1XCLA 2FSIA 1UBOS 3QEMB 4IHJF 3RD5A 1UBEA 5JMPA 4QGHA 1DPFA 1K63A 3MCUA 1QS0B 2YN0A 1UJBA 4KIJA 4G0UA 2IDMA 1A7KA 3MUNA 3QW2A 4B85A 4US0R 1FU8A 3E7PA 5CHEA 1BJTA 4EKIA 2VYND 3LYAA 4O2BA 3JQFC 1KMQA 4HD8A 4XVQA 1SKMA 1SR8A 1EFRD 2Y6VA 1AHPA 2I6TA 1UKVY 3C3WA 3CEPB 4OHYA 2Q5FA 5EOVA 1M2FA 2V9ZA 2CVOA 3PUWA 4Q48A 5JSYA 3DMGA 5CFNA 1PNRA 2J9GA 3MBKA 4C7VA 5AXBA 2GN8A 5HQ3A 4J0JA 5TB5A 3UF0A 3RROA 2P6UA 3BERA 5AI6A 5FAKA 3O8OB 1E0KA 2FVXA 2V03A 4I4CA 3ORRA 4B6JA 3THSA 3PEEA 5D51S 1JWAB 1RRFA 3DL4A 3HL4A 4PS1A 1RP7A 2P0AA 2WFMA 2PS9A 3PYMA 4QFBA 3WDMA 4NOKA 4JR0A 1VA4A 3ZY6A 3RTCA 2YNMD 5TF0A 1WNFA 5K03A 4KK4A 4W1QA 1CQPA 4DJAA 3IMCA 3R4VA 3U4IA 4X6UA 2YZKA 3NM5A 3WQSB 2YQ4A 2GBLC 1WZIA 3CCBA 4KN6A 3E8XA 7MDHA 1EHCA 3L0ZA 3ETEA 2F3UA 3IGFA 4QUBA 2XCRB 1KNXA 1D0SA 1SBCA 3HBFA 3JZFA 3Q3GE 3E58A 5ESWA 1OH8A 4UD6A 3IDAA 4D4JA 3RHSA 3K1JA 3H17A 4IXTA 2YJNA 1GP2A 3MTAA 3PQCA 1U7TA 3MWYW 4QYWA 3O1LA 5EZYB 4NC9A 3NRCA 5CG1A 3GJ0A 1OIXA 5JNSA 1QOPB 1U4SA 2VUIB 1Z8FA 1IXZA 3PLAE 4GRDA 1ORHA 1PJAA 2C20A 3OTWA 4QQFA 2YBEA 4CF5A 3CHYA 5FNVA 4KDEA 1IULA 1CP2A 3AY7A 3FW1A 3NWPA 3GPCA 4GWGA 4OYYA 4DLBA 3GDGA 2SKDA 2CV2A 1X80B 2C5FA 1AQLA 3ILHA 2X0IA 4UUNA 3DVQX 1E2KA 5HZGA 1VIVA 1BO6A 3INYA 3PWKA 4FX5A 3BIWA 4B47A 2WWTA 4FZVA 3W04A 3I64A 3K6JA 4H6XA 4U7PB 5EWJA 5JANA 1EZ1A 2DSTA 4X44A 2RGBA 2AVNA 5CUQA 5T67A 4YRQA 1GV1A 3UXYA 4UXIA 1Z34A 2ADMA 1V4VA 5GOZA 1UPAA 1JFFA 4F12A 3M3HA 1A8PA 3C6XA 3OQMA 1L3IA 3KU1A 4GPD1 4NJEA 4WNYA 2NV6A 1W0KD 2BGGA 2QMEA 2VUHB 4MYSA 3IS3A 2R9VA 2ZYRA 5DE3A 2QROA 1E2NA 4ZDWA 2BHLA 4N5HX 5LP6B 4C7JA 1YNSA 4EW2A 2EP7A 3ESXA 3ABSB 4V0SA 3KQLA 5KKNB 3UA3A 2X5OA 3GWZA 5EA2A 5JQWA 4LF9B 4LI3X 4JFAA 1T0UA 4J07A 5CVDA 2OXEA 2ZRGA 3LPCA 2FF7A 2WB2A 1NX6A 1CX9B 3VDRA 2DGDA 3BOSA 1CF4A 1PZGA 3ECCA 2XSZA 1P19A 4EY5A 2QIOA 2Z3ZA 1S8AA 5CDFA 1I8TA 2NSLA 2YY6A 3VYVA 2IS4A 3MMNA 1F3OA 4TTQA 4D3ZA 2QTHA 5BVGB 4N48A 3HP7A 3SC6A 2B30A 1BWQA 3KAKA 1RXWA 4WRRA 4BLQA 3EPPA 5IZCA 2HADA 3LBIA 3UFXB 4BLRA 4CE6A 3LHIA 2EP8A 5CM9C 1C30B 3ZIAD 1XPOA 1CS0B 2QF7A 1EQAA 2ZGVA 3W7VA 4PNPA 1CJMA 1U8TA 1RKUA 1W4LA 2RGGA 3PDCA 5ENZA 4X62B 1KF0A 4RF3A 3LYLA 1MHTA 4QTUB 2ZTVA 2CHEA 3QZUA 4L3WA 4LJKA 5TSDA 3U7QA 3TTYA 4OX9Y 4HNGA 2ZFUA 2J3MA 1JEYB 1AC5A 1QZTA 1M0WA 4JP2A 4Z3KA 2FMUA 3NHKA 4MS1B 2QBYB 4FFBB 4EHBA 1OFGA 3G3EA 4IQ0A 3ZDDA 1I4LD 1T24A 2HCJB 1HA3A 1HKHA 2A9PA 3IRUA 4DJJA 4JVNA 3HEMA 1LX7A 1KY3A 3VV3A 5KX5F 4M3NA 1PF7E 1YZQA 5CFPA 2BFMA 4I1PA 1E0SA 3EQ6A 2CLDX 4CFYA 2Q3MA 3BMCA 2A7XA 3NORA 3GA7A 1AH2A 3VHLB 1A9QA 1NDHA 3D54D 3PFIA 4PQFA 1SRRA 4JI1B 1Q2UA 4KAAA 2X41A 3W2HA 1DAPA 5JEDA 1VLZA 4P83A 1ZXLA 2YHIB 4B81A 2W6ID 2E37A 1UJ4A 2IUUA 2J9ZB 3RS0A 1DWOA 3AFHA 2WWGA 2CFTA 3OZRA 1DPGA 2YYZA 5K4HA 5K9ZA 1VKJA 1PS8A 3SE0A 1RC8A 1FFDA 2JA2A 4L4YA 5JEEA 4NV3A 1NONA 3D8NA 1Z06A 1CF9A 4J6EA 2AIRA 3IEIA 4TL6A 4WKPA 3U0BA 1T6NA 3WL4A 1KR2A 4GOXA 5D3QA 3EXHB 3O6VA 1C1YA 3ZBPA 5IVHA 1MC8A 3E0QA 1O5OA 1CG6A 3E18A 1C2YA 4UM5A 4DARA 2B4AA 3DXZA 2VDWA 3NQ41 2QTAA 2JIOA 1RJGA 3HU1A 2RHMA 4OHCA 1EVEA 2Q8QA 3AIIA 2FW7A 4R0NA 4REOA 2FX5A 2HMWA 1M74A 2QPOA 1VPWA 4KRYA 4BO8A 1Z33A 3C3XA 4HWRA 1U9IA 2FG7C 1USGA 1KAHA 2C54A 4IMRA 1X1AA 1BVUA 2ZJ5A 3ZR4B 3AY6A 2PKEA 5HYVA 4OXRA 4BE4A 1HM5A 3HGQA 4RV9A 5I48A 4URHA 5PGMA 3FE2A 3Q85A 1QRDA 3BE8A 2BKVA 5EN4A 2BDUA 4RK0A 3BCRA 4B6FA 3TLGA 4UUBA 2GX6A 4EAAA 2H00A 3P94A 3OQVA 4I1SA 4RKEA 3DJYA 4AKIA 1DV1A 1GQRA 5TQ0B 3H5WA 4RPCA 5EQJB 2YXBA 1Q0UA 2EFJA 4RZ2A 2MR5A 3A10A 3NASA 1UEIA 2RC6A 1HNNA 3ZGVA 1T9KA 2R1UA 4PM4A 4WNCA 5FLXA 3HXMA 3G23A 2G28A 4A03A 3AHDA 1GUAA 4UXJA 4G5HA 5L8VA 1ZMOA 4LYEA 1I14A 1QX3A 4CW7A 4AWXA 1U28C 2PBRA 4HNAA 4MX8A 1EG2A 1P5ZB 4BBZA 1FSZA 1NYTA 3ILYA 1JP7A 2X58A 4FVTA 2IPXA 5EIOA 3VZCA 4BGDA 1C3EA 4ZCLA 3LWZA 1SOVA 2WE8A 1SIBE 4DPMA 1Z6PA 3I4FA 3EDOA 5THXA 1DIOB 3A1WA 3BWBA 3KSBC 1VQ1A 1KZGB 3GZNA 4KNVA 1D04A 1E0DA 4DCOA 5JS1A 3F8WA 1KYYA 2J6IA 5HPYB 4IILA 1OILA 2KJQA 4JCOA 4ZN6A 3C4QA 5CW1A 5EQDA 1F8GA 2JGMA 3HXKA 4E07A 2NADA 1VMAA 4NF2A 1X1CA 4QQNA 4F45A 4JFRA 5CLLA 5FFFA 3VAYA 3LQRA 1WSDA 3ZXIA 2R6R1 3ZQ6A 1IUNA 1RYZA 1YB6A 2VR1A 1YI0A 2WNHA 3VPCA 5G4LA 5IX8A 3L4EA 4KLZA 3UM9A 4DCCA 1UFKA 4S3MA 5D7NA 4L16A 3Q41A 3UZUA 2J0QA 1UJCA 1KI8A 2G36A 4RJIA 2IWHA 1RWQA 2Q3EA 2ZIUB 3OUZA 4XE5A 3R7BA 3OZGA 3OCUA 2OL4A 2HRCA 1IBCA 4RGYA 4ZQEA 5AKXA 3I30X 1Q84A 2SCUB 4ZZ1A 1ONSA 4YAKA 3TLYA 4EL0A 2WM8A 4IIJF 4KYVA 1PW7A 4QFCA 4CM3A 1FSPA 2ZI4A 1HYGA 2Q7OE 1X1QA 4A91A 1M0SA 3RBXA 5HZMA 5JH7F 1LZLA 4OJQA 1JR2A 4F3RA 3QW4B 3MTBA 4CT5A 4XSHA 3PKJA 4X9XA 3QOFA 4HFRA 2NUAA 2X8LA 5K3FA 1OYYA 2FZLA 2P6NA 2WAXA 3E3LA 2EVWX 3I2IA 4UEKA 3HI6A 4V39A 4FCWA 4QYMA 5KVVA 3RAPR 1TQ4A 4X41A 2H9IA 1YZNA 1UMCB 5FNZA 5T3YA 1QP7A 1H2BA 2XQJA 1V1MA 4YPVA 3CKLA 1GTJ1 3A1TA 3IE2A 4GPIB 5DGTA 1XG5A 2R85A 3GAZA 4KYIB 3ZQ4A 3C8UA 3B38A 1G98A 2NU7B 4YMTA 4FEYA 5FA5A 3EIFA 4JLVA 4RVCA 3Q7RA 2CNLA 1U5BB 1O0SA 3LT0A 3Q7TA 1NQTA 5CH5A 4BP9A 2FLWA 1YFJA 3IEVA 1IK4A 3W06A 2GM3A 2BFNA 3KAPA 1UOEA 2Z5LA 3ELUA 4LK2A 3FGNA 4C4XA 3C1TA 4H18A 3MYYA 1PEDA 4IIGA 4Y2SA 1I3MA 5LP6A 5TVKA 4X20A 3KV1A 4PLGA 4ZZ3A 3U7HB 2X8AA 2AJ8A 2VJLA 1OH5A 3NHLA 1MC4A 1KBQA 1P9NA 3FPCA 5GONF 2BPOA 1YDGA 3ZE6A 4LPSA 4EGSA 4OLHA 3N87A 1O6CA 4AJ4A 3WA7A 2O3TA 2CT8A 5KNCD 1E5LA 1DC4A 1T5SA 2A1UB 2EW8A 2HSZA 2WHEA 3GROA 1D4ZA 1QV6A 3BF8A 3K1AB 3TL3A 1GL6A 3UV7A 3IPAA 3GFPA 1LDMA 3LY9A 4LJ5A 4EATA 3Q4GA 2G70A 4X3PA 4IMJB 1BC5A 4HH0A 4DSAA 3FCEA 3GI1A 4E12A 5C35A 3W4JA 2ZE8A 4IGEA 1HX7A 1KJWA 2WJWA 1BE1A 4KXMA 4XYBA 1FQJA 1C3VA 1JYSA 4Z4HA 1XZIA 4G84A 3W5SA 5B7QA 2FR1A 2J3DA 4IX1A 4XB6B 1ZUNB 4G65A 2QY9A 1YD7A 1Q3TA 3LP8A 3T1YB 3TQHA 1RRVA 2AK2A 2KPOA 2NZJA 3JR3A 2PRKA 2IBMA 1JVBA 4M1TA 2R6HA 1N1GA 1F4LA 2F7SA 1NJ8A 5DBHX 1EK2A 3UUEA 1JEQA 4PSDA 4HVCA 2Y9PB 1P81A 2O8VA 4EQ6B 4G24A 4NE7A 3F5FA 3H5RA 4ZARA 2PH5A 2C2ZA 3FKJA 4IWNA 3T38A 4DDHA 2HWKA 5EYPB 5FPHA 2FEAA 4OMCA 1E0AA 1XEAA 1EWRA 2ZTHA 1PR3A 2CXPA 4IL5A 5DGCA 2YWGA 3E53A 1AXRA 4WXEA 1HE8B 2BE9A 4MV6A 4WCFC 1KC3A 2EFDB 1RRPA 4M8SA 5HFJA 1GZ6A 3NVDA 3VHRA 1AS3A 2MOKA 2OCAA 3WGNA 3WGYA 1NR7A 4JQOA 3AP3A 4I9HA 1XAGA 1DS6A 2GETA 2JATA 4WBSA 4QQRA 3U3RA 1HDRA 2VEDA 5M5BA 3D0QA 3WL8A 1A9OA 5A3RA 1R18A 1Y3HA 2E4UA 2W2LD 4ENQA 3R8FA 5BYJA 1KS9A 2WYWA 5AP9A 4B3SB 3CPJB 4K03A 1BWSA 2OFWA 1OF1A 4KQ1A 2GEVA 1Y9JA 1QGDA 1VJCA 1RRGA 4LWPA 5MDHA 5DLEA 1ECCA 2HRRA 3N9IA 1ITZA 2CVZA 2VF5X 2YJGA 3LVBA 3KL2A 1R5NA 4G5RA 4GQAA 5JYDA 4UE6A 4BQFA 2YQ5A 3O2NA 3M5PA 2Y67A 1VHWA 2AN5A 5KYKA 2W22A 2X6TA 5E4FA 2D0IA 2IPOA 3EGOA 4BVFA 3NKLA 3RU9A 1KI6A 4JXKA 3THYA 2FHSA 5JZSA 4GXRA 3VYTB 1CNMA 4ALJA 1ZRNA 4R2WA 2YJ5A 1G66A 5AVWA 3SQMA 4AJKA 1Q0QA 3QVWA 4OSEA 3GJ5A 4QRIA 4GBED 1RI5A 3BL6A 2CSUA 3CLKA 2BM8A 1P2GA 2VN8A 2R65A 3PXBA 4WNAB 3ZDXB 3AF6A 4LJ9A 1LA2A 4CUJA 3CX8A 3JQAA 5C9ZA 1Z2AA 4X0EA 4RTKA 3IUPA 3RVDA 3RVQA 4D9KA 2VQ3A 4WUVA 2OGWA 3M34A 4M0CA 5SV2A 3ZC3A 3R77A 4MW4A 4UDYX 3V8BA 1DBQA 3WS7A 3GLGE 3UK6A 1ENPA 1PNTA 1XMSA 3GAMA 3U3JA 3FPEA 3DE2X 1ZITA 2A2ZA 4HAXA 5BWNA 1JIKA 1EAMA 1O08A 1M1NB 1TGVA 3M3PA 3V4ZA 1OB2A 1JR4A 3ANYB 3I92A 1VZ2A 2VAXA 1OW3B 2W2VA 3NVAA 1J09A 3MC1A 4NZZA 4AJNA 4AY4A 2P9GA 3PJRA 2LV8A 1E1DA 4RQUA 1DGQA 3GLTA 5DM70 3PPIA 1MO2A 1Q0PA 2XVAA 3QBVA 4AZ3B 3BFJA 4D96A 4HXYA 1UEJA 3P20A 3WLEA 4EA8A 5CDGA 1KO4A 2VVTA 4WXHA 4HWKA 1UJNA 2E4VA 4LJSA 4TM7A 3O73A 1OYWA 1WW3A 1JEAA 4Q4LA 2WJVA 2A0XA 1VRCA 1DIBA 4RXTA 3PDUA 1Y5RA 3UJ7A 2DSNA 1QHHB 2QL9A 3FPBA 1W4RA 2QXYA 4RETA 5A02A 1EDEA 4OMUA 4I4TB 3TKYA 1W6UA 4RIEA 2A0WA 4MP8A 3J81A 5BRNA 3LOPA 1LLCA 4ITRC 4RIGA 2DUNA 2X9QA 2AN3A 4WESA 1O5IA 2NUTA 3AVYA 2WSMA 4IJVA 4CMAA 4HDAA 1IN8A 1EBUA 4QT4A 3UHJA 3VZDA 3V32A 5IXJA 1ID8A 2GYYA 3HBJA 3P9NA 2O5CA 1YOBA 1Z4JA 4KLCA 1C8KA 3R5XA 3AP2A 4Q4HA 1T35A 1R6TA 2ATVA 13PKA 1Z0SA 2OG1A 3VDMA 3K70B 1TIBA 3H65A 3AVQA 3BWYA 2ZM5A 1NMYA 1K97A 1VL0A 2B6HA 1CQXA 4MGEA 4TXLA 5F4ZA 2HT6A 1UKCA 5HJ5A 4YPFA 3OD5A 5KOHB 4HPXB 4UXHA 4NABA 4XARA 3TMKA 3S8YA 3D5EA 2DBQA 3UHAA 2OXIA 3FTFA 3F5SA 1OXVA 2Q5LA 4HQOA 1E2UA 1LNQA 1W75A 4FGWA 5B2ZA 3W2TA 4ETWA 1EHIA 4MVYA 4DV2B 1H0HA 1T6XA 2CYAA 4KFTA 3U56A 1HTTA 4JELA 3GH1A 3EZGA 3V34A 4H31A 2C1XA 2I6QA 2XNHA 3CGWA 3M6VA 2GCPA 3DMRA 4JMPA 2OM2A 3E0XA 2P9JA 5E6UA 1F51E 1P29A 3AILA 3IOEA 3UAYA 1E9SA 2RHGB 4BCBA 3GGCA 5CX1B 1XCBA 2CMHA 1E61A 1UZUA 4COOA 4D8TA 1FJ2A 4N54A 2A5LA 4XVRA 2JJ2A 2O0MA 2R8ZA 5ALHA 1RI2A 2WVAA 3IIMA 1KMHB 3FVTA 5DMXA 4YJ2F 2C2OA 1EBFA 2W6JA 1OYVA 1CWUA 4L3OA 2VYFA 1G18A 2P67A 2ZI7A 4KP7A 4TT3A 3H75A 1N4AA 1ST3A 2JI6A 3QUAA 1CUFA 4OO3A 3Q11A 2R68A 3K2EA 1IQPA 4P3NA 4RXUA 4YQZA 5A4IS 3BXZA 3GXBA 4KVFA 1PO7A 3AHJA 4FGSA 2C2BA 4GPEA 4QUDA 2COKA 4F2WA 4DR5B 3I12A 4M87A 3EVBA 2YBDA 4YGYA 3GLKA 3PXAA 3GUVA 1DJMA 2FDXA 1FNBA 5FL3A 3T5DA 1PJ3A 2WSSA 1NXXA 2PS0A 1URPA 4TZTA 4B87A 4D7AA 4B44A 4JVOA 1ULAA 2QRZA 5TQ0A 5KTOA 4CRWB 1LKZA 2J87A 1MB2A 2AN9A 3CLTC 1FDWA 2Y76A 1NI4B 4PXAA 5JQGF 1P7CA 1AXEA 3LLUA 4NFSA 3UOAB 4W7HA 3JQGB 2W0SA 4O2LA 5HZKA 1Y3CE 3FMIA 4RW0A 3SM3A 2VDOB 3L41A 2WV9A 2XQVA 1X7XA 1KQPA 4DCPA 3NOXA 1OT5A 1P7PA 2TMDA 4MW1A 4I6GA 5J5CA 3AK4A 2ICAA 1ZD2P 3C97A 4K9OA 3UA4A 3OX2A 4WOBA 1KR5A 4AN4A 1E6CA 1NHGA 1XMIA 1FMTA 1A5BB 1YHZA 4HLDA 2NU8A 4NFLA 5JAQA 4ZT3A 3QUTA 4DLVA 5IH3A 3PUYA 4WLUA 5HK9A 5I9NA 3E1KA 3W5IA 5BOSB 1XMJA 4H7PA 4DUPA 3ZJ4A 3OZBA 1AGNA 1CKEA 1SO8A 4QELA 5BNIA 5B1DA 1ABFA 2DY1A 2N1MA 2IF2A 1P2UA 3TD9A 5IYZB 1HE5A 2V5AA 1C7JA 3IEPA 4U2FA 4D9NA 2HHLA 3KELA 1DUVG 2ZU6A 4HH1A 4DEXA 5JZMA 1D2CA 1MVLA 1JPNA 2FW0A 2ISQA 2VP4A 3FHJA 3GJ6A 3ODGA 4LOHA 4OGKA 4MVCA 3WJ7A 3ZZTA 1RYDA 1I6LA 5KTSA 3ZHVA 4JBHA 1ZX1A 2JJ1D 2ZYWX 3LFTA 2QVXX 1M6VA 1W4AA 4L85A 4ND3A 1Z4PX 3T7TA 3AVOA 1A8SA 3WLJA 3SZOA 2I34A 3JALB 2BW0A 5EUCA 4DR3B 3KZKA 3KOMA 2RDMA 3LDHA 3IP8A 4ENRA 4NDNE 3V8NA 1ORVA 4ZT7A 3QPVA 1PEKE 1J0AA 1ZM7A 1YCDA 4B3GA 2XB9A 1NQ5A 5FX2A 1WZUA 4NIMA 1WDKA 2QW0X 3W6OA 1S8OA 5BNTA 3ANSA 1KMNA 5CRIA 5EPUA 1VB5A 5EVJA 3SOPA 2FKNA 5BN5A 2HJVA 5C5IA 2IVZA 4KQXA 2WFAA 2BKEA 2CZGA 4M9CA 2JAPA 1W88A 4J0EA 4OJTA 3DMFA 4XAQA 2FUNB 1FMJA 5BSTA 4DLXA 1Q0RA 2VZEA 3AUXA 2BGTA 2NO1A 3OZUA 3ECSA 1P1IA 1YQDA 1O8CA 1US8B 2QN6A 2H07A 2HQ1A 2X19A 4FMDB 3UH1A 3I2GA 4II3A 5TS2A 2VC2B 2QDXA 3Q1LA 5J47A 1KKUA 3H2GA 3UJ9A 1EWKA 2FWPA 2HZ7A 1IDN1 1KZ9A 4C4OA 4EABA 3BSSA 1G17A 2E21A 1SKAA 1LTQA 1NRIA 1X15A 1Y5NA 3GFGA 4K6HA 2C7PA 2I4IA 1VRVA 4U7WA 1MRNA 1EINA 2ZJ6A 2Q1SA 2VNSA 2PJUA 1I01A 3BGOS 5CLGA 3L1UA 4U2EA 5CA1B 4ID9A 4JLOA 5FLKA 1N1MA 4U1RA 3C85A 3GAAA 5JBQA 1R0KA 1DKQA 1PR0A 2AOTA 1M2HA 3QVMA 4FP9A 3S1AB 1GOTA 1EFTA 4WZZA 3AHFA 3HJNA 1KQ3A 4L6AA 3SBDA 1H4QA 1TJ4A 3AT1A 2H5LA 3OLXA 2IY8A 1JQBA 2JS7A 1XP5A 4CCSA 2IYOA 2VYVA 3JASA 1TAGA 3P9IA 1FS5A 5AOVA 1JSRA 2G88A 1VP9A 5LKAA 4B3CA 4FS8A 3RKRA 2QTTA 3PL1A 1IOLA 3L01A 3CRQA 3WLHA 3OTQA 3B9PA 4L5AA 4U7HA 2H3EA 3ZJTA 4J0DA 3GIDA 2EBUA 5JNRA 2OCKA 3TZQA 5CDYA 2R00C 4DG8A 4FJ1A 1XX6A 4ZVVA 4ZT4A 4LZNA 5DGDA 1CSEE 3O4FA 4R8RA 2R87A 3MINB 5JNTA 2MMCA 4CBVA 1TU0A 3DE4X 3MCWA 1D1SA 2UUAB 4G9BA 4GXTA 1QHSA 4JGBA 1NIJA 5KU1A 2D7DA 4DNXA 4LZAA 4YQEA 2VP0A 2BLLA 1T1GA 3MPOA 3DOJA 4KQ6A 2BGLA 1QRTA 1SH7A 2GO1A 3CYFA 2HGZA 2BHNA 3W7AA 1RQGA 4MXDA 4A8TA 3HBNA 1CZHA 1U7XA 1MW8X 1WCYA 4BNVA 1EGMB 4PLPA 3KPUA 3HO6A 3DYVA 3SS8A 1J9GA 2AI3A 2CNWA 3AM5A 1Z37A 1WIWA 3FYUC 3PNOA 4JEMA 4N65A 3P0FA 2CCKA 4HAVA 1SWVA 3KVOA 3CRZA 2WQZA 5ITVA 3DR3A 3GGPA 2QK4A 3NOOA 2XWSA 4V3BA 4BZXA 4WGFA 5GGYA 1KK1A 3MGCA 1ZI8A 3P26A 4X3OA 4EHFA 1ZQ1A 1V25A 4XIIA 4YP0A 2FZ4A 2AJBA 1EUZA 1N2IA 2WIAA 4ZJPA 4IQGA 3SR4A 1TMKA 2ATIA 1YZFA 3AI1A 1EEXB 4IDBA 4Y9SA 1N5JA 3AFOA 3UTCA 2NYRA 3TW6A 4I6JA 3B6IA 4N47A 1NA5A 2ZRFA 2NTYC 2Y1FA 3EVFA 2R86A 4R2IA 4MDFA 4LVOA 3EH2A 4FHGA 2PIDA 4L78A 1ADJA 1JEDA 1G8YA 1R8QA 2RGCA 3KFLA 5DIFA 5LPNA 2BGJA 3JTEA 1JALA 5FCDA 4F9EA 1H23A 4ZMSA 5BSKA 1VI6A 2WUGA 4AF6A 1Z0FA 5ES3A 1W36B 4YUVA 1KWGA 2J5BA 1M34E 1SU8A 3GLFA 1JR3D 1V39A 3LC7O 1Z4NA 2LP4Y 3LUGA 2GD6A 1F2DA 2JZCA 2NU6A 4I2VA 3THXB 1FL9A 3D6HA 3QPWA 2MSDB 2V6JA 3HDJA 4HDSB 1W1WA 4TXHA 2C57A 3ENWA 1LK0A 2AR7A 4NCHA 2J59A 3D4OA 3SF0A 3PL5A 1EP2B 5K8JB 1E4OA 1E79D 4I4NA 1HT0A 1Z2DA 4XQGA 5A04A 5I4KA 3ZGYA 5IULC 4HEHA 4CUKA 5J1SB 3HR8A 5EE5B 4DZRA 3HVHA 2AXNA 5EXXA 4EEKA 4DDWA 2PFSA 2FK7A 2OHVA 2IKQA 5EZ6B 3VOTA 2P68A 1A88A 3I04A 3V2GA 1U98A 2BFBA 1ZGHA 3L9WA 2NO0A 2OZKA 4B6SA 4RULA 1K4YA 4UUAA 3QYFA 4HLQB 3F98A 4JX9A 5ADHA 4CG3A 5CITA 2ZRQA 1Q22A 4IHKA 4XX1A 3G2KA 3EEYA 2VKQA 3QPUA 2NSJA 1T4BA 5FTLA 4K05A 4HN2A 3IOBA 1BRTA 2OCYC 3ZWBA 1ZJZA 2WWIA 4ZOLF 4AWBA 4OLBA 3FNHA 1N3BA 4ZOLA 1RQRA 1ID1A 1YZUA 3JQ9A 2O06A 5B37A 3ZWAA 5I7WA 1E96A 5LOVB 4HAWA 2H54A 4G5SA 3NHPA 2XRZA 3EVGA 1AQYA 1RRMA 4UHBA 1ZGAA 4C1BA 5LIRA 3KWFA 4CIVA 3HCAA 4EI2A 1WP9A 1WCWA 4UEJA 3FHTA 5KPDA 3KJNA 1M83A 4UW9A 1Y8AA 1SCUA 4BN4A 4ZANA 3KB2A 1H2RS 4Q7EA 3UQYS 1G9XA 1QG0A 2I65A 3KYCA 3MSXA 4RFSA 4ZGWA 4W9MC 4HI0E 2GD2A 1F0PA 3TPZA 2C29D 4W9NC 2G1PA 2JKZA 1LSUA 1JECA 3FZGA 5TVGA 1QHHA 3KWMA 3KZ1E 2WF7A 3K20A 3L4KA 3BZWA 5AUQA 4MUHA 2JZOA 4XWTA 4EOGA 2WKSA 2VUSA 2PBFA 3E22B 3UPUA 4GYYA 4IYRA 4URZR 2PWYA 4YGXB 5BSHA 3G0IA 2EJVA 4QULA 3BGIA 2OHFA 5KNDA 2D5BA 5KYYA 1DAKA 4MNTA 1UM8A 1HYHA 3LUKA 3TFOA 3WQBA 3T5PA 1BVHA 1S2IA 3MBIA 5LXTF 3KETA 3GLRA 1SIOA 3N1UA 4WD3A 3IP1A 1Y6GA 1XTPA 2BL4A 4RIIA 4KREA 5EKDA 4PLCA 1S2NA 3Q10A 1A4UA 1Y3FE 2VSYA 16PKA 1F60A 3FZQA 1CEEA 2P0EA 2HJ9A 4TL7A 4YUWA 4ES6A 4IJKA 4Q03A 4FMPA 1NAIA 2GUGA 1SQ5A 1UXOA 2NZUG 1KVQA 2BUBA 2ORED 2WJAA 3L0PA 4X6YA 4OI4A 5ELLA 4Q4CA 2OCXA 4WAUA 1ZK1A 1L7EA 2C88A 3O8QA 4FFDA 3OLQA 4MAAA 4MVJI 5EKSA 3WADA 3BMQA 3WHKA 4QM7A 2FB9A 2WWYA 4Q37A 5J58A 3FMOB 1TCUA 4BVGA 4KVZA 5IUKC 4PYJA 4KQCA 5B7NA 1UM9A 2CVPA 2RIPA 2ZS9A 4EEXA 5EJAA 4XX0B 3DE3X 3G8CA 2QV7A 3MJRA 3AJDA 1K8XB 5JAIA 3V7UA 1RQNA 3DE1X 3V9PA 5FPYA 5I8PA 3G5AA 2FN3A 1OI7A 2V8OA 1NUQA 4JU9A 2FPPB 1CVIA 1SG9A 2J9XB 1O96A 4OIFA 2LDXA 5DPMA 3QX3A 1EM6A 1QZUA 2OSBA 3GG2A 3PUXA 4Q9HA 1UBHS 1SQ6A 1UIMA 5CVJA 4IOJA 4EY6A 1XXHB 4ILKA 5C46F 1EWVA 5KYUB 3ROEA 5AW9A 4F1JA 1GTSA 1BXGB 2WWWA 4G8JA 4ZD6A 1R5OA 4C01A 4FYMA 2EIHA 1K5HA 1H3EA 3RRXA 1MG5A 4A73A 4GT1A 1MT0A 2X6RA 1NQXA 5DNCA 4Y0AA 4HTFB 2AR0A 3BH0A 3D43A 3IKVA 4NULA 1QIHA 4TM8A 3E9YA 3ADBA 3A32A 3WLMA 1NBEA 5FJIA 5A0FA 3VZSA 3A05A 3PR3A 4A2PA 4C0JA 1WCIB 3D0KA 3ZD7A 1RAAA 3I9LA 2H1LA 5D2CA 1KMIY 3Q40A 1BN7A 4OHRA 3W34A 4QXPA 1J7KA 4Z8XA 4MW0A 3L7KA 1CUYA 1JHOA 4Z9BA 3QVOA 3JZMA 4HCJA 1HTWA 1T2DA 2PMDA 1G8JA 3HBMA 2IPNA 4ZYLA 2A5JA 1DRWA 4WMLA 2MINB 2Z43A 2VJOA 3L43A 1LK5A 4MV9A 3I5XA 1G5TA 4EIWA 1WP4A 1UJ2A 3VR5D 4QJ4A 1ZL2A 2JBWA 3GLHA 1E1KA 2Q29A 2WKQA 4FD3A 4IIYA 4UUQA 1ZYUA 1TQHA 1C9JA 2O1XA 4CLRB 2BM9A 3R7DA 5CYGA 3TM4A 5L7TA 5L95A 1ZONA 3HFJA 3R7FA 2ZRNA 2ATXA 4ZO8A 5IYZA 4DXHA 3IVGA 2GCOA 1WPRA 1KXZA 3JW8A 1G9TA 3JQPA 2ANCA 3U31A 2GO7A 1VMIA 1L7BA 2LKCA 3FYTA 5TQ2A 4NY1A 1DJQA 1MB4A 1KEEB 2YDYA 3QX7A 1GRQA 3CVJA 4NPAA 5FUMA 4RD6A 3TOXA 2DPLA 4UMFA 1Q7RA 3TM5A 3G88A 2I3DA 1UAAA 4JODA 2B94A 5EWMA 1H8ED 4ZMRA 3AYZB 5EZYF 1IQ0A 4U2BA 5J63A 3I58A 1XALA 2IUSA 4F9FA 3IR6A 3FPFA 3HGMA 2EP5A 4HBZA 4RZSA 1J7JA 4X94A 5A6SB 1PBTA 3HE3A 3TWOA 3TUZC 2AVDA 5KYXB 4DV3B 2PH7A 4TVBA 2NP7A 3DHYA 3LQYA 5HFNA 2Q0HA 1OFIA 4MR7A 4Q05A 3WV5A 3P4UA 1SHZA 2TECE 4CDNA 1TL7C 3P52A 3T41A 1A97A 3R24A 3ZY2A 1FUKA 1XI2A 5U1PA 1KMCA 2A9VA 3A1VA 4OSPA 3VR6A 3C3CA 3TNDA 5L9AA 4TSRA 4YLYA 2UVPB 5H1YA 3SM9A 3ZY5A 5I8WA 1I36A 2ECPA 1U0NA 1YBFA 2HBQA 3C5CA 5DT9A 2Q07A 5FL7A 2HK7A 5DB4A 4IM7A 1LSJA 4MVXA 1BEEA 1PP4A 2BGMA 3OZEA 3W2EA 3BILA 1A9XA 5F98A 1YBHA 1XB2A 5I4CA 3A3PA 4TQGA 4RVUA 1T10A 5IVIA 4KBFA 4UU1A 3PLRA 1RWVA 3FYDA 4MQMA 1BHJA 4JBGA 4WKGA 1NW9B 3OX3A 2PRYA 2ZUFA 1VRWA 1TMYA 2PGXA 1IBKB 4IZHA 3HFGA 4NNOA 2Y1DA 3PKZA 3QWIA 4MLCA 5CAEA 2A58A 2ZT7A 4B3XA 5KQLA 1NZJA 1AKUA 3UMMA 1BKSB 2DCMA 5JBNA 3FYHA 1T4CB 2ZRPA 1U2GA 4GX2A 1E77A 5AKLA 5DKFA 5TJ9A 3ZE2B 2R6ZA 3WWOA 7YASA 5EHIA 1SU6A 1NN5A 2X9GA 2B21A 2AWOA 3WIDA 2GPTA 4Y3UA 3LYHA 1R6VA 3JASB 1R8XA 2QX8A 4TWBA 4LCJA 2QLTA 3QVGA 4Q3LA 1VKZA 4NECA 3HKCB 3EJWA 4DMRA 5BVHB 1SN7A 2QUJA 5FWAA 3UV6A 4GMHA 3TMYA 3EARA 3FCUB 4QBIA 4EVRA 1YJBA 3GARA 1B8VA 4B2YA 4X91A 2HGSA 3VMFA 3REFA 2LZ0A 4LBZA 2FYTA 3OTHA 1J21A 1RBYA 2OV4A 5CD1A 2X8JB 1U8EA 4N7MA 3DC2A 3H1EA 4OQDA 4PPYA 2OVBA 2RHTA 5CBKA 2AZTA 1Z6ZA 3LTEA 3QLJA 5AIAA 2IFTA 1M2GA 4WDRA 4ZHSA 2HV9A 1P9WA 1AZSC 4YRIA 4OI0A 2P2DA 4Q7QA 3DDNA 4IJQA 1Q7BA 4OM8A 3SZUA 2CVFA 5IM5A 3SQDA 3SX2A 2FLVA 4MJLA 2E48A 1NW4A 1Y4DE 2ACWA 4NBVA 2A3RA 3OCWA 1X1TA 3U3XA 3UW1A 3GV0A 4RD0A 1U7OA 3NGXA 5TQVA 1A7JA 1MVOA 3VR0A 1VCIA 3AM1A 2C84A 5KJFA 2OAGA 4ARSA 3MEQA 1E3EA 2AKEA 4JP3A 5HKLA 3UK7A 3K7EA 5MFPA 1ISFA 3QKSA 4L75A 4NHEA 5CVCA 3SIPA 2HRQA 4BBPA 3H4MA 2GZDA 2Z2YA 1NP7A 4Y6GB 5HUQA 2IU3A 3FR7A 3VR2D 3ZYZA 4BYGA 2PT9A 1HPLA 2VPXA 4MMXB 4I3HA 2QLFA 1IRXA 2FR8A 4PC3A 4RCYA 5ERYA 5K3EA 2IZ5A 2XUKA 4YRRA 3H9UA 3W90A 3MJCA 2O4UX 3NLLA 5DN6D 1HURA 5CFRA 3R5HA 3L77A 4OHVA 4Q1FA 4Q6BA 2W90A 2IZ1A 1L1RA 1YJQA 2ZIGA 3NHAA 4OHWA 1X77A 4L8LA 4P38A 3M3DA 4U3JB 5TEVA 2HF7A 4WASA 3S8MA 1KNQA 5D3MB 1PJCA 1DOHA 4LXHA 1J5XA 2XA1A 1QF6A 3VAAA 3M49A 1PI3A 1J2TA 4YP7A 3V80A 4ALLA 2HWXA 3NOQA 1GY8A 3QP9A 4FIDA 2J3LA 1BH2A 4HQKA 5AKYA 1YDEA 1PDWA 2Q3FA 3OIYA 2PKCA 3VU9A 4AZVA 2JG3A 2GA9A 2CL6X 3IUNA 5K8IA 3CN7A 4U2DA 4U7GA 5A9TA 2OHJA 4UHEA 1DP4A 4HGYA 1H3NA 2HU7A 4YWJA 5KEIA 4U2GA 4JI5B 5FUBA 2OYSA 4EJ2A 3REQB 1PT5A 5FTNA 1RJWA 3ANTA 3ECAA 2IXDA 3OETA 3KSAC 2ZREA 1GYRA 4E94A 2QJFA 4ZQBA 4J2OA 5BV1A 3VC7A 3AFIA 4MKHA 2QAGB 3GZNB 3B2QA 2PY6A 4DDKA 4CF6A 3THWB 3Q8KA 3ADDA 1W29A 1AKWA 4W5JA 4MKFA 1AN9A 4YJHA 3RE1A 2OGZA 3ZBQA 2O2EA 2SKCA 5CEEA 3SX4A 1QOQB 4XIGS 4JSYA 1U1GA 2D1QA 3KKNA 2F9FA 3P2IA 3ORYA 1ZICA 5ER6A 3RR2A 4GP7A 2QT9A 4C2UA 3RUIA 3K8ZA 1PJTA 1RZVA 1ZH4A 1SK9A 3PIIA 5AVKA 3M0EA 1XNGA 4NLLA 3ZE9A 1H5QA 3VYSB 3ZOKA 1U80A 1ORRA 4LMAA 4PONA 3E35A 3IUJA 3P4XA 4RIHA 5FP0A 5DCLA 1U28A 1TZKA 4Z4QA 4BQRA 1B2RA 1OJLA 1G5PA 2R4QA 3TAUA 3G2PA 2R1TB 1QVVA 5E7IA 3VPFA 3R7WB 1A4XA 4ER7A 4F4IA 2JKYA 2X23A 1T5OA 3M7IA 4BO3A 2I62A 3RHZA 3C5WP 3I73A 2ZOSA 1GXSA 1Q1GA 1RQPA 3TW8A 1LI5A 2QR5A 2C83A 2QTNA 3GJRA 4BGUA 5CB6A 2G76A 2D0DA 1WR8A 3ABZA 3C3YA 3PG5A 1A1SA 3MUEA 4P1ZA 3FN4A 4H1UA 521PA 2YVUA 3NC4A 4JLKA 4B4UA 1IM8A 4A1FA 1GG8A 1OKKA 4JEIA 3U9SA 1DTEA 2HTEA 1EWTA 4YRFA 1KTIA 3MZ0A 2X8WA 1KOLA 1ZW6A 1ORDA 4ZTUB 1QH8A 5LYJB 2JFUA 2GHTA 3D8UA 2B0CA 4G3XA 4J2TA 1FYEA 2EGUA 3ZV6A 5IJAA 4AKEA 3ZCUA 3T1HB 3GY0A 2AV6A 2XRYA 4G56A 1USVA 2WJIA 5H70A 1JI3A 4ZQHA 2A14A 5DLDA 2C4NA 2BKUA 2W6CX 2WUVA 2RGDA 1CUVA 1R10A 3FB1A 4J0CA 1SUAA 3KLPX 3GEGA 4ZHQB 1MXFA 1YU9A 3B1ZA 2F55A 3NRJA 3ROZA 4UTNA 1XDGA 2KYRA 3LDUA 3PUIA 1XKLA 4OI1A 5HM6A 5IWAB 1U65A 4PGFA 1SXJC 3G8AA 1SG6A 2PM8A 1HK7A 4HV4A 1FPQA 2MSNA 5I7HA 4JJIA 4X20B 3LZDA 2QLJA 1YDWA 3DNFA 4PZUA 3RVBA 3S2YA 3JU3A 4TQAA 1LBQA 1E2BA 4F56A 3P0IA 1T3LA 4E88A 4R8KA 5LZ5A 1KO5A 3KOOA 5HEKA 5BQ3A 1J49A 3VOBA 5AJZA 5CA0B 1QAQA 2L0XA 4PRLA 3U1TA 3GB9A 1CUSA 2G63A 4BOYA 3O95A 2QSJA 2R8OA 5AW3A 1WOYA 4M8NE 1WEKA 2J41A 2KW5A 3SDZA 1O2DA 1JYEA 2X15A 4O1MA 3C7TA 3OJEA 3GVHA 1EE9A 4UDOA 5DLPA 1ZN7A 2C7RA 4M83A 1V8OA 3NC1C 3PS9A 4GSKA 3GVXA 4H08A 4XOIA 3KQSA 4OGLA 4HFJA 3A4NA 3C4JA 4D43A 1IBRA 1Z08A 1ZO8A 2PUBA 3NYQA 2A3NA 2IJGX 3LQFA 3FH0A 2I03A 3MS4A 4TMZA 3L18A 2C4WA 5LP6C 3TW0A 3ZLTA 2YHUA 4FXPA 4D3XA 4R2LA 1I7LA 1NASA 3RIXA 4CDGA 4EENA 5AM0A 4WBNB 1GU1A 1OTXA 3CF4A 4ZDIA 3EY4A 1AGPA 1NUTA 1NWHA 1DFIA 2D1SA 3O4GA 1CUWA 1O6GA 2XXAA 1SUDA 2F62A 1DSSG 1DEKA 3K15A 2Y0CA 3DXFA 1Z4MA 4G8BA 4S1VA 2GCEA 1NXPA 3DV2A 3R4CA 4IIXA 5FR1A 4CQJA 1O94D 1RI4A 1Z13A 4OQQA 5JY6A 5EJMA 1EMDA 2OECA 1GNQA 2BR3A 2ODBA 4PSCA 2PKYX 4KFSA 3Q3IA 2EHJA 3L40A 5H02A 2YHAA 1JHXA 3IVAA 2FN4A 4XA8A 4GLFA 3IJEB 3INGA 3VGPA 5C51B 2OAQ1 3ULKA 4KRFA 3K9CA 4OAOA 1E5QA 2XMCA 3MRSA 2CLCX 3HU5A 3ISTA 3LIIA 2WIFA 3THOA 3MB5A 1YHYA 3BD9A 2V58A 5DULA 4PO8A 2WK1A 1CZRA 1U0HC 1XQVA 1GWNA 1QCCA 2H29A 2WD7A 3EYAA 3LZCA 3O7WA 4S0ZA 3J80A 1GKUB 1DG9A 3WGOA 3MTQA 3D81A 3KB1A 4B7AA 1UPFA 1AM4D 2QTRA 4FB4A 2CC2A 2YJ3A 1UMBB 4WPGA 2AGVA 3RU7A 2RGAA 1KVTA 3BMNB 1J5EB 1AKYA 5FEMA 2WUFA 2ID9A 3NT2A 1VBNA 1ZJYA 3WL5A 1L5VA 3OUUA 1RKBA 4WZAB 1OD6A 3ZHXA 4D26A 4NG5A 2QD5A 4DIOA 2X0RA 4MUJA 4EMBA 2CL5A 2JLCA 4X8OA 3G5TA 3OOJA 4L0CA 5KNCH 1LRJA 2H5IA 2W93A 3H6KA 2DLCX 2XDQA 4GI2A 2E87A 3K92A 1TW3A 5C8YA 2WA1A 3J7AC 1GNTA 4NOJA 1GPAA 1S9DA 2GPYA 3VX4A 4B3DA 2JHFA 4HQFA 2PX5A 2VTEA 2FPRA 2F67A 4LOIA 5F64A 1RHUA 2G08A 1NJ5A 4YCJA 5E1DA 2OGSA 1JG3A 5K6AA 3RYCB 4FNMA 1T1RA 1EX9A 1U0GA 2QE7D 1YQXA 4JWKA 4MWSA 4PRKA 5ANRB 4DA7A 4EYKA 3KFVA 3QA3E 3AYXB 3ED1A 3QHPA 2A1TR 2H2DA 5TEWA 2O57A 2BFEB 2O8NA 1PGOA 4RD1A 2IUEA 3R3HA 4V0NA 1KORA 3IOMA 4MP6A 2G17A 3M9LA 2IHKA 5DXFA 4DLPA 3H9JA 3F3KA 4UUMA 1UFOA 3A1UA 4R7ZA 2VSFA 4XGIA 1ND5A 5JECA 2O3QA 3ZV5A 2YY5A 2WHRA 3HYRA 4L5YA 4UULA 3BCHA 2QP3A 1AMUA 4WZBE 1F0YA 1QGOA 4K9PA 4IW3B 4QASA 1I51A 1OI3A 4HLUC 1XD8A 3IUSA 1KFJB 2YZGA 4MUIA 2Y68A 3FOZA 3CH6A 4TKVA 2ERXA 4U6SA 2H9AA 4M1KA 5DMHA 1SIUA 2QM8A 4LYDA 5BN4B 5FUYA 1Q50A 2FPWA 4FZRA 1NT4A 4F4UA 2QUZA 4DQDA 1NXWA 4RDXA 1JX6A 1KJYA 3CEMA 5F2KA 4J6FA 4C4YA 3U4AA 2XF8A 1U7HA 2JFBA 1MIOA 2AOUA 2EGHA 3HKDA 5A71A 1Z4KA 4L74A 1WW2A 3WK9A 1QFZA 3WAKA 2ZI3A 2H9YA 1CUJA 4M1WA 4IG9A 1S01A 1ZESA 5AOAA 5FV4A 3L7LA 3PX2A 5E38A 4FKZA 1QBKC 5JCJD 5E8RA 1KJQA 5BQOA 4BTEA 4LHEA 4GQIA 3UYLA 1NSYA 2DG2A 3AI2A 1VLLA 2HSGA 4FE7A 4NV0A 2EKBA 4GZ6A 4QOHA 5L45A 2DQYA 3LXMA 2VO1A 3RHTA 4MUAA 3WWEA 4Z9AA 3OOEA 3TQQA 2LVBA 5IASA 1DXYA 4C6TA 3A14A 5EL0A 1O6BA 2E3JA 4V1CB 1PR2A 5LQUA 2QE7A 4RA6A 4ZC8A 2EKZA 3FLMA 3MLEA 4L8WB 5DDIP 1N34B 4Z53A 2RK3A 4NYJQ 1ULTA 3SBOA 3RIEA 5E9AA 2EYUA 5JXGA 1AZTA 3IC5A 3EXFB 4H0NA 1Y7LA 4JN6B 4S1PA 2ZE7A 3ROTA 1CVRA 1TPYA 5H9VA 5JWOA 2N46A 5INTA 3K70C 2H7YA 1P77A 3AINA 2YOGA 1R8SA 1A27A 2BEUB 1G20A 2ZXFA 3BHJA 2VFAA 1G60A 1HSZA 3C1AA 2ZK7A 3SAJA 3SZGA 5LUAA 3WGUA 4UD2A 3IB3A 5FO0A 1RPTA 1MAAA 5I6DA 3WIOA 2XOKA 4ZJZA 4A27A 1T26A 3TSYA 1Q3HA 2CJPA 3B5EA 4WBXC 3ZQUA 4WADA 3TXAA 2VUUA 4DA0<