3ZGOA

Re-refined structure of the human sirt2 apoform
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
318
Chain Sequence
GSGEADMDFLRNLFSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESPPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-2
publication title Crystal Structure Analysis of Human Sirt2 and its Adp-Ribose Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 318
sequence length 325
chains with identical sequence B, C
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3zgoA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3zgoA01
1YC5A 5MFZA 4JUBA 3RIGA 2QQGA 4K9MA 1M2HA 3FLMA 1QPBA 1Q14A 1SZCA 1YHYA 1PVDA 4JUAA 1Q1AA 3HWX1 4RMHA 4JSRA 3D4BA 4BVFA 4MPRA 5K2OA 2JLCA 4KGDA 4BV2A 2VJYA 3ZGOA 4JT8A 2EZUA 1U28C 2QQFA 1YI0A 1O97D 5EJ5A 2X7JA 5MFPA 4K9KA 2IHUA 4QPZA 2H4HA 1YBHA 1OZHA 2Q27A 1DJLA 2BRUC 4X3OA 1S5PA 2EZ4A 4JD5A 4QELA 1U2DC 2OD7A 2FSVC 1U2GC 2PGOA 4C7BA 4ZZIA 2H2GA 1ZPDA 4UTXA 4UTZA 4IG9A 2PGNA 3OE1A 3CLTD 3D7KA 4COKA 2VBGA 4BVEA 2WVGA 2WVHA 5EJ9A 1PYDA 5EJAA 4J1TC 4BUZA 4TWIA 2OD9A 1S7GA 3GLTA 4I5IA 4FEGA 4KPUA 3PKIA 4GG1A 2HJHA 2JI9A 4BVGA 4MZXA 4V1CB 1Q6ZA 4GM4A 4UU7A 2FRDC 2H4JA 2DJIA 4K9NA 4MPPA 4GPEA 1OZFA 2JIBA 4QQ8A 2H2FA 4L3OA 2Q28A 4D5EA 3IAEA 4BN4A 4C78A 5EJ4A 1YC2A 4V1CA 5BWLA 4X3PA 3JR3A 5K6RA 5K3SA 2H59A 1UPAA 1T9CA 5DGTA 4IAOA 1M2KA 4Y6QA 2Q29A 4D5GA 4JUFA 4J16C 1XLTC 4FVTA 4JT9A 1YHZA 3FSJX 3D81A 3LQ1A 4L2IA 2H4FA 3RIYA 2W93A 2Q5QA 3CF4G 3E9YA 1T9DA 1M2NA 2V3WA 4JU9A 4BN5A 2OORC 1UPBA 2OO5C 5FYQA 2H2IA 4RMGA 1JSCA 1M2GA 4FEEA 2VBFA 3F6EX 1V5FA 5EJMA 5K6TA 3GLRA 1T9BA 2Q5JA 2UZ1A 4UTRA 1EFPA 2NXWA 4UU8A 3CLRD 1OZGA 4V1CI 4K9LA 4RMIA 2H2DA 3F6BX 2VK4A 2A1TR 2FN3A 4JU8A 5EJ6A 1PT9A 2VK1A 3HWWA 5EJ7A 1UPCA 3CLSD 4RJKA 1T9AA 4Y6LA 1POXA 2AG1A 1MA3A 2AG0A 1YTLA 5FEMA 2EZ9A 4Q9DA 4ZP1A 1Y9DA 1PI3A 3ZGVA 3EY9A 4K9OA 4MQ5A 5DEIA 4UUBA 2Q5LA 1Z8NA 1U31A 1V5GA 4BV3A 1M2JA 2C31A 4F56A 4GM1A 2PANA 4BVBA 2JI7A 2H2HA 4KXQA 2A1UA 1Q17A 1EFVA 1SZDA 2JLAA 4G1CA 3GLSA 4Y6OA 1BFDA 4R8MA 4JUDX 3ZG6A 1YNOA 2VBIA 2JI6A 3PDHA 2NYRA 3K35A 5DGDA 3EA4A 1O96B 1PO7A 5AHKA 2EZTA 4O8ZA 1NM5C 4K9PA 4BVHA 1POWA 2WVAA 1MCZA 4F4UA 5BWOA 1PTJC 2JI8A 2FR8C 4UTVA 2UZ1B 4UUAA 4RMJA 4GM0A 3IAFA 3PKJA 5BWNA 2B4YA 2FWNA 1HZZC 1OVMA 2EZ8A 3EYAA 1PNQA 1J8FA 3GLUA 4HD8A 4GP9A 3CLUD 3FZNA 2Q5OA 2IHTA 5IMSA 3JWPA 1D4OA 1N0HA 4IF6A 4RJIA 4TWJA 4K9QA 5EJ8A 1PNOA 2VK8A 4JUCA 1E3TA 5MF6A 4RJJA 2OD2A 1ICIA 2IHVA 4HDAA 5MGNA 4FZ3A 4MPJA 3U3DA 3U31A 4UTNA 5D7NA 1YI1A 1V5EA
chains in the Genus database with same CATH superfamily
3LUAA 4ZVQA 5NLLA 2I76A 3CUEF 3RJ5A 5BR8B 2O8CA 3Q2KA 1O6BA 1X0XA 3L40A 3PC4A 1O8BA 4UMDA 4Y8VA 5C8VA 4REOA 4EJSC 2QZJA 3GJ4A 3IBSA 2VQDA 3WNBA 1CJSA 3KSMA 2C7QA 4DCNA 3VAZA 1ZI6A 2AN1A 3HEAA 4MS4B 5LP6A 3HCEA 5LXTB 1KHHA 4J2OA 2EAUA 1JDBB 2VNHA 1IG0A 3GIDA 2E5WA 2IP1A 4M9ZA 2J7PA 4OGLA 1VC2A 4QGSA 3Q3HA 1BOOA 2VO1A 3DOCA 2YDYA 3COVA 3GEIA 4HLUA 4NI5A 2PS1A 2GASA 4ZOLA 5DRYA 5IJZA 4MEAA 5LOVB 3LKVA 4KNVA 3Q87B 1WCYA 5K3AA 3ROGA 5BSTA 1GARA 3A6FA 1LVUA 5IYZF 4OM7A 2YYAA 3WK7A 1AM4D 1CUFA 1BVHA 1N9GB 1L4BA 3LBYA 5AJUA 2XZOA 1GGHA 1K86A 1NVXQ 1BE8A 2QW1A 1EZ1A 2GVNA 1M7HA 4WESA 1CDZA 3TNFA 1G8GA 4JJKA 2GYWA 3K4PA 4G1FA 5D6NA 3EZ6A 3RAPR 3PPXA 2BGJA 3CVUA 2YFHA 1XE3A 5AICA 2ZYWX 2FMTA 1PJ8A 2J6IA 2QN8A 2OMKA 2LZ0A 4JOBA 3NJRA 1V4VA 4XIGS 5AOCA 4B09A 1KJ8A 2G83A 4ZAVA 4AP6A 1S89A 1Q50A 4RK6A 3VO8A 4I8IA 3G88A 3WJAA 1A5SB 1E9EA 1XDUA 4FE7A 1ORDA 3ZOZA 3AP1A 1PU2A 2NUPA 3IDSA 4DABA 4OHBA 4BOYA 4JV5B 3PJEA 3GFRA 5TMEA 2M6RA 1NBHA 1GTJ1 5DXFA 1JQ5A 3IV6A 3TINA 1GAEO 1WULS 2ZU6A 2HLDA 4ZOBA 4D8YA 4XWKA 3V48A 2Q4TA 9ABPA 5NULA 2PJUA 1E7QA 4F93B 5MFPA 3AEXA 3T5MA 3Q7PA 5JS6A 3U4IA 4EA7A 2ZCJA 1YOVA 4EF4A 4YJGB 3NOVA 1G3QA 3AF3A 4C7VA 1LFAA 2WIKA 3HY4A 2GNOA 3WLLA 1DJOA 1REQA 1VBKA 2VQEB 2AN3A 3PLAE 2NOAA 4G0XA 1H85A 1OZHA 4UU0A 3KCQA 2GLTA 3I92A 4WXPA 2JJQA 1ZIOA 3R77A 4JFAA 2VZ9A 4QUAA 4YHBA 1FYXA 1AZWA 1OTXA 4R69A 2XB8A 3K2IA 4TRRA 3WKCA 1F9EA 5P21A 4C4RA 4LGYA 5C53B 3NWPA 1JA0A 3ASZA 3QXSA 2Y6VA 4M0DA 1UQRA 2HQSA 4I3GA 2CXNA 2AXQA 2NNWB 2ZIXA 4IHAA 1N5MA 2P9TA 1W49A 1H2HA 1K3UB 3PV0A 1XDZA 4LWQA 3FETA 4FJ1A 4ACBA 1QZTA 4IINA 4DA8A 1P8AA 3SCZA 1U2GC 3G7UA 1N2GA 2V0CA 1NMYA 3TE7A 1KAHA 2C5SA 4ZVVA 4BLQA 3JWIA 1FL9A 5CB0A 4IDFA 2FTKE 5LKAA 1X19A 4UJ3A 3USCS 2CLOB 1IB0A 1PLJA 3CKMA 2H1FA 5ALQA 1KERA 5B5SA 5D51S 2A86A 3N0VA 3RVSA 3H1AA 2XCQA 2ZJFA 5JC1A 2EG5A 2XQGA 3NHZA 2F62A 2A5GA 2NO1A 3MMNA 2VSQA 2ZJBA 4NWIA 4ZTUB 2NZJA 3TNDA 2O2YA 1NNSA 3DE0X 2JFZA 4N0MA 2HCRA 4Z4QA 2C9MA 1QFJA 4UBMA 3ODGA 1KNQA 1RJ9B 3PI6A 2EJCA 4JBNA 4IH9A 5FOUA 2BRUA 1EFTA 3RVMA 4QD3A 2RMKA 1BE6A 2BMFA 1GRVA 2HV8A 3C14C 1YT5A 2XCSB 2QL7A 1D6SA 3OF5A 3I2HA 1U81A 2OQIA 2QLBA 3ZJ4A 5K03A 3M4YA 5EMLA 1WXWA 1PYDA 5EFZA 3W8EA 1IPFA 1G9SA 1WMAA 1NAHA 1EVLA 4GRAA 5EZ5A 5FTKA 3STWA 4IH4A 2FSPA 1DCMA 4KL8S 5FUBA 2ZEJA 3U7EB 4KXLA 4Q9LA 2HCBA 3AP2A 3L92A 2P9JA 4IHJA 3L0PA 3EASA 4HPJB 1UDWA 3FZEA 4D46A 4E2WA 4FFDA 4P98A 2XR1A 3UMSA 5IT4A 4JENA 3SHWA 1C2TA 4HP8A 3OJCA 1QK5A 1TD1A 2ZJ3A 3EWNA 3H83A 4UAUA 4UEJA 3VC2A 1AKQA 4MGEA 4BNMA 1ISPA 5F98A 3KKLA 1YMQA 2WUDA 4R05A 1ISJA 4FYWA 4IVNA 2ODQA 3TO5A 1DRJA 4OX9B 5CFQA 2XWSA 3M2TA 4A0SA 5DEOA 4ZJYA 2UZ4A 4M36A 2PZLA 2WZDA 3NHAA 4HEA6 3TW8B 3OEWA 4QFCA 1FDRA 3A1FA 3JX9A 2R6ZA 4GM4A 4DW8A 4RTOA 4BP9A 5IJAA 2HTEA 5A4JA 1Z6XA 4XVRA 1AK1A 1CXZA 1N2BA 2QT1A 3DE7X 2QJWA 3IRVA 3EC2A 3LHIA 3MJTA 1EDEA 4PM4A 4MPPA 4F91B 4NFLA 1P1BA 4HS9A 1OZFA 2LPMA 1XHEA 1J21A 3RVLA 3X2EA 4AROA 2H2FA 3DC7A 4L3OA 5TR9A 2HK9A 4DXAA 1CR1A 1KARA 3VAAA 4L9WA 4BN4A 1GZ6A 4HSEA 4DM7A 2TRSB 4KVGA 3RYTC 3D6MA 2CHVA 1EJ6A 5EA2A 4BASA 4C0XA 3PGMA 2NMVA 4Q03A 1OH6A 1P0PA 3D3NA 2VJAA 1JQLB 1COWA 2I1WA 2EQAA 1E79D 3BGIA 2G07A 3ANYB 4DC9A 5ER9A 2XCTB 2BZGA 1XEWY 4TL6A 3ENQA 2Y1XA 1FS6A 2H59A 5EPUA 3T3DA 4F9TA 1QUEA 2ORWA 1SHTX 5BQ5A 1SCIA 1Q12A 3HKDB 1L7EA 4IAOA 4FNGA 4U6SA 3R0XA 2Q3LA 5LZ5A 1ZM7A 2I2WA 5M5BA 3ZVNA 2IYEA 4C0WA 4BU1A 5E6SB 2PUDA 3EVTA 4ZWNA 4TLMB 1PR2A 4YTEA 3SZOA 3ZWPA 2H5LA 1C1DA 3PDUA 4JVOA 3DLAA 4F0JA 5KCMA 4FMPA 3E7DA 4EAAA 2GUWA 1PG0A 5CX1B 2AI3A 3HXPA 4LK3A 4MVJD 5AKGA 2CLHB 4F8EA 4DV5B 3NTQA 3KYCB 3FCYA 1T8RA 2JBAA 3BWBA 4AL4A 3O4IA 2Q9CA 3DJYA 1ODCA 2AWNA 3EF0A 3ECCA 3ONVA 1P1JA 1TEHA 1SG0A 4I1RA 3BL8A 2H4FA 3FB1A 1W46A 4B48A 1GTVA 3HLTA 4QJ5A 2OO7A 2Q5QA 3TLJA 1ZU5A 4F1KA 1Z37A 1ZOOA 2OWEA 3FNRA 3H2KA 2XE4A 3KR0A 3ZZTA 3O1IC 2QL5A 2Z57A 3QE4A 5TEWA 4B6JA 4PTYA 2HIGA 2R7NA 4DMLA 4LYEA 5DTRA 1NLMA 1OZ0A 2BJVA 4RY2A 4LZJA 4NP6A 2D59A 4U0KA 5FO0A 4BNYA 4J3JA 1TADA 5FBHA 3T7DA 3KJNA 1WHTB 1EZ4A 1J06A 3QXGA 1GNRA 1MJGA 3C6QA 4TQUS 3VYSB 4K3VA 2DVMA 1XTKA 3H3FA 4H60A 2GCIA 4KB5A 1F48A 1C9EA 1XYYA 3TECE 1H0KA 4JR1A 4KTTE 3T7SA 1BW9A 2HBZA 3R9XB 4OXQA 4UNPA 3CKYA 4LYYA 2ZRCA 4B71A 1J00A 4WQMA 1ELOA 1QP0A 4LCJA 4NTZA 2XT9A 3EAFA 2B3TA 3I5XA 2X0JA 3DBHA 4TROA 4ADSG 2QLFA 2J46A 1VRCA 2O3QA 4RXUA 4J16A 3TXXA 2PWZA 3FKQA 3E35A 3H2BA 1D2HA 4FXPA 5DIZA 2ZQ5A 4GSYA 3W77A 4EKIA 1T36A 2Z1DA 1EH5A 2O5CA 2CL5A 2E4YA 4A0FA 2JAPA 5IJ9A 2NXCA 4G0PA 5TMBA 3RBXA 4ALNA 4PICA 1FC0A 4YV1A 1G5FA 2O54A 5FCDA 1PQYA 2BPOA 2OLJA 2GBCA 3QEKA 3QVSA 1KQFA 3DUFA 1VI5A 3QEJA 3DTYA 1YOBA 3G5MA 1YR6A 2UUCB 1EUCB 1UP4A 3PRYA 4ZOAA 4XQ9A 3RFUA 1KDTA 2DSNA 1SOAA 1G41A 1LUAA 1NYRA 1U04A 2A0KA 3AJEA 3B53X 1QS0A 3HPQA 1D0SA 3ZCXA 5ADVA 2EF1A 1UZUA 2ZIEA 3JV7A 5GJVC 1AMOA 4PYJA 1JR3D 2HZ7A 2JGAA 4GXTA 1I14A 4DLNA 1TKCA 4EUEA 3QX9A 1S8OA 1DWOA 3U4DA 4E4YA 3BQ9A 4QLBA 5H9WA 1SZPA 1MJNA 4BWYA 3GV0A 1D6JA 1T8SA 2FPRA 1EB8A 1WF6A 2I03A 2RIRA 3K1YA 5G53C 1HLFA 2WP8J 4H31A 2NADA 3MWKA 1W59A 4FKZA 5AKEA 2GZHA 5IZ4A 3IMFA 2A1TR 4X7MA 4B6GA 4D98A 3ZE7A 3WLRA 4DS3A 2FN3A 4WEQA 1XTQA 2KM1A 1QJ4A 1UFKA 3O4VA 1E0SA 2XBLA 2FJ0A 2Q7DA 4IXDA 3NWBA 1XZJA 1IU9A 3G9XA 1GPLA 1DHRA 3W9UA 1ONOA 1E79A 1OFGA 2MYUA 3HWWA 3PA6A 3RUHA 1R6TA 4EYOA 3B3AA 4YP5A 2RGXA 4Y6RA 5AM3A 1L8OA 5HK9A 4Y6LA 2QLLA 3A6DA 2CUNA 3BL5A 3QK7A 3Q7RA 4XUEA 2OGSA 2VTKA 3AR4A 3I42A 2C9OA 2OFPA 2FE1A 1YTUA 2ZJ2A 1O8CA 2AVNA 5T64A 2D13A 2PU7A 1UOOA 3DD1A 3V1KA 3IBGA 4GOMD 1ARZA 4AJ2A 1QXSA 1O4WA 2Q1YA 3OCUA 1OH8A 3PNPA 4X5OA 1UBSB 1ID8A 2AFIB 1P61B 3U4GA 3BT7A 2C8VA 2GZ1A 1H42A 4EY8A 4MVJA 2OXRA 3WVNA 4QUIA 1ZGGA 2GJ4A 1M6YA 3ZKWB 4B7UA 3OLZA 3D6HA 3CIFA 1SXJB 5AQEA 3AOEA 4CTOA 3L49A 1E5XA 5J5AA 2VT6A 5AMXA 2JKZA 2LVBA 3LIPA 1VLJA 3AWDA 1SHJA 3CCCA 1DC5A 3K72B 4KDFA 5AXCA 2HR1A 2FUNB 4AO6A 3RT9A 1JI0A 4JKIA 5EE0A 3QVOA 5BN4B 4BVBA 1T4CB 1UKBA 4H7KA 3C4VA 4XEHA 4QLOA 2JKYA 5B2ZA 3SC4A 1E2EA 3T9BA 4Z4FA 1P18A 1W76A 2PGJA 5LYJF 1L4YA 4ZO9A 1RQGA 4M46A 2OHIA 4FP9A 3T1HB 3JARA 1YR7A 3SX2A 3M82A 3OJLA 1Y7LA 5FL3A 2BYTA 3O2JA 2FKNA 3DBLB 1ZGBA 5PGMA 1ZNXA 2WMOB 5BOVA 5IABA 3L4JA 4QTXA 2WWYA 1MR3F 4J0FA 2ESRA 1WU8A 3K05A 5M29A 2PS9A 1MNAA 2ZTSA 1M2VB 2ZVDA 2ZDGA 3F49S 4WK6A 1X7ZB 3WLHA 3EA4A 3BXGA 4E2XA 3G79A 3LCRA 4W7IA 4GZ5A 2B35A 4UUNA 3QA3E 4JJ6A 2CHQA 4X6XA 4M7OA 1Z08A 5LLDA 3CF0A 2AMFA 4PLGA 5D3MA 4ZRMA 1E2QA 3IV7A 3IAM6 2R84A 2EEZA 1KL7A 2GEDA 2QNIA 3KZOA 1AF7A 2WILA 2CE7A 4FI3C 3GLFE 1GAJA 2ODWA 2MSDB 3BG5A 3HYSA 4BIMA 3CLSC 3P71T 4N1AA 1QG2A 4A0HA 4BMOB 4DV0B 3H9EO 1VSVA 4MYHA 4MKHA 5CA1B 5K0TA 2VQ3A 3KOYA 1CF9A 3I52A 1XAJA 4E2FA 3TPZA 1G4HA 4MMZB 3RHSA 5E1DA 3ER6A 4HB0A 1B6GA 1GN8A 3QVTA 1JR3A 3R6WA 3NZEA 1NG1A 1VIMA 4IQ0A 4LMBA 4QPNA 1C8LA 1WW8A 4EMUA 1JFSA 2VBCA 3WK6A 3ETJA 2YMQA 2RH8A 1IY2A 3KSDO 2JIDA 4WY2A 4KR7A 1SIWA 4B3JA 1GR1A 1QLJA 3MCZA 1CBUA 2Z2ZA 3CUYA 4LSWA 3SS8A 3ZV7A 2EATA 1T8WA 3NKFA 1AGYA 4D9EA 2QDXA 1DQYA 2QHXA 3D31A 4E1BA 3Q3IA 2W11A 4YRCA 6AT1A 5L3VA 4YY3B 5IHXA 1I4EB 3FDFA 1ACMA 4C29A 3B1JA 4DIDA 1PEAA 4JQCA 3G6KA 3SF8A 1HY3A 3U7QB 3J80A 1X77A 5HF5A 1I7SB 1XK6A 3MAGA 2EKPA 3LXXA 3RVOA 2FFJA 3FWKA 2JEYA 5MGBA 4RY8A 5HKOA 3IKLA 4QQKA 1RM3A 4JQSA 2EBWA 1C7FA 2A88A 1PWXA 4CMKA 3O9ZA 2ZSDA 1YUBA 1NAIA 1EVYA 1X13A 2BUCA 3IEUA 4WKCA 4Y9RA 3DGEC 5KNCD 4C5AA 4BB9A 4MUGA 4JP5A 4TKVB 1UH5A 4IICA 1BC5A 1LBHA 4AYWA 3T5GA 1LPPA 3GRKA 4LVCA 1F8YA 5IASA 3R5FA 1G55A 2ZVJA 3BSFA 2FKAA 3G0OA 1OJLA 1WQ1R 1MB2A 4FQ7A 1P44A 1UMDA 1XALA 3A14A 1FYVA 1N2CA 3H1FA 3QKRB 4YIKA 2BEJA 2DHDA 5FLKA 3SLRA 1LEHA 3AEUB 1Q0UA 1WB4A 4NYJQ 5CAEB 4MV5A 2FEPA 1R4NA 1YSCA 4NMWA 3GCWA 2ZYHA 3TQSA 4BLPA 2GF2A 1EX7A 2GRAA 1NI3A 1CLUA 2R79A 5BSRA 2FEOA 2B8NA 2ZSKA 1PEYA 2XEDA 3UENA 4F85A 3QNMA 2XLCA 2VJMB 2UUOA 2AOTA 4O3MA 4R2LA 2NQ2C 5JWOA 2BTQA 1R9MA 3NUZA 4H2DA 1JPVA 4J76A 4EBFA 3T1TA 1XVVA 4ZO7A 1T5LA 1NJ5A 3T5BA 3VPGA 1CX9B 1ZVKA 3IIJA 3SP1A 3AIMA 4GQIA 4E5PA 3OFVA 3L4BC 5BT9A 4BECA 3UUGA 4EYEA 1FFAA 3GAAA 4CT4B 1ZM3A 1DO2A 4M0FA 1NN1A 4HNVA 5J5VA 2K5UA 1EWYA 1MAUA 1SRRA 1Y1LA 1ZIXA 1TYBE 1DC4A 2J8ZA 2JBWA 1O6GA 3PGLA 4YFYA 5ER6A 2OPHA 3S7TA 3SMQA 1JKMA 3HEBA 3L8DA 3QOXA 4ZIRA 1DO0A 1SD2A 2BHRA 2FEWB 3W4IA 2XOKD 2Z95A 3L0IB 3R5XA 2UYQA 2ZS7A 4WMLA 4ZZ2A 5AW7A 5L3QB 4QGFA 4RORA 1WJGA 4JI0B 4TQAA 2FLKA 7AT1A 2J9RA 4BWGA 2ODBA 4K8RB 4IIVA 2CXPA 3BKWA 1UINA 2A78A 3ANTA 3IMEA 4KE6A 4XLLA 1UWCA 1XCGB 4XSHA 2JGDA 1JEYA 2QG6A 3ZIAD 3HHEA 5FADA 2Q3CA 2VCHA 3K73O 3PPYA 1WCIA 4WXRA 1W94A 1K8ZB 3PFBA 5GM2A 3FFXA 3GPIA 5T4HA 2QWXA 3I0NA 1G2PA 2ANBA 4EHAA 4DDWA 4QPZA 4AS1A 1I33A 3WRXC 1WUKS 2G04A 3GA0A 2F67A 4GBMA 4AXXA 2YINC 4AZVA 4OHYA 5AW4A 1P3DA 2OZEA 4NH0A 4H35A 1Q7CA 4FLMA 2GRUA 1YBHA 3KEQA 4ARSA 1SN7A 2O9JA 4OVKA 3PD7A 3UWSA 3LT0A 5JR3A 1A5ZA 3TEJA 2V3CC 4ZCMA 1IJFA 2PL1A 1UWLA 4WFIA 4P0PB 4AU1A 1W9HA 4E6PA 1OFUA 3WMFA 4ZODA 4IFBA 3FRJA 4IW3B 1H0RA 1T3HA 3BTSA 3T7JA 3W2EA 4CN9A 4P7GA 1OH5A 4UD6A 4XGNA 1EP9A 4GDFA 3KYBA 3BILA 3OOYA 4L73A 1IZ0A 4FHEA 4LECA 4LX8A 1C7IA 4OPMA 1QVAA 1Y3AA 3CVOA 2FSVC 4HDRB 3RUDA 2JA2A 4S1PA 2X1LA 5AOAA 1E9CA 1R6DA 1FDUA 2AJDA 1ECLA 2OB2A 4Z7OB 3ZJVA 1RWWA 4KQHA 4M1YA 4CIBA 3OI7A 4FE3A 1V48A 2TSYB 4HYQA 1NG9A 4B33A 1S2IA 5CFLA 1DEXA 2I8CA 3MINA 4KBGA 4RQBA 1HYBA 1DL5A 2KPOA 4UTXA 4LVUA 4NAHA 1MX5A 1EG2A 3HKBA 3P32A 4WNCA 3QLUC 4NF2A 5E3IA 5A62A 4UCXA 3BUSA 3Q8MA 3P2JA 1G2OA 3P45A 4XGKA 3DKVA 2A1IA 3HS3A 1R27A 1QP8A 2G1KA 4HWGA 1TK9A 4RKQA 2I4MA 3I28A 3TPCA 3LWBA 1MO3A 2D5CA 2VOEA 1JECA 3A6ZA 3WJ7A 3Q7TA 1N2XA 2O2ZA 4LHVA 4MI1A 4MI9A 3VNSA 3V2HA 3GJ3A 4EY7A 4URVR 2FZVA 2PCLA 3H9BA 2DBZA 2MSLA 3KHSA 4KIWA 4R2XA 5K5EA 2WVHA 5EJ9A 3K8QA 3QVVA 1XEXB 1Y0BA 2FW1A 2OM6A 1T3LA 3U3JA 5CDYA 3BERA 4NQRA 5JROA 5DDIP 1D3AA 1ZHOA 1PNTA 2W48A 1GFWA 4GH5A 4HEA1 4WZZA 1SC6A 4S2UA 3UM9A 1HFEL 1FFWA 1HDYA 1KEEB 1U2DA 3IHKA 2FJUA 2R8XA 2Y93A 3T5CA 2OD9A 1KJIA 5GONB 4BNUA 4XR4A 1SXPA 2IZ5A 4BKPA 1CZRA 1EXNA 1USVA 1XELA 3Q5GA 4IKPA 2JZCA 2WVJA 4LS3A 5ICFA 2JD1A 4RKYA 4UHFA 2GJ9A 4JLPA 4US1R 3I62A 1DWPA 1IAVA 3RG8A 3FYCA 3ND8A 5IVIA 4JH0A 5DBOA 1WPGA 4RWZA 3M2PA 2FG5A 3FJYA 3A1WA 5AKIA 2C84A 1FFSA 2GD2A 2DUWA 2VFAA 1JDNA 2HJHA 4ZMSA 1TAHA 2OAEA 1NP7A 4I2VA 3F47A 4MZXA 1BA3A 4P5PA 1XMIA 3GFPA 2FG6C 3QITA 1FP6A 5SICE 1NBAA 3WB1A 2HF2A 3AU9A 3FLEA 2X23A 3LAWA 4KAXA 4DIEA 4MVJH 1XYGA 2XOKA 1G20E 2H52A 3GL9A 3RIEA 4B3IA 1OX5A 1UAYA 4I66A 5ARDA 3WGKA 1HUQA 1ZNZA 1VHLA 4S2EA 1NVDA 4JI2B 4KLZA 4ZKEA 5TGDA 3L1JA 2OV1A 3L77A 2PQ6A 4CM4B 2D06A 4JYPA 4LJSA 5DNUA 1NGSA 2J0UA 5JNVA 4MGIR 2QY9A 5L51A 4H6VA 2I4NA 3GD7A 3NBUA 4KACA 1Z17A 2ZTLA 3HN2A 4WH0A 1U4OA 3DLIA 1Z74A 5FD8A 2OCBA 4DUGD 5BUZA 4DY4A 3E3NA 4RV5A 1K6MA 3B7GA 5LXTF 5KYUB 3GA5A 4GDMA 4UCFA 5KKNB 2X77A 1XXHE 1U7XA 3A1NA 4N54A 4PR3A 2IEBA 2Y4NA 1U8YA 1IC6A 4M49A 4OO3A 5CT5A 3WLKX 5CDHA 4JC0A 4FSDA 1XLUA 2QSJA 2PMCA 1W48A 1ZRHA 2X2OA 3DZGA 1PUIA 3I8SA 4EATA 4PYKA 5J4KA 5LOVF 4OH7A 5CX4A 5IJXA 5K3SA 3E82A 4EELA 3MK31 1CTQA 5CTAA 5ITZA 2HL6A 2XE7A 3DWGA 4OHZA 1K5PA 2XTNA 5BOSB 3PFWO 3U49A 5KSPA 2HJRA 1EYZA 5AOVA 1M5RA 5BQOA 4B43A 3MIIA 2R4QA 1Z13A 4OB7A 3U13A 2VHVA 1R18A 3H2SA 3E58A 4MQLA 4X8LA 1TVCA 2O2CA 4UDNA 1MIOA 1N5LA 4CNQA 4NNPA 4Q1FA 4F86A 3IT1A 1ETHA 1G1AA 1MAAA 1UT6A 1XLTC 4JT9A 2P0YA 4IX9A 4HNAA 5ESDA 4B2PA 1NU8A 4DIMA 5AW6A 1FVOA 4RA6A 3D81A 4Q66C 4D4HA 4H9GA 5LIRA 4REMA 4PRYA 2Y27A 2DWOA 4L2IA 3L3BA 1JFRA 2AZDA 4GOOD 1L7BA 4DRZA 3PFIA 3BWVA 1JUDA 3RIYA 1DPGA 1K5HA 2D0DA 2FZEA 2O5VA 1E1YA 2ZWIA 3D7RA 4RJ2A 5CXXA 2R8BA 1HX7A 4Q7MB 1V8OA 3TLAA 4WLFA 1I2AA 1NP3A 1Z0DA 4GP7A 1ZD2P 2W8BB 1ZIYA 2J5RA 2X13A 5EHZA 3TFOA 2B20A 1OZAA 2O3SA 2PSFA 5LDGA 2J9GA 3SZRA 4FOLA 4ZU6X 1CIVA 4DJFC 1W5FA 3PICA 5I9TA 1TUBB 2JGFA 3FOEC 3C8DA 4H6XA 3RS8A 1R0YA 3U48A 3KQQA 3IBYA 1KKUA 4HYTA 2R6DA 1E3WB 1T9GR 1U3CA 3H97A 1TJ3A 1K8YB 1S2NA 1VG8A 5GJBA 1EJBA 1M6VA 1XCLA 1C8VB 1P9LA 2X6TA 2YN4A 3G9UA 4MB2A 3ELUA 4BNZA 3S40A 3K8OE 1WQ4A 2TMKA 5H16A 4KFRA 1D07A 3HBLA 3OT5A 3CKLA 1XGKA 3JQ7B 4JOCA 1JAXA 1HQDA 1WB9A 5FYQA 4LN1A 1TEXA 4DUYB 2XGSA 1H9CA 1KI6A 3F97A 3FA2A 3LHKA 4FFBA 4HTFB 4KQFA 4RO0A 2PZMA 1O9BA 4PZDA 3TLGB 5EUQB 3RRXA 3UXEA 2QD3A 4DLTA 3HQ4O 1XX6A 1DG9A 2OXFA 4MR8B 2W2LA 5K8LA 2J6HA 1TUIA 4MK4A 3GLRA 3L41A 1KK0A 2HMTA 4JEIA 4LEIA 2J48A 2Q41A 4U7FA 4NH4A 4CETA 4L76A 1NQAO 2JASA 5EMMA 1QF7A 2VJLA 1A8UA 4RY9A 1IZYA 3AYZB 9GPBA 2PZAA 1X80B 1CUWA 4PZCA 1T25A 2C4KA 2NU6B 4UBIA 2JFUA 1L5MA 5BMVB 2ZUDA 4GXRA 1L5RA 1Y6ZA 4I5GA 3V80A 4KSBA 4WOKA 5DCUA 2X8JA 1P31A 1ZW6A 5G1NA 1QVRA 3VUFA 2Z98A 2YHBA 3PYXA 4FBMA 4IIYA 5JY1A 2Z2KA 2Y0BA 3QKIA 3VPHA 4BZZA 2YYSA 1UMBA 2RGEA 5T7BA 3IEKA 1WBBA 3U7HB 3H84A 5I3ZA 2MJLA 1TO6A 2P9FA 4N0PA 1BMQA 2ODNA 1R2QA 1GZSA 2P6RA 1NR1A 1TJPB 2BONA 2DLNA 3I58A 1MV8A 4L74A 3RCBA 4B40A 4C03A 3U4QB 3P9SA 3R7FA 1ZWKA 2VHZA 3EDOA 3T4UA 2GAOA 2A67A 2QLJA 3EWSA 3OECA 3T41A 3AV0B 4MHSA 3OJ0A 4DUGA 4OA8A 3NHUA 1Z39A 4NX2A 1EK2A 1WUHS 3DE5X 2B2XA 1SCJA 3AV3A 3I9OA 4XWOA 4PLWA 1EXWA 3AETA 4BMSA 3KR2A 2IYZA 4PZZA 5CMLA 5EZSA 4QARA 3UMRA 5IS2A 2A2ZA 5CNKA 4KVZA 3KSUA 3EF3A 4ZQEA 4IDDA 1S2DA 2JFOA 4BBZA 3COPA 4CWAA 1EDDA 4QYSA 1JDPA 4YNBA 5IW8A 1U5BB 3DP7A 2YICA 4AIRA 3RFXA 2E18A 2X9VA 4G67A 2JCYA 1P1HA 2L42A 4C5BA 4P0QB 1IYZA 1FXWF 3TAUA 3PXEA 4D41A 1D4ZA 2F1HA 4B76A 1LVGA 5L9AA 3EIEA 2QP9X 1Z4QA 3ZGVA 1W88B 5KX5A 4FNAA 1JEEA 3IDAA 5F3DA 1EIZA 1TCAA 1FDIA 3MWDA 4HTAA 2QTBA 2RGDA 3W9SA 5IVPA 1P1IA 3VJRA 3JPWA 2PWAA 2W2KB 4K81B 5B7NA 3HJBA 2EC5A 4YPFA 2OKCA 3GEHA 1R4MB 3QUTA 2JLXA 3EODA 2JFNA 3BJIC 4Z2AA 3OU2A 1EAMA 1RWPA 2R8PA 3JAKB 4MW2A 2VF2A 4G8BA 3PWZA 4P3XA 2VH5R 3OTOB 3N5CA 3THWB 4KWIA 1W5EA 2C31A 3ZHYA 2F43B 5J40A 2PANA 4Z3KA 3SXUA 3UEOA 2VYQA 3EFOA 1DT3A 1DQPA 2X5KO 1QPGA 1SVNA 2B78A 1N2JA 3KYDA 3IYLW 3FD8A 4BMCA 5HBRA 4CKBB 1LWOA 1V9CA 4GBGA 4MLCA 3L7DA 4TRMA 3IAM1 4F1WA 2RAFA 4Y2XA 2QM3A 2CVPA 2JGRA 2UYOA 3GFTA 3PXXA 4ZVPA 4Y6OA 2FP4B 4Q0MA 1URPA 2VRNA 4F72A 2Q6KA 1L7AA 4V24A 1QIDA 2CDAA 4ZVOA 4OLBA 5ALNA 2C0QA 3SZUA 4ZYTA 3L4EA 4P7KA 3GNSA 4LXYA 3RV3A 4DSUA 2LTAA 1DIGA 2OFFA 3AKZA 1YQQA 2VL7A 3LVFO 3UG7A 2DH6A 2H5EA 3MTJA 4MYUA 4QHTA 5I4BA 1R5NA 1UBHS 4U3JB 3GLFB 4B75A 4HZIA 4AICA 1KY4A 2D6FA 3PHJA 4HK4A 3W8RA 3DGFC 1TAGA 1GA6A 4E33A 3A4IA 4IEEA 4EYSA 1OLXB 2QDKA 4UXHA 4X44A 5FWDA 2FR8C 1H4VB 5G41A 2PR7A 3WGOA 2CN1A 3FYUC 3FNIA 4YRBA 4AY6A 3NHRA 2AMLA 4QRIA 3T9DA 5ERYA 1W2GA 4XCQA 3VNQA 5A3JA 3IAS6 2W43A 4AY2A 3O26A 5KNCH 1EFPB 2YFKA 4NU5A 1ZWLA 2Q21A 3D6JA 2CL7X 2I6GA 1UJCA 2H4WA 4H15A 4YECA 4ZT3A 3JQBC 3GZJA 1DRUA 1V3VA 1THGA 3GEMA 2AFHA 4PFSA 4AYTA 2IE0A 3ETNA 1AZLA 3B6IA 4I1IA 1XA4A 1PZXA 5D84A 2BY4A 1OWPA 2QN2A 4K87A 4RVDA 4E5UA 1IWPB 4YQEA 3USZA 3ZHOA 1QHFA 3LGSA 3NDIA 5HILA 1RT9A 4QFBA 3L8HA 1IQ0A 1S4QA 1V41E 1CV2A 1WOMA 4Q19A 3CYFA 4FC7A 4I19A 3DOHA 4EMTA 1LBSA 4GU5A 1E3DA 1BJTA 2SKDA 2XF2A 4JCOA 2DFTA 3VRHA 3ZI4A 4B8WA 3A9WA 2WD9A 4C4PA 2OHHA 2C82A 4B3CA 3NKVA 5HJ7A 5JTUA 4WE3A 2QMUA 4C0JA 2AF4C 2LXNA 5B3LA 4JZYA 2V5VA 4WZBE 1ZY2A 4NMXB 3QV1A 2HDNB 4YJKA 2YIJA 3EGIA 1DDOA 1T9HA 3K9WA 3OZXA 5K8JB 4KPEC 3FBTA 3AHIA 5BN3A 3NTLA 1H2WA 1PL7A 1YQTA 2WSYB 1NQTA 5BRJA 2BI4A 3PUWA 5C18A 4JR2A 4WA8A 4KZKA 5ALRA 4C30A 4BTEA 4PLZA 2CZCA 4Y98A 5ED0A 1YRLA 2FR0A 2DPYA 1GPYA 3ZXUB 1QO7A 3ILVA 1WEHA 4OXKA 1LLUA 3LWNA 3DV0A 4PLHA 5A9TA 3ND6A 5LLSA 3STXA 1QHEA 2P27A 3OLYA 3TAXA 4A10A 2IHNA 2FW7A 2X22A 1FTGA 4NV0A 4JJFA 4ONEA 3ZDRA 3EVDA 1CZOA 2F3QA 4D0RA 1QZUA 2DAPA 2GPSA 4JX9A 3PXBA 2DKNA 2JATA 2Y71A 3D2AA 4UREA 5T5QA 4EABA 5JNWA 3L7KA 3PDIA 1R9GA 4KK4A 4DCOA 1NV9A 3IQGX 2R44A 3HDHA 3NBQA 5MFZA 2BGUA 1AXGA 4D6XA 3IRUA 3RS5A 3AIKA 2G67A 2ACKA 2HX1A 4QUHA 3KKOA 5FUXA 3DV2A 1GGMA 3MMPA 3AUTA 4UMFA 4D26A 3WKDA 4ZYLA 5B58T 4NECA 4CMGA 4YH1A 3P52A 3I76A 1OAKA 3TOXA 2CUTA 1RQ7A 4MQ6A 4OQPA 5A03A 4FGJA 4MR9B 1JA1A 3NCHA 3IUQA 1BGVA 4WCFA 121PA 3ZK8A 1QVZA 1NVVQ 2Q4EA 3E0XA 1D4AA 3S28A 4B82A 5LMUB 2IW3A 3VH2A 2WF7A 4RMHA 1Y5MA 3CCFA 2JFBA 4BJ6A 5DMXA 1P2UA 1I4WA 3FSEA 1YZLA 1WDWB 4H18A 1YWGO 1E4YA 1R10A 1HEYA 3AL2A 4KQ9A 1KIMA 1UBOS 2HWXA 3UKDA 3WGJA 4Q4CA 5H81A 1UEJA 3ZGOA 2WOJA 1PCXA 1K8RA 4I14A 4ARZA 3DEYX 3GC6A 3R5SA 4OBBA 5L53A 3ZJUA 3TQTA 1FMTA 3DOUA 3KZKA 1XD9A 1ZD4A 4AF8A 4KH0A 5HJ5A 3TLBA 5AR1A 1U28C 2QMQA 2ZRNA 4MWGA 4G5OA 3KVOA 1FSGA 3E9MA 4Y7DA 5EXPA 5KQPA 1U5AA 4PLVA 4ZALA 2HSDA 1IB6A 3OH8A 3RRMA 1YJAA 1QO0D 1CY8A 1QDLB 2PSHA 2Z6VA 3OTGA 3Q85A 3I64A 1SUSA 1T4BA 1I24A 1Q11A 1T2UA 2XMDA 3O3OB 3DTNA 4I1YA 2G4VA 5JCJD 1HV8A 5CLHA 2AIRA 4WI1A 1KYXA 1VG0B 2Q1UA 4DJAA 3ES9A 4LI3X 1WZUA 3BIWA 4WCVA 4HAYA 2PX3A 3AI1A 4ZREA 3NBZC 1WMSA 4KOEC 4C0QC 4EWLA 3STYA 1DO8A 4PS1A 4Y2JA 2B2CA 2SICE 1GPH1 3I3OA 3V2UA 5C37A 1UDAA 1CEEA 2CV2A 1NR7A 4LQLA 5DVZA 5GQSA 5GV8A 4B7AA 1OR8A 1YR9A 2AR9A 3LZCA 4XD7D 3DLCA 4HMQA 4MIEA 3PE3A 3E6AA 1XJ5A 1NBMD 4PGMA 1F1BA 3PC6A 3H9JA 4LJ7A 2MYNA 4V3BA 4HAUA 3RO7A 1DV1A 3A4YA 3GT7A 1UADA 2Q6LA 1FFYA 2FW0A 2HCJB 2JD0A 3KKQA 4PSAA 2V7EA 3EXFA 3GIWA 1LBEA 5CYGA 5IJ0A 3C3MA 3I2YX 1Y3CE 4D6YA 4JLBA 3T9CA 2O06A 2VUSA 5DNVA 5IKEA 2EL7A 4A0RA 4CL0A 3QQ5A 2PFSA 3AHGA 3HV0A 4MUEA 3VR0A 3R7BA 1CFJA 1WZ2A 3UMGA 2ZJ1A 1VKNA 2JLRA 3K70C 3UV6A 4JK3A 3KQOA 5HGXA 1NJ2A 5CA1F 4PGFA 2AI2A 3O4FA 3ZWXA 3KVNA 1P1KA 4HLQB 4HRXA 1U8EA 3AIIA 4OAOA 1FIUA 1JDTA 3H75A 4G41A 2OHOA 4LJ4A 4FNOA 4WKPA 4XTCS 3W5AA 4RVCA 3W05A 2J6CA 4D42A 2ZAOA 4RMNA 1OXXK 1W73A 1IEVA 2O8VA 3IUNA 3ACDA 3Q7QA 4A5OA 2YKGA 2C9DA 1YVPA 3RVNA 3P2OA 1G42A 3DH0A 3LLVA 4H6PA 4PO1A 4COKA 4DWVA 3R1IA 4POOA 4OMDA 4XDHA 2V58A 4G26A 5KIAA 2AH5A 1UKVY 2QK4A 4QA9A 2BSXA 5DWVA 1UBNA 3DLHA 5KOHA 5ITVA 1WZIA 2A7QA 2RG1A 3JD1A 4EHLA 1K5DA 2Y0CA 2ZIWB 4GZ6A 5DNYB 4JIGA 2D0IA 4GVLA 2ZXUA 2OV8A 5CDFE 2V96A 4WJZA 3W6NA 2WFLB 1GPUA 1OILA 2ES4A 1F20A 4GF5A 4JS0A 3SGLA 3PR3A 1QRUA 1S7GA 4WK0B 1U2GA 3H17A 3WXBA 1DBPA 2AEEA 2BH9A 3JQAD 4NLLA 5FFNA 5CLQA 4AG6A 3CZ4A 3KL2A 1JZTA 1EBUA 1PFQA 1TTHA 2QS9A 1DTWA 2QX7A 2VDWA 3RUAA 1E2LA 4C76A 5B36A 5LMNB 2Q1WA 4KPUA 4Q3DA 1OX4A 3GFOA 4HEJA 1C3OA 4Q4JA 1BS2A 1G20B 5LA6A 1RJGA 3O3NB 4P4NA 4XOUA 2E1RA 2BM9A 3F9RA 3B3GA 4GO1A 1TL7C 1WOYA 1TAQA 1VI6A 2QV0A 3ZXXA 3W5HA 1NIJA 5AHXA 3R8CA 1RBMA 2XDQB 4NE7A 4PHCA 3FW1A 3JRWA 3G8DA 5EZQA 1L4NA 3PNVA 1R4ZA 4YDRA 5AVRA 3HJUA 1AO0A 5FAKA 1VCOA 2H48A 2XD4A 1DKMA 4V0QA 2BDUA 4AZ3B 1QO0A 2H1SA 2Y8EA 3C3XA 4C0AC 1WNFA 1JXOA 2GTIA 1IM5A 2NYUA 1XXHB 5JCJA 4Q1EA 4DC0A 6REQB 4FMBB 4IYRA 2UVPA 3RSCA 2YIVX 3W2IA 4EHJA 5JZ9A 4A26A 3EN0A 4P4TA 4HYEA 1QWOA 1I4LD 4V1CA 1K27A 2ROQA 5HBGA 4WX2B 3G8AA 2Q6TA 4AZWA 4A2WA 2W71A 4F6LA 5I7HA 2FA9A 4XFKA 3WYAA 4CEHA 3G2KA 3AL0C 3NM4A 2Y1OA 1RXVA 4B6RA 4DBLC 4MWCA 5EWMB 3KPYA 3CIOA 4IQGA 4X62B 1IM8A 4FUQA 4QLAA 3UJHA 1NHGA 3A10A 3MTDA 2PTHA 1T9CA 2XUFA 3QHQA 3VJMA 4LBWA 1H5NA 2HN9A 2YRFA 4MKXA 4W5NA 1NBMA 3UK2A 1V25A 3QMVA 2I7TA 2H63A 2IODA 3TKAA 4OQLA 3ZWNA 5JCZA 2IC5A 5JLJA 3WRWA 3IUYA 1BWSA 1NW5A 2XRMA 4N65A 4O4IB 2J67A 4Q12A 2WJWA 3SF0A 1JPNA 4Q3AA 4FILA 3FPCA 4MUXA 5CVCA 1ORTA 2ZCVA 2B3DA 2IOYA 3JYQA 2G1JA 1PD1A 4B87A 2ZYSA 4LRYA 3ESDA 4R16A 4PYMA 1TTQB 5C2JB 5B3KA 2E82A 1WHSA 4UE3S 4OIFA 2FYTA 3S29A 2FFAA 4ESOA 5JOQA 3L79A 1L8XA 1NW7A 2QN3A 2XXJA 4X6LA 5AM5A 4QJBA 1AUXA 3X1WA 5JZBA 1H23A 1CKEA 4QUBA 3ADCA 1QQBA 4C7MA 1FCJA 2XZLA 1SBHA 3FFWA 1JZQA 1PZHA 1E1RD 2CVQA 3BK1A 4OFBA 2WIAA 3H9CA 2IGTA 3LD9A 3OOJA 3SJUA 3HUEA 3Q3JB 1KBQA 3KR9A 1HA3A 4NPHA 4RVHA 5TARA 2ZRMA 1M2NA 3CJRA 2W4IA 4IJVA 2GD6A 3A4LA 4M0PA 3GXOA 3ORYA 3NBMA 3IAXA 3G0IA 4M37A 3OZTA 4UBJA 4JLVA 3TZLA 2CKMA 3WGHA 3ZV4A 4YEDA 1C1XA 3QXHA 1U63A 1Z6YA 2GAIA 2OAP1 1I3MA 2IXFA 2P2ZA 3HL4A 3L6DA 4U2BA 2ONJA 4J3FA 1L5KA 2NVUB 1H8HD 2VPXA 3BULA 5B3AA 2IU6A 4DC1A 1QV7A 2IEAA 3Q0TA 4GLOA 4KKXB 5B1IA 3SFTA 3TM5A 4AX8A 4CKWB 2PVCA 4G1MB 5I9NA 3OQOA 2O20A 3FOBA 3OEED 2GI4A 2A9RA 4TZKA 3WQSB 2Q6IA 2WRZA 4KNWA 1LXCA 3MLBA 2ZRJA 4RJTA 3OOHA 1WV0A 3NANA 3JQAA 3OQIA 4ENWA 1KGSA 4PEVA 2W0MA 1AN0A 4GL4A 1J09A 1I7QB 2TYSB 3ZWBA 4G1EB 1OAOC 5JJKA 1RD4A 4MRSA 4HLDA 1OREA 3TIVA 1UBUS 3UNXA 2PUEA 1YCFA 1CR4A 3JQPA 3OFKA 2YW2A 4OOEA 1G8YA 4I50B 3D4PA 2HDOA 2QVYX 1S6YA 3GB9A 3UAYA 5HW0A 1HTTA 4M6WA 5BW8A 2R1UA 2CYAA 2Q9UA 2QUBA 3B1FA 5GIOE 3PXDA 1KZ4A 3C3JA 2O7QA 3ETEA 5E9QA 2ETXA 2JGKA 1TW3A 2CSUA 5FNVA 2IX3A 5EMHA 1QKJA 3O7WA 4IQ8A 1MO2A 4BUCA 1S9DA 3BIXA 3FNQA 4BZQA 621PA 4UHJA 3GGJA 4DCPA 3R9WA 3I2GA 4MLPA 1YZNA 3LCMA 4LYHA 5AJZA 3WICA 1CY4A 2VS1A 3DOIA 3B6KA 3P0EA 1QVWA 2O0LA 4L5YA 5FJIA 3ILYA 2CVHA 3TUJC 4B44A 3FKSA 3L93A 3PPWA 3N2KB 4QFDA 5E6RB 4ALMA 3CB2A 1D6NA 4EPRA 1QGAA 2BGIA 1KO8A 2G8LA 3BXOA 2Y2VA 3FHOA 3N6VA 3OUTA 4O59O 2DR3A 5GONF 4RLHA 3WLSA 4JU8A 4RVUA 4I36A 4DVGA 1NXPA 5BW4A 4O4JB 5HUJA 2F90A 4PCVA 5ALTA 1D4FA 4XIFA 1QAQA 1U1EA 3KAQA 1D2MA 2O05A 3CLSD 1EFCA 1C9JA 4BGVA 1M1YA 5GJWC 1FX0B 2GGSA 2FWPA 4TSFD 3TOZA 3G6WA 3DL2A 4NZ9A 1YTLA 1KY5A 3N58A 3L7OA 4P22A 2NXJA 2CXQA 2P7IA 4RD2A 7REQA 4Q9DA 2VP9A 2YXNA 1F2UA 1YRAA 3BKXA 3PA8A 2CDNA 2H57A 4HRAA 2VP4A 5FORA 4CEIB 4MUAA 4JLJA 1XR3A 4GLBA 2FNAA 2VG8A 2GZRA 3CN7A 4K88A 3QBTA 1NFFA 3BCUA 4XUCA 1N5DA 1V3UA 3CB4A 4W9RA 4B0OA 2DWUA 4NONA 4U02A 1CUXA 1E3SA 1ZXXA 2WJAA 1W1IA 1YB4A 3LUGA 2E6KA 1HDXA 2R65A 1KY3A 2YN0A 3HP7A 4OFXA 4BJ5A 4MQ5A 2D0PB 3HCRA 4CR8A 1DRKA 4UUBA 2A59A 2AKEA 4MPTA 4TUYA 5IG2A 4RJLA 1N8NA 1NBIA 1WUTA 1ZL2A 3DKRA 5FO1A 2CHUA 5FI5A 1EUDA 1YASA 5EKXA 1K6JA 3DFZA 5T6BA 1M0TA 2H0RA 1TYDE 1Y1PA 3NHBA 2ZRGA 4M8LA 4XI9A 1E1RA 1FRQA 1MV5A 4X45A 5FPHA 1XZGA 3NOQA 1KSFX 3PENA 3SEFA 3LC2O 4KE7A 4YQFA 1STOA 4BX8A 1A8QA 4RZUA 3FIJA 3ZIDA 1JP7A 1MVOA 5FXMA 2QJRA 3MJVA 2QGZA 3O82A 5EWLB 3P26A 4BQOA 1USUA 1XP8A 5FBRB 2X2PA 2OO3A 4NBRA 5EHGA 5FWNA 3H11B 4QO7A 3ZDFA 2PX6A 2ISQA 4F3YA 4GOLD 3PNMA 4HFMA 4RGVA 4FCTA 2QQ5A 3IAS1 2P11A 2QAGB 3N8GA 1RQ2A 4WJKB 5E1MA 3CMCO 3LQ2A 1U4NA 4DG5A 3L7JA 5DGDA 1MENA 1E32A 3EX7C 3S1AA 1PQ4A 4PHFA 5IRCD 1E4EB 3OEEA 2X76A 2EZTA 1H2BA 3X1JA 4O8ZA 2VATA 2GXUA 4G5FA 4TXLA 4BVHA 5TRTA 4IJWA 4PC6A 3GARA 3ABSB 4D43A 5BWOA 4RU1A 1L8AA 1QH0A 3VR4D 2NYAA 5B1EA 1DRWA 3C7AA 2RI0A 4B7CA 3RWMB 5I48A 1QWSA 4V02A 4W1RA 1DMSA 3LOUA 1UXKA 1Z0AA 2ECPA 1PP4A 4GM0A 3ZHXA 1H5QA 1I80A 2HQ1A 3OA0A 3QFHA 1PDVA 1SQ5A 2ID9A 1MG0A 1CE8A 1P0MA 3OKPA 3LL4A 3R2JA 2RKWA 4PSCA 4UEQA 5CPFA 2GSDA 3IAHA 3OPYA 3AVWA 2C2YA 1JAHA 3E22A 3BH0A 3GOQA 2B4YA 3V9AA 2ECFA 2CL0X 3TNLA 2EZ8A 4AY3A 1H2YA 4GX1A 3E2PA 1JDSA 1O4VA 4KXWA 4QJIA 5JCXA 2I1VB 1MFZA 3DL4A 1YZ3A 2VF4X 4XGIA 4AKEA 1NJ8A 5L3RA 1YDGA 3ZS8A 3UJDA 4I8XA 3OVMA 4C5CA 4MIYA 2O8EB 2GK6A 4CI9A 4Q4HA 1ZCAA 3LC7O 1GR0A 3AKEA 4KBFA 1UK6A 4WZBB 5J9FA 2QG9A 3RV4A 4KR3A 3B9BA 4CCYB 2YUIA 3GR6A 3QNUA 2IYFA 5GM1A 4PG8A 4YRQA 5BSEA 1VMKA 1W85A 1N0HA 1SK9A 3I04A 5K0SA 4A4DA 2JFWA 1NJ6A 5IUJC 1EQ2A 3T52A 4FM9A 4JA2A 2D2IA 2Z8YM 3OCYA 5JH7A 3L5KA 3ONFA 5CDUA 2G0AA 2P1ZA 4UNNA 2V7GA 3U3MA 4HH1A 3UWPA 3WMGA 5HEKA 3R3XA 3UPUA 3O47A 3E9CA 3OHPA 4HX5A 1AVTA 2ZE8A 2C5EA 1GG2A 2Z43A 2I3DA 2ZXFA 3NGLA 4UEWA 2QUIA 1SOVA 2W4QA 2HY7A 3GPCA 4E03A 2C2ZA 2HHAA 1YH3A 1EQAA 1A4RA 1KTVA 2L18A 1CP2A 2HT6A 2MINA 3HFSA 4S0ZA 4U8GA 5CT6A 4ASUD 1G8JA 1Y1TA 1OW3B 1QMPA 3K32A 2K87A 1KPIA 5BMVF 2I33A 2O14A 2WWWA 3ORHA 4IIEA 2OD2A 4Y9TA 2QP4A 2XZDA 4P4SB 1VLZA 2VNIA 2Y1CA 3RYHA 1ICIA 5JEDA 4KIJA 1IVSA 3GROA 3GCXA 1H4QA 3MOSA 1LQ2A 2P9GA 1L5GB 1QO9A 5A06A 4RENA 1BO6A 3A06A 1NZFA 3LK6A 3TNJA 3PGXA 2WTXA 2ECQA 3QU9A 3A27A 4MVJE 3ZQUA 5BW5A 1LW7A 4QDOA 4S1VA 3RVDA 4KN5A 3P9KA 4D9IA 1G5RA 2XYVA 3CA8A 3GVPA 4MKRA 4CLRA 3JZFA 3RBZA 3WK9A 3WWYA 4CI0B 2VT3A 3PNKA 5IZCC 3JAWB 4MO9A 1Q7RA 2R2AA 1PJQA 2YFYA 3HSSA 4G84A 3DZCA 4TTVA 3UZUA 1WKBA 4L5AA 3PX3A 4DFDA 1GNLA 3SR3A 2AOXA 5ILOA 3N76A 1ACLA 3K15A 2H1OA 2V6BA 2M1XA 1RE1A 2YV4A 1G19A 1JKFA 2JJYA 4ZCLA 5CB4A 2VHJA 2V7UA 2ZIVB 4C4TA 2EKZA 2P4QA 4N6NA 1RHMA 3E70C 5C5EA 5ALPA 2FEXA 3LDUA 4MPRA 1V71A 1ZJ6A 2VUIB 3E7XA 3IC5A 3SJCA 5GPBA 3DWEX 3KELA 5CA0B 1UANA 4ZQGA 4X90A 1OB5A 3D6FA 4ZYUA 2CNOA 3Q2IA 4E2YA 1OSNA 4QT0A 2F4VB 2DULA 2MMCA 3AONB 4D0SA 4OBXA 1PJ3A 3ABQB 4RKWA 1II0A 2PH3A 2VHCA 4K9RA 3RT7A 1FRNA 5K05A 1H5UA 2PN1A 1JHDA 1GU1A 1Q6YA 4OUDA 1NA5A 2XJ9A 1LS6A 1N2HA 3BH7A 4Z3DA 3TSZA 4AUEA 2W2NA 2I2CA 2C2XA 4RLFA 4F3CA 3VR4A 4LSMA 4D97A 3L7BA 3DEFA 1CP3A 4HBZA 4Q3OA 1SO8A 4EI7A 1FXSA 3PWSA 4ZU1X 1S3FA 4TM7A 5BVHB 2B7CA 3FPLA 3HSKA 3PLRA 4PIVA 4RF2A 1R6AA 1AZTA 2VUTA 4QDTA 5B7GA 1KVRA 3TZBA 3LP5A 4F45A 1Y33E 4QU0A 3D7MA 1XMVA 1SD5A 2ZRDA 3WKBA 1DAHA 1LLDA 2MYTA 3AY3A 1NE7A 2QT9A 3KM0A 5GGXA 4F7DA 5MN5A 5LIPA 2ZIZA 4CLOB 1ZN9A 3CX8A 4PLCA 4ILEA 3L4BA 3F6RA 4IVQA 5AUNB 3EEQA 1KEUA 2OFWA 1HMPA 2BMVA 2LIVA 2UDPA 3C7DB 4ZVRA 3ZEIA 4B80A 7MHTA 1QCYA 3MWYW 5EZYA 5AJHA 1DJLA 1ZOLA 4YMGA 1L5HB 2GHTA 3VPFA 2PVPA 5JAMA 2FW6A 5KYWB 3B60A 2ZZNA 4Z6KA 3K1AB 4OP3A 3AM3A 1LTHR 4D8UA 3L0BA 2PWPA 3NHFA 3FNFA 3P96A 4A3SA 3SXJA 2ET6A 4LOJA 1TCUA 3WTCA 3CJTA 3PQ6A 1XQ6A 4JJEA 1H94A 4JP3A 2QUKA 1K9SA 4ON9A 3CM0A 3IVMA 3MZ0A 4CMIB 1HQKA 3DZDA 2HHJA 2WPDD 1M74A 5GMOA 4JQOA 3ZCQA 4BQQA 3Q9UA 3EC1A 4JNCA 4N12A 5HCIA 3BFKA 4U7DA 3NWJA 2R1TA 3MGKA 5KINB 3DA8A 1RACA 4BFSA 4DHEA 3R7LA 3VKHA 3WRXA 3OPMA 2MR6A 1YVEI 3V34A 1WMDA 4QOSA 1U5CA 3A9SA 1PT6A 2OQRA 2OY0A 2ZAYA 5JBQA 5EP3A 1UP7A 4BKUA 4P92A 4O5OA 4GMGA 4XYLA 4J7CA 4MI6A 3NR2A 3BHMA 3KVRA 1HQYE 1HT0A 3C39A 5KVAA 3JTEA 2W2PA 4MV8A 2O8CB 2WDZA 2K2WA 4YAEA 4E32A 1KEKA 4U2KA 2WKPA 3TOSA 8GPBA 1J99A 4DEYA 5C4GB 1A8PA 2ODTX 1GL6A 1N3LA 1TPZA 2XDYA 3RF7A 1SC9A 3IUSA 2TMDA 3WAGA 2PLRA 4M7PA 1R0SA 3DZFA 4PRLA 1HE8B 1HE5A 4Q6BA 4EGQA 4F9EA 5LP6B 2YJ4A 2NIPA 5EXSA 1IK6A 1WDLA 2FSVA 3B13B 2VJOA 4P32A 3GPLA 2BMEA 4Q3LA 4MUNA 3GVCA 4ZOLB 3CVWA 2YHIA 2WSSA 3WRYC 1W29A 1X3LA 4DIKA 3VNBA 1WTCA 3TL6A 3VSAA 4FFNA 4HX9A 2A9FA 4TWAA 2O5RA 2LE0A 3I2FA 4XPIA 4J7UA 2PUCA 4I3HA 1YZYA 3K0HA 3SBEA 2GPNA 1AUPA 4R2WA 3CO5A 3ZNQA 2QTFA 4FT4A 4NC9A 4XDGA 1PQPA 3OF2A 1OLSA 3CZAA 3F9IA 3PFHA 3QLUA 4MTLA 4QPDA 1UWKA 4WESB 4HQNA 1OFHA 2XUHA 3LY8A 4KXNA 4B6OA 1VMIA 2WQ7A 3FI9A 3WLMA 1E1MA 3U9SA 1ADYA 3LUFA 2ZBUA 3KZVA 3TR5A 1CQJA 1JJVA 4LGMA 4IKOA 4RK7A 5FPPA 1EEHA 5TVGA 2F3TA 3IDFA 5IUKC 4OMFG 3LT4A 4YQYA 3BGOS 3WYFA 1SKQA 3LOQA 4C20A 5HJEA 1GCIA 3BX1A 3I9JA 4RBNA 3H9UA 2H1CA 1X9GA 2NUPB 3ENNA 2O0HA 2C5AA 4HSGA 521PA 2CB9A 1A9XA 4N5DA 3TUIC 3CLVA 1RYZA 4IZ6A 1FW6A 2NT3A 1GPDG 1X7WA 2IBMA 3HJNA 4I7EA 4EW1A 1GTZA 3OCWA 5AI8A 4KYIB 3AUUA 3DFMA 3ZWYA 4B3TB 1YOVB 2UZ3A 3DB1A 3L0YA 3OC0A 5FF9A 2C7RA 2PXAA 5IT0A 4UHEA 4XPZA 5IU6A 3JATA 5AJYA 2CEKA 3PXUA 1DAFA 1N25A 1QDEA 1REQB 5EL0A 1EWTA 2VP3A 4EF5A 5T8KC 3IIMA 3QI2A 3FTQA 1BMTA 1PT7A 1XBTA 1O0SA 1U8UA 2F17A 4RHCA 5IBCA 3JQ8A 5TGTA 2AEFA 3QTTA 4UZFA 1HF3A 4XX0B 1SA0A 1ZESA 1SQ6A 1AY0A 5SYNA 1CY7A 4BLSA 2XA2A 4OQ4A 3PDJA 2ZQYA 3G2NA 4LDJA 2QYOA 5A4KA 2ZIXB 2DHCA 1NQXA 1OD6A 1CIJA 2YWEA 3K0FA 4JUFA 4MITA 1AB5A 4FZJA 4NS1A 2ONYA 4UBNA 1YHZA 4BUJA 4UASA 4CG2A 1NC1A 1Z56C 2RGYA 4L08A 2RI6A 2X6QA 2YY7A 1NJFA 3PQFA 4TV9A 4BAUA 1M83A 4IR7A 2GJAA 2OE2A 1NF9A 2QVBA 3UWMA 1FVFA 1T4GA 3QEAZ 3FVVA 2WPDA 4ZDWA 2LKCA 4BB0A 3R6GA 4L8FA 2AK3A 1B8UA 1O9GA 5A6VA 1E9AA 4FGSA 5KJFA 2BF7A 2ERYA 3C24A 4JVLA 4BE9A 1N34B 3FDZA 4YAOA 3GN2A 5CBPB 5IWAB 3OKCA 4GX2A 3JYPA 1EVIA 1PBTA 3BD6A 4CIYA 2P6MA 3H13A 2GZDA 4G1BA 1VHQA 1P74A 4X41A 2VZ8A 2Z2YA 1FFXA 3ROPA 4ZGBA 1S3SA 4NE2A 4Q4AB 3WQBA 1KI2A 3EVNA 4OSEA 2RE8A 3JQEA 3NNDA 4DR1B 2IHYA 1P5FA 3IGFA 3N8KA 3PF9A 3AGPA 2VEDA 1DG3A 3URMA 2OV6A 5KVVA 5E3HA 1WD5A 3VR6D 1XNQB 2FQXA 3HYRA 3IEVA 2H29A 4KAFA 4Z1MD 5B7QA 1U8TA 1JBQA 5IBRA 1V8DA 1HYEA 1XLTA 3AKCA 3FWZA 3THRA 4UM5A 1HM5A 2W22A 1NMSA 3QHPA 1U0NA 3H99A 4ZGWA 4ZYZA 4QECA 5JBNA 1XV5A 4HDCA 3OIUA 3FTCA 4IHJB 1ZCJA 4IIXA 1WO8A 2OPBA 1P2SA 2LIPA 4NHOA 2BFDA 3GRZA 3PUJA 4WKBA 4KWHA 4ZN6A 2O2HA 2QD1A 5F77A 3K6SA 2JC3A 4GECA 1PJLA 1T34A 1CF2O 3OX1A 3QG1A 5K6TA 2Q5JA 2ZYDA 4YP9A 3W4KA 1VBMA 1FUKA 1ST2A 3DM5A 1X3SA 4MCIA 3DFIA 1UBGA 4N7RA 3RK0A 2CVFA 5CJ2A 4V3CA 3KPWA 2M9MA 1VMDA 1NJSA 3L0OA 2C4TA 3V46A 2AJBA 4I9HA 4D9JA 1SCNE 2PIAA 2O52A 1V4NA 1Z5OA 4QYIB 4JP1A 2XAUA 4CUKA 5BYKA 2OG2A 5DTEA 1KIFA 1UIMA 5I4KA 3K71B 4PNZA 5CVTA 2ZCUA 4UU8A 2NN3C 4FR5A 3S2FA 1MMFB 1C8BA 3DE1X 3A8TA 3MBKA 3WNCA 4RW0A 4Q16A 4U1RA 3NP7A 4KXXA 1KI8A 3OZ7A 2HW8A 1JN0A 2GZSA 2C83A 3HA5A 2FVXA 1JXQA 1R8QA 1MB3A 1UEIA 2FH5B 1WXQA 4OD0A 5CH8A 1IEWA 3IUJA 2FN7A 5C1OA 1A72A 4IO0A 2XDWA 1CS4C 5FTNA 2GJKA 3G5AA 4JROA 2AC4A 1IUOA 2RI1A 2PEZA 4YASA 3VFDA 1P29A 4YAWA 3SEAA 4HAOA 1YS2X 2CLFB 5CU7A 2PSEA 3CNEA 4H6WA 1MUUA 3L0ZA 4OCZA 1YBVA 1WE2A 1KVQA 5AKYA 4O4HA 4GKVA 5G4KA 1M0WA 1N6NA 2HU2A 2GHIA 1E3EA 4B32A 4W8GA 5AHOA 2ACVA 2FG7C 1XZIA 5ENZA 4HGZA 5IH7A 5LSAA 2RONA 1SUEA 2G6BA 3RU2A 4TVSA 3FHLA 3ED1A 3C87A 5KWJA 4OQMA 1S2LA 3DL0A 4EW3A 1C1DB 3ZK9A 3IUEA 4ZCTA 1KMIY 2AZTA 4N5MA 3E9ZA 3GVHA 4NPCA 2QV7A 2YOFA 3TB4A 2IF0A 1DAIA 4KR0A 5JFTA 1B23P 2YV3A 3FCSB 4AM8A 5F5XA 3X1DA 2GA9A 1ULUA 2JBAB 4N40A 1J8QA 4PX5A 4MSUA 3L18A 4DWJA 3PVZA 2Q3BA 3HNRA 3Q41A 3QKTA 4L7VA 5DEIA 5HS6A 3VR4H 1IJBA 4QIHA 1RZUA 1W4RA 4XM2A 2IYUA 3PQ8A 2OCGA 1WP4A 4ILKA 1ZA1A 4R1LA 4DT1A 1U9YA 3EVBA 2Z6UA 4EFDA 4C2BA 1J5XA 3FTEA 3U7JA 1PIWA 3IUPA 5TS2A 2JGEA 3VBCA 5CEJA 2JI7A 3D8RA 4N9WA 3H4IA 3GMDA 5JNTA 1EFVA 5DTQA 5ITWA 3V4VB 2IBTA 3NBAA 5AKJA 1DUIA 4FU0A 4BV8A 1UMCA 4KP7A 2QVGA 1XPJA 3NKLA 3L1VA 4LIPD 1P75A 4Y6PA 4YROA 1KS2A 3W2HA 3PITA 4G1CA 3QLTA 3T7CA 4GI3A 3IHWA 5E38A 4JDPA 2PRJA 5GZ1A 4M88A 4R71A 3EDYA 1BW9B 2HQBA 3T38A 3WGUA 3VMMA 3QW4B 3H87A 1OIWA 1LRLA 2FN4A 2HLNA 2X0IA 4QWMA 1A5AB 1ZSYA 2QLMA 4MW5A 4B4VA 1F38A 4KX5A 4FKMA 3SY8A 4QYWA 2ZM6B 3DBHB 2JI6A 3VR6A 4LDPA 1Z6AA 4IIJA 4O4IF 7MDHA 4Z1MA 3C8ZA 4MRRA 3W8DA 1D2AA 4B6PA 3UATA 4BO1A 4U9HS 1FEZA 1YACA 4H1WA 4UBOA 4Z4GA 2ZPAA 2IVFA 1G5IA 1T36B 4IDBA 2ZI6A 3TZ6A 1JHYA 1V8ZA 2QVXX 4HGRA 1U9ZA 4RM3A 1PE0A 1XWFA 3HDJA 4KQWA 2Y1GA 1GHTA 4GEGA 1SCBA 3H2IA 3V1MA 5IBQA 4L27A 1U0GA 2JI8A 1GL9B 4DPMA 3GFBA 3DUFB 1NI5A 3NBKA 3OD5A 3OQBA 2RC6A 3K2QA 1I1HA 3ELBA 4LF4B 4M7RA 1WL8A 4Q3EA 1E2GA 2C94A 1QS0B 3VDRA 2WM3A 3U7IA 4TX1A 4CU2A 3WLAA 4KRGA 1JAYA 4IWYA 4WY5A 4UDYX 3Q0IA 3WK8A 4D9BA 3C7KA 4NK5A 3KFLA 4DGSA 3GLQA 2FWNA 5F3RA 5DCWA 3OT1A 1LVHA 2XYPA 1DKLA 3EHEA 1E1DA 2GM9A 2JGMA 1EAYA 3OZWA 3PFGA 1E6WA 1FLAA 4G01B 3TRHA 4UQLA 3EYAA 3OU7A 3PX2A 3OJOA 4OK3A 4TTTS 5E9WA 2NTJA 3A1EA 2WY2D 5DFAA 3HV2A 4MB0A 4P1ZA 5DHUA 3KKZA 4MROA 1CRPA 1J9EA 1X70A 4J7AA 4KDRA 1LPBB 1VDMA 1Z8HA 3R7WA 4PBTA 3KLBA 3EMDA 3P0IA 4P84A 5L7WA 3C41J 1DLIA 1GSAA 2HI0A 3M4JA 3BFVA 5CIWA 3SYKA 5FQOA 4C2AA 5DJ5A 1PR9A 1CUYA 1LDMA 2ODPA 3BSWA 2KB0A 1D4OA 1VRWA 3EQ9A 4P5DA 3IQEA 2W6MA 1JG1A 1Z4IA 4IS2A 3K0SA 2DKOA 4HWPA 2OGUA 3DMPA 2Q5FA 3LF1A 4BY9E 2GPJA 1B15A 2FR8A 3GT0A 1AQ6A 2XNJA 3C4JA 3GZNA 4RJIA 4URWR 3FYUA 5HM6A 3CUKA 1AHNA 2H06A 3H9GA 1KI3A 4UUPA 3LGAA 4CBVA 3LL7A 4O8CA 2GD1O 4PC7A 3KG2A 1AF4A 3B89A 1E2HA 3CG4A 4XJTA 4XIIA 3VH3A 4I50F 2IX9A 3JQBA 3LCUA 4E5MA 5F78A 1OIXA 3DXXA 2EFCB 4N41A 1GAWA 4BPBA 2QPOA 2Q50A 3H16A 4NJMA 3AVXA 3K3PA 2NLOA 4XXHA 4B4DA 1KEZA 2QSZA 3KP1A 4L5JA 3D8NA 3OQPA 1GT91 3KV1A 3GPDG 5B4TA 2VN8A 1LQTA 2V6MA 4N0QA 4PQYA 1MJGM 1JNYA 2H4YA 4WLEA 1XROA 5LD2C 3VNVA 3ZDZB 1U02A 4FFWA 1E0JA 3CGGA 4OQZA 3NHMA 3A2MA 4TLCA 4BN0A 5AP9A 5AKLA 5FR1A 2HSWA 3NT4A 4DCUA 1K5GA 1Z6GA 2PT6A 4RIFA 1XQXA 2FMFA 3K4QA 3IBCA 3KQPA 4PGAA 1XRMA 1H93A 4K1LA 2YL2A 4O4JF 5G0WA 4JYZA 1CJTC 4JGGA 4J9UE 2JFQA 3JARB 3KCNA 1EX1A 1X74A 2RK4A 1H1TA 4L07A 3BMQA 3VHQA 4N7BA 1H1LB 3OTHA 4M9UA 5F7JA 3NQ41 5CM9C 1G3UA 4LZNA 1JHOA 2XUIA 4FT2A 3WHKA 5EMJA 2GZ3A 1MVLA 4MI3A 4RL4A 5IDYA 4CV0A 4AI6A 2QRNA 2X8WA 3QE0A 1CU1A 2HMAA 2WG0A 4NCKA 3RS4A 2BMDA 4JB8A 1ESDA 3GUCA 4Q93A 2YW9A 4ARAA 1U0OC 5AWFC 3MTBA 1KJZA 2GBLC 2GM5A 4R8KA 4YYEA 1UIRA 4DG9A 3G2JA 1KXJA 1J5EB 4PXSA 3T7EA 1MHTA 1XTIA 1GLVA 4F9GA 3IPYA 2VKTA 4TS4A 3DKPA 1SG9A 3AR5A 3NT5A 5D3MB 4CFSA 4KREA 3EGEA 1GG5A 4E21A 2RB4A 3IJ5A 1QP7A 1WZNA 2O8DA 1E62A 3HZRA 1E89A 5DASA 3QX7A 4WVLA 1JQEA 4L6IA 1C9YA 1CJVC 5K8UA 3Q8KA 1QPZA 2AL7A 3V4SA 2CCKA 1A9ZA 4ML3A 4OG2A 4QVKA 2HHHB 3DE2X 3DLTA 2PL3A 5LBUA 3D8UA 4X20A 3KXLA 2A0YA 2BKUA 3STTA 1NXXA 2J5BA 2P77A 2PT9A 2BR5A 3NAZA 1RVDA 3KU4A 4XQEA 2AF3C 4O2BF 4KWCA 2JFYA 4FR2A 4XRGA 1ZR4A 1ETUA 3KOMA 2ZBVA 2BH2A 2P5UA 3JXEA 1BOFA 1WMEA 3OM8A 2IUTA 1B8OA 3C16C 2QXUA 3OP4A 3P2IA 5HFJA 3WFZA 2FFBA 4EH1A 2ZAMA 2I3GA 2LDBA 4LZWA 5A0VA 5KHOC 2J5QA 3ZW7A 2Z2JA 4IIUA 3TXAA 1OXTA 1EA5A 2X9QA 1PS8A 1V7CA 4G3XA 5TPWA 3M3DA 4EQZA 3W6PA 3FVWA 5TQ0A 2EZ4A 3K53A 1BH2A 4TTJA 1RKXA 1ECFA 4H7FA 4QRDA 1JYEA 3C1OA 3WJ1A 1U28A 2RBKA 2RKOA 3AZPA 3A1TA 2NTEA 3O8QA 2BJHA 1ONNA 3D2LA 4HPXB 2C7PA 1B1CA 3E03A 5COQA 2BZ0A 2QU7A 2Q4RA 3JD4A 3UYKA 4WIAA 2XNDD 1SVWA 2FMHA 1I3KA 4E6EA 4MVJM 5C5DA 5I6DA 3NM6B 1QIFA 5ALLA 1LI5A 4HBGA 2IVZA 5L6LB 3MUNA 1EINA 5JBIA 2GH1A 4ALLA 3SC6A 3OLXA 3EQ2A 4B34A 4DNOA 1K3TA 1GDTA 2JA1A 1MAHA 4LA4A 3F8TA 4GRDA 3U7GA 2C95A 3RFTA 3I8XA 2YY6A 4ZRDA 3BE5A 4NJEB 4G0UA 1UMDB 4ZVKA 4KLCA 2FSFA 4BEWA 2H7VA 3J7AC 1BH6A 2OYCA 1JHVA 3EEIA 4F4JA 2R87A 2E21A 1OC4A 3MJFA 1R4NB 4MGYR 4OGKA 4XLZA 3AVYA 1PUXA 3C8HA 3D3WA 3CXUA 3G8YA 3I83A 1Z73A 3C97A 1U8AA 2DFKB 5DLEA 2QYSA 4O0MA 2NGRA 1L1EA 3B52X 4KRYA 3K9CA 5HZKA 1D0IA 1R16A 1T0PA 1OPRA 3EGXA 4F4FA 1PJAA 4FLFA 4JVMA 1DWQA 2AOTB 1NFQA 1P7CA 2BEVA 3CUTA 3IB3A 3K7EA 1EK0A 1XRRA 5EVJA 4AS3A 1NUTA 1Y6QA 2ZI3A 3FHCB 3FLAA 1VP9A 3KPVA 5HK8A 2WJ4A 2CJPA 5G0SA 3V97A 4AJ1A 5L4LA 3O8CA 4MDEA 4ZA2A 2CLLB 2FDRA 2H00A 3AF4A 3C6ZA 2K4MA 3OX2A 4YJ2A 1RCFA 2I2FA 5COBA 4D8WA 3PR1A 2QTRA 3REQA 1LLFA 4C6TA 2FUG6 4CZ2A 4EK9A 2PUGA 2DWPA 2FRVA 5LZ8A 1KYTA 3K2EA 1HLGA 4X7PA 2HAEA 2EQBA 1OU0A 3FCUB 3QPUA 3ORFA 4BRSA 5G3ZA 4BVGA 1LTQA 4KO4S 2OZVA 5GVRA 2B69A 2J3EA 2AW3A 1CB0A 2R6GA 2ZT5A 4E31A 5AKKA 1ISMA 4RA9B 1QGUB 1ZLYA 3SJZA 9MHTA 3P9RA 1Y8QB 3WBBA 5H59A 3P5BA 1I94B 2PMDA 1DFHA 2Y4OA 4GPEA 1RWBA 1M67A 4YXWA 4EGAA 1TVKA 3GYBA 2BDEA 2PKYX 3VTAA 2GB4A 3LX5A 3HM9A 2BMAA 5GTDA 2VP2A 1CT9A 1Z47A 1DBRA 4QG7A 1TK2A 3SQDA 2JGDB 1P2VA 3QVKA 4D5EA 1K6XA 2GD0A 1JEYB 3PQ4A 1D09A 1WCIB 3TIIA 2V45A 1Q77A 1ZAKA 1Y4DE 2E4UA 3WGZA 3BE8A 1W9MA 3WIBA 5G2OA 4XWWA 3JR3A 1U65A 3C3CA 3MRXA 4NEQA 1QH1A 1VLMA 2GPYA 4P83A 1XTTA 1D8AA 3TJMA 4WV3A 4I5FA 3T9AA 5JVDB 4ZQCB 4D3FA 4CIWA 1YZUA 1XPUA 1TF5A 2WD8A 2DFDA 4P3OA 2P9BA 4OGFA 4EYQA 5C7IO 3GCZA 2FQWA 3LRPA 2WD7A 3NLLA 5CA0F 2WMYA 3VR6H 1QK4A 3JCZA 5F1KA 2V8OA 3ZDQA 4CTJA 5BR4A 3OQ1A 4RACA 1AE1A 3LZDA 3M1AA 3GEDA 3MYRA 2Z58A 1OXUA 3PEVA 2P4HX 3RSQA 4D9GA 3TBKA 3FSJX 5L8VA 4X1OA 5CYOA 5THQA 4G5SA 4RCVA 3SDSA 4QOEA 5CEEA 2O50A 4ME6A 3UPTA 2VJBA 4KI0A 1MAVA 1IBSA 3ZLBA 2XNDA 2NW6A 1FNCA 4CF4A 1GPBA 2ZM5A 1T4MA 2B82A 2ZPUA 2G5PA 1L7XA 2X4DA 4XB1A 3MINB 1U80A 2PWBA 4L85A 4J0EA 4B3HA 3C8UA 4UPDA 3D3EA 3HKBB 2VWHA 3AR6A 2QTVA 3IELA 5JWHA 1QHGA 3K31A 2YQ5A 3M83A 4INAA 3WE7A 1RSZA 2WFZA 1MZVA 1Y5NA 5A3SA 3NM5A 5HS4A 1UXJA 3EZXA 3DDNA 1U8CB 2QTHA 2WZBA 5I9SA 5DGIA 1YRYE 1BCSA 2G08A 3MUFA 1KJQA 4J8PA 6GPBA 3WZ2A 4R31A 2W2XA 1SWWA 2D1TA 4BRZA 5E2AA 2I1QA 4L3WA 1Q7GA 1ZGZA 4GZMA 4F5ZA 1BDHA 4KE8A 3ULKA 2C0PA 1OXMA 1G4UR 1OFVA 1TFRA 4LMAA 4ZDJA 5LQMA 3U4MA 1CJBA 1CHDA 5HTKA 3ABIA 5KWSA 2EGHA 1LDEA 4Y2VA 1RZRD 1T0IA 5EPOA 4W6QA 1XAIA 3S5UA 2OFXA 4D4GA 2FUEA 2VBFA 4DLRA 1LC3A 4NG4A 3EARA 1GY8A 4LXQA 2I4TA 1XZCA 4PAOA 1JIQA 2DTXA 3HVJA 4OQXA 1T2EA 1JIKA 1TU0A 1R8XA 5EZ6B 2POQX 1QHXA 4O2AA 3T94A 5EIOA 4L8YA 4GX0A 4NICA 3KS9A 3KOUA 2WHPA 3D2BA 3WDKA 2HUPA 1NKSA 1ADJA 1KMNA 3I1YA 2Y0EA 1U4SA 2OCAA 4ESVA 4UTRA 2H08A 4HDQB 2EHDA 4BBAA 3SFVA 1H3FA 1UBFA 2NXWA 2OOKA 2ORVA 2WYHA 2ZSEA 3QFRA 3KIPA 4IGFA 2YRWA 2PH1A 4CV1A 2MSCB 3ACBA 3WSVA 5KJCA 1Z75A 1DBVO 5HUQA 2VSNA 4RHUA 4UTPA 3QWBA 4K6MA 2I87A 5JAQA 4RWEA 4ND2A 3E5RA 1L4KA 1YI8A 2JIPA 4RABA 5DCLA 1GTRA 4QOJA 1U2SA 2UUBB 4ALJA 1EESA 4KQIA 1SELA 4JIMA 2J0UB 5KREA 1P81A 4G0OA 4M86A 5GY7A 3MWFA 5EYPA 4HUJA 3EGDA 5LP6F 3MIZA 1IPEA 1DBIA 1WRBA 5I7EA 2O19A 1KO5A 4YI5A 1X7GA 1QE0A 4ZI3A 4DCCA 3FGOA 4MNTA 4NEGA 1ZD8A 2PLWA 1RXIA 4P33A 1E6LA 5C1IA 5A4AA 3DQPA 3OO0A 1JALA 4FFRA 5EJIA 3V2GA 3K09C 5HQ3A 2YMPA 4ER6A 4KQ6A 2WWGA 2VA8A 1X7XA 5ITZB 1OAOA 2B21A 2ZB7A 2AG0A 3VVBA 1LQUA 1RZ3A 3AWIA 4TVKA 1YMUA 4LV6A 2FB9A 4X1KA 4D96A 4EG5A 1ZQ9A 1GPWB 4DXHA 5IMBA 4EX7A 1JKJA 2WEKA 4YAUA 4LG1A 2JS7A 4MVYA 1N2IA 1MIOB 4MAMA 2HJVA 2NU7A 3G13A 4YT8A 5F35A 4PNEA 1RWQA 4DR5B 4HNAB 4G5QA 3P5SA 1GIAA 3R5TA 4RA6B 4JYAB 2XTZA 1RWVA 1T6BY 2WAMA 3GLHA 3IURA 3KZNA 5H80A 1N5KA 1NW6A 2O7RA 4ZU3A 4L2IB 1G7SA 2BN4A 2FUCA 2DFPA 2RGUA 3H86A 4JXJA 4W5JA 3LC1O 4LYDA 3ET5A 4ZEWA 3OCJA 1IUKA 3D8TA 5AKXA 4YJ3B 5IYZA 2FPSA 2VNAA 3IOBA 1KAEA 4BE4A 5KOYA 2ZLBA 2BCEA 5SZJA 1SXIA 4FDAA 4J43A 3GQBB 4NNJA 3GJQA 2HK7A 4A0GA 4IV0A 5C46F 4K6OA 1PZGA 4WXHA 1Q17A 1COZA 2LNDA 3LM8A 4H17A 4D3YA 4DEXA 1IIBA 5K0EA 4CLDA 3PQ3A 2WG2A 1PHPA 4BCCA 3FOAA 1EUZA 4PPQA 3ND5A 4YO8A 4GMHA 3T0FA 3WYEA 2AQ8A 1V1RA 4UFNA 4J91A 1JHZA 1MA0A 1Z82A 3IBFA 5T6MA 2ZSBA 3GLSA 3GU3A 1M6VB 3GAZA 3A1DA 2IWRA 1Y37A 3KOXA 3EXEA 3IQHX 3CZRA 4KU4A 2ZVQX 3GJTA 3QUCA 3S2SA 3L6BA 1GGFA 1XT6A 3IDZA 3VZDA 2GVDC 4WD3A 5H1YA 2OHJA 2QYHA 1KI6B 1RZRA 1PSWA 2FGKA 3EGCA 4Z49A 3A1SA 4LZZA 3MMSA 1YL7A 1NM5C 4MUIA 4KV7A 1ECGA 5E4YA 2DECA 5JS8A 3EQ6A 3R76A 2G9QA 4CMJA 2C57A 3MAAC 3K9FC 3CSSA 2ARKA 1GVNB 4EB6A 4C4OA 2BGNA 4OI2A 4ZMBA 4IPTA 3ICEA 4EMBA 4QDZA 4J0DA 5BPHA 4UTVA 4G4IA 1VGRA 3TTXA 2BFFA 1YD7A 2BE9A 2IYRA 3DPSA 1L1QA 1ISRA 3GZTB 3LPNA 1W30A 3AESA 3I12A 3HR8A 4JT4A 4ZYXA 2YJTD 4JMPA 1MC4A 4KN8A 4QAQA 4WK2B 4DV6B 1QYVA 2Y1FA 4JI8B 4JBWA 2X8JB 3S0JA 2PMKA 3COWA 5IPFA 4PYRA 2BM8A 3U4HA 1NVBA 3WLTA 4IJMA 1O2DA 1N8SA 1RNLA 1YQXA 1UMBB 4LRWA 4QPJC 5DX8A 4HNTA 3NBFA 5I8PA 3SQXA 4TT8A 1GPJA 1CUGA 1WNTA 1Z6TA 2Q3MA 3R44A 2JCXA 3WNZA 3RC9A 3WK5A 2XXAA 1ZICA 1BTOA 5G0UA 4MV7A 2YBDA 2GTPA 4C3VA 1AURA 1X1SA 2O3TA 5F76A 1VKOA 4Y67A 3VC7A 3SDZA 4RF5A 2W2OA 3AHHA 3TDMA 1B93A 3KVVA 4KMSA 4NZMA 2H17A 2JBHA 3A2NA 3UMMA 4F5EA 1J8YF 5DB4A 2UZIR 4IHJF 4OMCA 1BWPA 1IEQA 4M3NA 3TZQA 4UOZA 1F8XA 1QYIA 2I4IA 1Z7YA 3E9DA 3HLYA 3I1FA 4P3PA 1RC8A 1B26A 1CF4A 4IF6A 3W5DA 4YV0A 4MAAA 1T2VA 1YL5A 2A3RA 5EQJB 4K9QA 3RLIA 3UBMA 1PNOA 1BEUB 2ZSIA 2PVSA 4CQMB 1FUEA 3L06A 1WLSA 2O1SA