3ZH8A

A novel small molecule apkc inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
343
structure length
318
Chain Sequence
SLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEQLPDDDDIVRKIDQSEFEGFEYINPLLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine-Binding Motif Mimicry and Cellular Effects of a Thieno[2,3-D]Pyrimidine-Based Chemical Inhibitor of Atypical Protein Kinase C Isozymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTEIN KINASE C IOTA TYPE
total genus 88
structure length 318
sequence length 343
chains with identical sequence B, C
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zh8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zh8A01
4A9UA 3E62A 1VYWA 2XIYA 3CE3A 4I0RA 2W1IA 1P4FA 5AUZA 4ZJIA 3ZRKA 3QKLA 2VN9A 5IA1A 3HMMA 2EXCX 3GXLA 3ROCA 4C4GA 3TWJA 5M44A 2BDFA 3M11A 4RGJA 3M2WA 5CF6A 3KK9A 3BLHA 5IEYA 2R5TA 2W9ZB 3ACKA 3QTRA 4KNBA 4Y5QA 3FYJX 4ZTMA 2ITXA 5CZHA 4XRLA 3PXKA 2JDSA 2CKEA 4JLCA 4CKRA 3VAPA 2HY0A 4NU1A 2BHEA 5F4NA 3EL7A 2C5YA 4BI2A 1FVRA 2VGOA 3PVUA 2O63A 5KHWA 4HGSA 5AA9A 3Q4UA 4OTFA 2FA2A 4EH4A 4AZTA 3PZEA 3D7TB 4MK0A 4EOSA 3I7BA 4MBJA 1Q62A 4HYSA 5HBHA 3GCVA 5AIRA 3BPRA 4IAYA 1U46A 5CASA 5CEPA 1I44A 4IB0A 1V1KA 4FOCA 5DNRA 4E93A 3II5A 5DRDA 3FLQA 3D7TA 5F20A 4J97A 4FV9A 3AD6A 3VO3A 1PXMA 1URWA 4YSMA 2X9EA 4IAKA 1Q8UA 4RFZA 1FMOE 5HIDA 4NT4A 3IDBA 4EORA 5E4HA 2QOLA 2W1CA 4QD6A 1YKRA 1KOBA 3WZJA 4FNZA 3QQJA 4IEBA 2XUUA 3OW3A 4HOKA 3MH3A 1MRYA 3QD3A 3WZUA 4AOTA 5I9ZA 4GEOA 2PY3A 4AZFA 3FKLA 3LFBA 2J0JA 3O96A 4RLKA 3DKCA 5IA2A 1QPEA 1A9UA 4FEQA 4AGUA 5LJJA 3EZVA 3EB0A 1PYXA 2C6DA 1UVRA 3C4ZA 3GCQA 3S2PA 2V0DA 3ZDUA 2R3JA 4OAVB 4IVDA 1IASA 4BBMA 4EOMA 3BU5A 2UW7A 4I24A 2YIRA 5GZAA 4CG9A 1O6LA 1Q3WA 2IZUA 2BIYA 4JI9A 4ZXTA 4EH2A 1Q8YA 1PXKA 2C30A 2A1AB 3A4PA 3FDNA 4XCUA 2ONLA 3W2CA 1A48A 2H8HA 4FICA 1QPJA 4K2RA 4U0IA 4F4PA 4KSPA 4R3CA 5CAPA 3HA8A 1V0OA 3FXWA 3WIKA 2V22A 3ORIA 4G6NA 3PIXA 5IDPA 3GB2A 4AAAA 4BDJA 3E92A 5JQ8A 3MFRA 5ETCA 3DQWA 4G31A 5FP5A 4CTBA 4RG0A 4L67A 4TYHA 4C3RA 3ORMA 3ID6C 5HCYA 1RE8A 4BIEA 5BUJA 3QXPA 3R1SA 3QZFA 4C7TA 1G8AA 4KD1A 5KBRA 3Q9XA 2E9VA 4YJTA 3OWPA 5EFQA 4KWPA 4J53A 2YDJA 3LE6A 3MH2A 3ODZX 2XK6A 5IA5A 2UVXA 3T9IA 4XMOA 1ZARA 4YZNA 4ORKA 1NY3A 2ZVAA 4FVQA 5IEXA 4BF2A 4XP3A 3V5LA 2OI4X 4IB5A 4TRLA 4A07A 4L7SA 4I21A 2GNIA 3W33A 4ZY6A 4TT7A 4QMSA 1H27A 1YQJA 2ZMDA 3AT2A 2VTOA 3FC1X 3K2LA 3ORLA 3R6XA 4QP3A 2ITYA 1E9HA 3P86A 5LCKA 4MX9A 1W82A 3RPOA 3HX4A 2XCKA 2JD5A 3UTOA 4O7TA 2IVTA 2XIZA 1NVRA 3ZZEA 1M14A 2VTAA 4DTBA 2A2AA 4O1OA 1Q99A 2HCKA 4FEXA 3TN8A 2WIPA 2C69A 3PSBA 1YW2A 3CGFA 3P7BA 4MEDA 3BU6A 4H3BA 3MYGA 3UNZA 2SRCA 3TJDA 3R8ZA 2CLQA 3MFSA 5GIOE 2YIYA 2C6MA 3AMYA 5ETFA 4JQ8A 4UMPA 5AR4A 5IH6A 3ZSIA 3A7GA 1NVQA 1NA7A 3K5UA 4EC8A 4HCTA 2ACXA 4PDYA 1XH4A 3FL5A 5EQEA 3SW4A 3ALOA 4RZVA 2HENA 3EL8A 4LOQA 5JZJA 2AYPA 1JLUE 1TQIA 3OXZA 4MD8E 1UU9A 3CQUA 2P2IA 2YERA 4IAZA 3NGAA 2OU7A 3DS6A 2VNYA 3LQ3A 3DB8A 3KMMA 4I93A 3TNQB 4GSBA 1CM8A 4ONAA 3KKVA 4O0TA 3PG3A 2R4BA 4X2FA 3LMIA 1OPLA 5AR2A 1ZY4A 5D1JA 5JSMA 2C3KA 2QR7A 2GTNA 2C3JA 4G3FA 5HLPA 4FZ6A 3R00A 3VJNA 5E8WA 3IOPA 3GU6A 1T46A 3GCPA 2HZIA 5IMEA 3OBGA 3DZOA 3ELJA 4IM0A 1OPKA 4MXCA 4RFYA 2VUWA 3EKKA 2PUPA 2GDOA 4AE9A 5AR5A 5AUWA 3QTXA 4C4IA 2PL0A 3PVBA 1FVVA 4FZFB 5FXQA 1JWHA 3ZXTA 2RSVA 5K3YA 3LHJA 2W5AA 4BCOA 2HZNA 4FKRA 5HNIX 1IR3A 5KMOA 4L3PA 4EK5A 5J9YA 1XH7A 4EOJA 4FGRA 3LIJA 1IAJA 5B0XA 2VWUA 2DUVA 1WBNA 3TM0A 4YJSA 4EKKA 2YWPA 3LVPA 2RKUA 5DIAA 2OW3A 3AMBA 2RFDA 3O8TA 4O0SA 5B2KA 1W84A 1YWVA 1S9JA 2BZIB 2Y0AA 3BHTA 4ZZOA 3EFKA 4A4LA 3PDTA 4PP7A 3C1XA 2YAAA 2X6DA 2BR1A 2R3PA 3C4WA 2YM7A 3COHA 4JR3A 4WD5A 4F09A 2BZKB 4FTKA 4U43A 2XBJA 3NCGA 3T8OA 1BL6A 3U6JA 4DTAA 4FKJA 3GI3A 2E2BA 4ASDA 3QGYA 5EQPA 3S00A 1T45A 3FZSA 3ZEPA 3BYVA 4AT5A 5AUYA 1JKKA 2GS6A 3BEGA 3IDPA 4BTFA 3TUBA 2B54A 2O8YA 2WFYA 3DGKA 2YIWA 4FV0A 4DG0E 1X8BA 5JFSA 4I92A 2QONA 2WMBA 3UODA 4ZZMA 3UBDA 3WARA 4AOJA 4AFEA 3QL8A 3F7WA 4RPVA 3VBTA 4F6SA 2H9VA 1APME 3GUBA 3PRFA 1KOAA 4FIEA 4BDEA 3D5WA 2VZ6A 3BV3A 3E8CA 3GU7A 4APCA 4IFCA 4JDIA 5JFXA 5HQ0A 5EYKA 1M7QA 4UXQA 3G0FA 5EG3A 3ORPA 2PPQA 3HMPA 4J8NA 1OL2A 3R04A 3GQIA 1P5EA 3EQGA 4FYOA 1P2AA 5LMKA 2GNHA 3LJ0A 2AUHA 4FSQA 5GZ9A 3TJCA 2PVFA 5DWRA 2I6LA 4F70A 2OZOA 4L8MA 4BCKA 2R0IA 5JGBA 3UE4A 3DNEA 1PXLA 2VTHA 3SG9A 3KRWA 1SVGA 4EC9A 1DI8A 4QMTA 4ANNA 4E5AX 1KE6A 5J87A 3C4EA 5AEPA 3HUCA 1Q24A 2OXYA 3V01A 3NW7A 5LMKC 5HG5A 4TKSA 4ZLYA 2YCQA 4JQEA 5GJDA 3UOKA 3QTZA 5BX0A 1YXVA 3TDVA 2WAJA 5AP6A 1ZZLA 2OJGA 1E1XA 2UZBA 5LVLA 4FKQA 5BYYA 4U9AA 2O65A 5HICA 3G0EA 4CCBA 2CN8A 4BICA 3LPBA 3LXPA 3MFUA 4L3LA 3W8LA 3SAYA 2FSLX 1YVJA 4DFZE 5EHOA 5JMSA 2GFSA 3Q5IA 4IDTA 4F99A 5BMSA 3PWYA 3U4UA 5BNJA 4FSMA 2RG6A 4UZDA 1LEWA 5K0XA 1H26A 3O8PA 2W17A 3FQSA 2ITNA 1OBDA 4C4JA 3OZ6A 2X8EA 1HCLA 1M17A 2YM6A 1FVTA 3FKOA 3UYTA 3H3CA 2ZM1A 2VTQA 4V0GB 3EQDA 3ORKA 3PPZA 2XNPA 3C50A 4FIJA 3HUBA 3LAUA 4FT0A 5E8YA 4CG8A 4RIYA 1WBTA 2IJMA 5E8SA 4D4YA 3FXXA 2YIXA 4FVPA 5HD4A 3R0TA 5A6NA 3GVUA 3EYGA 1XH8A 3DKGA 4XG6A 2CSNA 2Z8CA 4AA4A 4RX9A 5CF4A 4RJ8A 3ENHA 3OHTA 3U87A 3GOKA 2X9FA 4XV1A 4XJ0A 4XG9A 3P1AA 1Y8GA 3P7CA 4WNOA 1W83A 5C4KA 4GIIA 4WHZA 3EQFA 5M07A 2YCRA 2B52A 2BZHB 4I4FA 4IJPA 3MA6A 3ZRMA 1OKZA 5AM6A 1J7IA 2Z7LA 1CSNA 4F9WA 3O17A 1BL7A 2XEYA 4DGMA 1OIQA 3QYZA 2ITTA 1ZMUA 4RWIA 3REPA 5M4UA 3F6XA 3HDMA 4EOIA 5AP1A 1WMKA 3KRJA 3SX9A 2XVDA 4GVAA 4I20A 1XH9A 4OGRA 3SQQA 1Z9XA 1JAMA 5EI8A 3ZM9A 5HOAA 4EQUA 4I0SA 2YIQA 2B55A 3DJ6A 4F1MA 4BZOA 3U8WA 4KABA 1R78A 3RI1A 5BVDA 5C01A 1IA9A 4YHFA 4HW7A 3HRCA 1K9AA 2XK4A 3PZHA 4EH7A 5T68A 5DEYA 2XRUA 4FIFA 3NMUF 3A61A 3DBCA 4GUEA 1PRYA 4Y85A 2J9MA 1ZYCA 4M8TA 5L8JA 3LFNA 5FEEA 4JIKA 3COKA 2PVRA 2WOTA 3Q96A 3ZO4A 3DB6A 1AGWA 3CTHA 2OKRA 4IBMA 4IZ5A 4A9SA 4TL0A 3KCKA 3JVRA 2X39A 5H2UA 3H4JA 5D41A 4M0YA 3VS0A 5HX6A 4IC7A 5DVRA 4XHKB 1Q8TA 2ETRA 4NCTC 4KS7A 1REJA 1CTPE 4O0WA 4F7NA 4EBVA 3JUHA 4D4VA 3R7EA 2R0UA 4DGNA 3ANQA 4ZTSA 3Q4CA 4GFMA 4NTSA 2IG7A 2WXVA 3MIAA 2WMXA 5M08A 4NH1A 4GJ2A 3SG8A 3PE2A 2DQ7X 4YPDA 2LGCA 1FMKA 4KAOA 3CQEA 3CCNA 2C1AA 2UZLA 5BQ0A 3VHEA 1PMEA 3P23A 1MQBA 3LFQA 2BHHA 2G1TA 4OBQA 3PVWA 3HV7A 3SW7A 4O0XA 3R1YA 3S1HA 3E93A 4QP7A 3QYWA 3KXZA 5FGKA 3RK9A 3HV5A 4AGWA 3ZBFA 4NSTA 3BLQA 4FR4A 4LGHA 3DY7A 3FY2A 3OUKA 2UW5A 3ALNA 3DQXA 3AGLA 5HZNA 2R3MA 5FM3A 4AZSA 4E4XA 1QPDA 5AR3A 2XBAA 3B8QA 3Q3BA 3S3IA 3HKOA 1XWSA 2I40A 4I3ZA 5CY3A 5IQFA 2BDJA 1R0EA 2QR8A 4NM5A 2QKWB 4S2ZA 4CT2A 3FLWA 3ZFYA 3HMIA 3WF8A 1K3AA 4DT9A 4Y46A 3U6HA 1SM2A 5EHLA 5I3OA 3TXOA 4Q5EA 4F6WA 1WVWA 4IWPA 1UKIA 5DA3A 4KKEA 4ARKA 5TF9A 3QCXA 1BX6A 3EWHA 1VR2A 3NPCA 3A60A 2YCSA 4QMYA 2XKCA 5HEZA 4AWIA 5ITAA 5JN2A 2CKQA 5EW3A 4O7WA 3SOCA 3KF7A 3G6HA 2I0YA 2ETMA 3I0QA 4AUAA 5D7AA 3ZLWA 2RFEA 4D9UA 5HE2A 1JKSA 4IWQA 3R30A 4H36A 4QPMA 1PY5A 3BI6A 3DFCB 4G6OA 4DGLC 1SNXA 3ULZA 3R2BA 3G90X 3N9XA 4GRBA 2I0HA 3BEAA 3DK7A 3KA0A 4C61A 4GH2A 4G3EA 5EYCA 4XLVA 1XKKA 3F9NA 3OCBA 4DG3E 4NIFB 4C2VA 4XUFA 1RW8A 4CZTA 5M09A 3V8SA 5T6KA 4ERKA 4DYMA 4U40A 1DAYA 2UZTA 2WU6A 2OLCA 3TNIA 5ICPA 3F2RA 4EI4A 4FKGA 2VAGA 1H00A 3C4FA 4YLLA 2P33A 1JSUA 2YWVA 3T3VA 2Y4IB 4O7VA 3R7GA 3UC4A 3ULIA 3Q2MA 4C35A 2PVJA 4XYFA 2IO6A 4JX3A 4ZZNA 3C5UA 3O8UA 4YC3A 5FDXA 4EYJA 2G01A 5J95A 4NKSA 3HP5A 2X2KA 3HL7A 4BDAA 4U42A 3VULA 3KVXA 4N6YA 3HGKA 3W2OA 2YJRA 1F5QA 1G8SA 5AMNA 4OTPA 3DCVA 5CTPA 4AA0A 5C8NA 4EZ3A 4O81A 4BRXA 4KRDA 3OP5A 3PLAE 4J7BA 2PUUA 5CEOA 3HRBA 4KIPA 5IH4A 3NIZA 5CU6A 3JXWA 4FTAA 4WT6A 4AN9A 3MGYA 2FUMA 2WMUA 5FBOA 3BU3A 3ZO2A 4APPA 2ZV9A 4C37A 4EJ7A 4XG2A 3ATTA 4XV2A 4FSZA 2QCSA 4QMMA 2VWIA 3LMGA 2XK7A 4PUZA 3OTUA 2PE0A 3PVGA 1H24A 2BVAA 3I0OA 1B38A 4YZCA 3ENMA 4RQKA 4F65A 3AT4A 5KX8A 3HAMA 4MHAA 4D2TA 2R7IA 4KINA 3F82A 2RF9A 3OMVA 1SVEA 4MXOA 4IZ7A 3LJ2A 4C33A 1BI8A 4OLIA 3BWFA 4FKTA 4J52A 2B7AA 3R7OA 5CALA 4ITHA 3Q52A 2J5FA 3E7VA 4IQ6A 3CIKA 2NP8A 5F9EA 1YHSA 4UBAA 4RIOA 3Q5ZA 3UMWA 3HAVA 1E1VA 2F2CB 4GIHA 1ZY5A 1TQMA 3QLGA 3DBQA 2QOQA 5HLWA 5I3RA 4XLIA 2CGXA 3D94A 4FV8A 3FEGA 2X8IA 4O83A 4C62A 4M12A 3KULB 1UWJA 2ITVA 2C6OA 3AD4A 2A4LA 5AV2A 1JKLA 3KXMA 3PFQA 1V0BA 4LOOA 3TNPC 5L6WL 4JDHA 3N4VA 5FXRA 4L44A 4MXZA 4TYEA 2OH0E 3NAYA 3V6RA 2Z60A 4GT4A 3TTJA 4WO5A 4E6AA 3PA5A 3MY5A 3KMWA 4RX7A 4YNEA 4BCQA 3LXNA 1Y57A 4IADA 3SDJA 4NIFA 4W8EA 5FTOA 4FTUA 3V8WA 3OF0A 2ZMCA 4A9TA 4TYHB 2C6EA 2VWZA 3PLSA 4D1XA 4YTFA 3CTJA 3NVMB 4BY9E 4QNYA 3OWJA 3Q6WA 5KNJA 2NPQA 2Y6MA 4EWHA 1KE5A 4X3FA 2OXXA 4NM0A 4PNIA 3W18A 2GHMA 4TPTA 4FODA 5FQDC 3F3ZA 4ITJA 1R39A 4AG8A 4RC4A 5CU4A 1YWRA 4LOPA 4AACA 4USEA 1H1SA 3BRBA 2WMWA 4HVSA 4FTLA 4OUCA 5DEWA 4RC2A 4G3DA 4CV9A 5C03A 4FBXA 4LRMA 4BCFA 5L2QA 4EH3A 5IA4A 3QCSA 3FJQE 1BKXA 1WFCA 4O0UA 4CKIA 3FPMA 4ZEGA 3BE9A 5CVFA 4TXCA 4UYNA 2BCJA 5C8KA 3RAKA 4U79A 3LW0A 5M57A 3IW8A 4XOZA 2XYUA 3VF9A 4DH8A 4WUNA 1ZOHA 3DA6A 4CNHA 3RALA 4KS8A 1XH5A 2E9NA 3RPRA 4M67A 3F3WA 4TWOA 4GK3A 3P4KA 4AZEA 1BI7A 2QNJA 1U54A 3FZRA 3NUPA 3MDYA 2YZAA 5HG8A 4HVHA 4LUDA 5H8GA 5FWKK 3OCTA 3MVLA 3LMHA 2ERZE 3R9NA 3OEFX 1JKTA 5A54A 4B7TA 3KXHA 2YITA 1ERKA 5ETIA 3VS3A 2OXDA 3LFSA 4ZY4A 3C7QA 3AC8A 3EIDA 3QC9A 5HKMA 5IQDA 3HNGA 2AC5A 2PZIA 3QBNA 3MV5A 4LMUA 2WTIA 3EN5A 3IW5A 4WSQA 3E64A 1WVYA 3QTWA 5HBJA 2EB2A 4Y95A 2JDOA 4Q9ZA 3ATSA 1ATPE 4N4SA 4ANLA 4XG8A 2R3RA 3F5XA 3LJ1A 3BX5A 3O23A 4E4NA 2Y8OA 3HMOA 3WF7A 2W1HA 1OPJA 3GC9A 4PL3A 5CAOA 3OOMA 1Y8YA 4JVGA 3LFAA 4FE2A 4UMRA 2IW6A 4L9IA 2C5XA 4QPSA 4P90A 4ZTQA 5CQWA 4V05A 5I9UA 4EH9A 2YHVA 2EU9A 3P0MA 3MY0A 2YA9A 4F6UA 3JR1A 4CZUA 4FNYA 2GQSA 5TO8A 4FSWA 1BLXA 4II5A 4QP9A 4CLIA 4E6DA 4PL4A 4J95A 3RAWA 1YI4A 1XHAA 2X2MA 2B9JA 3AXWA 3R8MA 4X3FC 4L43A 4L52A 3RTPA 4B9DA 4P2KA 4K33A 1QMZA 4HGTA 3C9WA 3VUTA 4EQMA 3QU0A 5KKRB 4IHPA 3CY2A 4CQEA 2XIXA 2XYNA 2NRUA 4G16A 2BAJA 4AF3A 4M13A 3SLSA 1SMHA 3VQHA 4BKYA 2R3GA 4QMZA 2JKOA 4ACMA 4XH6A 4KKHA 5I9VA 5IEVA 5CEQA 4O2PA 3C5IA 1PJKA 4C38A 2VTTA 4ALUA 4LG4A 3FLSA 1MQ4A 4MNEB 3P7AA 4XP2A 2I1MA 3L1SA 4RJ7A 4CFUA 4EH5A 5HLNA 2WTDA 2G2FA 3I1AA 3G9NA 3ETAA 4I0TA 5IPJA 2IZTA 3EQPA 5M51A 2F49A 3FC2A 3E88A 2PHKA 3MI9A 1DI9A 5A3XA 3UG2A 5A4CA 4X2JA 3A7HA 4KIOA 4IAFA 2WPAA 5C8MA 4F9CA 5I5ZA 4BYJA 1OB3A 2ZJWA 3DJ7A 5DFPA 3WOWA 4Z7GA 3WILA 4HPTE 2PK9A 4OTQA 5AP3A 3MH0A 5DLSA 4BCJA 2UZVA 2VWVA 5KZ0A 3UZPA 2UZNA 4PMTA 1ZZ2A 3PXQA 4FSTA 5A6OA 3OC1A 2REIA 4W9XA 4XV9A 3KULA 1GAGA 4YBKA 3QX4A 2WZJA 3NX8A 3HV3A 4OAUC 3QKKA 3OTVA 4G1WA 1Y91A 2W06A 3EKNA 3R8VA 3QA0A 2ZM3A 3UOLA 4G3CA 3RCDA 3KCFA 4KUJA 3NRMA 4FEVA 1A06A 4NJDA 5BUEA 4MXYA 4H39A 3OWLA 5IA0A 4EJNA 2OIBA 3EQCA 2XNGA 2ZB0A 1FQ1B 2R9SA 1FGIA 3GCSA 4CQGA 2X7OA 3IECA 4IX3A 4O6LA 4G9RA 4HCUA 4L01A 4R6VA 5CVHA 4QP8A 1Q8ZA 4GK4A 4BR3A 5CF8A 2HELA 4FKLA 2JIIA 4FX3A 4I5CA 3BV2A 4IMYA 2YDKA 4EL9A 4RWLA 3CJGA 3UNJA 1GIIA 2JIUA 3PJ1A 2YJSA 4QYEA 4QQJA 3I5ZA 5H3QA 1H01A 1RJBA 1F0QA 1IG1A 5E1SA 5FEQA 4D1SA 3CSVA 4C0TA 5GIPE 4KKGA 4IVAA 5FRIA 4TYIA 2PVNA 1WCCA 4JBVA 5DH3A 4IXPA 1MRVA 4D2RA 4F7JA 2O0UA 4ACGA 4RIXA 4YSJA 3AC5A 3NCZA 3UIBA 5ETAA 4ASXA 5AFVA 5E8XA 1DM2A 3TTIA 4ZJJA 4O7NA 2BALA 1OECA 1Z5MA 3FZOA 3NAXA 5M4IA 1UU3A 5FBNC 2EVAA 4BCPA 5CEKA 4ANMA 5GNKA 4N57A 5BVEA 2GCDA 1VYZA 2XKEA 2P2HA 5JGAA 2KTYA 2JAMA 4U7ZA 5J79A 1PXIA 2VGPA 3B2WA 3CBLA 4NW5A 1SNUA 2HW7A 1O6YA 5HU9A 4QYHA 4WRGA 4L00A 2PZ5A 4U81A 2IVVA 5AP7A 2R3LA 1O6KA 3F66A 4M69B 3SD0A 4OTDA 4O91A 4FK6A 1R1WA 4RIXB 4BTKA 1OKVA 3FL4A 4XEYA 5JZNA 4B8LA 4M97A 4PNKA 3ZCLA 3LFCA 3D5UA 4AU8A 4QMOA 4JBPA 3ZLXA 5DN3A 3NR9A 3ZUUA 4BWXA 2UZDA 2BROA 3CJFA 4JOAA 5LVMA 2W99B 4ZSEA 5IUIA 3VBVA 4TNDA 3HP2A 3G5DA 4QTCA 5JH6A 3ZFXA 2B9IA 3MSSA 4WRSA 4AQCA 5M56A 4FL3A 1Y6BA 4BKJA 1XBCA 3H9RA 4FNXA 2EXEA 3THBA 3UJGA 4X2NA 3UP2A 3ZS5A 3UO5A 2BUJA 5FTQA 4CMOA 4EONA 3AC2A 4E1ZA 3OXIA 4MTAA 3BKBA 4JG8A 4JS8A 5TKDA 3WF5A 4AGCA 3A8XA 3FMLA 3FLYA 4FTJA 3S95A 4BFMA 4C3FA 4DFLA 4FV4A 4U3YA 5FP6A 1W8CA 4O0RA 1XJDA 4RJ3A 5AWMA 3EN7A 5HHWA 4RWKA 4RSSA 3QUEA 4X2GA 5AP4A 4I6BA 3L8XA 4G6LA 4D4RA 4FV3A 4QQCA 4FTOA 4F9YA 2G15A 4QNAA 5CF5A 1H28A 3EN9A 3LCOA 5J5TA 1OVEA 3C51A 3R73A 4AS0A 5EDRA 3SVVA 4DTKA 4E20A 2OSCA 3LQ5A 5IQEA 3PSCA 5AJQA 4ZMFA 3QD0A 3W16A 4O7ZA 3A2CA 4KBAA 2DWBA 2NRYA 3HRFA 4OTWA 4IZYA 1LPUA 2WGJA 3ZTXA 5IKWA 4G34A 4EOOA 3C0GA 5F95A 3GP0A 3F61A 2VTRA 3PJCA 4EK3A 2I7QA 4EBWA 3ZUVA 5DR6A 5EHYA 3TT0A 3TZ7A 2B1PA 3EZRA 4IW0A 1UU7A 4RFMA 5JKGA 2OJIA 2J0LA 3MY1A 1UKHA 2R7BA 4HYIA 3TKUA 3UIXA 4NKAA 2QLUA 2C6LA 3KB7A 4QP1A 3F7ZA 4IH8A 2BMCA 3UOJA 4D2PA 3R7YA 4FVRA 4IACA 3OD6X 4DEAA 4B99A 3W1FA 5AP0A 2GPHA 1JNKA 4D5HA 3PWDA 2BRHA 4L7FA 4MVFA 3TZ8A 4YJRA 5AR8A 3NLBA 5AV3A 2B9FA 4QP6A 1OUYA 4PF4A 3ORZA 4WNKA 4Z55A 4FOBA 4A4XA 2HYYA 4QTAA 2CN5A 4RVLA 2JFMA 4Z7HA 1M2QA 3FUPA 4YHJA 3RCJA 3RPVA 4BDCA 3EN6A 5H8BA 4BHZA 3NYNA 5E8UA 5L3AA 5EOLA 4WNPA 3BHUA 2PVYA 4M66A 3UZTA 4WG4A 1H08A 4F0FA 4ALWA 2WEVA 2WTKB 4FG7A 2GU8A 1OM1A 4DE4A 1KE8A 5DGZA 1H1WA 4DINA 4XG3A 4IB3A 4YC8A 3JY9A 4O7YA 1P4OA 3GEQA 4S34A 2HZ4A 3HA6A 3AOXA 4QMVA 4P5QA 3PXRA 2PMIA 3H30A 2B9HA 4N6ZA 2YN8A 2UUEA 5E91A 4RMZA 4BZNA 1XBBA 5CVGA 1H8FA 1OL7A 2ITZA 2HIWA 2OK1A 3DBDA 1B6CB 3R8UA 4MYGA 3FWQA 3RVGA 5HO7A 3TACA 2OBJA 2OF2A 5HVKA 4DF3A 3KN5A 5GZ8A 1WVXA 1OL1A 4F0IA 1K2PA 3TNWA 3UQGA 3WBLA 2WTCA 3FE3A 3VRYA 4HVIA 1H25A 2VO7A 3IS5A 4MBIA 3QD4A 5K5NA 1Q61A 3I79A 3PIZA 2WMVA 3CGOA 2VU3A 2ZM4A 3PSDA 1GNGA 4HGEA 4JBQA 4NUSA 4Z9LA 3DK3A 3RPSA 4CYJA 5L6PA 5LARA 3FBVA 4P4CA 4MCVA 3Q32A 4J8MA 4V0GA 3H10A 2JLDA 5EM6A 1Q41A 4QMLA 5CI7A 5GJFA 3RHKA 2X6EA 3VUHA 1NT2A 2WNTA 3FZ1A 4OTGA 2J0MB 4F9BA 2CPKE 2J2IB 2XNBA 3KY2A 3QQKA 4FKWA 4Q9SA 3F2NA 4UZHA 2VRXA 4RC3A 3Q4ZA 2GNGA 3RM6A 5AUXA 2ZAZA 2E9UA 1W7HA 4DH7A 4MAOA 3SKCA 4E26A 2XA4A 2X7FA 3ZO3A 4BDDA 3EQBA 1RQQA 4B4LA 5AAEA 2OJFE 4EK4A 2C47A 2ZDUA 2HK5A 4AN3A 3MVHA 4FV6A 4HYHA 3PPJA 4HYUA 4DHFA 4BBEA 3TIYA 2E9PA 2OJJA 4ZS0A 2VTPA 4DEDA 4FSYA 3ZHPC 4UN0C 1MUOA 2XRWA 4G3GA 1JOWB 4BTJA 5KCVA 4F0GA 1YXTA 3V5TA 2Y4IC 2XNOA 3GC0A 3WF6A 4BC6A 3IW7A 1ZXEA 4PTGA 4DBXA 4I94A 2JFLA 2HAKA 4FIHA 4IM2A 3FXZA 2B0QA 4TWCA 4ANQA 5HORA 3A4OX 4GUBA 4X3FB 1PMNA 3CLYA 3MJ1A 3QWJA 2OO8X 4K6ZA 2X4FA 1ZMVA 4HVGA 2RIOA 5CANA 2CNUA 4MNFA 5A4TA 3PY1A 5I9WA 5CEIA 2XZSA 3PJ2A 4D2SA 4GK2A 2QG7A 4DEIA 4U41A 2BTRA 4F64A 4R7IA 5AP2A 3EOCA 3R9OA 2C5OA 3L9NA 1PW2A 3COMA 3IKAA 4EZ7A 4RIWA 1DS5A 4EHZA 3BIZA 5JQ5A 2QOOA 4HNIA 4C57A 1FGKA 1IAHA 2WO6A 1JVPP 2VTLA 2QU5A 3IPHA 4QTDA 5EK7A 2W4JA 2HWOA 5DBXA 4NFMA 2J7TA 1J7UA 4FKUA 3Q2JA 2R64A 3ZC5A 4W9WA 4JX7A 3QCYA 4LL0A 1XR1A 3HECA 3KK8A 4DLJA 3AT3A 3RZFA 1XO2B 3CR0A 3RZBA 3DKOA 2GHGA 4DT8A 2XM9A 1YXXA 4O6EA 1R0PA 3NUSA 4RX5A 2VWBA 3QALE 3TG1A 3V8TA 3FYKX 4JDJA 4J98A 4M3QA 4BCGA 4DCEA 4QMNA 2F57A 2VTSA 5HIBA 5AX3A 5L2WA 1U4DA 2C3IB 4ZIMA 3CY3A 2X1NA 2F2UA 3Q9ZA 2W96B 3W2PA 2UW0A 4M14A 4TZRA 4XNEA 3KVWA 4W4WA 3K5VA 4BDBA 1UV5A 3BELA 4LRKA 3DNDA 3CD3A 4DBNA 4C34A 4ZP5A 4UXLA 5AUVA 3PG1A 4F7LA 2R3QA 2PVKA 4WG5A 4FI1A 4JJRA 3ZONA 5HIEA 3E7OA 2YAKA 1LR4A 2UV2A 1U5RA 1FPUA 5M53A 5KMJA 5ANIA 5EM7A 2J6MA 2O3PA 3WZKA 2WQBA 4J71A 4R77A 5A14A 1W98A 4IWOA 3R8LA 5KE0A 2HW6A 3U4WA 3Q4TA 3AQVA 4RLLA 1J91A 4BGHA 5CAUA 2YFXA 5CI6A 2PMOX 2P4IA 1ZOGA 4X6QC 4D9TA 4FL2A 5CSPA 4CZYB 4C58A 1LP4A 3BYOA 3FZTA 3QX2A 4GG5A 2IWIA 4PV0A 1XQZA 3ODYX 2BFYA 2ITQA 4FSUA 4L53A 4K1BA 4RJ6A 4E6CA 3NUYA 3ZUTA 2PVLA 2UW8A 4DH3A 2X81A 3ZLYA 2OIQA 2ITPA 4M84A 3DT1A 3WYYA 4YLJA 5CSXA 4EEVA 3A8WA 1NW1A 3DXQA 4YZMA 3RGFA 3GBZA 4DEHA 4EKLA 1I09A 4IJ9A 3G2FA 5AX9A 4ERWA 3BBTB 4MQ1A 1U5QA 4NJ3A 1ZYLA 4TTHB 4BDIA 2XKFA 4HVDA 3TDWA 4JNWA 4QYFA 4CYIA 4MWHA 4FC0A 4FV2A 1CKJA 1LUFA 4CKJA 4ZY5A 1H1RA 3R02A 3DK6A 3MPAA 4IDVA 4ITIA 3OY3A 5ANGA 3SHEA 5L6OA 5CZIA 2BKZA 5IH5A 5L4QA 2VWYA 3RINA 3UPZA 2CGWA 4BIBA 5LWMA 5I9YA 3TNHA 4Q5HA 3ZXZA 3LLAA 4H3QA 2JKMA 3O2MA 3GENA 4MBLA 5HI2A 3EH9A 5AR7A 4WIHA 5LXMA 4FA2A 4DFBA 3POZA 3V5JA 4EOQA 4E5BA 1F3MC 2XNMA 4FT7A 5AV1A 5M4CA 3D83A 3OCSA 3DAJA 4QRCA 4BB4A 2QHMA 4KIQA 3PY0A 3FY0A 3VS1A 5IQBA 4C4HA 2F7XE 3A62A 4IE9A 3GC7A 4GU9A 4I1ZA 3RK7A 3UOHA 4RJ4A 4RRVA 5HO6A 2ERKA 2VO6A 5IUHA 3R01A 3E8DA 2XEZA 3D2IA 4QOXA 2JC6A 5J7BA 1YI6A 2YISA 2YM8A 3EFWA 3IO7A 3BGZA 4BL1A 5IMXA 3MS9A 4EK6A 1WBSA 3F5UA 4YHTA 4I4EA 1JQHA 2V62A 3GFWA 4TNBA 4A7CA 3ROYA 2PMNX 3VUKA 1Q8WA 4AA5A 3VW8A 3FMHA 3TZ9A 5HD7A 3H9FA 2QI8A 2IZSA 2Z7SA 4E5WA 1Q97A 3U6IA 1G5SA 1V0PA 2BKKA 4FNWA 4DFUA 3FQHA 4IIRA 4AZVA 4H05A 2ITWA 3W32A 2R3FA 1PYEA 4K9YA 4H1JA 1YOMA 4KB8A 1ZMWA 5DR9A 5I9XA 1WZYA 4UEUA 1OZ1A 3ZM4A 4PMSA 4JRNA 4CCUA 2VTNA 4ZTNA 2E9OA 3OVVA 3QCQA 4XOYA 3MPTA 4USFA 1O9UA 1PXOA 4ENXA 4AT3A 3F2AA 3IONA 3EMGA 3LOKA 4DFYA 4CTCA 4C36A 4AW5A 3PYYA 1LEZA 5EI6A 4UX9A 4DITA 2IVSA 2G2HA 2PZPA 2BZJA 2BIKB 3QZGA 4IWDA 3W2SA 4DFNA 3CC6A 3E5AA 3KRRA 1VZOA 3W10A 1BYGA 5CX9A 5KMNA 2C0TA 4EZ5A 4R5YA 4BCHA 5CAQA 4ZS4A 3GU8A 3KFAA 3V5PA 5KMMA 1YDSE 2BAKA 3PXZA 1PF8A 4JRVA 4O0VA 3OCGA 2OZAA 3NDMA 4S32A 4XG4A 4GMYA 4L6QA 4OBPA 2V5QA 4O86A 3LLTA 1GOLA 4I6FA 1YHWA 2FSTX 3UNKA 4EQCA 2F7EE 3JYAA 4IANA 3ZO1A 3KN6A 2ZB1A 1ZYDA 4FSNA 1XBAA 3DXPA 4S33A 5DRBA 4KRCA 4YJPA 2YABA 2FVDA 4QTEA 4DA5A 3PXYA 4EWQA 5IISA 5DHJA 3QFVA 1OITA 5GHVA 1BUHA 1TQPA 3TZMA 5HO8A 1H0WA 5CQUA 2O64A 3UIUA 5EYDA 5IF1A 3R1NA 5K0KA 3ZRLA 2XH5A 3DTWA 4XBRA 2WB8A 5IQGA 4YNOA 3BWJA 4GKIA 3BYMA 2VO3A 4M15A 3UO4A 2YLEA 1OI9A 4H58A 4TWPA 5HU3A 3E3BX 3MFTA 4S30A 1KWPA 4PP9A 3DAKA 3O7LB 4CD0A 5KMKA 1ZWSA 3OT3A 3TI1A 3PRIA 4CXAA 5IQIA 2ZDTA 4GKHA 4DH5A 4UMQA 4BCMA 2WTJA 5CWZA 1JSVA 2W4OA 4FTTA 5AP5A 1UNGA 2AC3A 2ETKA 3MA3A 4FUXA 4R1VA 1UA2A 2QU6A 4AP7A 1U54B 4OT6A 3VS7A 3NUAA 2QOHA 1PMUA 3IW4A 4QMUA 4H1MA 1P14A 5E8ZA 3LCTA 4X6RA 3L9MA 2HWPA 2O5KA 3QQUA 3ZBXA 4DCAA 5HVJA 5CYIA 4QYGA 2J5EA 4CT1A 5EI2A 2FH9A 2VTMA 3G51A 3L8SA 3JPVA 2PVMA 1GZ8A 3PP0A 4J96A 4WBBB 3UVQA 3VBQA 2JDRA 4CLJA 3IGOA 1NXKA 4V01A 1MP8A 4AXAA 4E4LA 5FG8A 4B0GA 5HCZA 4D0WA 3IW6A 3KMUA 3UDBA 4O22A 4DGOA 4FTQA 4WOVA 4ZOGA 1QCFA 2JGZA 2PZYA 3OXTA 4XS2A 3ERKA 3O7LD 4C02A 2VX1A 3QHRA 2EXMA 2UZWE 3UP7A 1M2RA 1WBVA 2CNQA 2P3GX 2XS0A 5E92A 4FTNA 3I6UA 3H9OA 4G2FA 4IB1A 3TL8A 3A99A 2W5HA 4FKSA 4PMMA 3TKHA 2C0IA 2GMXA 2HXQA 3NYXA 3OT8A 3GOPA 4N0SA 3CTQA 4USDA 4WSYA 2VNWA 4ZJVA 3RWQA 3DJ5A 1WAKA 2VD5A 4FT9A 4XBUA 3R7IA 3BGPA 4A9YA 4YR8A 2GQRA 3VBYA 1YDRE 3P08A 3ZSGA 3ZU7A 2C6TA 4RA5A 2YDIA 2RGPA 3FLZA 4FKVA 2WHBA 3WZDA 3SXSA 4D28A 3V51A 3CKXA 4ID7A 5HX8A 5EM8A 3AC1A 4ACDA 4DAWA 2NNWB 5FEDA 3LFFA 3GT8A 1SVHA 2WTWA 4BGQA 5AIKA 5I4NA 5C27A 3VS2A 5TOZA 5JFWA 1H4LA 4L42A 3QRJA 4U6RA 3QGWA 1DAWA 4D58A 5CEMA 3PY3A 1H0VA 5HG7A 2KULA 3K54A 3LM5A 5HTIA 4CFVA 3UC3A 5LCJA 1M7NA 5IUGA 4IVCA 5BVNA 1ZRZA 3D15A 3KREA 4IC8A 4O82A 4QMXA 4LMNA 4YJQA 2B4SB 5DYJA 2UVYA 4NWMA 4RIWB 3PPKA 3QTQA 3GCUA 4F9AA 2PMLX 1Q5KA 3C4XA 3HZTA 4OBOA 5AADA 2PU8A 2Y9QA 3A7FA 4M0ZA 2CDZA 3FMMA 4NZWB 4YPSA 5IZFA 4K11A 3ZFMA 5D9HA 3RMFA 1VJYA 3QQLA 4CRLA 4EH6A 3R22A 3BLRA 4Y73A 4ANBA 4JG7A 4D2WA 4RBLA 4PX6A 3R21A 4BZDA 4R8QA 5CU2A 3MESA 4GL9A 3IGGA 4Y83A 3D9VA 3RKBA 4Z16A 4NFNA 3W8QA 4XV3A 2WMTA 3P78A 3PA4A 3ZLSA 1H1QA 3HDNA 4ZSAA 5DT0A 3PXFA 3W55A 4PPCA 5E7RA 3ORTA 3SC1A 3KXGA 2Q0NA 1JBPE 4FT5A 2W05A 5L2SA 4QMWA 3BHYA 2CGUA 4NW6A 2Z2WA 2OJ9A 2IN6A 3D5XA 2Z02A 3WE4A 3V04A 2QO2A 3DBEA 3IG7A 3LCDA 2VWWA 3ZEWA 5L8LA 2X4ZA 3LFEA 4TWNA 3SA0A 2PYWA 4JR7A 3DXNA 3FLNC 5AAFA 3LFDA 4CGAA 5KHXA 3UO6A 3QQGA 4O7RA 4TYJA 3EYHA 3UPXA 3QTUA 3F5PA 3SXRA 4YUQA 1PXNA 1FBNA 2Q83A 3PTGA 1MRUA 1JPAA 3GGFA 3PUPA 4PQNA 4Y8DA 4YZDA 4YP8A 3VUGA 4ACCA 4ZAUA 3QHWA 3HMNA 1L8TA 2EUFB 5J1WA 2XB7A 2W9FB 5HGIA 4QMPA 5CU0A 2CLXA 3MWUA 2QKRA 2BTSA 4IFGA 1WBPA 1GZNA 3ZZWA 5CSHA 4B8MA 4GW8A 5M4FA 4I23A 5E1EA 3KGAA 3VVHA 2QURA 4BDKA 3EN4A 4FT3A 5E90A 5BVKA 4ANSA 4YLKA 2PVHA 3IDCA 2A27A 4OW8A 3TIZA 3QTIA 4M7IA 3VC4A 3HV6A 2OWBA 3CPCA 2WMRA 3H0YA 3HYHA 4BCNA 1J7LA 1KV1A 3BYUA 2W1DA 4C4EA 2QHNA 2QO9A 5LMBA 3QRIA 4FL1A 3Q60A 4QQTA 1GY3A 3BZ3A 2C6KA 3MW1A 4GV1A 5EOBA 3BBWA 4GJ3A 3L9PA 3QQFA 3G6GA 4W4XA 4F1TA 3BHHA 3RNIA 4U44A 5JGDA 3NUNA 3QUPA 4O7SA 1NVSA 4UMUA 3S4QA 3VN9A 4U97A 3K3IA 1ZYJA 3QA8A 4BDHA 4NYEA 1TVOA 2RFNA 2QOBA 4JQ7A 3RJCA 4UYAA 5CXHA 3OOGA 2H34A 2QVSE 4NTTA 1GZKA 1EH4A 2VX3A 3NS9A 1PXPA 4GVJA 4NK9A 1AD5A 4D0XA 2QLQA 4BDFA 2NO3A 4HCVA 3GFEA 5FLFA 3V5WA 2QOIA 4QT1A 3QAME 2BRBA 2QOCA 1OL5A 1UNHA 2FO0A 2HOGA 4NCTA 4GFGA 5A4LA 3RPYA 4ALVA 2C1BA 3KL8A 3P9JA 3R2YA 1SZMA 1CKPA 1OGUA 4NEUA 4OT5A 3WZEA 3F5GA 4QPAA 3I4BA 5AM7A 3FI8A 4LRJA 3ZDIA 4UWCA 4OR5A 5EYMA 3S0OA 4PDSA 5CSWA 5AV0A 5L8KA 3D14A 3ZYAA 4C8BA 5G6VA 3MBLA 1PHKA 3LZBA 3U9CA 4HNFA 3VRZA 1Z57A 3I7CA 3BYSA 5HE3A 2IW8A 4CFWA 2QO7A 2VWXA 3WYXA 3HV4A 2XK3A 4OTHA 2WQMA 4K77A 1OMWA 2JKKA 3BGQA 3VQUA 2WMAA 3R9HA 4D5KA 4FKPA 4G9CA 4MD7E 4QMQA 1ZYSA 5ANDA 1IRKA 1XH6A 2CHLA 2XK9A 4FF8A 4O1PA 5JRSA 2CNVA 2C3LA 3ZMMA 3UZRA 4FEWA 3IOKA 5J5SA 3QTSA 2GSFA 4O96A 5HE1A 1ZAOA 2R2PA 3FI3A 4IX6A 5I0BA 4KBCA 2JKQA 3QD2B 3DU8A 5CT7A 4AW1A 1KE9A 2BDWA 4OTRA 4EK8A 4F63A 5ANEA 4DFXE 5JK3A 2FGIA 4ZMEA 2UVZA 5DT4A 5A46A 1YOJA 3F69A 2OZAB 3P79A 4FEUA 3WIGA 4DGGA 5BPYA 4YURA 3M42A 4MF1A 3NZ0A 4U45A 2EWAA 3KC3A 3W2QA 4BTMA 2GQGA 4UMTA 3R9RA 1GIJA 1KV2A 1YXSA 2J50A 4YZBA 4GT3A 4AW2A 2XCHA 4LV8A 3B2TA 3U9NA 4CFNA 2YACA 5C1QB 3OS3A 2B53A 3FI2A 3FMEA 3QXOA 1URCA 4FZ7A 4WG3A 3OUNB 3O71A 3VS6A 5HNGA 5DI1A 4G5PA 3U51A 2J4ZA 4D2VA 1WBOA 4GU6A 1PKDA 2BRMA 3CQWA 1Q3DA 2XJ2A 4RQVA 2W0JA 4IAIA 2XP2A 3COIA 4M68A 3UQCA 4BN1A 4EUUA 3CEKA 5KKRC 1M2PA 2WELA 5DG5A 5TR6A 2GTMA 5ANOA 3ZC6A 4GCJA 2I0VA 4G17A 4FKIA 4RA4A 4FTRA 3DDQA 5J8IA 2WKMA 4U80A 4ACHA 2C6IA 5JFVA 3OWKA 2CCIA 4LFIA 4OTIA 5DE2A 4FSRA 3TV6A 5J9ZA 3TUCA 2JDVA 3NUXA 3JS2A 3VBWA 4D4SA 4ZSGA 4BBFA 3OEZA 2ZV7A 4CVAA 3EJ1A 4RZWA 3AC3A 5AA8A 3ACJA 3OROA 5IQCA 2XF0A 5D10A 5LQFA 5EM5A 3PJ8A 1OL6A 4J1RA 3ZOSA 4X2KA 4BVUA 2WTKC 3Q53A 3C0IA 5FXSA 3KXXA 1WBWA 4IZAA 3EFJA 3DZQA 2Q0BA 4C4FA 3R71A 2RG5A 5D11A 3RAHA 3UG1A 4K0YA 1VEBA 4YJVA 3ZSHA 1J3HA 3PP1A 4PPAA 4RVTA 3QRKA 3BQRA 3E3PA 4O38A 5EH0A 5EW8A 2VTJA 5BMMA 4HZRA 4L46A 4ASEA 5HNBA 4MWIA 2OF4A 4UB7A 4F7SA 4PTEA 3NW6A 4N70A 4O7LA 4AN2A 2W1GA 5TT7A 4AT4A 1REKA 4LYNA 4FTMA 3A7JA 3JY0A 4KIKA 3GNIB 1YHVA 4LUEA 5B7VA 5CNNA 5LVOA 4FV1A 3EQHA 5ACBC 3R63A 4WBOA 4JXFA 3RAIA 3BCEA 3SXFA 3I81A 4W8DA 3BE2A 4K8AA 3PJ3A 2OG8A 2R3OA 4AZWA 4QTBA 3VUDA 5EDPA 3QUDA 5F94A 4ZK5A 3TKIA 3L8VA 1M52A 5AUTA 1ZLTA 2ITOA 4FV7A 4X7QA 2XJ1A 2XIRA 4XX9A 4BKZA 2P0CA 1UWHA 3LM0A 4RWJA 4RIYB 3R8PA 3W2RA 4A9RA 3DLSA 3RWPA 2ITUA 2UZOA 3KF4A 4FZAB 3O50A 3U54A 2C5VA 4GT5A 1GIHA 1CKIA 4BWPA 5IQHA 4HZSA 2CMWA 3GC8A 3DBFA 2PTKA 2ESMA 3AD5A 4I5MA 2JDTA 4LL5A 5AV4A 2G2IA 2QD9A 5HG9A 2BPMA 2DYLA 4P5ZA 2WQEA 3O0GA 2ZOQA 4PWNA 4YJOA 3VJOA 4AX8A 5M06A 4E6QA 4EHEA 2GHLA 1RDQE 4IM3A 3FV8A 3R7UA 4ZSJA 3NW5A 4TW9A 1OIUA 3PIYA 4O2ZA 4X21A 5H8EA 4CFMA 4ZLZA 5K9IA 2PUNA 3BQCA 3KU2A 3DV3A 2QQ7A 4DEBA 4FYNA 3FQEA 5IDNA 3K3JA 4I5HA 3HEGA 3QWKA 5J9LA 2JBOA 3FZPA 3IQ7A 3LCKA 4UWBA 3AC4A 3CP9A 3O51A 4CEGA 4R1YA 4GYGA 1J1BA 4C59A 1TKIA 3SRVB 5DT3A 3P5KA 3Q04A 2YEXA 4EOPA 2WOUA 4A4OA 5KMIA 3GU5A 3D0EA 2V7AA 2X2LA 5BYZA 3DDPA 4DEGA 5KO1A 4CMUA 4IX5A 5HCXA 4FGBA 3WF9A 4PDOA 1YOLA 4WUAA 4PMPA 4MH7A 4LV5A 2WEIA 5A4EA 3LXKA 2GNJA 3I6WA 3F88A 1OKWA 5EQYA 3FI4A 3UVRA 5IU2A 2FB8A 3OY1A 4FTCA 2HZ0A 5CNOA 4LQMA 3FPQA 5LVNA 2BFXA 5E9EA 4JIAA 3G33A 3G9LX 4ENYA 4BI0A 2R3KA 2GNLA 2RL5A 4G5JA 2OH4A 5BVFA 4CFXA 3NUUA 4R7BA 4W4YA 3EFLA 5EKNA 2V55A 2XJ0A 2G9XA 3RM7A 2F4JA 2WD1A 5L2IA 2W4KA 4I6QA 1GZOA 2XK8A 3D2KA 2W1FA 2C4GA 3NWWA 4UV0A 2BILB 5GJGA 3C13A 3MTLA 4AGDA 4MD9E 5CSVA 5K4IA 3FMJA 2W1EA 3DAEA 5FUTA 5BYLA 3F3UA 4FUYA 4YJUA 1PKGA 2GS2A 2H96A 2V7OA 4CRSA 4MNEA 4PRJA 5BVOA 1L3RE 1PMVA 4LM5A 4E3CA 1CMKE 5CT0A 3DPKA 3N4UA 3ORXA 4KIKB 4C2WA 3WE8A 2J0KA 3NYVA 4YBJA 1QL6A 4X0MA 3DOGA 3MPMA 3Q9WA 4O21A 3Q6UA 5HESA 2J90A 3HLLA 4IAAA 3OBJA 3FMNA 4R7HA 4JT3A 4MXAA 3R83A 3VUIA 2OFVA 5A4QA 1Q4LA 2ZYBA 3MJ2A 4V04A 4CMTA 2UW6A 4Q2AA 3H0ZA 4CFFA 3B8RA 3AGMA 3UYSA 4BDGA 1UNLA 1PXJA 3RHXA 5LWNA 3KRLA 1KE7A 3T3UA 3UIMA 5B2LA 3UQFA 4B6LA 4FMQA 4JDKA 4PY1A 3SOAA 4QP2A 3HVCA 2QC6A 4YZ9A 2OICA 4UWYA 2Y4PA 3QLFA 2UW3A 4W4VA 5C9CA 2QG5A 3NIEA 3NNXA 2R3HA 4KA3A 4EOKA 2PULA 5IQAA 2QODA 2F9GA 2WMQA 3I5NA 5CLPA 4FG9A 4AE6A 3EHAA 4H3PA 1JSTA 2Z7RA 3MVJA 3C0HA 2EB3A 4WNMA 5FD2A 3WI6A 2I0EA 1KUTA 5B2MA 4EHVA 4X3JA 3NSZA 5DPVA 5ACKA 4EOLA 2FSOX 4C3PA 4WA9A 2VTIA 4TY1A 2CCHA 3NEWA 5AAGA 4NM7A 2P55A 3NYOA 4MF0A 1YWNA 3VWAA 3FAAA 3L9LA 4AOIA 3U55A 4LI5A 2IW9A 5J1VA 3N51A 5ANKA 4E7WA 2YM4A 2F7ZE 5EW9A 4FZDB 3FKNA 3MB7A 5HTBA 2FYSA 3IK3A 4O84A 5EDQA 2DS1A 5E8VA 1STCE 4QP4A 4JG6A 4YTCA 4DH1A 3G15A 2X7GA 4QO9A 3TEIA 4E73A 4PL5A 3ET7A 4ANOA 4ZSLA 1KSWA 3L8PA 4ZTRA 4R3RA 4BWKA 2PWLA 4IVBA 4S31A 2HY81 3LKMA 3TCPA 1YDTE 3DKFA 4FIGA 4FKOA 4CV8A 5HE0A 2WMSA 2WQOA 4DC2A 5AUUA 4L68A 5HTCA 1FINA 5FDPA 4EYMA 3NNVA 2BRGA 3D5VA 4GG7A 4FK3A 5FTGA 5K5XA 2CKOA 3QZHA 1OIRA 5KBQA 3V5QA 1IEPA 4YTHA 2ONLC 4YMJA 5DR2A 4BHNA 1QPCA 2PSQA 2XNEA 4F1OA 3JVSA 3BHVA 3NNWA 2OGVA 1W0XC 4WKQA 3FSKA 3V6SA 5G1XA 4KBKA 4JAIA 3CS9A 4JL9A 3SV0A 3QQHA 2IVUA 3LXLA 3Q9YA 4PTCA 4QYYA 5F1ZA 5TE0A 5KUPA 1UU8A 2YM3A 3QF9A 2RFSA 1Y6AA 2BRNA 2GFCA 3DFAA 4I41A 2IZRA 5DMZA 2FSMX 4DEEA 1CDKA 1YI3A 2HXLA 4FTIA 2BAQA 4BIDA 5BVWA 5CU3A 4FV5A 4M69A 2GNFA 5FM2A 1AQ1A 2WIHA 2R3NA 3MTFA 4ASZA 1BMKA 4YO6A 1R3CA 3NVKI 5CAVA 3V3VA 2QOFA 3T9TA 4NL0A 3KQ7A 2Y6OA 3ZH8A 2UW9A 3I60A 4R5SA 4TYGA 4LGGA 5H9BA 5T3QA 2ZV2A 4FG8A 3CD8A 3MH1A 2GS7A 4HJOA 4Y72A 1ND4A 3R28A 4BI1A 2XMYA 3GU4A 2H6DA 1SYKA 2JIVA 2OFUA 2QOKA 4HGLA 4I6HA 1H1PA 4HPUE 5JRQA 2YCFA 4JBOA 3CXWA 1YXUA 3NNUA 5KMLA 4I22A 3VHKA 5GINE 2W7XA 3RNYA 2Z7QA 3UMXA 2X0GA 3FMDA 4E4MA 3E87A 5IA3A 2PZRA 4L45A 3QRTA 5E8TA 3VNTA 3OFMA 3CKWA 2C68A 3D7ZA 5LVPA 3MN3A 3EQRA 2XNNA 5IG1A 5KZIA 5J7HA 1U59A 3E63A 3QC4A 3F3VA 4CSVA 2JITA 2OIDA 3AG9A 4BYIA 5CENA 4LGDA 3PE1A 3OW4A 4RVMA 3UGCA 3TV4A 3A7IA 2J0IA 2A19B 2JAVA 4IX4A 2VV9A 3VS5A 5CS6A 3FMKA 1S9IA 3QRUA 4J99A 4NM3A 2J51A 3R9DA 3TV7A 1IA8A 2XKDA 4R3PA 4XRJA 1GJOA 4YTIA 1J1CA 3E8NA 3RK5A 4D1ZA 4U8ZA 4EUTA 2YZLA 2UW4A 3VIDA 3SGCA 3R1QA 2A0CX 4D55A 4K18A 3KEXA 2PE2A 2JBPA 2UZEA 4JAJA 3RP9A 4BCIA 3ANRA 4DLIA 5CXZA 5LOHA 4DG2E 4ZTHA 3C4CA 4UALA 5LMAA 1H07A 4F08A 3DLZA 2YLFA 1ZOEA 4EHGA 4MKCA 2X8DA 2Y7JA 4YC6A 2YM5A 3QZIA 3PA3A 4YJNA 5EKOA 2W1ZA 3RBWA 5JT2A 2CJMA 4BGGA 2W5BA 5A9UA 2JEDA 4RVKA 5HVYA 3VF8A 2WTVA 4E8AA 5K4JA 5L2TA 3VS4A 2C0OA 4YO4A 2CKPA 4R78A 5ANJA 4YU2A 4RX8A 3VW6A 4PDPA 2CGVA 4UY9A 3GQLA 5D7VA 1B39A 3FHRA 3UVPA 4U5JA 2C5NA 3CPBA 3ITZA 4L3JA 4AW0A 4EH8A 2IPXA 3FHIA 3FSFA 2VX0A 4KSQA 4P7EA 5C4LA 2R3IA 4QQ5A 1YRPA 3DTCA 3LCSA 4XG7A 4O27B 3TUDA 4PPBA 4GFOA 4AFJA 3EQIA 2WQNA 4RT7A 2XM8A 1FOTA 4XP0A 5JEBA 2PE1A 3AMAA 1OIYA 4I5PA 2VO0A 4RJ5A 4Y5HA 3E8EA 3KRXA 1OKYA 3LQ8A 2LAVA 4ZLOA 5BUIA 4TN6A 2XIKA 2ZV8A 3F3TA 5D12A 4ZTLA 3R7VA 3OG7A 4DN5A 4MXXA 4U3ZA 3KXNA 4MQ2A 2PUIA 3SRVA 3POOA 3MVMA 4GS6A 4GYIA 5HBEA 4FIIA 2O2UA 3M1SA 1G3NA 1OBGA 3MB6A 3QKMA 3ORNA 4Z3VA 2UZUE 5DOSA 4O0YA 3VBXA 4YGAA 3VUMA 5C26A 1OUKA 5M55A 4A06A 1HCKA 3N4TA 1HOWA 3MIYA 2WU7A 3D4QA
chains in the Genus database with same CATH superfamily
4A9UA 3E62A 1VYWA 2XIYA 3CE3A 4I0RA 2W1IA 1P4FA 5AUZA 4ZJIA 3ZRKA 3QKLA 2VN9A 5IA1A 3HMMA 2EXCX 3GXLA 3ROCA 4C4GA 3TWJA 5M44A 2BDFA 3M11A 4RGJA 3M2WA 5CF6A 3KK9A 3BLHA 5IEYA 2R5TA 4O4BB 2W9ZB 3ACKA 3QTRA 4KNBA 4Y5QA 3FYJX 4ZTMA 2ITXA 5CZHA 4XRLA 3PXKA 2JDSA 2CKEA 4JLCA 4CKRA 3VAPA 2HY0A 4NU1A 2BHEA 5F4NA 3EL7A 2C5YA 4BI2A 1FVRA 2VGOA 3PVUA 2O63A 5KHWA 4HGSA 5AA9A 3Q4UA 4OTFA 2FA2A 4EH4A 4AZTA 3PZEA 3D7TB 4MK0A 4EOSA 3I7BA 4MBJA 1Q62A 4HYSA 5HBHA 3GCVA 5AIRA 3BPRA 4IAYA 1U46A 5CASA 5CEPA 1I44A 4IB0A 1V1KA 4FOCA 5DNRA 4E93A 3II5A 5DRDA 3FLQA 3D7TA 5F20A 4J97A 4FV9A 3AD6A 3VO3A 1G8KA 1PXMA 1URWA 4YSMA 2X9EA 4IAKA 1Q8UA 4RFZA 1FMOE 5HIDA 4NT4A 3IDBA 4EORA 5E4HA 2QOLA 2W1CA 4QD6A 3PFYA 1YKRA 1KOBA 3WZJA 4FNZA 3QQJA 4IEBA 2XUUA 3OW3A 4HOKA 3MH3A 1MRYA 3QD3A 3WZUA 4AOTA 5I9ZA 4GEOA 2PY3A 4AZFA 3FKLA 3LFBA 2J0JA 3O96A 4RLKA 3DKCA 5IA2A 1QPEA 1A9UA 4FEQA 4AGUA 5LJJA 3EZVA 3EB0A 1PYXA 2C6DA 1UVRA 3C4ZA 3GCQA 3S2PA 2V0DA 3ZDUA 2R3JA 4OAVB 4IVDA 1IASA 4BBMA 4EOMA 3BU5A 2UW7A 4I24A 2YIRA 5GZAA 4CG9A 1O6LA 1Q3WA 2IZUA 2BIYA 4JI9A 4ZXTA 4EH2A 1Q8YA 1PXKA 2C30A 2A1AB 3A4PA 3FDNA 4XCUA 2ONLA 3W2CA 1A48A 2H8HA 4FICA 1QPJA 4K2RA 4U0IA 4F4PA 4KSPA 4R3CA 5CAPA 3HA8A 1V0OA 4O4CA 3FXWA 3WIKA 2V22A 3ORIA 4G6NA 3PIXA 5IDPA 3GB2A 4AAAA 4BDJA 3E92A 5JQ8A 3MFRA 5ETCA 3DQWA 4G31A 5FP5A 4CTBA 4RG0A 4L67A 4TYHA 4C3RA 3ORMA 3ID6C 5HCYA 1RE8A 4BIEA 5BUJA 3QXPA 3R1SA 3QZFA 4C7TA 1G8AA 4KD1A 5KBRA 3Q9XA 2E9VA 4YJTA 3OWPA 5EFQA 4KWPA 4J53A 2YDJA 3LE6A 3MH2A 3ODZX 2XK6A 5IA5A 2UVXA 3T9IA 4XMOA 1ZARA 4YZNA 4ORKA 1NY3A 2ZVAA 4FVQA 5IEXA 4BF2A 4XP3A 3V5LA 2OI4X 4IB5A 4TRLA 4A07A 4L7SA 4I21A 2GNIA 3W33A 4ZY6A 4TT7A 4QMSA 1H27A 1YQJA 2ZMDA 3AT2A 2VTOA 3FC1X 3K2LA 3ORLA 3R6XA 4QP3A 2ITYA 1E9HA 3P86A 5LCKA 4MX9A 1W82A 3RPOA 3HX4A 2XCKA 2JD5A 3UTOA 4O7TA 2IVTA 2XIZA 1NVRA 3ZZEA 1M14A 2VTAA 4DTBA 2A2AA 4O1OA 1Q99A 2HCKA 4FEXA 3TN8A 2WIPA 2C69A 3PSBA 1YW2A 3CGFA 3P7BA 4MEDA 3BU6A 4H3BA 3MYGA 3UNZA 2SRCA 3TJDA 3R8ZA 2CLQA 3MFSA 5GIOE 2YIYA 2C6MA 3AMYA 5ETFA 4JQ8A 4UMPA 5AR4A 5IH6A 3ZSIA 3A7GA 1NVQA 1NA7A 3K5UA 4EC8A 4HCTA 2ACXA 4PDYA 1XH4A 3FL5A 5EQEA 3SW4A 3ALOA 4RZVA 2HENA 3EL8A 4LOQA 5JZJA 2AYPA 5BV3A 1JLUE 1TQIA 3OXZA 4MD8E 1UU9A 3CQUA 2P2IA 2YERA 4IAZA 3NGAA 2OU7A 3DS6A 2IF8A 2VNYA 3LQ3A 3DB8A 3KMMA 4I93A 3TNQB 4GSBA 1CM8A 4ONAA 3KKVA 4O0TA 3PG3A 2R4BA 4X2FA 3LMIA 1OPLA 5AR2A 1ZY4A 5D1JA 5JSMA 2C3KA 2QR7A 2GTNA 2C3JA 4G3FA 5HLPA 4FZ6A 3R00A 3VJNA 5E8WA 3IOPA 3GU6A 1T46A 3GCPA 2HZIA 5IMEA 3OBGA 3DZOA 3ELJA 4IM0A 1OPKA 4MXCA 4RFYA 2VUWA 3EKKA 2PUPA 4JMQA 2GDOA 4AE9A 5AR5A 5AUWA 3QTXA 4C4IA 2PL0A 3PVBA 1FVVA 4FZFB 5FXQA 1JWHA 3ZXTA 2RSVA 5K3YA 3LHJA 2W5AA 4BCOA 2HZNA 4FKRA 5HNIX 1IR3A 5KMOA 4L3PA 4EK5A 5J9YA 1XH7A 4EOJA 4FGRA 3LIJA 1IAJA 5B0XA 2VWUA 2DUVA 1WBNA 3TM0A 4YJSA 4EKKA 2YWPA 3LVPA 2RKUA 5DIAA 2OW3A 3AMBA 2RFDA 3O8TA 4O0SA 5B2KA 1W84A 1YWVA 1S9JA 2BZIB 2Y0AA 3BHTA 4ZZOA 3EFKA 4A4LA 3PDTA 4PP7A 3C1XA 2YAAA 2X6DA 2BR1A 2R3PA 3C4WA 2YM7A 3COHA 4JR3A 4WD5A 4F09A 2BZKB 4FTKA 4U43A 2XBJA 3NCGA 3T8OA 4AXFA 1BL6A 3U6JA 4DTAA 4FKJA 3GI3A 2E2BA 4ASDA 3QGYA 5EQPA 3S00A 1T45A 3FZSA 3ZEPA 3BYVA 4AT5A 4QDEA 3W0MA 5AUYA 1JKKA 2GS6A 3BEGA 3IDPA 4BTFA 3TUBA 2B54A 2O8YA 2WFYA 3DGKA 2YIWA 4FV0A 4DG0E 1X8BA 5JFSA 4I92A 2QONA 2WMBA 3UODA 4ZZMA 3UBDA 3WARA 4AOJA 4AFEA 3QL8A 3F7WA 4RPVA 3VBTA 4F6SA 2H9VA 1APME 3GUBA 3PRFA 1KOAA 4FIEA 4BDEA 3D5WA 2VZ6A 3BV3A 3E8CA 3GU7A 4APCA 4IFCA 4JDIA 5JFXA 5HQ0A 5EYKA 1M7QA 4UXQA 3G0FA 5EG3A 3ORPA 2PPQA 3HMPA 4J8NA 1OL2A 3R04A 3GQIA 1P5EA 3EQGA 4FYOA 1P2AA 5LMKA 2GNHA 3LJ0A 2AUHA 4FSQA 5GZ9A 3TJCA 2PVFA 5DWRA 2I6LA 4F70A 2OZOA 4L8MA 4BCKA 2R0IA 5JGBA 3UE4A 3DNEA 1PXLA 2VTHA 3SG9A 3KRWA 1SVGA 4EC9A 3TMOA 1DI8A 4QMTA 4ANNA 4E5AX 1KE6A 5J87A 3C4EA 5AEPA 3HUCA 1Q24A 2OXYA 3V01A 3NW7A 5LMKC 5HG5A 4TKSA 4ZLYA 2YCQA 4JQEA 5GJDA 3UOKA 3QTZA 5BX0A 1YXVA 3TDVA 2WAJA 5AP6A 1ZZLA 2OJGA 1E1XA 2UZBA 5LVLA 4FKQA 5BYYA 4U9AA 2O65A 5HICA 3AKLA 3G0EA 4CCBA 2CN8A 4BICA 3LPBA 3LXPA 3MFUA 4L3LA 3W8LA 3SAYA 2FSLX 1YVJA 4DFZE 5EHOA 5JMSA 2GFSA 3Q5IA 4IDTA 4F99A 5BMSA 3PWYA 3U4UA 5BNJA 4FSMA 2RG6A 4UZDA 1LEWA 5K0XA 1H26A 3O8PA 2W17A 3FQSA 2ITNA 1OBDA 4C4JA 3OZ6A 2X8EA 1HCLA 1M17A 2YM6A 1FVTA 3FKOA 3UYTA 3H3CA 2ZM1A 2VTQA 4V0GB 3EQDA 3ORKA 3PPZA 2XNPA 3C50A 2X0PA 4FIJA 3HUBA 3LAUA 4FT0A 5E8YA 4CG8A 4RIYA 1WBTA 2IJMA 5E8SA 4D4YA 3FXXA 2YIXA 4FVPA 5HD4A 3R0TA 5A6NA 3GVUA 3EYGA 1XH8A 3DKGA 4XG6A 2CSNA 2Z8CA 4AA4A 3VONA 4RX9A 5CF4A 4RJ8A 3ENHA 3OHTA 3U87A 3GOKA 2X9FA 4XV1A 4XJ0A 4XG9A 3P1AA 1Y8GA 3P7CA 4WNOA 1W83A 5C4KA 4GIIA 4WHZA 3EQFA 5M07A 2YCRA 2B52A 2BZHB 4I4FA 4IJPA 3MA6A 3ZRMA 1OKZA 1TZDA 5AM6A 1J7IA 2Z7LA 1CSNA 4F9WA 3O17A 1BL7A 2XEYA 4DGMA 1OIQA 3QYZA 2ITTA 1ZMUA 4RWIA 3REPA 5M4UA 3F6XA 3HDMA 4EOIA 5AP1A 1WMKA 3KRJA 3SX9A 2XVDA 4GVAA 4I20A 1XH9A 4OGRA 3SQQA 1Z9XA 1JAMA 5EI8A 3AKJA 3ZM9A 5HOAA 4EQUA 4I0SA 2YIQA 2IEWA 2B55A 3DJ6A 4F1MA 4BZOA 3U8WA 4KABA 1R78A 3RI1A 5BVDA 5C01A 1IA9A 4YHFA 4HW7A 3HRCA 1K9AA 2XK4A 3PZHA 4EH7A 5T68A 3NFFB 5DEYA 2XRUA 4FIFA 3NMUF 3A61A 3DBCA 4GUEA 1PRYA 4Y85A 2J9MA 1ZYCA 4M8TA 5L8JA 3LFNA 5FEEA 4DHZA 4JIKA 3COKA 2PVRA 2WOTA 3Q96A 3ZO4A 3DB6A 1AGWA 3CTHA 2OKRA 4IBMA 4IZ5A 4A9SA 4TL0A 3KCKA 3JVRA 2X39A 4O4DA 3H4JA 5D41A 5H2UA 4M0YA 3VS0A 5HX6A 4IC7A 5DVRA 4XHKB 1Q8TA 2ETRA 4NCTC 4KS7A 1REJA 1CTPE 4O0WA 4F7NA 4EBVA 3JUHA 4D4VA 3R7EA 2R0UA 4DGNA 3ANQA 4ZTSA 3Q4CA 4GFMA 4NTSA 2IG7A 2WXVA 3MIAA 2WMXA 5M08A 4NH1A 4GJ2A 3SG8A 3PE2A 2DQ7X 4YPDA 2LGCA 1FMKA 4KAOA 3CQEA 3CCNA 2C1AA 2UZLA 5BQ0A 3VHEA 1PMEA 3P23A 1MQBA 3LFQA 2BHHA 2G1TA 4OBQA 3PVWA 3HV7A 3SW7A 4O0XA 3R1YA 3S1HA 3E93A 4QP7A 3QYWA 3KXZA 5FGKA 3RK9A 3HV5A 4AGWA 3ZBFA 4NSTA 3O5AA 3BLQA 4FR4A 4LGHA 3DY7A 3FY2A 3OUKA 2UW5A 3ALNA 3DQXA 3AGLA 5HZNA 2R3MA 5FM3A 4AZSA 4E4XA 1QPDA 5AR3A 2XBAA 3B8QA 3Q3BA 3S3IA 3HKOA 1XWSA 2I40A 4I3ZA 5CY3A 5IQFA 2BDJA 1R0EA 2QR8A 4NM5A 2QKWB 4S2ZA 4CT2A 3FLWA 3ZFYA 3HMIA 3WF8A 1K3AA 4DT9A 4Y46A 3U6HA 1SM2A 5EHLA 5I3OA 4AXEA 3TXOA 4Q5EA 4F6WA 1WVWA 4IWPA 1UKIA 5DA3A 2NYAA 4KKEA 4ARKA 5TF9A 3QCXA 1BX6A 3EWHA 1VR2A 3NPCA 3A60A 2YCSA 4QMYA 2XKCA 5HEZA 4AWIA 5ITAA 5JN2A 2CKQA 5EW3A 4O7WA 3SOCA 3KF7A 3G6HA 2I0YA 2ETMA 3I0QA 4AUAA 5D7AA 3ZLWA 2RFEA 4D9UA 5HE2A 1JKSA 4IWQA 3R30A 4H36A 4QPMA 1PY5A 3BI6A 3DFCB 4G6OA 4DGLC 1SNXA 3ULZA 4LDTA 3R2BA 3G90X 3N9XA 4GRBA 2I0HA 3BEAA 3DK7A 3KA0A 4C61A 4GH2A 4G3EA 5EYCA 4XLVA 1XKKA 3F9NA 3OCBA 4O4EA 4DG3E 4NIFB 4C2VA 4XUFA 1RW8A 4CZTA 5M09A 3V8SA 5T6KA 4ERKA 4DYMA 4U40A 1DAYA 2UZTA 2WU6A 2OLCA 3TNIA 5ICPA 3F2RA 4EI4A 4FKGA 2VAGA 1H00A 3C4FA 4YLLA 2P33A 1JSUA 2YWVA 3T3VA 2Y4IB 4O7VA 3R7GA 3UC4A 3ULIA 3Q2MA 4C35A 2PVJA 4XYFA 2IO6A 4JX3A 4ZZNA 3C5UA 3O8UA 4YC3A 5FDXA 4EYJA 2G01A 5J95A 4NKSA 3HP5A 4FJVA 2X2KA 3HL7A 4BDAA 4U42A 3VULA 3KVXA 4N6YA 3HGKA 3W2OA 2YJRA 1F5QA 1G8SA 5AMNA 4OTPA 3DCVA 5CTPA 4AA0A 5C8NA 4EZ3A 4O81A 4BRXA 4KRDA 3OP5A 3PLAE 4J7BA 2PUUA 5CEOA 3HRBA 4KIPA 5IH4A 1G8JA 3NIZA 5CU6A 3JXWA 4FTAA 4WT6A 4AN9A 3MGYA 2FUMA 2WMUA 5FBOA 3BU3A 3ZO2A 4APPA 2ZV9A 4C37A 4EJ7A 4XG2A 3ATTA 4XV2A 4FSZA 2QCSA 4QMMA 2VWIA 3LMGA 2XK7A 4PUZA 3OTUA 2PE0A 3PVGA 1H24A 2BVAA 3I0OA 1B38A 4YZCA 3ENMA 4RQKA 4F65A 3AT4A 5KX8A 3HAMA 4MHAA 4D2TA 2R7IA 4KINA 3F82A 2RF9A 3OMVA 1SVEA 4MXOA 4IZ7A 3LJ2A 4C33A 1BI8A 4OLIA 3BWFA 4FKTA 4J52A 2B7AA 3R7OA 5CALA 4ITHA 3Q52A 2J5FA 3E7VA 4IQ6A 3CIKA 2NP8A 5F9EA 1YHSA 4UBAA 4RIOA 3Q5ZA 3UMWA 3HAVA 1E1VA 2F2CB 4GIHA 1ZY5A 1TQMA 3QLGA 3DBQA 2QOQA 5HLWA 5I3RA 4XLIA 2CGXA 3D94A 4FV8A 3FEGA 2X8IA 4O83A 4C62A 4M12A 3KULB 1UWJA 2ITVA 2C6OA 3AD4A 2A4LA 5AV2A 1JKLA 3KXMA 3PFQA 1V0BA 3UDZA 4LOOA 3TNPC 5L6WL 4JDHA 3N4VA 5FXRA 4L44A 3UDTA 4MXZA 4TYEA 2OH0E 3NAYA 3V6RA 2Z60A 4GT4A 3TTJA 4WO5A 4E6AA 3PA5A 3MY5A 3KMWA 4RX7A 4YNEA 4BCQA 3LXNA 1Y57A 4IADA 3SDJA 4NIFA 4W8EA 5FTOA 4FTUA 3V8WA 3OF0A 2ZMCA 4A9TA 2X0OA 2C6EA 2VWZA 3PLSA 4TYHB 4D1XA 3CTJA 3NVMB 4BY9E 4QNYA 3OWJA 3Q6WA 5KNJA 2NPQA 2Y6MA 4EWHA 1KE5A 4X3FA 2OXXA 4NM0A 4PNIA 3W18A 2GHMA 4TPTA 4FODA 5FQDC 3F3ZA 4ITJA 1R39A 4AG8A 4RC4A 5CU4A 1YWRA 4LOPA 4AACA 4USEA 1H1SA 3BRBA 2WMWA 4HVSA 4FTLA 4OUCA 5DEWA 4RC2A 4G3DA 4CV9A 5C03A 4FBXA 4LRMA 4BCFA 5L2QA 4EH3A 5IA4A 3QCSA 3FJQE 1BKXA 1WFCA 4O0UA 4CKIA 3FPMA 4ZEGA 3BE9A 5CVFA 3AKKA 4TXCA 4UYNA 2BCJA 5C8KA 3RAKA 4U79A 3LW0A 5M57A 3IW8A 4XOZA 2XYUA 3VF9A 4DH8A 4WUNA 1ZOHA 3DA6A 4CNHA 3RALA 4KS8A 1XH5A 2E9NA 3RPRA 4M67A 3F3WA 4TWOA 4GK3A 3P4KA 4AZEA 1BI7A 2QNJA 1U54A 3FZRA 3NUPA 3MDYA 2YZAA 5HG8A 4HVHA 4LUDA 5H8GA 5FWKK 3OCTA 3MVLA 3LMHA 2ERZE 3R9NA 3OEFX 1JKTA 5A54A 4B7TA 3KXHA 2YITA 1ERKA 5ETIA 3VS3A 2OXDA 1W2FA 3LFSA 4ZY4A 3C7QA 3AC8A 3EIDA 3QC9A 5HKMA 5IQDA 3W0QA 3HNGA 2AC5A 2PZIA 3QBNA 3MV5A 4LMUA 2WTIA 3EN5A 3IW5A 4WSQA 3E64A 1WVYA 3QTWA 5HBJA 2EB2A 4Y95A 2JDOA 4Q9ZA 3ATSA 1ATPE 4N4SA 4ANLA 4XG8A 2R3RA 3F5XA 3LJ1A 3BX5A 3O23A 4E4NA 2Y8OA 3HMOA 2XAMA 3WF7A 2W1HA 1OPJA 3GC9A 4PL3A 5CAOA 3OOMA 1Y8YA 4JVGA 3LFAA 4FE2A 4UMRA 2IW6A 4L9IA 2C5XA 4QPSA 4P90A 4ZTQA 5CQWA 4V05A 5I9UA 4EH9A 1ST0A 2YHVA 2EU9A 3P0MA 3MY0A 2YA9A 4F6UA 3JR1A 4CZUA 4FNYA 2GQSA 5TO8A 4FSWA 1BLXA 4II5A 4QP9A 4CLIA 4E6DA 4PL4A 4J95A 3RAWA 1YI4A 1XHAA 2X2MA 2B9JA 3AXWA 3R8MA 4X3FC 4L43A 4L52A 3RTPA 4B9DA 4P2KA 4K33A 1QMZA 4HGTA 3C9WA 3VUTA 4EQMA 3QU0A 5KKRB 4IHPA 3CY2A 4CQEA 2XIXA 2XYNA 2NRUA 4G16A 2BAJA 4AF3A 4M13A 3SLSA 1SMHA 3VQHA 4BKYA 2R3GA 4QMZA 2JKOA 4ACMA 4XH6A 4KKHA 5I9VA 5IEVA 5CEQA 4O2PA 3C5IA 1PJKA 4C38A 2VTTA 4ALUA 4LG4A 3FLSA 1MQ4A 4MNEB 3P7AA 4XP2A 2I1MA 3L1SA 4RJ7A 3TYKA 4CFUA 4EH5A 5HLNA 2WTDA 2G2FA 3I1AA 3G9NA 3ETAA 4I0TA 5IPJA 2IZTA 3EQPA 5M51A 2F49A 3FC2A 3E88A 2PHKA 3MI9A 1DI9A 5A3XA 3UG2A 5A4CA 4X2JA 3A7HA 4KIOA 4IAFA 2WPAA 5C8MA 4F9CA 5I5ZA 4BYJA 1OB3A 2ZJWA 3DJ7A 5DFPA 3WOWA 4Z7GA 3WILA 4HPTE 2PK9A 4OTQA 5AP3A 3MH0A 5DLSA 4BCJA 2UZVA 2VWVA 5KZ0A 3UZPA 2UZNA 4PMTA 1ZZ2A 3PXQA 4FSTA 5A6OA 3OC1A 4AXCA 2REIA 4W9XA 4XV9A 3KULA 1GAGA 4YBKA 3W0PA 3QX4A 2WZJA 3NX8A 3HV3A 4OAUC 3QKKA 3OTVA 4G1WA 1Y91A 2W06A 3EKNA 3R8VA 3QA0A 2ZM3A 3UOLA 4G3CA 3RCDA 3KCFA 4KUJA 3NRMA 4FEVA 1A06A 4NJDA 5BUEA 4MXYA 4H39A 3OWLA 5IA0A 4EJNA 2OIBA 3EQCA 2XNGA 2ZB0A 1FQ1B 2R9SA 1FGIA 3GCSA 4CQGA 2X7OA 3IECA 4IX3A 4O6LA 4G9RA 4HCUA 4L01A 4R6VA 5CVHA 4QP8A 1Q8ZA 4GK4A 4BR3A 5CF8A 2HELA 4FKLA 2JIIA 4FX3A 4I5CA 3BV2A 4IMYA 2YDKA 4EL9A 4RWLA 3CJGA 3UNJA 1GIIA 2JIUA 3PJ1A 2YJSA 4QYEA 4QQJA 3I5ZA 5H3QA 1H01A 1RJBA 1F0QA 1IG1A 5E1SA 5FEQA 4D1SA 3CSVA 4C0TA 5GIPE 4KKGA 4IVAA 5FRIA 4TYIA 2PVNA 1WCCA 4JBVA 5DH3A 4IXPA 1MRVA 4D2RA 4F7JA 2O0UA 4ACGA 4RIXA 4YSJA 3AC5A 3NCZA 3UIBA 5ETAA 4ASXA 5AFVA 5E8XA 1DM2A 3TTIA 4ZJJA 4O7NA 2BALA 1OECA 1Z5MA 3FZOA 3NAXA 5M4IA 1UU3A 5FBNC 2EVAA 4BCPA 5CEKA 4ANMA 5GNKA 4N57A 5BVEA 2GCDA 1VYZA 2XKEA 2P2HA 5JGAA 2KTYA 2JAMA 4U7ZA 5J79A 1PXIA 2VGPA 3B2WA 3CBLA 4NW5A 1SNUA 2HW7A 1O6YA 5HU9A 4QYHA 1XMMA 4WRGA 4L00A 2PZ5A 4U81A 2IVVA 5AP7A 2R3LA 1O6KA 3F66A 4M69B 3SD0A 4OTDA 4O91A 4FK6A 1R1WA 4RIXB 4BTKA 1OKVA 3FL4A 4XEYA 5JZNA 4B8LA 4M97A 4PNKA 3ZCLA 3LFCA 3D5UA 4AU8A 4QMOA 4JBPA 3ZLXA 5DN3A 3NR9A 3ZUUA 4BWXA 2UZDA 2BROA 3CJFA 4JOAA 5LVMA 2W99B 4ZSEA 5IUIA 3VBVA 4TNDA 3HP2A 3G5DA 4QTCA 5JH6A 3ZFXA 2B9IA 3MSSA 4WRSA 4AQCA 5M56A 4FL3A 1Y6BA 4BKJA 1XBCA 3H9RA 4FNXA 2EXEA 3THBA 3UJGA 4X2NA 3UP2A 3ZS5A 3UO5A 2BUJA 5FTQA 4CMOA 4EONA 3AC2A 4E1ZA 3OXIA 4MTAA 3BKBA 4JG8A 4JS8A 5TKDA 3WF5A 4AGCA 3A8XA 3FMLA 3FLYA 4FTJA 3S95A 4BFMA 4C3FA 4DFLA 4FV4A 4U3YA 5FP6A 1W8CA 4O0RA 1XJDA 4RJ3A 5AWMA 3EN7A 5HHWA 4RWKA 4RSSA 3QUEA 4X2GA 5AP4A 4I6BA 3L8XA 4G6LA 4D4RA 4FV3A 4QQCA 4FTOA 4F9YA 2G15A 4QNAA 5CF5A 1H28A 3EN9A 3LCOA 5J5TA 1OVEA 3C51A 3R73A 4AS0A 5EDRA 3SVVA 4DTKA 4E20A 2OSCA 3LQ5A 5IQEA 3PSCA 5AJQA 4ZMFA 3QD0A 3W16A 4O7ZA 3A2CA 4KBAA 2DWBA 2NRYA 3HRFA 4OTWA 4IZYA 1LPUA 2WGJA 3ZTXA 5IKWA 4G34A 4EOOA 3C0GA 5F95A 3GP0A 3F61A 2VTRA 3PJCA 4EK3A 2I7QA 4EBWA 3ZUVA 5DR6A 5EHYA 3TT0A 3TZ7A 2B1PA 3EZRA 4IW0A 1UU7A 4RFMA 5JKGA 2OJIA 2J0LA 3MY1A 1UKHA 2R7BA 4HYIA 3TKUA 3UIXA 4NKAA 4MUQA 2QLUA 2C6LA 3KB7A 4QP1A 3F7ZA 4IH8A 2BMCA 3UOJA 4D2PA 3R7YA 4FVRA 4IACA 3OD6X 4DEAA 4B99A 3W1FA 5AP0A 2GPHA 1JNKA 4D5HA 3PWDA 2BRHA 4L7FA 4MVFA 3TZ8A 4YJRA 5AR8A 3NLBA 5AV3A 2B9FA 4QP6A 1OUYA 3W0NA 4PF4A 3ORZA 4WNKA 4Z55A 4FOBA 4A4XA 2HYYA 4QTAA 2CN5A 4RVLA 2JFMA 4Z7HA 1M2QA 3FUPA 4YHJA 3RCJA 3RPVA 4BDCA 3EN6A 2ZFYA 3W0RA 5H8BA 4BHZA 3NYNA 5E8UA 5L3AA 5EOLA 4WNPA 3BHUA 2PVYA 4M66A 3UZTA 4WG4A 1H08A 4F0FA 4ALWA 2WEVA 2WTKB 4FG7A 2GU8A 1OM1A 4DE4A 1KE8A 5DGZA 1H1WA 4DINA 4XG3A 4IB3A 4YC8A 3JY9A 4O7YA 1P4OA 3GEQA 4S34A 2HZ4A 3HA6A 3AOXA 4QMVA 4P5QA 3PXRA 2PMIA 3H30A 2B9HA 4N6ZA 2YN8A 2UUEA 5E91A 4RMZA 4BZNA 1XBBA 5CVGA 1H8FA 1OL7A 2ITZA 2HIWA 2OK1A 4FRFA 3DBDA 1B6CB 3R8UA 4MYGA 3FWQA 3RVGA 5HO7A 3TACA 2OBJA 2OF2A 5HVKA 4DF3A 3KN5A 5GZ8A 1WVXA 1OL1A 4F0IA 1K2PA 3TNWA 3UQGA 3WBLA 2WTCA 3FE3A 3VRYA 4HVIA 1H25A 2VO7A 3IS5A 4MBIA 3QD4A 5K5NA 1Q61A 3I79A 3PIZA 2WMVA 3CGOA 2VU3A 2ZM4A 3PSDA 1GNGA 4HGEA 4JBQA 4NUSA 4Z9LA 3DK3A 3RPSA 4CYJA 5L6PA 5LARA 3FBVA 4P4CA 4MCVA 3Q32A 4J8MA 4V0GA 3H10A 2JLDA 5EM6A 1Q41A 4QMLA 5CI7A 5GJFA 3RHKA 2X6EA 3VUHA 1NT2A 2WNTA 3FZ1A 1W2DA 4OTGA 2J0MB 4F9BA 2CPKE 2J2IB 2XNBA 3KY2A 3QQKA 4FKWA 4Q9SA 3F2NA 4UZHA 2VRXA 4RC3A 3Q4ZA 2GNGA 3RM6A 5AUXA 2ZAZA 2E9UA 1W7HA 4DH7A 4MAOA 3SKCA 4E26A 2XA4A 2X7FA 3ZO3A 4BDDA 3EQBA 1RQQA 4B4LA 5AAEA 2OJFE 4EK4A 2C47A 2ZDUA 2HK5A 4AN3A 3MVHA 4FV6A 4HYHA 3PPJA 4HYUA 4DHFA 4BBEA 3TIYA 2E9PA 2OJJA 4ZS0A 2VTPA 4DEDA 4FSYA 3ZHPC 4UN0C 1MUOA 2XRWA 4G3GA 1JOWB 4BTJA 5KCVA 2XAOA 4F0GA 1YXTA 3V5TA 2Y4IC 2XNOA 3GC0A 3WF6A 4BC6A 3IW7A 1ZXEA 4PTGA 4DBXA 4I94A 2JFLA 2HAKA 4FIHA 4IM2A 3FXZA 2B0QA 4TWCA 4ANQA 5HOR