The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
120
|
sequence length |
339
|
structure length |
339
|
Chain Sequence |
MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETKDFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALESYIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQKTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFELINKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASNLKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Insights Into the Structure and Assembly of the Bacillus Subtilis Clamp-Loader Complex and its Interaction with the Replicative Helicase.
pubmed doi rcsb |
molecule keywords |
DELTA
|
molecule tags |
Hydrolase
|
source organism |
Bacillus subtilis
|
total genus |
120
|
structure length |
339
|
sequence length |
339
|
ec nomenclature |
ec
2.7.7.7: DNA-directed DNA polymerase. |
pdb deposition date | 2012-12-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF06144 | DNA_pol3_delta | DNA polymerase III, delta subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | Helicase, Ruva Protein; domain 3 | ||
Mainly Alpha | Up-down Bundle | Zinc Finger, Delta Prime; domain 3 | Zinc Finger, Delta Prime; domain 3 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |