3ZH9B

Bacillus subtilis dna clamp loader delta protein (yqen)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
339
Chain Sequence
b'MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETKDFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALESYIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQKTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFELINKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASNLKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA
publication title Insights Into the Structure and Assembly of the Bacillus Subtilis Clamp-Loader Complex and its Interaction with the Replicative Helicase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 339
sequence length 339
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06144 DNA_pol3_delta DNA polymerase III, delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zh9B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3zh9B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zh9B01
1E94E 1A2BA 4QHYA 1G5TA 3OEHA 3D8BA 3WHKA 1T91A 4HYYA 1HT1E 4I1OA 3LXRA 5M04A 1RJ9A 4EQ6A 3DL0A 4XSHA 1G7RA 1BYUA 1FW6A 1N6NA 1Q3TA 3SR0A 2V7QA 3NBXX 4LSGA 1G20E 2HT1A 5LD2C 3VKHA 1JAHA 3AF0A 3EIEA 4E03A 3R8CA 5KPDA 5J47A 1P9RA 1XBTA 3H1TA 4BFVA 1U81A 1QVRA 4JLJA 2P5TB 1NBMD 4JSYA 4K46A 2EWWA 3ZIAA 3Q3JB 3CR7A 3EZFA 4LJYA 5CDFA 2ZETA 3THYB 4GOXA 3B1XA 2IF0A 2L0XA 3RRZA 5L3SA 4F7WA 3GLGA 1KI8A 5CIWA 5FI1B 3K0SA 1E69A 1TF5A 4DUGA 4UXIA 1G7TA 2V1XA 3U44A 4NP6A 2WWWA 3PEYA 1RRPA 2D74A 1X86B 3B78A 1FQKA 2KSQA 4DLZA 1UJ2A 2JLXA 4JS0A 4DLTA 4IHQA 2J45A 1XTQA 3C7KA 4BGDA 3GLHB 3F0TA 2ODBA 1E32A 4DDWA 2LKCA 3C4JA 4B2IA 3TGPA 4Q1DA 4EKDA 3I32A 1XD2A 3LVQE 2BJWA 2YOGA 4KU4A 2PCLA 3EAQA 2JA1A 4EUNA 3LWNA 2FPKA 5KDLA 4OI1A 1SKQA 1FMJA 2QTHA 1HE1C 2A5JA 1DAHA 2ZRLA 2ZSBA 4JL5A 3V00A 3H0KA 4HLCA 4PO1A 1ZNZA 1LW7A 2RGBA 3MJRA 1C1KA 4AYXA 4OYHA 3PEUA 121PA 1W4AA 2V1UA 2WKRA 3ADKA 5G53C 1L4UA 4XVUA 4OI4A 2VP2A 4ERNA 1YZNA 1Q44A 3DKVA 3TUIC 2QW6A 3LQQA 5HCIA 4D4JA 2ZJ5A 1EGAA 5TARA 4DDUA 1PUJA 4BEBA 2R9GA 1F5NA 4OI2A 3K09A 3KKPA 4DLSA 3KKNA 2C2HA 2Y8EA 1G5PA 4URXR 2X19A 5IF9A 2ZYUX 4QL3A 1XXHB 5IT5A 1XPRA 5FBRB 4G1UC 2WSSA 1OYYA 2GBLC 2YWHA 4LBVA 3V4FA 5CB6A 2JASA 4GZMA 2RGGA 2YWFA 4P3YA 5FPSA 4W9MC 1P61B 4BFYA 5CLLA 1ZUNB 1X37A 1Z0KA 1NIJA 1G19A 4C9BA 4MQBA 5JS8A 3KQNA 1H65A 3DHWC 5EE9A 4FWHA 3THXA 2EYUA 1QF9A 2P67A 3B7GA 1S9DA 1NN3A 3QF4B 4LHWA 4FCWA 1U0JA 4D80A 1DO2A 5ANRB 4RCZA 5K8UA 1VHLA 1UEJA 2QTFA 2JLVA 3TQCA 2V3CC 4HZUA 4P4UA 1OT3A 3EZ2A 3O8DA 3U3RA 4LJ8A 1QBKC 2IYYA 5G3ZA 1FUUA 2AWNA 2BM1A 3QPUA 5DI3A 3K1JA 2Q6TA 5FL3A 3VR4A 2GJKA 2F43B 1Q3HA 2IX3A 4C7OA 4M1SA 4BUJA 5AK0A 4BFZA 2WWXA 5EXPA 4LI0A 5CYOA 1NG1A 4B43A 5EE1A 4M1WA 1OF1A 2FGJA 2VF8A 2NG1A 2IYXA 4IFBA 3RAPR 2XTNA 3FOZA 2YWEA 1NI3A 2QRNA 3VR1A 4C2TA 2IL1A 2IXEA 2V9PA 1G6HA 1Z63A 1T9HA 3KKOA 3OAAA 1OFIA 4XVQA 3GP8A 2OFWA 2O5VA 4EJSC 4QRHA 3K9GA 3L8ZA 2A30A 1FOEB 3OE7D 2BKEA 1Z0JA 1DOAA 1KSHA 2JAQA 4WBSA 5DHFA 2O8DB 1S3SA 2IS1A 4MGZR 4KHZA 2WAYA 4UKDA 1G8GA 5H1YA 3SZRA 2C8VA 2HYDA 2GJSA 2J5XA 4JSTA 1R4AA 3RS2A 3I5XA 4G0NA 1GG2A 3IQWA 3BB4A 3X1YA 1YR9A 2A5DA 1O87A 1GDDA 3I5YA 5DYGA 3HWSA 1F60A 1VTKA 1IXZA 3IBGA 1Q0UA 5TB5A 1KK3A 1U0HC 2BBTA 4DLXA 2JIZD 5J4VA 2O8EA 4HAZA 5JI2E 2QAGA 4PQYA 2ZSAA 4E22A 4MYTA 1OB5A 4HUTA 4XSGA 2VP6A 2RKOA 1PJRA 2XNDD 3GFTA 4DZZA 2ZRFA 3B1ZA 1S96A 2PMKA 5KSZA 1OIVA 4O2LA 3PITA 2QMEA 3CLVA 3TE6A 3EPHA 1G8PA 1IN8A 3QKRB 2WM9B 3B5JA 3N5CA 4ARZB 1R5BA 2W6JD 721PA 2CCGA 4URYR 4K8OA 5FBQB 4KCGA 2RGEA 3NBFA 5FBLB 1GRQA 3RSOA 4TMTA 2YJTD 3CM0A 3QUSA 4JT2A 4JVMA 1WCV1 2JLYA 1ZP6A 2GAAA 5LB2A 4QJ4A 4BLQA 1GM5A 5CYPA 4OQFA 2V6ZM 4LHXA 3THYA 1AKEA 4EAQA 2RB4A 4CGZA 1OV4A 1FX0B 1H8HA 1KI2A 2IBMA 5L8VA 4V0MA 2D06A 3DOFA 5IDVA 3E70C 5JJIA 1Z6YA 3SE0A 1Q20A 1E0AA 1QHSA 1QHXA 3SBDA 4DCSA 3IGFA 2QE7A 1E2HA 4QHSA 1CLUA 3Q5DA 3R9IA 2FNAA 1N25A 1IY2A 2ZRCA 3C8UA 4LWZA 4S2EA 3R7WA 3WNCA 4KLNA 1RYHA 3B2EA 3GLHA 4C0AC 2BMFA 4MGYR 1RRCA 1KDTA 2E9SA 4BRUA 5F9FA 3X1ZA 1E2PA 1JBKA 1X8JA 2VYFA 4PSVA 5D3MB 3TIFA 1C9KA 1MO6A 2YZ2A 2BMJA 1OHHA 1Z6TA 2HCJB 3EIHA 2FN4A 4EPXA 1M6NA 1W0JA 2IS2A 3VX3A 2W2TA 3QBTA 3SOPA 1HQYE 4FMDB 3OFNA 3I4LA 5JECA 1HE8B 2DB3A 4P0TA 2G9NA 1KAOA 3PUVA 3TR0A 1MT0A 4WA7A 2WPDA 1NSFA 2C04A 3MLEA 4Q1EA 5FTMA 3T06B 4ACBA 3U3OA 1NLZA 1NMXA 4MKHA 1SXJD 2CNWA 3LBNA 2WJIA 2VHQA 2J41A 3HR7A 1NIPA 2ORWA 1G64A 5FOXA 4I4LA 2JJ1A 3CRRA 5B57C 2YKGA 3RS3A 3A4MA 3CZPA 2NTYC 2JLZA 1ZU5A 2ZUCA 1XXHA 5LBIA 1O3YA 2ANCA 3MGCA 4CVNA 2EFCB 2NO0A 2IUSA 4EPTA 3IHWA 1R2QA 2FSGA 4ASUA 4CF7A 1YVDA 2WJJA 4KFUA 1W44A 5HPYB 2FFQA 3BH0A 4HEJA 1W47A 2OLJA 1UFQA 2CLCX 1IOZA 1AK2A 1N5IA 3QF4A 4MRVA 1AQUA 1BMFD 1ODFA 3FVQA 4GFDA 3CB4A 4RD3A 4TMVA 3KUDA 4F93B 2ZANA 4AKGA 3L0SA 2W0MA 1M2OB 2REBA 4Y0AA 3FHCB 1LS6A 2WMOB 2OE2A 2YNMA 1DVRA 1J70A 2ZS8A 1GKUB 5FOVA 4G5RA 2A5GA 3L43A 2C95A 4M53A 1KDPA 1NVMA 4DXAA 2P6RA 1VHTA 4PQRA 1E9CA 4ILEA 3MD0A 4NCIA 2IS4A 2KRKA 1LS1A 2DY1A 2F43A 5FBVB 4JVNA 3K70C 4BLRA 2VHTA 2NMVA 2JDIA 1M8PA 2B92A 4QKQA 4GBMA 2RMKA 4XOIA 4MRPA 1RYFA 4F4JA 4F4IA 3PR1A 1Q12A 1SVWA 1W4BA 4AIIA 4D0NA 1I4LD 1Z5ZA 3DVLA 2AWOA 3ZVMA 1VDZA 3OESA 4KV9A 2FG5A 2FJUA 1G7CA 4NL4H 4G5GA 1NKSA 4HLQB 3I8SA 2O8DA 2AK2A 4Q9JA 3UANA 5FTJA 3KQKA 4UJ3A 4Q5IA 2FPLA 1UBEA 3CTDA 3PVSA 4I99A 4BFTA 4HB0A 3AVUA 2WMNB 2F55A 2Q0HA 2B7BA 1JR3A 2OCPA 3DMNA 2CCJA 1ZCAA 4FCTA 1QG2A 2C99A 3W90A 3CZQA 1KAGA 3AVPA 1E96A 4L9WA 4Q4JB 3OIWA 4UXJA 3T1QA 1N0UA 1OIXA 4LOAA 3EWAA 3TBKA 1KDOA 1XD8A 1NVVR 1Z6XA 3P32A 4Z1MA 4Q4HA 1US8B 4LBYA 1LF5A 2N1BA 1F48A 3I62A 3MWKA 3TQFA 4YC7A 4BFSA 3SQXA 1U9IA 3FFBA 1E79A 3TSOA 5J4YA 4ARZA 1G4AE 2G1KA 3KB1A 2B6HA 2VP4A 4KFTA 3PJRA 5TVKA 2ZYVX 4FD2A 3FGNA 3Q72A 3UG7A 1CS4C 3WXMA 4TZ6A 4TT3D 4AWXA 1X1RA 2FX3A 1YZKA 4W5HA 1FFHA 1LF0A 2KWIA 3L2OB 2ZI6A 3SC3A 1QHGA 2X1VA 4LRWA 2ZR0A 5FOUA 4AK9A 4LDJA 4B2PA 1G41A 2JJ8A 2WSMA 4ABYA 2ORVA 3Q7PA 5TXGA 4DIEA 3QXHA 3GJ3A 2GRJA 2CDNA 4BFUA 1GRNA 1WRBA 1R7RA 1XEXB 4QGHA 3I8XA 1Q1QA 2OAP1 3LO5A 1FX0A 3MSXA 1FPMA 2C78A 3K0CC 4Q1CA 3CWQA 5EE5B 5B58C 3WYFA 3QBVA 3VAAA 2ZS7A 2QAJA 4KSBA 3SU8A 2BBSA 2DFTA 4JYCA 1XPUA 4MRNA 1VCMA 1AM4D 4TLBA 1MABB 2EFGA 3TAHA 2CCKA 3RWMB 2EYQA 4C0SA 2DWPA 4G5OA 1OH7A 3I73A 5JRZA 5AJWA 4OKSA 3UMSA 5KNBA 4AG5A 1PV4A 2QP4A 1YZGA 4MGIR 4PQFA 5D3MA 4M8NE 3U3MA 3PUYA 4UNRA 1E0KA 1KJYA 3QY0A 3REFA 1P75A 4Q9LA 3ADBA 1XTKA 4OQLA 4IOMA 5C4GB 2BMEA 1S0UA 2GTPA 1OIWA 3GQBA 2QN6A 2FFBA 1K5DA 5CDFE 1VYVA 2P6UA 2REXB 4YXWA 5DN6D 1U0LA 3SJZA 4GSYA 3QE0A 2WJYA 3AF2A 3GJ6A 4AYWA 2QORA 5TY0A 3ZDQA 4WIAA 1A82A 1UF9A 3Q85A 1D8TA 3UK6A 2F3TA 1E9BA 5K8LA 5HZKA 1IJEA 3MWYW 1T5LA 4B3BA 2PL3A 3UATA 4JL8A 1FQJA 3QQ5A 1N5JA 4GL2A 3NC1C 2ECKA 1KO4A 1UBCA 3IBYA 2H5EA 2UVQA 5JJKA 3CPJB 2OSBA 1UEIA 4LC0A 3HR8A 3IPYA 4LX0A 4LHZA 2V8OA 3T1OA 2BOVA 2W58A 3RSLA 1SKYB 5CLQA 1NMZA 5AUNB 3FMFA 4LHYA 2NZ8A 5EP2A 4YLGA 1KKLA 4L15A 4HAWA 4B73A 2ZJZA 2WBLC 5B64A 3A37A 1F2UB 1Z29A 4DLRA 4Q1FA 1IXSB 4V02A 5JS7A 5FTNA 1CP2A 2IYRA 2ORIA 3MJHA 4ESVA 1TNDA 1JB1A 1YZTA 3N2IA 3AQ4A 2AKYA 5FI0B 5KHOC 1TQ2A 1VYUA 2A5YB 1XB2A 2R6CA 3L82B 4N3NA 1JXMA 1MRNA 1Z0FA 1IHUA 2PX3A 4HDOB 4LJ6A 1ZUIA 1VECA 2F1IA 2ZJAA 4YONB 3VNVA 1V43A 2OV2A 4TYWA 4RD6A 3IDQA 3IKJA 4HB3A 3AVTA 3W5IA 2LWIA 4FMCB 1D2NA 1DAMA 1XJCA 3BWDD 3HPRA 4DDVA 3GJ0A 1NN0A 4ZDWA 1IN7A 1YHNA 1RE0A 4B3FX 5KNCA 3BD9A 1IONA 2GZDA 4HB2A 3KXKA 3TMKA 3UMRA 1E3MA 1VIYA 3EARA 4IXNA 4PTLA 3CF0A 4WXRA 2F7SA 2NZJA 2PT7A 3QNUA 5DNYB 2A2ZA 2W0SA 2P3SA 1IY1A 4Z51A 3A1VA 4XH9B 1E2LA 4PSAA 4NPHA 4BWYA 4DSTA 2R6GA 5CK5A 2ZRNA 4EFNA 1VCIA 1RC8A 1YR8A 3E5HA 2A3RA 3H84A 4XWOA 4IDNA 4MITA 3K70D 4C4PA 3CNNA 1R0XA 3KXLA 4ESHA 2QP9X 3ZZUA 4EJSB 2RGCA 1UKYA 1KSFX 1W48A 4DLUA 4GOJA 2VF7A 3NKVA 3B60A 2ZRAA 3HU2A 2QI9C 2PEYA 1YR7A 2KE5A 2XNDA 1UKZA 3B82A 5BYJA 4Q4JA 2HV8A 3THXB 2NGRA 5HZHA 1US8A 1E2DA 4GT1A 3RC8A 2JLSA 3Q8XB 3AF1A 4PZYA 1KGDA 3LLUA 4LYFA 4E5UA 2ZJBA 2NPFA 4MYUA 4B32A 3KL4A 4MRSA 4IDOA 1GNPA 2IK8A 4I1SA 3K9LA 1WBDA 1KNXA 4R9UC 4X8OA 4DHEA 2AD5A 3AUXA 3ZQJA 1AKYA 4DWJA 1R8SA 2CVHA 4IEEA 5EZ5A 5E7JA 1CXZA 3MCAA 4TLCA 1SULA 4KFSA 1YQTA 4WZBE 1U94A 3UWKA 4CRWB 4C7OB 4B35A 5J4HA 4M21A 1XEXA 1EFHA 1ETUA 4FWIB 3X1DA 1D5CA 2BM0A 3U6BA 5KNDA 3AV0B 3O47A 3P1JA 4C0KA 2X8AA 2ZYWX 2WV9A 3SNHA 3ZVNA 2RGNC 4HAVA 2QSZA 2XXAA 1Z08A 4A0HA 1W7AA 2ZRPA 4PPQA 3QEOA 3H86A 1XRJA 4FCVA 1MABA 1SVIA 1E2MA 1QZMA 1W46A 2ZIAA 4YMVA 2Z4RA 1UKVY 2FU5C 3S1AB 4KO8A 4QFMA 1RRFA 1G17A 3HU3A 4KLZA 1VG0B 4NZYA 2ODWA 2QTVB 3DO6A 1VKJA 3TJZA 2ZUDA 3CNLA 2CK3A 5B30A 1MH1A 1W2GA 4PPFA 3U60B 4TWZA 3KQHA 3TH5A 4A15A 4D4LA 4K81B 1COWD 4KAXA 4CEHB 5SZKB 5C18A 4A8JB 4G3XA 2R6FA 3ZQ6A 4D25A 1E2QA 2XTMA 1G7SA 5A4JA 2ZROA 4V0ME 3UPUA 3R9WA 4A92A 6Q21A 4WZ6A 2QY9A 1P73A 2JJ2D 3IEVA 3M6AA 5GJWC 3AH8A 3VU9B 4Q9KA 3OIYA 3T12A 2C9CA 5KU1A 1E99A 1FNMA 5GVRA 3FMIA 4RD4A 3GLHE 1E4VA 3PENA 2FE4A 2Q9AA 4NONA 4D6PA 1VPLA 4AG6A 3BORA 1UAAA 3SS8A 1DAEA 3B85A 1N6HA 1W49A 4ZDIA 2UKDA 5TV2A 2WZQA 3LA6A 5IHPA 3PCRB 5G40A 2OCYC 4WXPA 4TYNA 1YRAA 1D9XA 4DLVA 3BH7A 1BOFA 3EC2A 3ZLJA 5EXXA 2HXYA 2ZAOA 2IW3A 1E2EA 4NE2A 3WBJA 1F2UA 1NJFA 2GBLA 5DO9A 4M0LA 3PIRA 1U2RA 3KTAB 2ZE5A 1ZMXA 1Z0DA 4UXHA 5CIQA 1I2DA 2PJRA 5DI9A 4AKIA 4PZLA 2O0HA 4P4TA 3R7WB 2VBCA 2REOA 2QRZA 2JCSA 3SFVA 1SXJC 4Q47A 1IN5A 3MAAC 2BKUA 2X2EA 4XVRA 1AGRA 1P6XA 2DYKA 4FWTA 3QKUA 4RKEA 4LCBA 1XXHE 1UM8A 1XTJA 4F92B 4QC2A 1XD9A 3BJIC 1F2TB 2GVZC 1YKSA 5GADl 2GXUA 2RCNA 2IHBA 1GKIA 2V6IA 5L3RA 1HQCA 1CBUA 2PEZA 4C0HA 2R6AA 1EFCA 2HJVA 3W6NA 2ZPTX 5FL7A 1CF4A 1T3SA 2YINC 3P4YA 3DM5A 1CEEA 3KFVA 1KI1A 3K70B 2W2VA 3TVDA 3K0EA 3ZD7A 4A9AA 2H17A 1OFHA 3WNBA 2YOFA 4LRSA 2OHFA 1P72A 3VHXA 4Q19A 1E9DA 1R0YA 1KMHB 3MMPA 4TZ0A 1X8LA 4PO8A 4EJSA 4FWDA 4UNQA 5J40A 3F5FA 1RZ3A 1ZM2A 3HU1A 4OQMA 2OFOA 3HYTA 4C0LA 1BKDR 2GF9A 4QGAA 1WBBA 3LX8A 1OH6A 3FDIA 1XJ0A 1GL6A 2AD1A 2QPOA 3A8TA 4JL6A 3FKSA 4POAA 3AKYA 4XD7D 3EX7C 1D2EA 4FINA 5DE3A 3KQUA 3LAWA 4X8HA 3MRSA 4IKEA 3U6KA 5FUVA 4US1R 2B21A 1CR4A 1LY1A 4GMDA 4AI6A 3NHBA 5FFMA 3VMFA 1CJMA 2RH5A 3MUFA 2CEAA 3AB3A 2JLRA 2HLDD 4HAUA 2H57A 2PMDA 3AVOA 3KJIA 4B71A 5B2ZA 4EPYA 1L4YA 1EFRD 2R62A 1YJ5A 2ZUBA 1W4RA 3DZDA 4QNMA 2F1RA 2UZ3A 2IHYA 3QJYA 4L16A 4PC6A 3IQXA 4BLSA 4D0GA 1PVOA 4RZ2A 3QPWA 1JR3E 3JZAA 2QA5A 4XTRA 4B6EA 2XX3A 4G01B 1W1WA 3K0AB 3AGPA 4UNNA 3VR6A 2IEZA 2IXGA 4YDHB 5EP4A 2ZSFA 3AKEA 4NBSA 3BK7A 1NG9A 1YU9A 1UKEA 2ZI9A 5HE8A 1WXQA 1GAJA 4TL9A 4LV8B 4O3MA 1UDXA 2H16A 4NYMR 2FMXA 3JVVA 3W8RA 1XEWY 1TEXA 3B9QA 5JHHB 4DCTA 3S1AA 1NBME 3UG6A 1HYQA 2EFDB 2E1RA 1IJFA 2F6RA 2ZRIA 1TQ6A 3BGWA 1R8QA 2YWGA 5G3YA 2DBYA 2PCJA 3E1SA 3K9HA 5DN6A 4F38A 4KVAA 4KYIB 4YMTA 1T3HA 2QEQA 3BGEA 1V5WA 4KODA 2Q21A 3SEAA 4TSFA 3CNOA 3L8YA 4JMPA 1E6CA 4GZLA 1MV5A 5K8TA 1Z07A 4P32A 4CEHA 4AC9A 4X8MA 2B7CA 1TUIA 1P5ZB 5A0FA 4A8JA 1GZSA 1DAFA 1EXMA 4Q4HB 2PT5A 4R98A 4FXPA 2VP9A 1KI3A 4JLAA 3TNFA 2XOKD 2XAUA 5EXTA 3KJHA 3KUCA 1WA5A 2H92A 3A4NA 3PQCA 1E9FA 1KK1A 4TMZA 4OBEA 4IDPA 3UKDA 1HUQA 3VU9A 4QNRA 4A1FA 2IYTA 4DT1B 4DSNA 4O0MA 4P33A 4Q1BA 3LFUA 2GK6A 4AURA 2ASEA 4WZAE 1XCMA 3T15A 2QZ4A 4RZ3A 4CEJB 4KBFA 4IVRA 3VHLB 1J7KA 3MWJA 4B75A 5BXQC 3A36A 4C0BA 4BASA 2CJWB 4O2RA 3THOA 4A0RA 1KK2A 1S2MA 5J4LA 5JWRA 1AA9A 3C5CA 2WWGA 1ZAKA 3BH6A 4DJTA 1S9HA 3ADCA 1AZTA 4Q1AA 5HCNA 4TQ9A 1XMVA 3NH6A 3KTAA 1XTSA 4KJZA 3REGA 4E09A 2HEIA 3NBZC 1B0UA 2P65A 3TAUA 1OFUX 2FEMA 1Z06A 1I4TD 4GMXA 3VR5A 2I3BA 3LDAA 1OXXK 1Z83A 4OJKA 2J0SA 3A1WA 1KYIA 1ZM3A 2DWQA 2O0KA 1ZCBA 1X6VA 2OBNA 1Q1ZA 1OXUA 3GLIB 1ZNYA 1ZNWA 1KO5A 1J99A 1KJZA 3T61A 3F8TA 1F2TA 2QGZA 4JLNA 2MSCB 4DSUA 4YDSA 1ZM9A 1QDEA 3WYAA 2NO6A 4JLMA 3WP0A 4GITA 4RCYA 1SZPA 2XB4A 1CTQA 1DARA 1P4SA 3TW8B 3A6PC 1XU4A 4QJ5A 4A2WA 2O52A 4HDCA 4B48A 1GL7A 1NVWQ 1TQ4A 1N6OA 2IYUA 1ZD9A 3IPXA 1Q1EA 2QM8A 2QUZA 3T1VA 4ZI2A 5E3HA 2AHOA 3I72A 1NN1A 3GLFB 3E2IA 1EFTA 1Z0AA 1KMHA 2CBZA 3CH4B 4MYCA 5JSZB 4J0QA 2LKDA 2WICA 4BQSA 4G5SA 2QT1A 5EXSA 4ZCMA 3QVUA 3U7EB 2MMGA 4AYTA 1M1YE 4FMDF 2BBOA 1LVGA 1U90A 4JYBA 1QRAA 2O8CB 2KJQA 4LJ5A 1W0KD 2F3RA 1WE2A 3U7GA 1T0JB 4OQXA 2AXNA 5GVSA 4MYHA 2R8RA 2IS6A 2J7KA 1ZINA 4Q00A 5BYKA 4DB4A 3GEHA 3K8YA 2ZQ5A 2P0EA 4DLWA 1EK0A 1OSNA 4LBWA 4HAYA 2H18A 4DIDA 4LPSA 1NLFA 4II7A 5KUTA 4HATA 5KSPA 3R8FA 1FNNA 3AVVA 1ANKA 2PJZA 1JNYA 3W5JA 4HLUA 2CLSA 5KYKA 1P9WA 1FP6A 1M74A 4TMWA 1L7VC 1BH2A 4LRTA 1E98A 2IC5A 2NIPA 1Z6GA 3CX8A 3T35A 3BRWD 1NP6A 2O0JA 2Z0MA 1XDBA 1Q21A 2NO9A 4M2LA 3AVWA 3K0AA 4C3ZA 2JLQA 2C98A 2R9VA 3VR3A 2N46A 1GNQA 2AFHE 1DG3A 2GESA 2AK3A 3T1TA 2FZ4A 2ZJ2A 1KJWA 1GILA 5CITA 4FN5A 4RD1A 2WWYA 2YYZA 3RC3A 3HP1A 4PHFA 2J0UB 2D7CA 1F6BA 3K0CA 3NTUA 5EUQB 2W6ID 5FUWA 1K8RA 1GP2A 3LQRA 4S35A 5F9HA 2HF8A 1X1SA 5SZIA 4URWR 4A3VB 5SZJA 3K0FB 1COWA 2IT1A 4KFRA 3RYTC 3TR5A 2GDJA 1FTNA 3P20A 3T5GA 4OHXA 3W34A 1E2NA 5AJXA 4Z8XA 4PZZA 1X8KA 4IOLA 1PUIA 4US2R 1J8MF 2JJ2A 2VIIA 3MHVC 2ERXA 2WVJA 1MKYA 2XEXA 3CR8A 5JCPA 3DMDA 4Q7JB 3KDSE 1CJUC 5FOSA 3LRPA 1JPJA 3LW8A 1DAIA 5F3WB 3GPLA 2FFAA 2RGAA 1M7HA 2ZJOA 3EA0A 1ESNA 1G8HA 2MSEB 1KO8A 3GD7A 2CL6X 3IHLA 4MRRA 5TDHA 3WRXC 1NBMA 5D3QA 4DT1A 4KBGA 1RRGA 2DHRA 3D6TB 1ZNXA 2FSIA 3X1XA 1KHTA 3ND9A 3CF2A 3AP3A 4CEJA 2J7PD 2FSFA 2XZOA 2WSSD 4BFXA 4XIGS 2WTUA 4QM7A 3GJ5A 3VKWA 1U8YA 4PC7A 3FHTA 5JJLA 3PV0A 5JI3E 4RFVA 2I4IA 2A5FA 1DELA 2CJWA 5LD2B 1JQLB 1GFIA 4BLTA 2R65A 3BBPA 3NVAA 4NYMQ 2OZEA 1SXJE 2QU8A 3SYNA 2ONJA 3AP1A 3I1FA 1UBGA 4NYIR 3TLXA 2XXAB 4LV6A 4IDHA 2FEOA 4TQUS 4Q7KA 2TMKA 2DVWB 5C1BA 2WWFA 3W9YA 3HJNA 3QI2A 2GXSA 5FOWA 1G8FA 1N3BA 2PBRA 3OIUA 1NN5A 3PUZA 4IFEA 1KY2A 1FUKA 4PAQA 4KSCA 1NY5A 2QGNA 5HE9A 3V9PA 3PEVA 3GLIA 1SHZA 3SFZA 1AZSC 4NKRA 5KSYA 2V6JA 1GOTA 5BN5A 5BN3A 1SKYE 1SXJB 2J87A 5CM8B 2R44A 4U02A 1IXRC 4I81A 5IRCD 4XWKA 2HDNB 1EFUA 2EFEB 1OW3B 1OXTA 1MR3F 1VYTA 1JI0A 3LD9A 3EWSA 4HI0E 4NCJA 3TKLA 1KI4A 4PC3A 3FWYA 3QXCA 5JRJA 4B3GA 1U8ZA 2F9LA 4HB4A 1N5LA 2C5LA 1QZXA 3U2QA 2FV8A 3U61B 4OHVA 3GLFA 5JBQA 2C9YA 2VHUA 3NBYC 5P21A 1QG4A 1TU4A 2JGNA 1U9IC 3K53A 4FI3C 4M1OA 4EIWA 3EASA 4A2QA 4BECA 5JSZA 3AF4A 2IYQA 2ZRKA 4QJ3A 1MOZA 2FWRA 1RVDA 4M22A 1P62B 1E2IA 5E4FA 3GMTA 3EC1A 2O8CA 3HYRA 3MWLA 4AY2A 3U5ZB 3QG1A 1E9EA 4GP7A 4DEYA 5H70A 1PLKA 2ODEA 4PPGA 4B6FA 4R7ZA 4MDFA 2N42A 2QMOA 1JJVA 3AVXA 4ZO4A 3PUXA 3BAFA 5FUXA 2CLDX 4ACAA 1EFRA 1JALA 2VP0A 2PZFA 2QENA 1AS2A 1ZM7A 2GEUA 4HAXA 4Q48A 2GJ8A 1GL9B 5JCZA 3IIJA 4YMSA 3U3KA 1KY3A 1WMSA 1XP8A 1KNQA 1TX4B 3KQLA 2ZYTX 3R9XA 1CJVC 3CRMA 2CE2X 3N70A 2J46A 4FW9A 1SVMA 4AD8A 3ADDA 2ATVA 4A0FA 2CE7A 4Z54A 3N2EA 1E4YA 1DS6A 1DG1G 3MFYA 2C03A 4N0DA 3A1SA 3RRNA 4DCVA 1G3MA 1NKTA 4MGKR 4MH0R 1Z22A 1CJTC 1KTVA 4TLAA 3LH5A 2I1QA 1KI9A 4IRUB 3OE7A 1H8ED 1JEEA 1OXSC 5IK2D 5JEDA 4CEIB 1I4DD 2QE7D 4P31A 2V54A 3I61A 1L2TA 2NQ2C 5FH9A 4PX9A 4BZXA 1SQ5A 4DCUA 5BQ5A 2IYSA 4JKYA 2J0UA 3G0HA 5J4KA 2EQBA 3A1UA 3QVVA 4WOPA 1OE0A 2ZREA 3ZJYA 2RHDA 2RGNA 1IAQA 4KYUA 1AQYA 3K0FA 4QBFA 1OHHD 2JIZA 4KVGA 2OXRA 4L9SA 1XNJA 4IVPA 1N0WA 3IEUA 3GJ8A 4PC2A 2SHKA 2XOKA 4P4SB 1E2JA 3CONA 1KOFA 2BIFA 3CX7A 1TAGA 1ELOA 4DC9A 4TQAA 2WHXA 2W6JA 1K5GA 2D4HA 2PZEA 1NVUQ 4OK5A 5FPHA 3UWOA 2AN9A 3DZ8A 4M9QA 4PO9A 3FPAA 2GZHA 1LFDB 4M4SA 4D0LB 1XFAA 1ZD8A 2JEOA 3LBIA 4MKGA 4MDEA 2GCOB 3F3YA 4KXFB 5KDDA 2G83A 2QMHA 3UMFA 5KDOA 3BB1A 1SVKA 5FTKA 2W83A 3IO5A 3NEJA 2ZXUA 1CRPA 2DFKB 3EA5A 3RRMA 4BLPA 2ZRMA 1N0VC 2ZRDA 3IUYA 3C5HA 3TSZA 1W36C 4B33A 1E0JA 1XX6A 1P60A 4TTRA 4RFSB 1MO5A 1XTIA 3VNUA 4A82A 1N5KA 2OAQ1 1SVOA 4QBIA 2F1JA 2H7VA 1DPFA 2Q3MA 3OEED 5DSZA 3UIEA 2FA9A 1NSTA 5KO2A 3EIQA 4V0KA 2J9RA 2FFHA 1Z0IA 4US0R 3ASZA 2ZEJA 1S1CA 1IBRA 3NHAA 3PUWA 4IOJA 4LYAA 4D81A 3QKSA 1HURA 5DGXA 2C9OA 2HF9A 4BLOA 2ODNA 4R71A 2XSZD 3W3ZB 3LVRE 2QQEA 1G3UA 4D26A 4LHVA 3GEIA 3LLMA 3HDTA 4RKFA 1BYIA 1GUAA 2OESA 3H2YA 2AKAB 2XJ4A 2FDCA 2QPTA 1CRQA 1A7JA 2OBMA 5AJZA 3LW7A 1FMLA 4JVLA 1X3SA 2G77B 2B8WA 1Q22A 3NG1A 2IWRA 1Q1BA 3RNLA 3ZH9B 2YOHA 1KKMA 1IQPA 1CR0A 3NC0C 1SXJA 2FZLA 2KBFA 2QL6A 1XCPA 2OFXA 2CXXA 2LCFA 4UNSA 4QOSA 1TADA 4HUQB 4M1YA 5L3VA 3WHLA 1BO6A 3WMEA 4PFSA 4GPTA 5JLJA 3RVBA 5H8WA 3CPEA 1TU3A 5EP3A 2ZE8A 3AKDA 4A36A 2A9KA 2PLRA 1KSJA 1W0KA 1CU1A 5AJVB 1QHYA 4QGFA 3WNDA 5KSOA 1JR6A 2OUKA 1E2KA 2VH5R 1T4GA 5EUMA 3ZZTA 4EPWA 4NYIQ 2WIBA 1G3QA 3BC1A 3FB4A 4AKEA 2ZRGA 1TPZA 2CHVA 1BMFA 4D82A 2GILA 3Q7QA 821PA 3D3QA 1TMKA 1XZQA 4N1AA 2P5SA 3W6PA 3SDZA 4Z1MD 3BS4A 3TUZC 4MUBA 3O8BA 1PLJA 4IDQA 421PA 3NIBA 4DKXA 1E79D 2AX4A 2OXCA 4B34A 4A6XA 4MA4A 2OILA 2AL7A 4Q9HA 1GKYA 1II0A 3L0PA 1T8UA 5H68A 4BZPA 1Z28A 4ON9A 4XJXA 1NMYA 2G6BA 3IILA 1WDTA 4JLPA 3AVQA 4RD0A 5C4MA 1RW4A 3C14C 1MRSA 3CW2A 3GJXC 2PH1A 2NO7A 4ZCLA 5C46F 4G5QA 2BV3A 5DLQC 2GNOA 4FIDA 3RS5A 1E1RD 1ZD1A 1CIPA 1AS3A 2O8BB 2QT0A 2W6IA 4CEIA 4NYJQ 3T5DA 1AJEA 2BEKA 2ZRHA 4Q7MB 5K8IA 2J1LA 3D31A 4V0NA 3CIOA 2QMUA 3RDPA 1HY3A 4EDHA 1G18A 1K6MA 621PA 1CR1A 1P2SA 3ZVRA 3AM1A 1M7BA 3QXXA 2IYZA 2W00A 4M9XA 1XF9A 4QGGA 1DO0A 1VMAA 3CH5A 1YZUA 2GAOA 2IXFA 3LXXA 3M4YA 3QIAA 4OQNA 1I2MA 4H1VA 3KJGA 4BE7B 4ZIRB 5C2JB 2WKPA 2GXQA 3KB2A 3SQWA 4JLKA 1ZUHA 2OCBA 2ZSEA 1YE8A 4L4UA 2D3WA 5AJYA 4BFWA 3U4QB 5JMTA 2A7QA 1SVSA 1VIAA 2G0TA 3QXJA 4P4SA 1J90A 5JEEA 4DSOA 5AUPB 4YXWD 3O8RA 1W5SA 4KI0A 3SJAA 4MKFA 1OB2A 2VPPA 2ERYA 3TK1A 3RWOA 3THWB 2JATA 1XMSA 4NCHA 3GJ4A 4IW3B 5F98A 2O8FB 4M9ZA 1ESMA 4TT3A 1QHHB 3SHFA 3U7FB 3A58B 4TL6A 2J7PA 4E07A 5HR5A 2GCOA 1N2CE 1HV8A 2Q3HA 1KMQA 1ZIPA 3OF5A 2IUTA 1GNRA 4NHOA 2BBWA 2QP3A 1XJQA 1Y63A 5KTYA 2GKSA 4GP6A 4Q02A 3EZ7A 1ZIOA 4PAOA 1NF3A 1TEVA 4RFSA 2ZSDA 2QQ0A 3TRFA 2C77A 1AIPA 1UADA 2JLUA 2GCNA 4A4DA 5EE0A 3CBQA 1UPTA 3BE4A 3OIVA 2XZLA 1S8FA 4QHTA 4ZKEA 4NCKA 3WMFA 2F9MA 1OFTA 5G41A 2P6NA 3O8CA 1WB9A 2IF2A 4TTQA 2YC4C 4Q4AA 2Z83A 1WQ1R 221PA 2NO1A 3WYGA 4TL7A 1W36D 1N6IA 2VLIA 1DEKA 4IVQA 3BFKA 4M9SA 3KXIA 1A5TA 3H4MA 2I1VB 3CRW1 4QBHA 4TYYA 2CL7X 2OM2A 3AEZA 3ZYCA 3B8HA 1E9RA 1ZC4A 2GETA 1KSGA 1II9A 1DAKA 4BRWA 3KW6A 2Z43A 2ZJYA 3IIKA 3SYLA 1R0ZA 4DVGA 3K09C 3UXMA 2PZGA 1VG9B 2R2AA 2D2FA 2Q3FA 4BEJA 3X2SA 4ZKDA 1W4CA 3AP2A 1RPZA 2H1LA 3GCGA 1G1MA 4LZZA 2HCBA 1XTRA 4LYHA 4F4CA 4HUQA 5DH9A 5AUOB 3W8NA 4HSEA 2WAXA 4RZXA 1G4UR 2CHQA 1OH8A 3EXAA 5FR1A 3PXGA 2WJVA 3EPKA 1CJKC 1TL7C 1R0WA 2IEYA 3GFPA 2WJGA 1HEIA 2ZR7A 3KZ1E 3ZS9A 3FMOB 4DB2A 4TL8A 4QXAA 3ASYA 1VCOA 4ZDKA 4D2IA 1S4QA 2EW1A 4LC1A 4QBGB 3M1IA 4Q7LA 3AKCA 5FPYA 3EZ9A 2XITA 3GLIE 3VLFB 3DOEA 2ZE6A 1KK0A 4R2IA 2PX0A 4DDTA 3RHFA 1W2HA 1EESA 1DADA 1CKEA 3P4XA 4RVCA 5EQTA 2G1JA 3CKLA 4LY6A 4FMBB 4PPNA 4V0OA 3CO5A 1T8TA 4Z8YA 1XEWX 2VTKA 4W5JA 2G3YA 2HT6A 4YMWA 2QSYA 2GJAA 2J0VA 1HH4A 4D4KA 3SYKA 1PZNA 3AJIB 1P3JA 3GLFE 1JEDA 5FTLA 1OKKD 3ZVLA 4B44A 1ZYUA 3TSWA 3HPQA 4UNPA 1IN6A 4JLVA 2RHMA 4GOKA 1H8EA 5IK2A 2EU8A 3TW4A 3R20A 1GRRA 2NPIA 3SI7A 3KKMA 2G88A 1JPNA 4MUAA 4ZPXA 1CR2A 2GCPA 4B3DA 2BCGY 2QROA 5GJVC 2O8BA 3OHMA 1DBSA 2GF0A 4NMMA 2Q9BA 2CVFA 4GDFA 4GNKA 5SZHB 4A8JC 4A2PA 3BB3A 4XWAA 2QAGC 2EVWX 3PFIA 2QPAA 4U00A 2H8KA 2IA5A 2WOOA 3PG5A 4JVSB 2BCJQ 2VL7A 2XJ9A 1E1QD 1IY0A 3FFAA 5HKKD 2VSOA 4LK2A 1R5OA 3SBEA 1U98A 1TQDA 2D2EA 4RSGA 4ZIRA 2GJ9A 1J8YF 4L5BA 1E9AA 2CK3D 2FOLA 4PXAA 3U4QA 4RD2A 2DWOA 3ICEA 3QPVA 2Q9CA 4ZDJA 2OT3B 2GVDC 1GTVA 1FP7A 1RKBA 2AFIE 3NEYA 3CRVA 5JZVA 4OHYA 1KI6B 1EX7A 1XWIA 2BJVA 3KX2A 4ZCIA 4TTPA 4UJ5A 3THWA 1ZW6A 3KKQA 4PC1A 3VFDA 2C96A 2ZI7A 2MMCA 4NCNA 3SJCA 2O8FA 3OEHD 4JLDA 1QHHA 1R5NA 5JHGB 3ONWA 3MG9A 1WF3A 1T3LA 2GK7A 3CWZA 1G16A 4PSKA 1G6OA 5EP1A 1GSIA 1Z2AA 4N0EA 2V7QD 3ZS8A 4CW7A 5LPNA 1BIFA 4NU0A 4Q66C 5FUYA 4OHZA 3RANA 3OEEA 1KZ7B 1JXOA 4YMUA 2WWHA 5E7MA 4TLDA 2ZU0C 1G291 5GJCA 3ZIAD 3RS4A 4OK3A 3DKPA 3AVYA 1SHKA 4W7SA 5L3QB 2WWIA 1UDWA 2GEDA 3VX4A 1LB1B 3Q9LA 2J0QA 1ONBA 1S3GA 2DFNA 1W36B 3RRYA 2GWHA 4DUGD 2XSZA 4OK6A 4ZI3A 1XMJA 2HJGA 3L0IB 4JBWA 3B9PA 2MSDB 2ZAMA 5BWMA 1DE0A 3BXZA 2ZE7A 2ATXA 1XEFA 2XGJA 2Z4SA 2Z5FA 5CJ2A 1W5TA 2DZNB 4IJMA 2GHIA 4JLOA 1TF7A 4RY2A 3FE2A 4JIMA 2DZOB 3V4RA 3SN6A 1HTWA 1G8YA 3G5UA 2AXPA 4Y0VA 5EJEA 1GWNA 2BHRA 2X2FA 5AWFC 1Y3AA 1A1VA 3GJ7A 2IWHA 4DBLC 1Q57A 3OZXA 3L0OA 2QBYB 2FGKA 4A6PA 3C15C 3FMPB 4HLDA 3RS0A 2OCAA 1NVXQ 3FKQA 5FL7D 3EW9A 2BEJA 3NDBB 2ZI4A 1BS1A 2ZRBA 2XZPA 4L8GA 1E2GA 2RGXA 4U5XA 1D6JA 4LJ9A 3B1VA 1EG7A 1C1YA 3U3JA 3ZD6A 1PLLA 2ZU6A 3BFXA 4M1KA 1EX6A 1WP9A 5CJPA 3WMGA 2ONKA 2CL0X 4M1MA 3KJEA 3WBKA 5TMPA 3DPUA 2GZAA 4TMKA 2VSXA 3NWJA 3EPLA 4MKIA 4HLUC 3B1YA 3U7HB 2ZRJA 1XPOA 1ZVQA 1A4RA 2V4ZA 3FKSD 1XMIA 3J81k 4HDQB 1LTQA 4Q01A 4Q4LA 3QKRA 3NXSA 4B47A 3W3AA 2D7DA 3BFVA 1FZQA 2P2LA 3G82C 1NRJB 3QKSB 2QNRA 2RGDA 1DAGA 2BVNA 2ZR9A 3GEEA 2VP5A 4Q9IA 1MO4A 4CT4B 1E9SA 1FL9A 3CF6R 5FPKA 1DTSA 2F1HA 1M7GA 3FYHA 4I1VA 2WOJA 4B3XA 2FPMA 4CYMA 1OYWA 3BIFA 4NTZA 1N6LA 1JECA 5CM9C 1R6BX 4UQOA 4X8LA 3RLFA 3AUYA 3ECCA 3B1WA 3TUJC 5JWOA 4C0JA 3P27A 2RAPA 1E1RA 5DISB 1YZLA 4DLYA 2G0NA 4D4MA 4NH0A 3SJBA 3DM9B 4CDGA 2XB2A 3CUEF 1TUEA 4JJZA 3ZGXA 4W5WA 2VA8A 5J5CA 2BC9A 3AF3A 2JLWA 1P2UA 3TVTA 1G3RA 1YRBA 2WJHA 1IM2A 3B13B 1ZU4A 2FSHA 1XCGB 4PANA 3OAAD 2J3EA 1NL3A 5EZ6B 1ZBDA 3LNCA 4IOKA 1QVAA 2ANBA 2ZITA 4I1UA 1G21E 5UKDA 4PHHA 5DYIA 1II8B 4DRZA 4ZV4A 4BPBA 5AR1A 4HZIA 4JN6A 4NYJR 1T5IA 4U7DA 3VR2A 3QKTA 1XZPA 1P2VA 1GIAA 4PHGA 4XD7A 3I92A 3EG5A 5GJBA 1OJLA 3GLGE 1KIMA 4TSFD 1N6RA 2DWZB 1R10A 1QHNA 4H1UA 5HTKA 3ETLA 5LB4A 1KI7A 2EFHB 2VO1A 2OLKA 4DCNA 3JVUA 1KZGB 1KI6A 1RJ9B 1JAIA 4EQ6B 2HLDA 2ZTSA 5FPTA 2IYWA 2VRWA 4LUCA 3CPHA 3VKGA 2OO7A 1T0HB 2AR7A 3GFOA 4IXMA 3I3SR 2K5UA 2QM7A 2YVUA 2IYLD 3IO3A 3KFXA 4F91B 4BZQA 4ITRC 2VHCA 5DHAA 2J59A 5FR2A 1AS0A 2DR3A 1B23P 2IYVA 5L3SB 4LJAA 2BMDA 3GLGB 4PAMA 5DIFA 4B74A 2ZJ8A 2ZS9A 1F3OA 1S1MA 4TN1A 5BN4A 1D2MA 3K9NA 5E7IA 2UZIR 2VEDA 4XTCS 3U44B 3P26A 2ZM5A 1AGPA 3W6OA 2HYIC 2E87A 4JT4A 4DEXA 2YC2C 2YV5A 5L3QA 4TLEA 1LV7A 1H8HD 3X1WA 1P2TA 5CB8A 5AUQA 1KDRA 1ZM4A 1HA3A 4LPKA 2BDTA 4LV5B 4LYJA 1FTSA 1T6NA 2VSFA 4WAUA 1TF2A 1JQJC 2B8TA 5JWHA 1XD2B 1P7CA 3LV8A 2WIAA 3NH9A 3SHWA 2YHSA 4QG7A 2GXAA 1EWQA 1P9NA 3A4LA 3IIMA 2KI5A 4PR0A 5ELXA 1LNZA 4LJ4A 1Z2CA 4FMCF 1OH5A 3QG5A 1UBFA 2QG6A 5E95A 3ICQB 3DDCA 2A78A 1W0JD 1YR6A 4Q03A 4B2LA 4C0QC 5F2EA 2HUPA 4TYQA 4FWGA 4O25A 5LDDC 1KO7A 4GI7A 3OFND 1YZQA 4OJQA 2QBYA 1C4OA 1RIFA 4Q21A 3NDPA 2ZVQX 1N6PA 3LBHA 4RJLA 2WPDD 1IN4A 4C30A 1VG1A 3B6EA 4TMXA 1TTTA 1NLYA 2XNSA 2CNWD 3ND8A 2Z6VA 1A2KC 2FF7A 1E0SA 1D9ZA 1OLOA 4QM6A 3LX5A 1EWRA 1QHIA 1N6KA 3FTQA 3VQTA 2FH5B 1Z8FA 2V55B 2JJ1D 2D62A 4EPRA 5JFGA 3ZZ0A 4R2HA 1RFLA 2WKQA 4PHTA 2GEVA 1Z47A 3QF7A 1NNEA 1G3IA 1G9XA 4KITB 5KOYA 2W2XA 2X77A 3JZMA 1U8AA 3AGQA 4CZ2A 4WW0A 3QEJA 4V0LA 2PLFA 4ASUD 1NJGA 3CX6A 3LY5A 3A1TA 2KB0A 1OPXA 1Z3IX 3C16C 3C41J 1SGWA 3EZ6A 4HZUB 4JZKA 5FBWB 3VTKA 3WY9A 5A5GA 1MO3A 5EE3A 3M0EA 3BERA 4Q4AB 3QENA 4URVR 1VCNA 4JBYA 3WP1B 1OKKA 4RZUA 5DI3B 4CIDA 1HT2E 4M1TA 3EPJA 3QOFA 1SVLA 2NOAA 1JJ7A 2R6DA 2ZI5A 4OHWA 4WVFA 3PEWA 4JJKA 4AKHA 3D7MA 1OXVA 1VG8A 2XTZA 4EPVA 1Z6AA 1CULC 4JKIA 8OHMA 2OEPA 2ZI3A 1J2JA 4Q18A 4JBXA 2OG2A 3Q5EA 1ZC3A 2DFLA 5KPJA 2CHGA 3RABA 521PA 2OBLA 1GVNB 3QXSA 3WRYC 2JDID 4NDZA 2HXSA 4C2UA 1KO1A 1ZJ6A 2VQSA 4OI0A 1NY6A 4LJ7A 3RS7A 1AN0A 4CT5A 4LGMA 4JLBA 4URUR 3QSYA 2DPXA 1E1QA 5HKKA 2CMKA 1L8QA 2BWJA 4EFLA 5BW8A 4V03A 3CRQA 4EFMA 1NVVQ 4TYPA 4H9GA 2VHJA 1II8A 4A0GA 3FHOA 4GRAA 2ZVPX 3DEFA 1M34E 5FOTA 2O8EB 1GITA 4IEIA 4LBZA 4B76A 3BOSA 2KBEA 1JR3D 2QAGB 3T34A 2EWVA 2IUUA 4B3CA 1G5RA 4YQFA 1U99A 4URZR 1ZRHA 1E2FA 4OL0A 5CK4A 2DCUA 2GA8A
chains in the Genus database with same CATH superfamily
3L7BA 4QHYA 4OB7A 2WILA 2DSTA 4LSGA 3G1WA 1L3CA 4DW8A 2DR0A 1RPNA 3Q3JB 4J3NA 2R66A 1YVEI 2JANA 3EJWA 3SGLA 2C57A 1X86B 3B78A 5TQ2B 4NR0A 4DLZA 3MPOA 3L40A 4KQMA 4N49A 5T4FA 3VAYA 3TZCA 1HDRA 3TIVA 1VSVA 1M5RA 3LDHA 2O8VA 2BJWA 3F9IA 2PD4A 1NFRA 1TVCA 1ACLA 2JAXA 2X1LA 4F5DA 1M67A 4LYEA 3B38A 3T0IA 4CJXA 4DHWA 1PUJA 3WLNA 3NV9A 4YJGB 3TSCA 2II6A 4PNHA 1FJHA 3R0VA 5FPSA 5MGBA 3EF0A 3ROZA 3NW9A 3FCXA 1QF9A 1RHJA 1KYWA 3BGIA 2PO7A 4ZK6A 2PX4A 4H0CA 4B80A 3HG7A 3O8DA 5CUQA 4YDQA 1QH8B 1QLHA 4P3NA 1JF8A 2V5VA 5EE1A 1RI2A 2V9PA 5BWBA 2OD9A 3SVLA 3D0KA 1Z0JA 5DTJA 1KFEB 4RVNA 2O8DB 2IS1A 1CUEA 4EITA 4TZKA 1JMVA 2A5DA 3IT0A 4YJKA 3JVDA 2VXBA 3M9WA 4JC5A 4NZZA 4BL5A 3ZWOA 4MR9B 2JGJA 2ACEA 2RGEA 3LQYA 1CVRA 2W2NA 4BGVA 3C1TA 4BLQA 5HYVA 2XYRA 1JIKA 3PWKA 3THYA 3AX6A 4CGZA 1QDRA 3OOWA 4V0MA 2JY7A 5JJIA 4PSDA 1H3NA 3DXYA 3K0KA 1TJ5A 3VGJA 2ZPAA 5KNDD 3WNCA 4BV9A 3SMVA 2E9SA 4PSVA 2VYFA 3ZLTA 1JG4A 3SASA 2HOQA 2IBSA 5DNEA 1LZKA 3UENA 2WPDA 2C04A 3N6XA 4MVCA 4JJEA 4F4DA 4YLEA 3TZQA 1H69A 1FP1D 2ORWA 2OQIA 4RELA 5B57C 1N0HA 4MWZA 2BEUA 5JPDA 3E4CA 1FZTA 1NQAO 3UJ3X 3ZI7A 1IHDA 4KIWA 4KFUA 2FFQA 3CYFA 1ZMWA 4JI4B 1IRIA 3QF4A 1BMFD 4JJGA 2OFPA 4F93B 3CVYA 4AKGA 1DCMA 1H22A 2VAWA 4G0XA 1KVUA 1GKUB 4YJ3B 3AONB 3KP1E 1NVGA 3R76A 3EEFA 2IS4A 5FBVB 1QTNA 3MRTA 2BEVB 4AJ2A 5CXXA 5EI5A 1SVWA 2AOVA 4AIIA 4AZVA 1N8TA 2ZATA 3QYEA 1Q74A 5T6BA 4Z6YA 4REQA 3A2MA 1V5FA 3I1JA 4HB0A 4GG1A 2CCJA 1HOXA 1MVOA 5J2UF 1KL7A 1RHMA 3A9WA 5HILA 2R4QA 4BKMA 1US8B 3ETJA 4XDZA 4QPCA 2BGJA 3PF9A 3QW2A 4KXLA 1G4AE 3T3DA 3HZOA 4UVIA 1UMDB 1CS4C 4BY9E 4TZ6A 3F78A 2F8LA 5CHEA 3A9TA 3E0XA 3FX2A 4ZU6X 4QYIB 4F5WA 5BUZA 4JJ6A 5ALRA 2OAP1 1FPMA 3BTSA 4LF8M 5EE5B 3FYSA 4JT8A 1HLGA 2TYSB 4JYCA 1XPUA 3O1LA 1J5EM 3EG9A 5ITVA 3VR5H 4E5VA 5E6SB 5K05A 1KZYC 3TI7A 4AROA 4G5XA 1P75A 1D4AA 2LDBA 2RGRA 5C4GB 1N7HA 4ZRMA 1K0FA 2GTPA 3EVZA 1DBWA 4Q05A 5CDFE 3OQIB 3BBLA 2J48A 5ES3A 5HZKA 1NI5A 1F1BA 4JL8A 4A91A 6PFKA 3NC1C 2PKXA 3HR8A 3RSLA 1SKYB 3R3WA 3CLSC 5TJHA 4OYYA 3HEAA 2ZJZA 1CQZA 3TM4A 1Z5VA 2IEBA 1YZTA 1XB2A 4R40A 4DZTA 3T1HB 1VECA 3IKJA 3W5IA 4CR7A 2LWIA 3I4VA 2J6IA 1DAMA 1O1YA 4LRYA 4X92A 4D3SA 3CF0A 2PT7A 1ZBQA 2P3SA 3SK0A 2HLNA 2JCGA 2CHEA 3A1CA 4P80A 4XWOA 4M8LA 3QWHA 1LJUA 4HNVA 3ZZUA 3MXOA 4K3VA 2QI9C 2PEYA 3FYTA 3JQAA 2XNDA 3GNLA 4L5IA 2QRQA 3OTGA 2IOFK 4FBLA 3EVBA 5HZHA 1E2DA 2V96A 4E5UA 3QA3E 2X13A 4KXWA 3HYSA 4B32A 3SAUA 2IK8A 1D6NA 3AFMA 2W6OA 5HXAA 2YFKA 1DT5A 4A6EA 5CLFA 4GE3A 3FJOA 1LKZA 4C7OB 3JQ6A 2PZAA 3VJKA 1OCEA 1ZH2A 3E84A 2C7BA 1GA1A 1SR8A 2GBPA 1Y1QA 2YJNA 3QEOA 3JATB 2LTUA 2VDNB 1RBYA 4RK1A 2WB4A 1VG0B 1NBOA 1MH1A 2HJWA 4W63A 1JNXX 4JROA 3C6ZA 3PPWA 4CMIA 1GAWA 3V3TA 1BRTA 4WZ6A 1Y9EA 4YTEA 2OZLB 3LP6A 1NBHA 2K9DA 5FNZA 1ZI6A 3IUNA 3IIIA 2WZJA 1P1BA 4DADA 4B3SB 4R2LA 3KYDA 5G40A 5MN5A 3KL2A 3LUBA 4K8RB 1GZ6A 4WX2B 2FPRA 2VDKB 5EXXA 2ZAOA 2GBLA 4UE3S 1RJEA 2XMZA 3H1AA 1QCDA 5C1OA 4DQ0A 3IOBA 2X0NA 3D4NA 4CF5A 3IVAA 3S28A 3D2BA 4UM5A 5D85A 5GADl 3A31A 1HQCA 2AFRA 2PEZA 3W6NA 5DNYA 4QO7A 2IQ5A 5F21A 3K0EA 4YRPA 1FX1A 3R7DA 2OHFA 3BSFA 3AHGA 2VWHA 4I4IA 3DF7A 1WBBA 3FDIA 3KR0A 5HGXA 4MPTA 3A8TA 3UMBA 3FKSA 1D2EA 3TTSA 5TGZA 3CUWA 3ZKAA 4TTJA 2UZ0A 4X62M 1B0ZA 1U8EA 1X7XA 1EFRD 2A84A 3MAGA 1JLHA 5EJAA 2OQ4A 3PGKA 5H9VA 4UVEA 4EKYA 5LYJA 1ZOLA 2IEZA 2IXGA 2ZSFA 1XQ9A 3SHGB 4YAEA 4JXJA 5J1SB 3TQRA 5PNTA 2J3JA 4J75A 1CIJA 2QUAA 1E7QA 1WIVA 4DREA 2OHIA 2JGEA 3DBLA 5ESRA 4Q3DA 2UXBM 2Q21A 4CHTA 1Q6YA 3GCXA 3FCOA 4Z7QB 4QREA 5A0FA 4A8JA 3FLMA 3IDAA 1QQTA 5FFNA 4W5RA 2P6OA 3LKDA 1ECCA 1NC3A 1MORA 2QZ4A 1NF2A 2C5AA 1GSOA 1VMEA 1SVNA 3AJDA 2Y1GA 3BH6A 1WX1A 4BBPA 5KEIA 4GWGA 1I4TD 4Z9FA 5B1DA 2IXAA 1ZCBA 1Q1ZA 1OXUA 1Y6GA 1QC5A 2IDJA 3HVRA 2GM4A 1NM5A 4JLMA 1EFUB 2YN2A 5K9ZA 5D3ZA 3AIOA 4Q3EA 4RHUA 2O52A 3FWPA 2IODA 4EVIA 3IPXA 1JA0A 4IILA 1QIHA 5BSMA 3EGWA 4N3AA 5B53A 3RUAA 1YJCA 1BW9A 1Z0AA 4MYCA 4BN0A 4J0QA 2WICA 2VUHB 3TQQA 2JK1A 5FEMA 1TKCA 4JYBA 1BKSB 3U7GA 2X42A 2IS6A 2ZG6A 3JU3A 3QOYA 3N2LA 4DLWA 3MUEA 1NLFA 4P58A 5EIAA 1MEOA 4YEDA 4FZ3A 1V3VA 4IIUA 5FWYB 3T7SA 2R8ZA 1SU4A 1WF6A 3KXPA 3FI0A 3TTTA 4KGVA 5AK3A 4CLXA 4GKBA 2AFHE 4C4OA 4HDRA 3MNFA 5JXHA 3VKUA 4PHFA 3K0CA 5EUQB 5F4ZA 3IQFA 1KQFA 3NDRA 3N07A 3MHVC 3VU3A 4TXNA 2HA2A 1DAIA 3KAQA 4MS1B 1NBMA 2R68A 3V4OA 3FETA 1HWYA 1ZNXA 3GIDA 3PZRA 4ML3A 4I7EA 1Y5RA 4G25A 3STVA 3LYLA 3HDGA 2QX4A 1EVKA 1F14A 4NOLA 3PNKA 1ZN7A 4YRBA 1RKUA 3S70A 3I1FA 5TPWB 1KS9A 2G17A 4ZXFA 1UDCA 4EF6A 1T3TA 5BO5A 3QZUA 4U39A 3HJNA 2GXSA 3V9PA 1PHPA 3IUMA 2YQ4A 1I6LA 5CM8B 3AMVA 2R44A 4NXMM 1EP1B 1LJLA 2PVCA 2P0YA 1BXGB 1G6Q1 3EISA 3IT3A 2JGNA 3K53A 1I4OA 5IHXA 1CC1S 5DNWA 4J43A 4Z9AA 1KFKB 3HY5A 2QU7A 2LVOC 1GA6A 3CBGA 2HC9A 5L4LA 2XOXA 2VJCA 4ZO4A 3PUXA 1VKNA 4NMHA 2VP0A 4WBNA 4WT7A 3SYTA 3OOYA 2J0EA 1KNQA 1MX9A 2EZ4A 4MGKE 5JO0A 1VE1A 2R4UA 1ZL0A 2R7LA 2NSJA 4UU8A 4KV7A 4HTAA 1KTVA 2ID7A 2IDMA 2NQ8A 3CINA 1O2DA 3AR7A 1SQ5A 4O33A 1H0SA 4EHNA 5BQ5A 3A1UA 3FOBA 1B16A 2IH4A 1Z17A 4J4TA 5THKA 3GLUA 4DPKA 3CONA 4Y9UA 2W2PA 4YY3B 2WM2A 4PO9A 3L8EA 4CV3A 2G83A 4HN9A 1HF3A 1FBTA 1L9XA 4OO3A 5DLEA 1DQPA 2NUAB 1NWCA 1QAOA 1N2XA 2F1JA 3OEED 2JGRA 3PHHA 2Q99A 4V0KA 4ICIA 5FB3A 2HIHA 2H1OA 2C9OA 3IG8A 4R2JA 3KOWA 2K7ZA 2EKDA 2XGNA 2Y2UA 4RTRA 4JOQA 3GEIA 1GUAA 2XJ4A 2IPXA 3DMTA 1DX9A 1X3SA 4DR4B 1IQPA 1MAUA 1XKTA 1JYSA 4UNSA 1K7EB 2CHUA 1U3VA 1T1SA 4MB7A 3RFVA 5BQPA 4J90A 1MGPA 5LNK6 4V1CI 5F33A 3WLFA 5AJVB 4UVGA 4QXMA 4RGYA 4JV5B 3D3QA 3E9CA 2LIPA 3O8BA 3WGLA 1RYYA 4IDQA 2D7EA 3WLKX 3LQ2A 1K0UA 3PNSA 4NLLA 5DX1A 2PRKA 2H1SA 1F7UA 4F3CA 3IHTA 2H1VA 4Q7MB 3H42B 5KWSA 2IUYA 3NB0A 4FBMA 1P2GA 3A6HA 5MDHA 4AY5A 3CH5A 2VI5A 3R5JA 3IQEA 4PONA 1EUDA 3ISVA 3H3JA 4L4UA 2XUOA 4RHCA 4RWZA 4Z4HA 3C3AA 4FDAA 4IW3B 1E7SA 1ESMA 1B41A 1L5KA 4AKTA 3VTFA 3I2HA 5KTYA 5EGSA 3H99A 2CHFA 4BMYA 4MINA 3V4VB 4L0CA 4DUYB 1H2YA 4PGMA 4HQLA 1DCFA 4S3MA 2QXTA 1T6YA 2G9QA 4Y2SA 2BGRA 3OPMA 4EGAA 2ZJYA 5KTNA 4UVDA 2QLFA 3X2SA 2PV7A 1XRPA 2FMFA 2H1LA 2R00C 2CXNA 2JFXA 4XKJA 4BVBA 3W8NA 4LTNA 1OH8A 1GZ4A 2PYIA 5BUQA 2WDZA 1XYYA 2ZR7A 3FMOB 3DDUA 2XDAA 2GT1A 2PXXA 4ZDKA 3UO8B 4WPGA 2BF4A 4GKJM 2AG6A 1JMYA 1F3LA 5HS4A 4YPVA 3MRVA 1CUHA 4M37A 1LDGA 1SPXA 2G1JA 4BN4A 3CKLA 1FRFS 3CO5A 2C7QA 4RA9A 3VH2A 1HH4A 4D4KA 3AJIB 4BB6A 1F17A 2HDOA 2XB8A 4EHBA 1H8EA 4LDQA 5KTMA 2Q2OA 3DUFA 2NPIA 3TDMA 4CIBA 6REQB 3NLLA 2GCPA 2W6ZA 1V35A 4GKAA 4A2PA 4LRXA 3T7KA 3CKYA 1KEPA 1XZDA 1WZEA 2GJ9A 3I04M 5E9WA 4KR7A 1N8NA 2Q3DA 1P7PA 1D0MA 2DWOA 1X9IA 4BMOB 1FP7A 1IVNA 3HE3A 3THWA 3NUZA 3SAWA 4NCNA 3DBVO 3NHWA 4M54A 4HBGA 2R4JA 4FJ1A 1G9TA 3KYCB 4OQQA 4IDEA 5LQKA 1G291 1TUBB 4OK3A 5CLGA 3AVYA 1NDUA 4L2IB 3HJQA 1PJIA 1KJIA 3H7IA 2NP6A 3GEPA 1ADBA 3ILKA 3SSOA 3M9LA 5FSWA 4RY2A 3L92A 1N8KA 1HTWA 1XTUA 3R40A 4AMBA 1A1VA 2JFWA 3HJHA 4BWGA 2YW2A 3M7IA 5ECGC 1SRRA 4ETIA 3NDBB 4PYKA 3ZQ4A 4RETA 4X6UA 3RYIA 3F47A 3BFXA 3PRJA 3S55A 4TKVA 4KE6A 4N5NA 3SS7X 2XZTA 3JPYA 4ZICA 4AW9A 1HPLA 1ENPA 2ZKLA 2BWEA 1ZEJA 3GVIA 4GECA 4PLZA 3F96A 4MW6A 1LV8A 2DULA 4WDQA 4XGKA 1DAGA 3AOEC 2PZKA 1DTSA 3TUJC 3LRXA 3P27A 5CX4A 3SJBA 1Q0LA 3CUEF 2XNCA 3IG5A 4MX8A 3PQ2A 3GJZA 3LHSA 1J24A 1XCGB 2AOTA 2HBRA 4Y6QA 3KPUA 1TYDE 1T5IA 2LBCA 4HQRA 3P2EA 1RT9A 3KSUA 3VDMA 1N6RA 5HTKA 2P40A 3H1PA 4GLLA 2Q6OA 2EFHB 5ARCA 2JGMA 2XUPA 2JGFA 2QM7A 3A4IA 1E5LA 7REQB 3RADC 3D6JA 2PGOA 4GPD1 2HYIC 1D5WA 3EY4A 1RP7A 2DY0A 5ESDA 4LYJA 4EA8A 3TTXA 4IUBS 3LV8A 1Y7LA 2I4RA 4PYIA 4X65M 2G8NA 2HTEA 1MIHA 2WF8A 3QEMA 5E6JA 1T1GA 1YZQA 4XA8A 2DBQA 2ZVQX 5DCWA 2F62A 4TMXA 1TTTA 2NZYA 4EF4A 1Y6FA 1E0SA 4RUKA 1EWRA 1L5OA 2V55B 1MXFA 3QU4A 3ZZ0A 4FHFA 4OBWA 5DKFA 4UOZA 4IXTA 1MBZA 2G9VA 4ASUD 1GA4A 3UFBA 1AUXA 1XDDA 2AFVA 1I33A 5A5GA 4O4IF 5IDQA 4Z49A 3I2IA 4KQKA 1YE5A 2R6DA 4WKBA 4C29A 4UBNA 3NHZA 4QDZA 3K71B 3OM1A 4ZJZA 1T36A 5ECWA 4ZHQF 4MQ6A 4EA9A 1ZJ6A 2VQSA 2DR2A 2JB9A 2X8WA 4JLBA 3CX3A 1J25A 3UAYA 2ZVPX 4ZJYA 1R9GA 1HYGA 2RAVA 5JT1A 1R2ZA 4Z9YA 1IE3A 1JR3D 4URZR 1U5BA 5J2TF 1M2VA 1SAYA 3D8BA 3UYKA 1U7XA 1RJ9A 5I7SA 4Y6RA 2HSJA 3NPMA 3SR0A 2HT1A 3FDZB 4F97A 1VJ5A 2NUPB 3E9ZA 1KI8A 3IC5A 3O4JA 2J9YB 1E5TA 4FPXA 2N0SA 2BZ1A 2A9FA 2B0JA 3COPA 1PWEA 4PO1A 1JSZA 3O84A 3MJRA 2BFBA 2LV8A 3T94A 3P9SA 1HL7A 3LQQA 2QW6A 3V46A 1QR6A 3K09A 3DVRX 1XJ5A 4HD8A 1ZHFA 2P4UA 2PIDA 2TSYB 2YUTA 3AR6A 4CLRB 4ZQFA 3UUWA 1G19A 2IGBA 3DC7A 1O4VA 4MV1A 4QTYA 3PPXA 3JYNA 4CJ6A 3PI7A 5K8CA 2PS1A 4D80A 2BFAA 1AO3A 4X41A 3S1LA 1EGHA 5FLEX 4AJLA 4P7GA 1IH8A 3SKYA 3QBJA 5DBGA 4CF6A 5EXPA 4B43A 1B43A 5K6TA 4IFBA 3TAXA 5KNDH 7MHTA 4ENSA 1GVNA 1P5RA 3OZIA 3PDIB 5KQGA 4MGZR 2WAYA 3NHRA 1TPYA 4JSTA 4ZZIA 3X1YA 2K47A 5DYGA 2XECA 1YCHA 1EGVB 2F90A 4IBKA 1X1EA 2RK4A 3QKWA 1LCIA 4QECA 2EGUA 4K8OA 5PGMA 5TF4A 2VAPA 3HKBA 3QBDA 1PV1A 3W1EA 1YUMA 4C0WA 3BXXA 4Z9BA 1YI1A 2P5TA 5CYPA 3L2AA 1A2OA 2CXTA 2YS7A 5IJXA 5K1ZA 3C6KA 2W70A 1K4YA 2Q4BA 4DCSA 4MGYE 1YDHA 3ZWYA 4JDUA 3U7IA 4F4HA 3GLHA 1KDTA 1KZ9A 1E2PA 1JBKA 1X8JA 1OX6A 5EWLB 3SE7A 4UOEA 2YZ2A 1MO6A 2BMJA 2FMTA 3FLEA 1Z38A 1LW6E 4YXFA 3IRUA 1Y8ZA 2O2SA 4Q1EA 1H42A 3U3OA 3IBCA 3IUPA 1EZ1A 2GZMA 2BTOA 3DE5X 3LQ1A 2DZLA 1MAWA 2NACA 3PQ4A 5ERGB 1R2QA 4OQDA 2FSGA 2X5XA 2WJJA 4K9PA 1A50B 3IV7A 2OLJA 4WBXC 2PMFA 3A2LA 1GT6A 2J9XB 1VPVA 3GR6A 2YNMA 4G5RA 3QLVA 4FYXA 2DY1A 4X1OA 4IO1A 4TLMB 3DAPA 4N40A 4AZ3B 4MRPA 3PR1A 3CV3A 4H6XA 2FMIA 3H3FA 4IGFA 2H59A 1N2SA 4HLQB 1NI4B 1T4BA 4UJ3A 4ZGWA 3CTDA 3RTCA 4C03A 3KZVA 4BFTA 5IP5A 2WMNB 1KERA 3C24A 1EFVB 4B7FA 1VPEA 5B3JC 4UN2B 3AVPA 4HNUA 1HSZA 3M34A 3BMXA 5CHYA 3TFQA 3UTCA 1R37A 4RGVA 1QQBA 4LRWA 4LDJA 3ZHYA 1N5DA 1TYEB 2CDNA 1U1GA 4YROA 1F12A 2HA4A 3VBEA 4AWBA 4KXYA 1DEOA 2VNIA 1VCMA 3BJMA 3OY7A 4BRZA 1PL0A 2QL5A 3U3MA 3CZ5A 2O54A 1OZAA 3IH5A 4EJMA 3RJMA 2HQBA 1ZEMA 3TNLA 2B0CA 4AYWA 1T35A 2QORA 3QU5A 4Z4GA 4U7TB 1I4WA 1IUPA 1IBSA 1TAHA 4IBGA 5LQRA 3VSBA 2LWXA 1FQJA 4EY6A 1UBCA 4EP1A 3O1HB 5LC1A 4HNSA 4LX0A 3EEIA 5C31A 1UODA 1WU7A 2YV2A 4KX5A 3H5TA 3A6DA 5HUHA 1J0AA 4YJFB 4EVQA 5CNJA 2I65A 3LQFA 1Z29A 5K3FA 3BL5A 1KETA 1I9CA 1M2OA 5IEJA 4CKXA 1XG5A 4TKMA 5C8ZA 3IDQA 2BUCA 1XT6A 4FMCB 4I9GA 3KTDA 2VN8A 4TKZA 5AJUA 4C89A 2W0SA 1W88A 4LWPA 3EGOA 3TR6A 5G4KB 3EQ9A 3MYRA 3CNNA 2RGCA 3T7CA 2H1IA 3BJEA 1SUEA 4RPGA 5BYJA 3Q0EA 5AH0A 5CX1B 3Q8XB 5CB4F 4CISA 4MYUA 3D3WB 4I1SA 2FVXA 1VDLA 4WMLA 4BLVA 2N9UA 1O7JA 2B36A 5EZ5A 5E7JA 3USCS 1SQFA 3O8OB 5A02A 3B12A 4BPRA 1T6BY 4TV8F 4DLKA 1D5CA 2QTRA 2BM0A 3NCHA 4R54A 2H4XA 2O48X 5B36A 3R9KA 1UPAA 3DBIA 2XWJI 3ZX4A 3PGA1 5I9LA 1CEQA 4KWHA 4KBYA 3AOGA 4EB8A 3GJTA 1COWD 3QX9A 1QOQB 2R6FA 3ZQ6A 1LH0A 3G13A 5A06A 3G89A 3AERA 1BXZA 1HEUA 3KWFA 3EHEA 2PNFA 2NO5A 2C9CA 2G7MC 1QHEA 1SUCA 3LOPA 2WVHA 2WYWA 5BRAA 4D6PA 1OLSB 2UKDA 5TV2A 1LI4A 4RY9A 5ENDA 3DE0X 2ZE5A 5CIQA 5HSGA 1APBA 2NV6A 3B2QA 2NN3C 4Q3CA 2SCUB 4L9RA 4XVRA 2GA9A 5LNK1 4I9NA 4RKEA 2H11A 3G2LA 3LPDA 2V6IA 2ZWVA 2Q8PA 5COBA 3UV7A 4E1BA 1EFCA 1VEJA 1AUAA 3KFVA 1OXKB 4A9AA 4X00A 5G1NA 4BOYA 1QGYA 4R69A 5EY5B 3O4GA 2V7VA 2MJ5B 3UJ6A 3W6UA 1EH5A 5ADHA 2HKIA 1CUWA 3EVNA 3VOTA 1DQSA 3OKPA 4FINA 3QUQA 2CFCA 3NHBA 1J0CA 4IWNA 3R5TA 4NRVA 2D1TA 1JHZA 2BL4A 4AN4A 2Y2VA 4IV0A 2XX3A 4G01B 4DR2B 5EHZA 4PCVA 4UEWA 3NU1A 3U6LA 1RR6A 3NAMA 4ECAA 2LIVA 1FY2A 4NYMR 4ROSA 1WD5A 1BRMA 2FMXA 3W8RA 3TIXB 4ZYTA 4W6QA 4QDXA 2WTAA 4Y7DA 1XNRB 1U6JA 4CR6A 1W96A 1JHRA 5LZ9A 4AC9A 2W6PA 1EXMA 3D6FA 5FUQA 3VPAA 3A4NA 3QOXA 4A1FA 2Z8XA 1I9GA 1GKKA 1UT6A 2E21A 4RL4A 4IVRA 1VPDA 2FZKA 4B46A 3IE1A 3C5CA 1RWKA 5BWCA 4D3ZA 5IM4F 5DXFA 4MLCA 5IUNC 4AF7A 3AFOA 3GZNB 4BVAA 1Z12A 1Z62A 5HS6A 1Z06A 4JI5M 2WZBA 4RF3A 2I3BA 5DEIA 3IQDB 3O3NB 3G5TA 2O0KA 5K0CA 2EBHX 5KYGA 1KO5A 3DZKA 2W6MA 3T61A 1F2TA 4MKZA 4YDSA 2NYUA 4GITA 3IUQA 3ZY4A 3D1JA 2Q2VA 5A9SA 1Q1EA 1GLNA 3VNQA 3Q7RA 3RVDA 2CBZA 3HGMA 3HDJA 4F3YA 2XNJA 5FV4A 4RZSA 1O6GA 2BBOA 2BHNA 3IDOA 1NXVA 3RFXA 3MGKA 3NAQA 5GVSA 5ILQA 1CZLA 4MW4A 2IIQA 1V8FA 4OXRA 3HJCA 5I8PA 1Z0UA 4MV5A 3C0KA 4DS3A 4MVXA 2DF8A 4CLOB 2MWMA 2DWLA 2EF1A 2H00A 4O2BF 2FWPA 4XIIA 1PBNA 1ZXBA 2WWYA 1IY9A 1GILA 3DDNA 4Y6GB 1LQ2A 1LWOA 1ZCJA 1YQEA 4URWR 5H5JA 3ET5A 1T8PA 2UUAB 3KLNA 4Q7JB 3SS9X 4GQAA 3O26A 4EELA 1UBTS 4BNKA 1YCGA 1Y6JA 4CG1A 1PQ4A 5C4IA 3QX7A 2BSAA 1E3WA 4DANA 1CUKA 1U8YA 1ACJA 3NVAA 3H6HA 3WLRA 2ONJA 2PKYX 1FVXA 4QVGA 1C0LA 4R3WA 2EP7A 4Q6WA 5GP1A 2XT9A 2IPNA 5EERA 1KY2A 4PAQA 3DGFC 1NUQA 5KSYA 1N92A 4U02A 3Q98A 4XWKA 1WLSA 4DA6A 4F0JA 5CEJA 5FBHA 3DGEC 4YASA 2HWXA 1NOKA 2C5LA 1QZXA 3D6VA 5AIBA 5FXMA 5FYDA 2BFDB 3GZ4A 2VHUA 1OA1A 3ZD8A 1TU4A 1XRNA 5DIZA 1SMKA 4CM9A 4QTTB 3JYPA 3EC1A 3T4UA 2WHPA 3R5SA 5FUXA 2ZB7A 3INTA 4ACAA 2HWUA 2PUEA 5BV2P 1YAHA 1S2OA 2JVIA 4RVUA 5HJ5A 3FPLA 4OW0A 3HYLA 4KRFA 3TPZA 5TSDA 1N32B 1E4YA 4DCVA 1EWYA 4MGKR 2RRUA 4IRUB 2PUTA 1OXSC 3U80A 3BHMA 5A5DA 4LSZA 3BFPA 4G4SP 4DSAA 3JR4A 4GYJA 1LQTA 1TF0B 3DXXA 3QH4A 1AK1A 2P75A 4HX2A 2AZ4A 2WP8J 3S8EA 1FP4B 5DX8A 3HP4A 4DV7B 4K6KA 1PX2A 3P9QA 3L8CA 4YJ2F 3H3XA 3ODPA 3TINA 2ZIXB 3QKSA 3ZWCA 4B3RB 3SZUA 1YL5A 2HF9A 1WP4A 3LVRE 5B12A 3GNTA 4X66M 3LE8A 4JAVC 3A26A 5TMEA 1HZZC 1XCPA 1X80A 3BTUA 3OU6A 3HL4A 2X6TA 4NQZA 1UOEA 4PFSA 3CEMA 1ZVMA 1PWYE 3CPEA 1TU3A 1YOBA 1C8KA 3USZA 3ANNA 1SBZA 4NBKA 1NNUA 3VH4A 3PICA 5E1MA 4QGFA 1IVYA 1E2KA 2WIBA 1TPZA 1DJLA 4JOBA 3HLYA 2GN4A 4JNCA 1E79D 2XDYA 2OILA 2P77A 1OLUB 4DWVA 3GAZA 1PS0A 5DV9A 3E48A 2G28A 4L4RA 4FIDA 3RS5A 1DG9A 2ZRHA 1ZD5A 1P2SA 3HA2A 1ZMOA 1KP9A 1DC7A 4PAGA 1UM9A 4X3OA 2OTCA 3D6HA 4CQLB 3TL3A 4MLZA 1GR1A 1J5XA 5JALA 2C42A 2J7NA 1KMQA 5L8RF 3OF5A 3KT8A 2QP3A 1XJQA 3CN9A 2ADMA 1ZIOA 1RS0A 1CDZA 1MRZA 3FGPA 3F6SA 4A4DA 5GY7A 5H80A 2OO3A 4NCKA 5D1NA 4KQIA 2P6NA 4ND3A 4YRJA 5EKUA 4TTQA 1DEKA 3OCZA 3TSAA 2UVPA 1KSGA 4HEOA 4BNZA 3HO8A 3KOYE 4MGZE 1YD7A 5IT9S 4MVJD 1RPZA 4LIPD 1YQWA 5JC8A 1HK7A 5DH9A 3BX1A 3HUEA 5AVXA 2WTNA 3MHPA 3PXGA 1PWHA 2WJGA 2R79A 3ZHRA 4H27A 3EZ9A 4KDFA 3TNJA 1EESA 2DXIA 1REQB 2B9EA 3HB1A 3N6VA 3B3JA 2UUCB 4X54A 4L8YA 4Y2JA 4OLHA 3K96A 3BCHA 5GGXA 4GOKA 3MT7A 3DLBA 4XRGA 3G68A 1IUNA 1CRLA 1OTHA 2BCGY 5H4HA 4B09A 3N2KB 2QRKA 2QAGC 2H8KA 3KVRA 4NECA 5C80A 1HDOA 1EP3B 3V4ZA 4QSHA 3QPVA 1NNI1 3M6MD 2AFIE 2R1UA 1KI6B 1DUIA 2C96A 3PHJA 5CPFA 3IRVA 4AMUA 1WF3A 2EV9A 1OBOA 4J0KA 3W0LB 5C1IA 4HYQA 3HKCA 1KZ7B 1SRQA 4G97A 3ZWMA 5L3QB 2Z1MA 3DD5A 2XH8A 4REZA 2ZAMA 1JH9A 1NJ2A 2PMWB 3PXUA 1OLXB 4HY3A 4FZVA 5AVJA 5DU2A 2IWHA 3O8QB 2AXEA 3L1VA 3VMMA 4HLDA 4K6GA 3BZWA 4YO8A 4DXDA 2ZRBA 2I7PA 4W1PA 1C1YA 3CLKA 3G79A 4DDHA 1O94A 4BFCA 5EIXA 2H2FA 2O2HA 3EFHA 1L4LA 2DHYA 1U9ZA 4MRMB 1H6CA 3ZG6A 1BCSB 1U2TA 4Y28F 3T9DA 1M0EA 2Y0EA 1YL7A 2WQ7A 4Q9IA 3ZHUA 2XF2A 1MQ8B 1H0KA 5CM9C 4UQOA 3RLFA 3ECCA 4P6VF 1TUEA 2VA8A 2VZLA 1PR3A 3ZDXB 3SD7A 1P0IA 2I5PO 4C4AA 3JD1A 3IT2A 4L5CA 3RFWA 4NYJR 4DV0M 4WNAA 3PSHA 3V7WA 4RJ2A 4M55A 1C0IA 3UMGA 4FDMA 1KI7A 2W82A 3GHHA 4RY8A 1YU6A 4UE2A 3OZUA 2FUCA 4IXMA 1QYDA 2GARA 2PQ2A 4JHLA 1IBLM 3W77A 3UEOA 1S1MA 2O20A 4KPUB 4NU5A 4J91A 2EZ8A 2AH5A 2QW0X 1U4NA 2H52A 1RYMA 1T1EA 2YZKA 2ZB2A 1DIBA 1DTWA 4ND8A 2BTQB 3LYUA 1X0VA 4QATA 2VZ8A 1I8TA 3ZHZA 1A77A 3RREA 1T1RA 4IX9A 4O25A 4C2AA 4CKZA 1TZCA 2KXEA 1XDUA 3V1UA 1AF7A 3TZHA 3Q8MA 1PZXA 3LX5A 3P0RA 2W6NA 3NBAA 2PYDA 3R75A 4PHTA 3C6BA 1V6CA 1G3IA 2FLVA 1LD3A 1DINA 1E59A 3PJFA 2IZ5A 4LF7B 1JHPA 2PWPA 3J80S 5CA0B 5JSUA 5JE8A 1O89A 3QEBZ 3JAWA 1SHLA 1XK6A 1DX6A 3LT1A 4HGZA 4AKHA 4LYGA 2R48A 2RIPA 4GM1A 3D3KA 4D3XA 4UASA 3U6QA 2JI7A 4U9UA 4G8JA 2FETA 3WI7A 4M0KA 3EDCA 4LJ7A 2A1UA 4GPIB 1AN0A 2ALJA 2PZJA 4V03A 1I1HA 4ZV7A 5AVUA 1SZCA 3V48A 1M0TA 4KLAA 1IXKA 2QAGB 3DZCA 4FILA 4XYGA 3OEHA 4HYYA 1R4MB 3SIPA 5MN4A 2QIOA 3C3BA 1BYUA 1WCIA 4ZC8A 2C07A 3G85A 3I2YX 3DBOB 4N8SA 4DIOA 1TTPB 3RRBA 3HJAA 2HJ9A 1THZA 2EWWA 1OT5A 3B1XA 2IF0A 2OCDA 1GLGA 3ZDRA 3L25A 2D74A 4PLTA 5CBPA 4PG5A 3GMDA 1ULZA 4WZZA 3OCWA 1MTZA 2ODBA 3P45A 5HRAA 3RB8A 5L7TA 1HNZM 1V6AA 3NWBA 1Y98A 3CPSA 3FOCA 3RVOA 3EAQA 3KSBC 5KDLA 1SKQA 4JL5A 1PAUA 4UUBA 4ZMBA 4BP1A 1ND6A 4BNJA 5AM4A 1MENA 2CDBA 4I4TF 1L4UA 2P3QA 2VP2A 4NJEB 5IKPA 2WEKA 1C9JA 3KP0E 1TCVA 1TGVA 2C4WA 4O4JB 1KBQA 4LBVA 1HLPA 3UXYA 1Z0KA 5JS8A 2C5GA 4C76A 4KWCA 1WHSA 5EEHA 2QTFA 3R6LA 2NT3A 2MTBA 3IAXA 4F1WA 4QUAA 4BNDB 1VIDA 5AHKA 2IX3A 1O03A 1RXYA 2IYXA 4RVDA 4TS4A 3PNPA 2XUHA 5ITZA 3FG9A 3KKOA 3PX7A 4EJSC 3F4LA 1S3SA 3SZ3A 4KHZA 4A1OA 1T13A 5CB0A 1QU2A 4ODIA 3P9YA 3HWSA 3DJYA 2Y6UA 2B1RA 2AIRA 2PTHA 4IBIA 1GTL1 3RF6A 5C8XA 3JTEA 1PJQA 4MW2A 3N5CA 2BFEA 3PKIA 3EN0A 3NBFA 1OWMA 2PMEA 5AW8A 4JT2A 2W2LA 3JQFC 3F90A 1ZP6A 3RRFA 4MKXA 4KXXA 4IUDS 4P22A 3SE0A 3OZFA 1CLUA 5COQA 3Q7IA 3JQ8A 1OBVA 5FAKA 4H1TA 4QASA 5EIWA 4KLNA 2AI3A 4MGYR 2Y66A 4DMKA 2YJ3A 1H05A 1JXAA 1K27A 3VX3A 1R00A 3OFNA 3I4LA 4PYRA 1G0NA 1NSFA 3MLEA 3PGMA 4ACBA 1OY1A 2CNWA 2XEPA 2YXEA 2ZUUA 4EMTA 1EHCA 1V8DA 3RS3A 2FEKA 4QPZA 1QGZA 2PRIA 4X62B 3GJRA 2ANCA 1HE2A 3UWPA 4EPTA 4WCDA 3W0FA 1TKAA 2A58A 1AKUA 3ZHCA 1RRMA 3KUDA 4UCFA 1LI5A 4F2GA 4MVJP 5FOVA 3TOVA 3OZBA 2B3DA 5SICE 1P0QA 4B6QA 2F43A 3EPRA 1KYVA 3OO1A 4OJYA 1GTMA 1NXOA 1W4BA 1I4LD 3I1IA 4KQGA 2RDMA 2ZYAA 4C7VA 3F74A 2BONA 1G7CA 3D7NA 5L4NA 5FTJA 1MPXA 2B8JA 2W98A 1NXWA 3P0EA 3VBCA 5AW7A 1Z9BA 1ZCAA 2C99A 3UWDA 1DFGA 1YIAA 5AMXA 2GHTA 2J32A 1I3NA 5J4YA 5AKEA 4Z5XA 2G1KA 3T7IA 2X4GA 2B6NA 1X92A 1J22A 1CZHA 4LNUB 2P9YA 1DGHA 3FUXA 1Q02A 3GJ3A 2IYAA 3SHTA 4BYGA 4CV1A 1RRVA 2WIJA 3M49A 4ENPA 4MROA 3ONVA 1U0BB 2ZS7A 1XCOA 3Q2KA 4RTKA 3Q6IA 2AS0A 1ZJJA 3EBPA 3WGKA 3QNMA 4FNOA 4WZAA 4M0EA 1EJ2A 1SOAA 3O8NA 2VRBA 5LOVA 3PUYA 1E0KA 1YJAA 1Q1AA 2A88A 1XMQM 2WZCA 2AMJA 3ZXSA 2WJYA 1WZUA 2DMRA 3D2LA