3ZH9B

Bacillus subtilis dna clamp loader delta protein (yqen)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
339
Chain Sequence
MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETKDFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALESYIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQKTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFELINKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASNLKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA
publication title Insights Into the Structure and Assembly of the Bacillus Subtilis Clamp-Loader Complex and its Interaction with the Replicative Helicase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 339
sequence length 339
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06144 DNA_pol3_delta DNA polymerase III, delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zh9B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3zh9B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zh9B01
2BHRA 4X8LA 2ZRGA 1T0HB 4GPTA 3SOPA 1J90A 3GJ7A 1G8FA 2ZRJA 1J8YF 2GBLC 3U7FB 4NYIQ 2ZE8A 1RRPA 2HXSA 4FW9A 2BBWA 4QL3A 5FPTA 4GOXA 2ZQ5A 3KQUA 4IXNA 2OFWA 3FVQA 1P2UA 1FX0B 3CBQA 2J7PD 1G291 3TAUA 1A4RA 3IHLA 1JAIA 2JIZA 1JBKA 1PUJA 4MRVA 2A5DA 1R6BX 1BMFD 3NDBB 3NWJA 4Q9JA 5KNBA 1GP2A 4V0OA 4LHXA 4LJ5A 2P6UA 3BFXA 2XX3A 2CJWB 4LYJA 3SN6A 3HU1A 1NBME 4C30A 3BORA 4KLZA 1OV4A 5IK2A 4ESVA 1OIWA 2JAQA 3LQRA 1QHSA 1XP8A 1VECA 2R9VA 3PEUA 3NDPA 2FF7A 3RDPA 1F2TB 1IOZA 2D4HA 4BECA 3VQTA 2W0MA 2Q6TA 1NVVR 3K1JA 5DIFA 4B35A 1U0JA 3I1FA 4X8HA 4PQYA 3UK6A 1X37A 3AB3A 1Q57A 4W5WA 2ZRKA 2ZRLA 1GITA 3IHWA 3K53A 2BMEA 3GFTA 4WAUA 2Q3FA 4BLOA 4M1SA 3U3MA 2WJGA 3R7WA 3WNCA 4CIDA 5L3SA 4MGYR 2DHRA 1RRFA 3CNOA 3DMNA 3U6BA 5FR2A 4NZYA 1II8B 4IEIA 3NIBA 4MUBA 1QVRA 3MCAA 5CK5A 3K0AA 5DGXA 4US0R 4PAMA 3OZXA 2FPMA 5DN6A 3P27A 4Q1AA 3EA0A 2GXQA 3KKQA 3MWKA 1M7BA 1Z29A 1VIAA 4AD8A 3VR5A 2D2FA 2AXPA 5JRJA 3DO6A 2A7QA 5SZIA 1L4UA 1OYWA 2HJVA 4JLDA 4JZKA 2G83A 4TSFD 4V0LA 4W7SA 2QA5A 1XPRA 2XZOA 1AJEA 2EQBA 2GBLA 3E2IA 4Y0VA 1TMKA 4LPSA 1E2QA 1FMJA 5JLJA 4BLQA 1OXVA 3RS0A 1KZ7B 4H1UA 2J45A 2Z43A 3ZYCA 4B34A 1QG4A 4JL5A 4B3XA 1HT2E 3WP0A 1JAHA 3CX7A 3AVWA 5IF9A 3MJHA 2IYTA 3P1JA 2IX3A 4Y0AA 3U44B 2ANCA 5DYIA 1PZNA 4KLNA 1NY6A 2WKPA 4P31A 4BZQA 3A4MA 1C1YA 3IO3A 1KK2A 4P32A 2ZRPA 5EZ5A 1NKTA 3VR4A 3Q9LA 3WY9A 1W2HA 3BS4A 3SNHA 3H86A 4LBZA 2ERYA 4B2LA 3KB2A 2P5TB 2NO1A 1E1QD 1VYVA 5CDFA 2KE5A 1X6VA 4TQUS 2XB4A 4YONB 2QM7A 1CRPA 3RRMA 2A2ZA 2KBFA 4TTQA 2D06A 4DZZA 3QE0A 5LDDC 4HATA 1RRCA 4OI2A 2NO0A 4R2IA 3QKRA 2YKGA 1G7CA 5F98A 2ZI4A 4X8OA 4G3XA 4C0HA 2OHFA 3D3QA 4PHHA 2R6CA 2WMNB 2ZRFA 4A1FA 2HF8A 3LX5A 2Q3HA 2VSXA 2BKUA 4GFDA 2A5FA 1R5NA 1CEEA 1E0JA 1I4TD 4LJAA 2ZRBA 1G41A 4D82A 3EIQA 3K0FB 5LBIA 1D5CA 4QGHA 4DLUA 3WXMA 3NBZC 2P5SA 4C0QC 3RSLA 2JJ8A 1M6NA 421PA 2ZYVX 4PFSA 1W4CA 5E7IA 4GSYA 1X8LA 5SZJA 1J7KA 3SE0A 3SC3A 4DBLC 3GLHE 2YJTD 3AKYA 5CYOA 4DCUA 3CW2A 2ODNA 4NYMQ 1Q3TA 3TVDA 1EGAA 4NONA 2VP4A 1S2MA 4BZXA 1OXTA 3JZAA 4JL8A 3Q7PA 1E2FA 2WSSA 3W34A 3T12A 4D2IA 1ZAKA 2QE7A 4IDNA 1WXQA 3G0HA 2DVWB 1E4VA 1UBGA 4FMDF 3SBEA 3SHFA 2AXNA 3I4LA 1FX0A 2DYKA 3K70B 3BRWD 4P4SB 1KI3A 1GL9B 1U99A 3TAHA 4CVNA 1BYIA 4MYHA 2JJ1D 4JVLA 1ZMXA 3I32A 2P65A 2REOA 3IBYA 5FPSA 1JXMA 1PUIA 4WZAE 2QPOA 2ODEA 3LWNA 2CJWA 2FN4A 3F3YA 5JEEA 5FOSA 4QGGA 3GD7A 3EZ9A 3MMPA 3U61B 4DIDA 1G8PA 3FPAA 1L2TA 3CWQA 4IVPA 4IXMA 1II0A 4JJKA 3ZVRA 4KAXA 5EP3A 3A6PC 2AK3A 1F2TA 4QM7A 2ORIA 3C41J 4PO8A 2X8AA 2GJSA 4P33A 5G41A 4JLKA 4LJYA 1RIFA 5EP1A 3T15A 3QOFA 1EK0A 1EFCA 4C9BA 3A1TA 2XSZD 4HDCA 4HLDA 1HE1C 1YZUA 1HQCA 3DZDA 1QHXA 2NZJA 5CM9C 2FNAA 3PENA 2QAGC 2GJAA 1N6HA 1EFRA 4NTZA 4PAOA 1TTTA 3R9IA 2D2EA 4FWGA 1DOAA 1Z6TA 3C4JA 2J5XA 3MFYA 1II8A 1E0SA 5AUNB 1NMXA 3QEOA 1BOFA 2XXAB 2CE2X 4B71A 2DB3A 2VA8A 4Q4JB 2J9RA 1KSJA 2JLWA 5C1BA 1ELOA 3TMKA 1XTJA 2J0VA 2C98A 3TGPA 4XSGA 3UMSA 4LDJA 5CB8A 2EFCB 1UKEA 1YQTA 1A7JA 1N5IA 1D2EA 2E87A 1OB5A 1P61B 1TEXA 4A0FA 3QKUA 1TL7C 3P20A 1B0UA 3VTKA 3THYB 4M22A 4Q9HA 2JDID 4UJ5A 3CNNA 5K8UA 2C5LA 1JPNA 4M1KA 3A1UA 2AKYA 4Q4HB 4W5JA 1H8EA 1W46A 1NLZA 2PJRA 2ZYTX 1UFQA 3CF0A 2CLDX 2H16A 2GVZC 3K70C 2XNDD 2FGKA 5JBQA 4HB4A 4PHGA 4ZKEA 1JNYA 4XH9B 5BYKA 5FTNA 1HYQA 4G5GA 3U44A 3TQFA 4F4IA 4ZV4A 3DKVA 2QP9X 2BV3A 1D2NA 3QBTA 4HAZA 5GADl 1F48A 5A4JA 5KTYA 2AN9A 3F8TA 2W83A 1KI7A 1LW7A 2DBYA 1TU3A 2ZE6A 3DEFA 1UEJA 3GJ4A 1HH4A 1ZM9A 4JBYA 1X3SA 3GP8A 4A0RA 1F6BA 1VG1A 4DRZA 2QL6A 521PA 2P6RA 1I2MA 1E99A 2IK8A 5FPKA 3LX8A 4BFYA 1GL7A 5C4MA 2GTPA 3AF1A 3UMFA 1MH1A 1VG0B 4JMPA 2EW1A 4NP6A 3BE4A 4Z51A 1E2JA 1U8YA 1CF4A 1HV8A 3ETLA 1DEKA 3K0FA 2ZUDA 3KXLA 4YMSA 2OLJA 4OHWA 2WM9B 3CTDA 2ZSAA 5TV2A 3RS4A 5F3WB 2NO9A 2GAAA 2PZFA 2CHGA 2N46A 1MO3A 4UJ3A 2FJUA 1W36B 3CRW1 1JI0A 4AYTA 1TU4A 4LK2A 2EU8A 5JECA 2OG2A 3WBJA 2UZ3A 3LH5A 1D8TA 4M0LA 4F4CA 2ZI9A 4YMWA 4NYJQ 2BCJQ 3TE6A 3CF6R 4Q01A 5J5CA 1CKEA 1KI8A 1N6RA 1N6IA 2BMDA 2QEQA 4JLBA 3T5GA 3TUIC 1W5TA 3U60B 4JN6A 4MRPA 3AJIB 1XMVA 2VF8A 2FSIA 5AUPB 2D7DA 5DE3A 5ANRB 2ZE5A 3P32A 1DG3A 4KO8A 1VPLA 5AK0A 3QPWA 2P6NA 2C2HA 2JLZA 1E1RA 4P4SA 4UNSA 2QM8A 4JLPA 1KAOA 1Z5ZA 1ZD1A 3A36A 2C9OA 1M8PA 1V43A 3CPJB 4RCYA 1OSNA 1E2HA 1VYUA 1XMSA 1Z83A 4KU4A 3OE7D 4KCGA 3KUDA 3C5CA 4PQRA 1XXHB 1KY2A 721PA 4URYR 2OILA 3GJ3A 3WMGA 1P9WA 3T5DA 2RGCA 2GEVA 2RGXA 2C78A 2WIBA 1COWA 2HDNB 3FHCB 4M1MA 3FTQA 3X2SA 1NNEA 2MSDB 2IS4A 1G8YA 4ZCIA 1TAGA 3ZZTA 4B44A 4BFWA 2BC9A 1E2LA 1S9HA 1G17A 2FZ4A 3A8TA 1W7AA 1AN0A 4YQFA 1FTNA 4Q4AB 4AIIA 2EFEB 1ZBDA 2ZUBA 3L8YA 4RD1A 1OPXA 4RVCA 3VKGA 3W3AA 3B6EA 4A15A 1KDPA 3JVUA 1I4DD 1W5SA 4CEIB 4I1OA 1VCNA 3UWOA 2R65A 5K8LA 3UIEA 3PUYA 4XWAA 4WZBE 1TUEA 3OAAA 2DZNB 4CZ2A 2XXAA 4Q4JA 5TARA 3MLEA 2RGAA 4TL8A 1UEIA 2WKQA 1RE0A 1DS6A 1XJ0A 2D3WA 3DHWC 4TLDA 4AWXA 2PEYA 3SEAA 1W36C 4CYMA 3EC2A 3OEEA 2B8WA 3A4NA 5C18A 4LPKA 1IN8A 2H8KA 1PLKA 2FFQA 3W8RA 4DIEA 2Q21A 4K46A 2GEDA 1K5GA 2PMDA 1ONBA 1SVMA 2Z5FA 4MYUA 4HAWA 4A2PA 3RANA 4MKGA 3PR1A 3TVTA 3ADKA 5JHGB 3THYA 2IW3A 4XTRA 1IN7A 1E9SA 2RB4A 3MG9A 1OKKD 4PPGA 4IEEA 3OIVA 4DDVA 4TYYA 2ZSBA 2GXAA 4YMTA 1CJKC 4Q4HA 4UNQA 3WHLA 1MRNA 2XZLA 1G4AE 2XTZA 1UADA 2NO6A 1R7RA 5H68A 5FH9A 1AKEA 1WBDA 4IDPA 2ZRNA 3GQBA 5CITA 3LD9A 1T91A 4OI4A 2CMKA 3C7KA 1AZSC 2HYDA 2W6ID 5BN4A 4QBFA 4RD2A 2CVHA 2GEUA 3W3ZB 4I1VA 1CR1A 4PSVA 1N0UA 2IWRA 1NIPA 2O52A 4AKIA 3IQXA 3QKSB 5GJWC 5UKDA 4YMUA 3SQXA 2OXRA 1GL6A 3SHWA 4R2HA 2GWHA 2F55A 3QENA 1EXMA 1ZIOA 4XD7D 4V0NA 1GNQA 2OBMA 3AVUA 1P4SA 3EXAA 2DY1A 4JJZA 4OKSA 2JCSA 1AS0A 4BEBA 1BKDR 4TN1A 3TRFA 1UBEA 2IC5A 3DPUA 1WA5A 3NHBA 4DSUA 4TYPA 2Q0HA 4QOSA 3DOFA 3GJ8A 1KJYA 1ODFA 4JVMA 2Q9BA 4V0ME 1CJUC 2OZEA 3T06B 2N42A 2ZPTX 3K09C 2G1JA 2QUZA 5CJ2A 2F1IA 1DAIA 1KI6B 4G1UC 4RD6A 4US2R 5GJCA 4HI0E 2VTKA 3QY0A 1G7SA 3MGCA 1SXJD 3R9WA 2JASA 4BLRA 1SHKA 2QI9C 3BXZA 3SS8A 1JECA 2B7BA 3TNFA 4PPQA 1TEVA 4OI1A 4BRWA 3DDCA 3AKEA 2ZI3A 4Z8XA 3VLFB 3GEIA 2OCPA 5B58C 1WDTA 4Z1MD 1GFIA 3CB4A 4PTLA 4WA7A 4LRSA 5AJVB 4B47A 3W6PA 5J4HA 1KKMA 1XTRA 4GRAA 3EZ2A 1E9CA 1Z0IA 2QP4A 5EE1A 5FTMA 4B33A 1JPJA 1E79A 2PMKA 2WPDA 3KKNA 1QBKC 3A1VA 1KK3A 5FL7A 2ZR0A 4XJXA 3VU9B 3WP1B 3IGFA 2YNMA 3RRZA 3LLMA 1RKBA 1FFHA 3EARA 1QHNA 3BJIC 2VQSA 4QGAA 2QT0A 4A2WA 1C1KA 3NHAA 4IOKA 1CJTC 4MKIA 1W44A 5F9HA 1NJGA 4AYXA 1GTVA 4EPYA 2ZJOA 1SXJE 4WOPA 5IRCD 2IS2A 2IYXA 1JR3A 2XTNA 2YZ2A 3DVLA 5FBWB 2C95A 1LFDB 3KKMA 1XXHA 4Q4LA 2D62A 2J0UB 2V9PA 4DJTA 4E09A 3GLGE 3LXRA 3PUVA 1CTQA 1IBRA 1QHHB 4TYQA 5ELXA 2PT7A 4XTCS 4QFMA 2H1LA 2CEAA 1TADA 5JWRA 3Q72A 1NVWQ 4PR0A 3CPEA 4BZPA 4DB4A 1O3YA 4HAXA 4KFTA 4P3YA 4QC2A 1BO6A 4WVFA 5KSZA 3PV0A 1Z2AA 1AZTA 4G5OA 3F0TA 2OAP1 2F3RA 2WSMA 1Z3IX 2X1VA 3AVTA 4Q4AA 4XWKA 1GSIA 3R20A 4N3NA 3ADCA 3FHTA 2OAQ1 1YHNA 2A30A 2GA8A 3FYHA 3HR8A 4BFSA 3PUXA 1P2TA 1P3JA 1S4QA 2QNRA 3P4XA 4MYCA 1UF9A 4YLGA 3AUXA 4CEIA 1UKYA 1XU4A 3B1YA 1E2PA 3EG5A 1AQYA 5JFGA 1E0AA 2KBEA 2CHVA 2ZS7A 2IUSA 4EQ6B 5DH9A 5FFMA 2WJVA 2XJ4A 1KSHA 1IQPA 4QRHA 3V4RA 3I62A 2WICA 3OFNA 2QY9A 5FTJA 1CR0A 3HWSA 3P4YA 2A5GA 221PA 4V02A 1G8HA 3ASZA 4JSYA 1S0UA 4AYWA 1OYYA 1XCPA 2A9KA 1G21E 3AKDA 2XGJA 4A92A 2R62A 5GJVC 3UG7A 3R9XA 1SKYE 2WZQA 3BFKA 1DBSA 4TLCA 2YWEA 1UKVY 1Z6AA 1P62B 1ZNWA 3TSWA 2V55B 2HT1A 3HPQA 1HY3A 1NVUQ 3OIWA 4E03A 2J7KA 1UM8A 4EFLA 1VCOA 1DELA 1NBMD 4OQMA 2W2XA 2C77A 4LHZA 2L0XA 5HR5A 5JCZA 5E7JA 3QKSA 4NE2A 4MITA 3CIOA 4P0TA 3QF4B 1JQJC 2B21A 2C9YA 5LB4A 4M2LA 1R5OA 2RGNC 3IIJA 3B2EA 2VP5A 1RPZA 3MRSA 3SR0A 1NF3A 2AFIE 1E3MA 1KI1A 1R0ZA 3OHMA 1VIYA 1ZNYA 4MGKR 2FEMA 3ND9A 1KIMA 4DEXA 1P9RA 4PC1A 2R6DA 2YWHA 3I8XA 2GF9A 2GJ8A 3EAQA 1G19A 4NH0A 4OK5A 4EPTA 3OESA 3RS2A 2R9GA 1U90A 2CCKA 1KI6A 1Z0AA 1TNDA 2TMKA 1Z28A 4G0NA 3ADBA 1NN3A 1E2DA 4KFSA 4BFVA 4D4KA 1FZQA 2O8CB 1T3HA 2DR3A 1CR4A 1SZPA 1IN6A 1GKIA 3SJAA 4YMVA 3EZ6A 3K0CA 3K9GA 4JLMA 2FEOA 1CXZA 4ZCLA 1FUKA 1YRAA 3QG1A 3RNLA 1RW4A 2WAXA 4MA4A 3FMPB 4ABYA 5CDFE 2H7VA 2BIFA 3AQ4A 1RYFA 2ZR9A 4GNKA 4HLQB 4DLRA 1S9DA 4BPBA 5M04A 4RJLA 1EX7A 2WSSD 5KDDA 2QE7D 3NG1A 2ZJBA 2FFBA 1U81A 3U7EB 4F91B 1YZQA 3ZIAD 4NMMA 4Q03A 3IEVA 4OHYA 5EUQB 3VNUA 3RRYA 2P0EA 3VU9A 2FDCA 1XEFA 3V00A 1P60A 5L8VA 4IVRA 3BK7A 2OT3B 1YZKA 4K81B 3SFVA 2XOKA 1E2NA 2W2TA 1G4UR 4PPNA 3AVVA 2V1XA 4U5XA 1CP2A 3CH5A 4HAUA 3UG6A 4B6EA 5JCPA 2ATXA 1R8SA 4NPHA 4OHXA 3FOZA 3WHKA 4NKRA 4GP7A 2J0UA 2WJHA 1G3MA 2QW6A 1QHHA 3CH4B 4JS0A 4PXAA 3MAAC 2FV8A 2JLSA 2RGNA 4A8JB 4JLVA 1XCMA 4NU0A 2DFLA 2C9CA 3SYLA 2RGEA 2Q3MA 1ESNA 2PZGA 3N5CA 4HEJA 4M9XA 1ANKA 4RZ3A 4UXIA 3JZMA 3H4MA 4URVR 1DAMA 3G82C 2NQ2C 1ZNZA 2AX4A 5HCIA 3LXXA 1TQ2A 4MRSA 4B76A 4L4UA 3RS3A 3IKJA 3LBIA 3FMIA 5EUMA 1CULC 1XRJA 4TT3D 1BIFA 3QG5A 3O47A 3SJCA 1EFRD 5DHAA 1M1YE 3THOA 4IFBA 2JJ2A 1LV7A 4LBYA 4NYIR 5E4FA 4JSTA 2OESA 3PIRA 2WOOA 4QNMA 4IKEA 3X1XA 2WTUA 2PEZA 4XVQA 2BMJA 4KVGA 2GETA 4ITRC 3NBFA 1DAKA 3UXMA 4AI6A 4EQ6A 5FTKA 1OIVA 2WWGA 3QPVA 2BM0A 3F5FA 3GJ6A 2BCGY 4FMBB 2C99A 4YC7A 1FP7A 3HU2A 1ZYUA 4RY2A 4URXR 1A82A 5AJYA 2VF7A 1AQUA 1JJVA 4PHFA 3TR5A 4HB2A 2LKDA 2LCFA 4QKQA 5FL3A 1ZCBA 5KOYA 1ZP6A 2QTFA 2RH5A 2YOFA 4FXPA 4LV8B 4QG7A 2ZM5A 3I5XA 5FUVA 4O0MA 2OUKA 5KHOC 3B85A 4FMCB 1H8ED 1LNZA 2PLRA 2CK3A 2GF0A 1W0JD 1YR6A 2XITA 3LY5A 3AUYA 1FTSA 5FBQB 4ON9A 2ATVA 1XD2B 3I72A 4TZ6A 2CNWA 1RZ3A 4KFUA 2WWHA 1G7RA 4LYHA 1N6KA 4DB2A 4B73A 3QQ5A 1WCV1 2KRKA 1Q44A 4IHQA 2VO1A 2REXB 2O8DB 2JA1A 1ETUA 1YZTA 3DOEA 4K8OA 4UKDA 4A9AA 4B32A 1KI2A 2G6BA 4TQAA 2KJQA 2E9SA 1W49A 5GJBA 1S8FA 3QF4A 2J0SA 3CWZA 2WWXA 3KB1A 3KXIA 1VHTA 4R98A 1U9IC 4HLCA 5FOXA 1P6XA 2IYYA 4PSAA 4AKHA 2FPKA 1SVSA 4PZZA 3AP2A 3BFVA 4QBHA 4BUJA 3T1TA 3EWSA 5DYGA 2BBSA 3TIFA 2NZ8A 5F2EA 5H70A 1IJEA 5G3ZA 1YZLA 1A5TA 3J81k 2ZIAA 2W2VA 2G88A 1GAJA 3TSOA 4Q1CA 5EXSA 4LC0A 4LY6A 5JI2E 1U98A 3AGQA 4BLPA 3NC0C 4LHVA 5JS8A 2V3CC 2RMKA 2FFHA 1FOEB 1L4YA 3U7HB 4QHYA 2ECKA 4I99A 1MO5A 3B5JA 2O8CA 5CM8B 2V1UA 4C2UA 4JL6A 3Q8XB 5AR1A 2OFXA 3UPUA 5FUWA 1GILA 4YXWA 1KGDA 2GKSA 3ZGXA 2QTHA 1EFHA 2B7CA 3BB3A 3U6KA 4WIAA 2W6JA 4KI0A 2V4ZA 5P21A 1FPMA 5J4LA 2QU8A 2EYUA 3DM9B 3A58B 3L0OA 4IDOA 4M4SA 4G5SA 2B92A 2QSYA 4ESHA 3Q5EA 5TB5A 4O3MA 3SJBA 1XPOA 4U7DA 2GK7A 3SDZA 2ZS8A 3K70D 1E1RD 4GI7A 2FH5B 1IN5A 1N0VC 3UWKA 3QJYA 1X86B 1QDEA 4Q7JB 3RAPR 3TUJC 3RLFA 2PX3A 1KDRA 4LYAA 3OEHA 2IYWA 4ASUD 3BD9A 3U2QA 1RYHA 2ZJYA 2YWFA 1E2IA 1E98A 1Y3AA 2VP2A 4F4JA 1COWD 1ZNXA 1MO4A 4UXJA 1XEWY 1US8B 2R2AA 1CS4C 1U9IA 2ASEA 1G6OA 2FSGA 3C8UA 4R9UC 4OQXA 4A8JA 4BFZA 4BFUA 5G40A 3KKPA 4UNRA 1TX4B 2VSOA 5TXGA 2PJZA 1QG2A 4LHYA 3EPLA 4S2EA 3E5HA 2V7QA 3KJEA 4PX9A 4EDHA 4C0BA 3PQCA 1PLLA 1YE8A 3GCGA 5IHPA 1SVWA 1AS3A 3RVBA 5DO9A 3LVRE 4NYMR 4MGZR 4A36A 3FMOB 3EX7C 4ZDIA 5L3VA 3ZD7A 1HA3A 3KKOA 4JLOA 3WYFA 2WWFA 5TVKA 4II7A 4ARZB 2RKOA 4DVGA 1XMJA 2D74A 4OQFA 1D6JA 4AC9A 3OAAD 3X1WA 3CR8A 1OXSC 3NXSA 4AK9A 4HDOB 2IEYA 1WP9A 1GUAA 3S1AB 5HE8A 1W2GA 3FKSA 1RVDA 3OEED 2ZJ8A 3IPXA 2IF0A 1M7HA 4KHZA 2X2EA 4O2RA 2H17A 3LV8A 4BASA 3GJXC 4IOMA 4DLTA 3BAFA 4TMKA 3KFXA 4CT5A 3B82A 1SVOA 1G3UA 2OEPA 8OHMA 4PC7A 4EPWA 821PA 3UMRA 3HJNA 4IDHA 4IRUB 1OH5A 3QIAA 2PT5A 1G7TA 4GT1A 3TH5A 4IJMA 1W0KD 2MSEB 3KW6A 1KI9A 4M8NE 3BGWA 4WZ6A 1HQYE 1XD2A 1UJ2A 3TBKA 5JHHB 2FU5C 1IY0A 3T35A 3LA6A 2SHKA 4EJSA 1ZCAA 1IAQA 3SYNA 1TF2A 1NVMA 4JLJA 4XSHA 3AEZA 2KSQA 2J46A 1T3SA 4GDFA 1CJMA 4AG5A 1IXSB 3B9PA 2LKCA 4FD2A 1F2UB 4BEJA 5KUTA 2GZHA 4JKYA 5LPNA 2O8DA 2W0SA 2PBRA 4BE7B 1T5IA 2FX3A 3PCRB 3ZQ6A 2I1QA 1J8MF 3FWYA 3WRXC 4DUGA 4QBGB 4QHSA 4Q9KA 2ZI6A 3BH0A 3LAWA 2GXSA 1G1MA 5G3YA 2C04A 5GVRA 4PANA 2FSFA 4FI3C 1U8AA 3GFPA 2REBA 5HZHA 1Z06A 4CF7A 3IBGA 4GOJA 1EWRA 1NKSA 5JS7A 2R44A 5CK4A 3EPHA 3KQHA 2F7SA 3C16C 5B30A 1NRJB 1ZVQA 1KI4A 5JJKA 2I1VB 2JLVA 4UQOA 1R2QA 1JJ7A 1ZM4A 3U7GA 1EWQA 2NOAA 3RC3A 4BRUA 2OE2A 2CDNA 5FUYA 1VG8A 4Q1FA 1CBUA 3QEJA 4LV6A 2IYVA 3RABA 1W36D 2OSBA 4FMCF 1Z22A 3CZQA 3VAAA 2V6IA 4L15A 4DCVA 1N0WA 3BERA 1OH6A 3RC8A 2GZDA 5HKKD 2J3EA 1SULA 1MT0A 4IVQA 1H8HA 4OHZA 2P67A 2Z6VA 4DLVA 2WHXA 1E79D 5DNYB 2WPDD 5JMTA 5FL7D 4F38A 2BMFA 2PCLA 5E95A 4M9QA 3B1ZA 3T34A 4BLSA 5JWHA 2Z4RA 1LS6A 2UVQA 5IT5A 5KO2A 3QBVA 2JATA 1MOZA 1S3GA 3HYRA 1SVKA 3W5IA 2DWQA 2DZOB 4CT4B 4OJQA 4NCKA 1EG7A 3QUSA 2KI5A 2VHQA 3G5UA 2J59A 3PUZA 3WYGA 2GJ9A 2WJYA 2YC4C 1J70A 3W90A 4P4TA 621PA 2PZEA 2JDIA 4LI0A 1C9KA 2WWWA 5EE3A 3WBKA 2ORWA 2F1HA 2EWWA 2ZVPX 4LZZA 3GLFB 1VHLA 4CDGA 2ONKA 3CM0A 1DAHA 3HP1A 2ZR7A 4LRWA 3TKLA 2DFKB 1F5NA 1US8A 3TJZA 4Q7LA 4B3FX 4E07A 2XNDA 3HR7A 1X8JA 4JBWA 2QBYB 1E32A 2RHMA 3EW9A 3PEVA 4YDHB 2NIPA 2IYSA 1IHUA 5KPJA 4RZ2A 2ZRHA 1TPZA 2HXYA 2IF2A 4IOJA 2ZROA 3VR1A 1A1VA 2DFTA 2VRWA 4D0GA 4D25A 3N2IA 4PQFA 2GCPA 3VX4A 3D31A 3UKDA 1ZD8A 3GPLA 1ZUHA 4MYTA 4PAQA 3TW8B 1HEIA 4NYJR 2HYIC 2WKRA 2OBLA 1XEXB 4OL0A 2FSHA 5JSZB 5KU1A 1T8TA 3NH6A 2NGRA 3QXCA 4HLUA 2Z4SA 1KO4A 5FTLA 3ZVLA 4ARZA 1JR3E 1E2GA 2GCOB 3FB4A 4Q9IA 1KNXA 2EVWX 1XXHE 1Z8FA 1S96A 2HLDA 2HCBA 1AK2A 1DADA 1P2VA 3S1AA 3U5ZB 4P4UA 5EJEA 3OFND 3R8FA 2DWZB 3WYAA 4EPXA 3ONWA 2A3RA 1FQKA 2QSZA 3C14C 2OM2A 2YYZA 3PG5A 3I73A 3LO5A 4PO9A 3CNLA 3CO5A 3H0KA 3CRRA 4HDQB 5DI3A 1N6LA 5DI9A 2GK6A 2Q9CA 3KDSE 1E2MA 2NPFA 4HZUB 3T1OA 1DO2A 4KVAA 2AK2A 5AJWA 5FI1B 1N6NA 2CXXA 3ZS9A 4B3CA 3WMFA 4QBIA 4ZI2A 3VKHA 2MSCB 1E96A 2XTMA 2G1KA 4BWYA 3KJIA 4RCZA 4A3VB 3VFDA 3LW7A 2Y8EA 1C4OA 3MWLA 1XCGB 1MABB 1YJ5A 1VMAA 3AVPA 4BLTA 3ZVNA 5J4KA 2BKEA 1F2UA 3AH8A 4UNNA 1XZPA 1W48A 2ZRAA 3L2OB 4NBSA 2H18A 1HURA 2WBLC 1L7VC 1J99A 3LW8A 2BEKA 2EWVA 2ZUCA 2IWHA 4B48A 1X1RA 1TQDA 2D7CA 4V0KA 2W00A 5CLLA 4W5HA 4F92B 3LFUA 5D3QA 3X1YA 3K8YA 2ZJ2A 1N5LA 5EP2A 4AY2A 4ZI3A 4US1R 2QGNA 1NVXQ 1AGPA 2UZIR 3ADDA 1Q1QA 2H92A 3AV0B 3ZVMA 2ZANA 3M1IA 1O87A 2AWOA 3AF0A 4KJZA 2V8OA 2JIZD 1KKLA 1NJFA 2WOJA 4HUTA 1Z0DA 1E9AA 3A1WA 4MKFA 2BDTA 3H1TA 4RFSB 2BWJA 2AWNA 2IYRA 2RHDA 1NY5A 4ILEA 1G64A 3VR6A 3MHVC 1P5ZB 1OHHA 3A37A 3GLIB 4DCNA 1WE2A 2CLSA 4DC9A 4DT1B 5IK2D 1DE0A 3KQLA 3VKWA 1FNNA 5KSPA 3K9LA 2BJWA 3NH9A 5B64A 2QMUA 4TL7A 2V6JA 3RS7A 2IYZA 5HZKA 1KY3A 2ZRMA 3LDAA 1KOFA 2F9LA 2NO7A 3GMTA 1OFIA 2AFHE 3I5YA 1G8GA 4D80A 3AVOA 3BH6A 2ZTSA 5C4GB 1HE8B 4PZYA 1X8KA 1E6CA 1P9NA 1VYTA 2ZSEA 3FHOA 4ACBA 5JJLA 3PFIA 4TMWA 2YOHA 1KYIA 2FFAA 2ZE7A 4CW7A 4FWIB 4TZ0A 1PJRA 1U94A 3THXB 4ZIRB 1U2RA 1N6PA 4IW3B 3RSOA 2G0TA 2ZYWX 4NDZA 2B8TA 2VHTA 2OLKA 2RCNA 4LWZA 3KTAB 2VSFA 1GG2A 5DISB 1FP6A 1ZM2A 2RGGA 3U3KA 4FIDA 5DN6D 1DO0A 4HB0A 1QF9A 1GVNB 3EZFA 1UDXA 3K0EA 2V6ZM 3K0CC 3QVVA 3PUWA 3GLFA 1N2CE 3IQWA 3MD0A 4OJKA 1TQ6A 4FCWA 2F1RA 4G5RA 2W6IA 4TLAA 2QBYA 1OFUX 1XWIA 1NVVQ 4AG6A 1EFTA 3KL4A 2O8EB 2QQ0A 1CRQA 4LV5B 1R0WA 4PC3A 4PSKA 1Z0KA 2IUTA 1ZD9A 3TQCA 4KXFB 5FOUA 3B1WA 2J41A 3B9QA 1K5DA 3EA5A 3GFOA 1QHYA 2ZI7A 3MWJA 4KBFA 4JIMA 3B7GA 2OBNA 3RS5A 1UBFA 1XEXA 4KITB 5JSZA 4XD7A 1OFHA 5BWMA 3DKPA 3U3JA 2N1BA 3B60A 3NEJA 2GCOA 5LB2A 3A4LA 2I4IA 3EIHA 5FBRB 5EP4A 4Z1MA 2CCGA 3CKLA 3L0SA 4LX0A 1U0LA 2KB0A 4XOIA 3Q7QA 2DWOA 1NMZA 2G0NA 4TL6A 6Q21A 2IA5A 2QORA 1XTIA 1GNPA 3DMDA 4Z54A 3NBYC 1K6MA 2WWYA 1ZC4A 1T4GA 1GWNA 1G5PA 4D0NA 2MMCA 4BFXA 3B8HA 4HZUA 1X1SA 3B1VA 1WB9A 2GESA 3RRNA 2G9NA 1TQ4A 1W47A 4MRNA 4DLWA 4GL2A 2GILA 4CRWB 1GRRA 4Q19A 4HUQB 1CU1A 4RD0A 2IHYA 1IY1A 2IXGA 1D2MA 3IDQA 1H65A 3M0EA 2O8BA 3ZS8A 1FW6A 2BBTA 3QXJA 1T0JB 2OO7A 2ZSFA 2GJKA 1NIJA 3FKQA 3GJ5A 5CIQA 3L82B 2JLYA 1MABA 1EESA 4OI0A 1YU9A 5FOTA 2Z83A 2C03A 1T9HA 2JLUA 1ZW6A 3HPRA 1KMHB 5J4VA 2CLCX 1KO7A 2P3SA 1W4BA 1P7CA 4QXAA 2QENA 2YOGA 1XTQA 3Q5DA 2VBCA 3M6AA 4DEYA 1PVOA 3L0PA 2XJ9A 4RD4A 1GKUB 4LHWA 1NG1A 4AURA 3KXKA 3W6NA 3OIYA 4EIWA 3KZ1E 1KK1A 3SQWA 3DL0A 4C3ZA 4QNRA 2QT1A 1KO5A 2ZS9A 1G20E 2EFHB 4A4DA 1MR3F 4B75A 4L9WA 4FCVA 4E22A 1QRAA 1KZGB 4LBWA 1ZJ6A 5JWOA 2IUUA 2FZLA 2V54A 3LBNA 4WW0A 4RFSA 5B57C 5K8TA 2VIIA 4RKEA 1UPTA 3IILA 3ICEA 3U3OA 3RHFA 2HCJB 4B3GA 4B2PA 3ECCA 1NSFA 3VX3A 2YWGA 3QPUA 3QNUA 1KDOA 3GLIA 2IL1A 1IN4A 1LF5A 4DT1A 4G5QA 5CLQA 4OQNA 4YXWD 2VPPA 2XB2A 1V5WA 4U02A 5AJXA 2ZETA 4HB3A 2OV2A 2AL7A 2CE7A 3PJRA 1PV4A 1BS1A 5AWFC 2ZRCA 1IXZA 1E9BA 3DM5A 2ZREA 1GKYA 2W6JD 2WJJA 4HSEA 5H1YA 1OH8A 2IYLD 3AGPA 1E94E 3CUEF 4M1YA 4WXPA 1UAAA 5JRZA 1E9EA 3ND8A 1YR9A 4UNPA 3OIUA 4F7WA 3CONA 2UKDA 3T61A 3GLHB 2QMEA 4Q47A 5JZVA 2BVNA 4LJ8A 3O8CA 3MJRA 4H9GA 1YKSA 4JYCA 2HEIA 1P75A 4DDUA 3W6OA 3THXA 4ZIRA 1XD8A 3QI2A 4JT2A 3OEHD 1EX6A 1Z6YA 1KSGA 1D9XA 4Q21A 4UXHA 4H1VA 3KTAA 5BN5A 4S35A 1U8ZA 1UBCA 1SVIA 4ZCMA 4ERNA 1OE0A 4DCSA 5K8IA 4J0QA 4Q48A 1KTVA 3HDTA 3L8ZA 1GNRA 4MKHA 2QROA 4OHVA 1T8UA 2OFOA 5KPDA 2G3YA 3K9HA 3AM1A 4TLBA 4JLAA 4B2IA 3AF2A 2V7QD 2GZAA 1CLUA 2O8EA 4MUAA 1W4AA 4KSCA 1NBMA 1XF9A 2NMVA 1G9XA 3WNDA 1R0YA 5HPYB 4Q1BA 2AR7A 4GP6A 2FWRA 3ZJYA 1FNMA 5AJZA 2VHUA 1XBTA 1P2SA 1WMSA 4EJSB 2J1LA 4L9SA 2QG6A 4N0DA 3X1DA 2ZU6A 5CIWA 4ZO4A 3NBXX 4FN5A 1YVDA 3V4FA 2ZU0C 3FKSD 2WIAA 3NKVA 1E9FA 1IM2A 1ZIPA 1KK0A 3K9NA 2YHSA 1A2KC 2J7PA 1LTQA 3I3SR 2QAGB 1S3SA 4TQ9A 1HUQA 4A8JC 4L16A 2EFGA 3VHLB 2CL7X 2GAOA 4DSNA 2QTVB 3KQNA 1NG9A 3AVQA 1XD9A 1BMFA 5EZ6B 1AM4D 1Y63A 2PH1A 4HAYA 4QM6A 1SHZA 1KMQA 2GXUA 4LRTA 4Z8YA 1WRBA 1IY2A 1ESMA 3KFVA 4LBVA 4FCTA 3AKCA 2QPTA 2VLIA 5G53C 5A5GA 5J4YA 2O5VA 4OYHA 3PITA 4MDEA 4DKXA 4ZKDA 2CHQA 4I81A 3QXHA 2VEDA 4HUQA 4E5UA 1OF1A 4W9MC 5DHFA 1E4YA 2AKAB 4L8GA 1ZINA 2BJVA 3AF3A 2FA9A 4GMDA 2BOVA 2YVUA 3ZIAA 1BYUA 4N1AA 3CF2A 1DAFA 4TMTA 2ZYUX 5A0FA 4LCBA 2AD5A 1TF5A 1KMHA 5SZHB 4DUGD 1HT1E 3ZDQA 3VR3A 4KYIB 3EWAA 4XIGS 1L8QA 1DPFA 2Q9AA 4YDSA 1M7GA 2VH5R 2YC2C 4Q7KA 5JEDA 3X1ZA 1ZM7A 1KDTA 4Q5IA 2Z0MA 2VP6A 1ZU4A 1I2DA 2ANBA 1DG1G 1Z6GA 2PL3A 5E3HA 3THWB 2YV5A 1GIAA 2IS6A 3LLUA 1OLOA 2IEZA 4JYBA 4MDFA 4TMZA 3EPJA 1OJLA 1R5BA 3N2EA 5L3QB 4TSFA 4G01B 4B43A 1IONA 1Q12A 4EJSC 5KDLA 4M9ZA 4DLYA 2HJGA 4RZXA 4QJ4A 5TDHA 2CBZA 2DFNA 3NC1C 3RWMB 4DLSA 1NN0A 4JLNA 2OCYC 4RKFA 3AF4A 5FOVA 3U4QB 1SKQA 2IS1A 1IXRC 2ZRDA 2GVDC 3D6TB 3SI7A 4A0HA 4TT3A 1H8HD 4R71A 1LS1A 1XJCA 2GNOA 2I3BA 3HYTA 2QN6A 4DXAA 1N5JA 2DPXA 4WBSA 1SGWA 4C0KA 1GRNA 2O8FB 2F43B 2W58A 2E1RA 4WXRA 1OXUA 1E9DA 2GRJA 4C0LA 4Q02A 2QP3A 2R6GA 2A5JA 1AIPA 1LB1B 2CCJA 4M1TA 4MRRA 1OT3A 5JI3E 1XB2A 3GLHA 2ZSDA 2ZITA 2FG5A 3CRVA 3UANA 4ZDJA 4B3BA 1E1QA 3REFA 4JVSB 1ZC3A 3EIEA 3QKTA 1UDWA 5BN3A 1A2BA 2JLQA 2C96A 3QVUA 3MSXA 1RJ9B 4ZPXA 1Z0JA 121PA 4BGDA 3B13B 3BGEA 4LC1A 4TLEA 1JEDA 1NI3A 2G77B 4QHTA 1W0JA 1WF3A 3AP3A 1RRGA 1XFAA 4EFNA 4C4PA 1XNJA 1DAEA 5L3RA 5DI3B 3CX8A 4Q00A 4M9SA 1TUIA 3TSZA 5H8WA 3PEYA 2DWPA 1RC8A 4MGIR 1G16A 1N5KA 1VTKA 1E9RA 1YR8A 2AD1A 2K5UA 3WNBA 4CEJB 3BH7A 2ODWA 2NG1A 2OCAA 3WRYC 1SQ5A 4DSTA 3W5JA 1MKYA 2XNSA 1VCIA 3T1VA 1Q22A 4IFEA 5BW8A 2YINC 3L43A 5C46F 4EKDA 1XTSA 1I4LD 1DVRA 2IT1A 1VCMA 2HLDD 1XPUA 4PO1A 4TWZA 2OXCA 1HTWA 3ZQJA 2FMXA 2RGDA 4JKIA 1OIXA 1XDBA 4BFTA 1NSTA 2HT6A 2CL0X 3SJZA 1MV5A 1KJZA 5CB6A 3BC1A 1JALA 2QAGA 1G5RA 3BB1A 4M1OA 2IXFA 3KJGA 3I8SA 3TW4A 3ICQB 4LJ6A 3C5HA 2JJ1A 1F60A 1S1MA 1WQ1R 4FWDA 1T3LA 2ZJ5A 2F3TA 4NL4H 3R8CA 1YR7A 1R0XA 5JJIA 1JEEA 2ZAMA 2ZJAA 5KDOA 1NLFA 2J87A 3KQKA 1KAGA 2BM1A 4HYYA 2GDJA 3OF5A 5HE9A 1Q0UA 2NPIA 3LNCA 4LSGA 1OFTA 1AKYA 1R4AA 4ZDKA 3LVQE 5D3MB 3KX2A 4XWOA 3IEUA 1T6NA 4RFVA 2VP9A 4HLUC 2ONJA 3JVVA 3N70A 4NCJA 1NP6A 2X2FA 2VHJA 5KSOA 3RYTC 3GEHA 1Q3HA 4TTPA 1KHTA 2F1JA 3PEWA 2WAYA 1KO1A 1VKJA 2BBOA 4ACAA 5J47A 2QPAA 2FOLA 5KYKA 3CX6A 2VL7A 5BQ5A 1Z08A 2XSZA 3CPHA 3EPKA 5F9FA 1EFUA 2JEOA 1DARA 4A2QA 1GDDA 4TMXA 4D26A 3QSYA 3GEEA 4TTRA 2XZPA 5IDVA 5LD2B 3ZD6A 1Q21A 2QGZA 1G3RA 3RWOA 2JGNA 4CEHB 1GZSA 3FDIA 1E2KA 3L0IB 4N0EA 4LJ7A 3W9YA 4ASUA 2CL6X 3U3RA 2A5YB 2C8VA 5FPHA 1M2OB 5FOWA 3SZRA 4R7ZA 3LBHA 4A0GA 4Q9LA 2QRNA 4C7OB 3THWA 4Q7MB 2QZ4A 3DZ8A 5DSZA 1K8RA 3TUZC 4DDWA 4PHTA 4NCHA 2B6HA 5L3QA 1GM5A 1JR3D 1E69A 2ZRIA 4MH0R 4XVUA 2OCBA 4F93B 1XEWX 1OHHD 1BH2A 1G18A 1KNQA 4LUCA 5EXTA 4C0AC 4TYNA 3SYKA 1M34E 1QVAA 4X8MA 1QZMA 4CGZA 2JLXA 4GITA 1RFLA 3H84A 1YZGA 3U4QA 2CVFA 3REGA 2AHOA 4IOLA 3B78A 4URUR 4AKEA 4BQSA 2GCNA 4U00A 4A6XA 4EAQA 4OQLA 4OK3A 2ZJZA 1R8QA 4KV9A 4PPFA 5HCNA 3V9PA 4DLZA 3TK1A 4GMXA 4JT4A 4Q1EA 1N25A 1J2JA 2WJIA 2IXEA 3E70C 1G3QA 2VYFA 3QXXA 2MMGA 2F43A 2XAUA 2WVJA 4NCNA 5FBLB 5BXQC 2O8FA 1NN5A 2QMOA 3O8DA 3EZ7A 3LRPA 5FBVB 4C0SA 2PX0A 1DTSA 5FI0B 3CZPA 3NEYA 4C0JA 5FR1A 3I92A 1F3OA 3IUYA 1AA9A 1ZUIA 2PLFA 3GJ0A 3Q85A 3QXSA 4JVNA 5E7MA 3MUFA 1P73A 3W8NA 3QF7A 4MQBA 3KJHA 3FMFA 4D4JA 1SVLA 1FL9A 4O25A 2H57A 2P2LA 3AVXA 4TL9A 3PVSA 1RJ9A 3M4YA 5EXXA 1G6HA 1CR2A 4JBXA 2X77A 1QZXA 1G3IA 1VDZA 1W0KA 4TMVA 1PLJA 4RSGA 1SXJB 4O2LA 1GOTA 2FE4A 2JLRA 4QJ5A 5LD2C 1Q1BA 3BWDD 2F6RA 5EE5B 1II9A 5TY0A 1Z63A 3FFAA 3GLGB 2ODBA 2ZVQX 3MWYW 4EPRA 5GVSA 4M1WA 5CYPA 4CEJA 4B6FA 3SBDA 1LY1A 1OW3B 1G5TA 2VHCA 1OXXK 4Q18A 2O8BB 1W4RA 4HAVA 1T5LA 4KFRA 1AS2A 3B1XA 4KBGA 3AP1A 4FWHA 5HTKA 2R6AA 3EASA 5CJPA 5KSYA 4IDQA 4D0LB 1MRSA 3AVYA 1XMIA 4FINA 1Q1EA 3GLFE 2IYUA 3TLXA 4D4LA 2O0KA 2H5EA 3BOSA 4QGFA 3CR7A 2XEXA 3PXGA 2FPLA 3IIKA 4PC6A 4ZDWA 4I1SA 3OE7A 4LOAA 1Z47A 3CRQA 5FUXA 2LWIA 4OBEA 4EPVA 3FFBA 3ZZUA 1U0HC 1DAGA 1KSFX 3VHXA 2ORVA 3D7MA 3CRMA 3UATA 3NVAA 2WV9A 5EE9A 3H2YA 2QMHA 1GRQA 5EXPA 5B2ZA 4URZR 1LF0A 5D3MA 5HKKA 3E1SA 1R10A 1N3BA 1OB2A 1FUUA 1P72A 3IIMA 4DLXA 3CLVA 1XTKA 3ZLJA 4I1UA 4C2TA 1Z6XA 4GZLA 1SKYB 3ZH9B 4DSOA 4GOKA 1Z0FA 2X19A 3R7WB 1TF7A 5L3SB 1E2EA 4FWTA 3IPYA 1AGRA 4A6PA 3HU3A 1XJQA 2IHBA 2ZAOA 5J40A 1ZU5A 3Q3JB 1YZNA 4CEHA 5AUOB 1NLYA 3FE2A 2VP0A 5EQTA 1SXJC 3TR0A 4NHOA 2KWIA 3K0AB 5KNDA 2NTYC 1QHIA 3IO5A 2QQEA 3NTUA 4KYUA 5C2JB 2QRZA 4POAA 3BIFA 1JB1A 3O8RA 4C7OA 2XOKD 1JR6A 3FGNA 5TMPA 2O0HA 1D9ZA 3A1SA 3SFZA 2HV8A 1JQLB 4GBMA 4EUNA 1CIPA 2RAPA 1QHGA 2IYQA 2IBMA 1Q1ZA 3P26A 3ASYA 1XX6A 1Q20A 5DLQC 4URWR 1OKKA 2EFDB 1B23P 3C15C 3T1QA 2WWIA 3KUCA 2ZXUA 1IJFA 4V0MA 4LYFA 1JXOA 3K09A 3VNVA 2HF9A 1Z07A 4DHEA 4M53A 4PC2A 4V03A 3K0SA 4D81A 2DCUA 1M74A 1YRBA 1W1WA 4D6PA 3LQQA 4DCTA 5FPYA 5SZKB 1OH7A 1KJWA 4PZLA 4EFMA 3ZZ0A 5BYJA 1FMLA 4FMDB 4B3DA 2R6FA 3VR2A 4KODA 4LGMA 2JJ2D 1XZQA 4DDTA 3O8BA 5EE0A 2ERXA 3VMFA 2HUPA 4RZUA 3I61A 4XVRA 2R8RA 4QJ3A 1E0KA 4DWJA 5KNCA 3WMEA 4A82A 3QKRB 1S1CA 4L5BA 1N6OA 4AKGA 3BBPA 2J0QA 4NCIA 1ZM3A 3SU8A 2GHIA 3GLIE 3EC1A 1UKZA 4M21A 5AUQA 1CJVC 4Q66C 1NN1A 4RD3A 4TYWA 4LJ4A 2FGJA 1NMYA 1VG9B 1WBBA 2A78A 2BEJA 3BB4A 1Z2CA 2QAJA 2F9MA 1ZUNB 2RGBA 4I4LA 2EYQA 1SXJA 1ZRHA 4HZIA 4KSBA 4B74A 1NL3A 4OK6A 4Q1DA 2WMOB 1LVGA 2CK3D 1KO8A 3GLGA 2ZI5A 4D4MA 4GZMA 1MO6A 2ZEJA 4LJ9A 1FQJA 2PCJA 2O0JA 3D8BA 2CNWD
chains in the Genus database with same CATH superfamily
4H1HA 2RHWA 4DV1M 4Y98A 5FEMA 3SFTA 4GOXA 2ZQ5A 2OAEA 7MDHA 3FVQA 3TIVA 1G291 3AOEA 4HMOA 3U1TA 1R6BX 5K51A 3DVAA 4D45A 3BFXA 3C6BA 4FKMA 3HU1A 4NE9A 2RKWA 1XYYA 1IG3A 2OD9A 4HY3A 2X2OA 3WZLA 4XIIA 4BECA 1P80A 3ZLTA 2DENA 2W2NA 4Q7EA 1GL3A 4G4SO 3RVKA 3IHWA 1T10A 2PSSA 4MGYR 4F84A 1Y82A 5I7EA 4Q7QA 3ZHTA 2JFPA 4MPJA 2XT9A 2GXQA 1DAPA 1PNQA 1VIAA 1I13A 3LWBA 3VR5A 1BA2A 3MT7A 4L22A 1JV2B 5EKSA 5JLJA 3K72B 4IBKA 1BROA 3NWEA 2PUGA 5ALXA 1RLJA 1D3AA 3BCUA 4LMPA 3ODPA 2IYTA 3FNBA 2X1MA 3KLOA 2AW3A 4I9UA 2GB4A 1DOZA 4LOIA 3FDXA 4HATA 3FH0A 4LVNA 2OHFA 2WNSA 1Z74A 2R2GA 3WDKA 3KHTA 4BX3A 4ZJZA 4LJAA 2A59A 4IQFA 4NEGA 3T7DA 2INGX 3A6HA 2V7EA 5E7IA 3OJEA 2DTEA 1DC5A 3GLHE 2E4ZA 4RO0A 2SKEA 3GL9A 5KOHA 3BZUA 3HVKA 1X7GA 1KC1A 2A9JA 3GLUA 1UBGA 4XGRA 3ZTYA 3SHFA 3UWPA 5AVKA 3MK6A 4F1JA 3Q12A 1P91A 1U99A 2AG8A 1PI3A 3IBYA 3RRJA 1OQAA 1FBNA 4DNXA 2KLBA 3WADA 1F6DA 1JDZA 1II0A 3E2MA 3KQPA 2GJSA 1RIFA 4MV4A 2B8NA 4DLKA 2X0JA 1TTTA 4FWGA 3SVTA 1BOFA 3AX6A 5J3JA 3CVVA 1KSJA 1PWEA 1ELOA 3ZY4A 3ENVA 2G8LA 2FPOA 3URKA 1RACA 2HJHA 1TZBA 3LUBA 4BNKA 4QJIA 2FXVA 2R4QA 1WW8A 4PZ9A 2YW2A 1DKRA 2P27A 1IHXA 5AOAA 1OILA 1N7GA 4U2KA 2W43A 2QP9X 1D2NA 1MB4A 5GADl 1F51E 3PT5A 5G0SA 1E20A 1GR0A 4Y7CA 3GDGA 3PE4A 2WSEF 2WWRA 3LX8A 1NXSA 3AF1A 1MH1A 1QIKA 1KRXA 4JV5B 1CHNA 4QUJA 3KXLA 2I67A 2WM9B 1TRHA 1L8LA 3WWDA 4C5AA 4LK2A 3LO8A 2UZ3A 4NV3A 3K92A 2BCJQ 2HIAA 2ECQA 3DBOB 3TZKA 1N6IA 1ZMBA 2RHHA 2IRWA 5JD5A 3GUUA 1SK9A 3KZCA 3BFPA 3QPWA 2X6RA 1Z5ZA 3ROTA 1V43A 1E64A 2RARA 3C5CA 2OILA 3M9XA 4BVBA 4ZXFA 2GEVA 4REQB 3EJ6A 2FWIA 1OGYA 3ZLBA 5DM1A 3P52A 3VR6D 5H3LA 2W8ZA 3PHJA 4S3MA 3VJMA 2UU9B 5MHTA 1OPXA 5I7VA 3ZHXA 3RSCA 1W5SA 2R25B 4I08A 2J85A 4R9SA 1DIBA 4AWXA 4US1R 2FFQA 4F3NA 3IT2A 3H42B 1ONBA 1BN7A 3KT8A 4J76A 3LGSA 4YMTA 5K45A 2BR4A 4EVSA 2I2DA 4UNQA 1MRNA 2A0XA 5HEKA 1G4AE 3V1MA 4EB8A 1Q2UA 1AZSC 3OTIA 5BN4A 4P5PA 5T4BA 3KOMA 5F1KA 3WLAA 4RD2A 3W05A 3GPUA 2COEA 1OPRA 3DUWA 2E6UX 3SHWA 3TZHA 1YQWA 4JFAA 2B1IA 3EXAA 4FSHA 2VR1A 2Q27A 4TYPA 3E35A 4IP0A 3GJ8A 1HFWA 1KJYA 1CJUC 3QYEA 2N42A 4TV8B 2QUZA 5E1DA 3MGCA 1N3LA 2OZLB 3R9WA 4ISCA 1OBVA 2CHUA 3BXZA 3U09A 1G8AA 1R9JA 3DDCA 1R88A 1RAAA 2OCPA 1WDTA 4Z1MD 4Y0NA 4ZOLB 1GZ5A 1QB7A 4EW2A 3EZ2A 5U1PA 2WPDA 4WQMA 2CXUA 3BJIC 3CZAA 4ZI7F 1V39A 3I34X 4Z3DA 4EPYA 3AEKA 4RVNA 4BE4A 3P8ZA 3CINA 3GLGE 3LXRA 2DHQA 4NR0A 4GXRA 3DOAA 1I5OA 4O4LA 4PU0A 3DMTC 1HC7A 2ZSIA 1O08A 3GAAA 3MS7A 1GSIA 1ZIXA 3QW4B 3ZJUA 5C37A 4U7FA 1P3JA 1XU4A 2UVPB 1L4EA 2WDZA 1VSQA 2GO7A 1O1YA 5FFMA 2P68A 5JAOA 3BWMA 5FTJA 5BXYA 3T54A 2F5QA 4WACA 3FAZA 1OYYA 5CFZA 4XUCA 1WNFA 1SKYE 3PD0A 1D04A 1J1ZA 1RHJA 3CEMA 4EFLA 1BCSB 1XC7A 2W2XA 1DP4A 2G7MC 3LQ2A 4NE2A 3P0IA 1NW8A 1JQJC 2C9YA 3G5AA 1RPZA 1CY8A 1S01A 2WYUA 2FEMA 3ND9A 1KIMA 5CDGA 3K1AB 2KW5A 4QOGA 3ZHQA 4AJNA 1V5FA 2G9RA 1BDIA 1SIBE 1BGXT 3RFWA 4C4OA 1PU2A 1GKIA 1EFVA 2ISCA 1WKVA 3TX6A 5IJAA 2W8BA 3P2YA 1KP3A 2P0EA 3VU9A 2JNHA 5IZCA 3OZTA 3CH5A 1XZGA 4G0MA 3WWEA 3PNSA 1S7GA 4NPHA 3FOZA 4NKRA 3FHJA 4TTAA 3E82A 1PK7A 3TAXA 2AX4A 3URMA 1W1IA 4L57A 3CN9A 2JKYA 2VH1A 3PI6A 3QG5A 5CA0A 4Z4QA 1PE0A 4OLHA 5AM5A 1DAKA 1DUVG 2H11A 1QK5A 4LF5M 1VJDA 4GLBA 4K0RA 3KVVA 4Z9YA 2LCFA 1UT5A 2CXOA 2BTOA 1VPEA 2PLRA 3V1LA 3LY5A 3I72A 4KLCA 2FQWA 2R96A 2J3HA 4HGRA 4BU0A 1WXHA 1WHSB 1AKTA 4ZZIA 1LKZA 3JSAA 1PNTA 3NHWA 4CLHA 4RHYA 4NIMA 1TAQA 2IE8A 1W49A 3QF4A 2J0SA 1U6JA 3QUTA 3TQTA 4HLCA 2W90A 4K9SA 3T6KA 3ZCSA 1E7SA 5KOJA 3IXQA 1Y8GA 5EXDA 1R27A 2DGDA 3L8GA 3EYWA 5F2EA 1XUOA 3HCOA 3EZLA 1QWOA 4JA2A 3QLVA 3J81k 1XKXA 3F6PA 2WYIA 5ITQA 5EXSA 3AGQA 1AUQA 3NORA 3B5JA 1K86A 2PX6A 1LPNA 3IEKA 2DT8A 3SOZA 4GKBA 4K9KA 2R7LA 2H7XA 4X66B 4MQFB 3TMYA 2DOKA 4ZICA 4EZIA 4ZGBA 3VSCA 3UWKA 1QDEA 4LYAA 1UC5B 5JDIA 1ZUWA 3QVGA 3L7YA 3T5CA 3QEMB 1VRVA 3L07A 1FFGA 4A8JA 1L1FA 3L6OO 5CT5A 5HQJA 3Q3GE 3LT0A 4A36A 4NBTA 3WYFA 1GQ2A 1HL7A 4U7WA 4ZAGA 4CR7A 4HDOB 4ZEXA 1MHTA 4ANRA 3EXHA 3B6ZA 3AL3A 4HL4A 3A0RB 4ENSA 2XB9A 1V25A 4P93A 1W0KD 2MSEB 3ZOZA 5HBRA 4H0FA 4ADSG 3OLXA 1NVMA 4LF4M 4UAGA 2PPVA 3HGIA 5H80A 1ZHFA 4BNJA 3TTSA 1MPTA 1F2UB 2GZHA 1N7JA 2AI2A 2OO5C 2Q7OE 4OKIA 1BVSA 1LC3A 4PANA 4MIYA 3GFPA 2WY2D 4E5SA 3AESA 1V4NA 2C2ZA 5CK4A 3EPHA 1T5HX 1MJNA 3PPXA 3ELBA 1SUFA 2YCBA 4BMXA 3C1AA 1XHEA 2OSBA 3CZQA 2V6IA 3C5VA 1SULA 1VRCA 1E6LA 3ISJA 5E95A 4UHKA 2HWYA 2BFEA 4OMUA 2W4IA 5HFJA 1MOZA 2XWSA 2R97A 1LBTA 3BE6A 3VC1A 3G5UA 1MAUA 5KYYA 4EB3A 4UUAA 4PYOA 3PFFA 4HH3C 2F00A 2ORWA 1RWVA 2ONKA 4P82A 1EDDA 3FGPA 4H4EA 1XTBA 4DREA 1N2OA 4WOJA 5KPJA 2ZRHA 2V03A 2PGNA 2B4KA 5DNDA 1UMBB 3QXCA 3OZAA 1YKFA 4RC9A 4Q9IA 1NV9A 1Z8FA 1FDTA 5IAAA 3WKBA 2JFZA 4B8WA 3S1AA 4R2KA 5C5CA 3P2MA 4NU8X 3CO5A 1QQWA 5CRIA 3S8MA 3KDSE 4HL6A 4HZUB 5FI1B 3J80A 2Q5LA 2DX7A 3DBRA 3WMFA 1TA0A 1VLVA 3I52A 2E5WA 1TAUA 3WGIA 4BBAA 3KTOA 3LW7A 1WF6A 5CH8A 3UHFA 2H18A 1TQDA 2D0PB 4X3PA 4EKYA 1VSVA 2XMGA 4AY2A 5IDYA 4AJEA 1H1DA 2NU8B 5FV7A 1LDBA 3O95A 3T7SA 2OC9A 2CYCA 4YT5A 1XZHA 3KQLA 2BJWA 4E2XA 5B64A 2QMUA 2UUOA 1QFSA 2VCEA 1OFIA 1PZXA 5FNVA 4PN3A 3I5YA 1DOHA 3NIGB 3EMBA 2FY8A 3K6KA 3VO2A 3THXB 1NP7A 4X7BA 1VLJA 5H4GA 1FP6A 2V6BA 2WJ6A 4B7XA 1UDXA 3O4VA 3PUWA 3IQFA 3GBSA 1WSBA 2DM6A 1EFTA 2WHPB 3T3DA 1IBKB 2QUBA 3AHEA 1Q7TA 1XEXA 1RPJA 3BQNB 2N1BA 3NEJA 1FTGA 3EIHA 5EP4A 3Q7QA 4MVJH 1TAHA 3MJTA 4FZRA 1GNPA 2PL1A 1JLMA 1ZC4A 4QDTA 1OFGA 2AZ4A 3LC7O 3KOWE 1OLSA 4HUQB 1A2QA 1JXAA 1ZG3A 3A1FA 3QXJA 1EXWA 3BK1A 4CCYA 4GG1A 4YJHB 2E4VA 3D3JA 3WKDA 4P98A 3BE8A 4UUMA 1VB5A 4AULA 1KO7A 4HEHA 3SJ7A 2YOGA 4H3SA 3M6AA 2G8NA 4BUZA 3JASA 3I2GA 4LBWA 3LXMA 2AUNA 2V54A 3ZHOA 4R01A 4RKEA 4B7CA 5KS2A 3BRCA 2XUIA 4B3GA 3QNUA 2FPWA 1PDWA 4GS5A 1NRXA 3PJRA 1PV4A 1BS1A 3RHTA 4HSEA 2YV2A 4YRRA 3RTDA 2NVUA 3UGKA 4PZUA 2UZAA 2VZ9A 1LH0A 3W3AH 1KSGA 3BSYA 1ZXBA 2JY6B 5ENVA 4Y2PA 4Q48A 3WMWA 3PIIA 2I6FA 2XF3A 2GZAA 3GPXA 2HQSA 1Z37A 1JE1A 3WA6A 4O02B 2XEDA 2WF5A 4BNIA 3QVTA 5HPYB 4EB6A 3RUEA 1T3ZA 2JFUA 2O1EA 1MOQA 5MN5A 4YI5A 3CSUA 5ER6A 1I7LA 3GZTB 5AW3A 4JYAB 3OLVA 1E9FA 2RONA 3FRHA 4PLGA 3VZQA 3RSZA 3PPWA 1MHPA 2FSVC 1SHZA 1WM1A 1ESMA 1QHEA 1UJ5A 3OPYB 1QSGA 3VOBA 1Q11A 1TM7E 1K3WA 4WCFC 3AUAA 2BT4A 2YVUA 4HKTA 3V2IA 3S1LA 3M7IA 1MX9A 1T2DA 3GY0A 5I01A 2R6HA 3H1FA 2B2CA 4L76A 4YJFA 2ONYA 3ZNOA 1Z7EA 1XQYA 1OLOA 3WIVA 5GIOE 1RI1A 4WY8A 4R9RA 3UHJA 4FE3A 4HRVA 5KVSA 4JLNA 1QLJA 3U4QB 3F7TA 4EX6A 3DPIA 3ND6A 4DXAA 1YWGO 5DJ5A 3C3KA 4MRRA 2HO4A 2VAWA 4DARA 3SK0A 4MV1A 1O5OA 4KSYA 4E08A 1EWYA 3ILYA 5MDHA 5BN3A 1KEEA 4NZOA 3MD9A 1S02A 4FS3A 3GT0A 1FUIA 3RYIA 2JCXA 1NI3A 3G8DA 2GNAA 1DAEA 2Y1OA 3TSZA 4M9SA 1A2OA 2HQBA 3PTZA 1IJKA 3S7ZA 3IHKA 5ESRA 2BN4A 2K5UA 3K96A 5D6OA 1W0CA 1HE4A 3II6X 4A03A 1IRIA 1T4MA 4ZRDA 1JFFA 4XK8F 4BFTA 2HT6A 3SJZA 2A1IA 4JI0M 2QTVA 1S1MA 2PBLA 3DEHA 4S04A 1N2BA 1CQIB 3OTWA 1JHOA 2VYND 1RAFA 1W76A 3A04A 2GZSA 2B1JA 3BMQB 3N70A 3RT9A 3GEHA 3C2QA 4MVJF 3EYAA 3QHPA 4CMEC 5JV5A 3W4JA 2GEBA 1QMPA 2XSZA 4P5EA 1L5LA 1LRJA 3NVDA 4Q9DA 1IBMB 3LHIA 4YV2A 2Z6UA 3L8HA 4W4TA 4DDWA 2KNZA 5ESWA 4N5NA 3SAUA 2PWPA 1L1QA 2AH5A 3FR7A 4J6FA 3K5IA 1FU4A 4V0SA 4GMXA 4XSVA 2RK4A 2LNHC 4KXWA 1OI4A 2PH7A 3I9V1 2ZWAA 4G24A 4V0QA 4LGVA 3C6KA 5HIAA 3BEDA 1N2HA 5KQPA 1FP4A 2A58A 4WMLA 3MUFA 1PIWA 2AB0A 4PXYA 3OZGA 1P2DA 2YJ4A 1RJ9A 1T9CA 5KSWB 3W8DA 4UCXA 2NUAB 3WV5A 1FZTA 3ZR4B 2WD7A 2ODBA 3MWYW 3SMVA 4EABA 3GNSA 1OW3B 1Q1GA 4NC9A 3F73A 4IAOA 1QTNA 4CCAA 3F5SA 1MRSA 4FINA 2IYUA 3RSQA 2FPLA 4PC6A 3DVAB 3V55A 4AJ9A 2LWIA 2OHVA 1BAPA 3VAYA 3GJRA 1XZBA 3LA8A 4CN9A 2C1XA 1EEHA 4UASA 4OU4A 5B2ZA 3F3SA 2HLNA 5KQ8A 3GZ4A 3IMCA 1FFAA 1P72A 3WL7A 3BXPA 1L5KA 2LVBA 2WYOA 3BE5A 2GN6A 3EVEA 2QN9A 3K73O 2X19A 2F9FA 3IMEA 4RKYA 3ESQA 2O7NA 2QV0A 4CEHA 3L06A 3G8YA 4I9FA 2JGAA 4BWGA 5I7UA 4OL9A 2P2GA 4M76B 4D9IA 3O2NA 5FI5A 4R83A 4ZMBA 4B3HA 3IVXA 2AE1A 3K0SA 4DIFA 4HDRA 4MMXB 1NMSA 1HYEA 1ZLYA 2PIAA 3TKYA 2DRIA 3PSHA 3ZCTA 4LGMA 1W581 2LIVA 3WMEA 1S2DA 4WJKB 3SU8A 4BTLA 4IL5A 3DDZX 1QF7A 3GMSA 4TYWA 3AUKA 3BB4A 2H1VA 2QNJA 1DIAA 3AR9A 4QQFA 5CB4A 2ZEJA 3GYGA 3MJSA 5KOHB 1V1JA 2BHRA 5ECDA 4LF6M 1U5AA 1U8XX 5A9TA 4NICA 1WSWA 2DSNA 1A71A 3VU8A 1E61A 4L4ZA 1QO0D 4IXNA 2EEZA 1L9KA 2QRQA 2OCLA 4GBGA 3NWJA 3NTLA 1GP2A 1Z39A 4RDIA 4BGEA 4FZVA 3RVSA 5HS4A 2QNBA 1GFZA 5CYFA 3L1VA 1QTRA 1Z8DA 5KQGA 4I3FA 4DR3M 5FUBA 6REQA 3KOXE 4BLOA 3L9XA 3R7WA 1VM6A 1VSTA 2OB2A 5FR2A 3EEFA 3RBXA 1F4IA 2FI1A 3GMDA 2FFJA 2MIIA 2QRPA 3RIEA 5M29A 4Y2TA 1IFXA 4WNYA 2XDQA 2G83A 4V0LA 3I4CA 2FN7A 1MC4A 1SG9A 2Q3JA 1K08A 3ZYCA 3DT8A 1NOIA 4TKUA 4JU9A 1P45A 3AI3A 3DTVD 2C5HA 2WKPA 4MPPA 2BUBA 5F5LA 3L0YA 3IV9A 3H86A 4MUFA 4EG5A 2D06A 4OUKX 1DQPA 4WNAA 5K3SA 2R6CA 2D1QA 2HF8A 4U2CA 3LX5A 3OH8A 5T7BA 3EVNA 2GFIA 2AC4A 1G41A 5LBIA 5IEJA 3SQMA 1GPUA 1UQTA 3OX2A 2IW1A 3EULA 4QUIA 2BFNA 4JL8A 2WSSA 2WHRA 4Q37A 1YJQA 3TAHA 1QIDA 2M60A 3GRRA 2K6BA 1IULA 3ZK7A 3I32A 1J8VA 4L73A 1Q83A 4ZCSA 3BL8A 4QGGA 1JF8A 3KLPX 3FPAA 3OQPA 4IVPA 5KTTA 4OO3A 3RYCA 4RM2A 2G80A 4MV6A 3C41J 1YGPA 4JY7A 5B3AA 4GX2A 3L7LA 3I0NA 1VBFA 5H81A 2R7KA 1HE1C 4X61A 4NTZA 1ZVJA 3C4JA 1II8A 2J9RA 4IIJA 5C5DA 2JLWA 1EUZA 3FVWA 1XTJA 2C98A 4XDZA 1YQTA 1WPXA 3NTRA 2PS1A 1C1DA 5AI4A 3ZWCA 4DDHA 5LL6P 3IVMA 5JCJA 3D0KA 2JD0A 1UFQA 2GVZC 5BN4B 3NYWA 3LM8A 4RMGA 3IP6A 4E5PA 2E18A 4NBRA 4DSZA 1Z4JA 4HGNA 1DJPA 2DKFA 3CUKA 1EA5A 1FTQA 4YECA 3OA0A 1GU7A 1VJCA 3MAGA 4H2DA 2I29A 3ZWAA 2XGGA 4XARA 1SOAA 3NCTA 1QVZA 3E7DA 3JD2A 3F6EX 1TU4A 3FLAA 3SG0A 3RFCA 2AEEA 3A3NA 5J5CA 2BMDA 4JN6A 2V6GA 2GI4A 4DLBA 4P9NA 2GBIA 2JKVA 3AEKB 1QQTA 2IXBA 1LWOA 3V8RA 2ENWA 4U0JA 3GJ3A 5DV9A 1H2ZA 3T5DA 2P6MA 4MUJA 3IV6A 4O4LB 2ZBRA 1TAGA 3DWFA 4HHEA 1JT2A 3GMIA 2EFEB 4W7IA 1RQPA 3HHZA 1IWOA 2AC2A 4YWHA 1ESDA 4MI9A 5LWQA 3NOOA 3A4NA 3OURA 3VYRB 2W4QA 4JT9A 1FYVA 3QRWA 2BSQA 3NR2A 2VT7A 2ZR8A 1ZGCA 5CIYA 3STUA 4CGYA 2CVHA 1R4ZA 3DMRA 4GSKA 2JANA 3GQVA 3GNLA 2I8LA 1Z26A 2PUDA 4QULA 3SM9A 2EW8A 4GPZA 1R50A 1SU8A 1JECA 4KPFC 1EFVB 4CISA 2H2HA 2VUSA 5GZ1A 2W8BB 2WK1A 2W9XA 3TRJA 2EBUA 3U60A 1QBKC 2ZSJA 5E2BA 4WOCA 4XYLA 3VU9B 2PT6A 1ABBA 1BXKA 3EHDA 1PK9A 5DX1A 1SUEA 3PKJA 2ZAIA 4CQMD 5IRCD 2IYXA 2H59A 2J6IA 1FVXA 3D7RA 2E4XA 3EHEA 2WLTA 4BVAA 4PRZA 1IEXA 2YJZA 3K4HA 1QGED 3F0TA 4PLHA 3N5KA 1TCBA 4RPJA 5CA0B 4JLWA 5J2UA 4DYDA 4MYCA 2CZGA 3AUXA 4E1BA 4LZOA 5KB3A 4YS6A 2EIXA 2C94A 1WG8A 2IUSA 3C3PA 5ALZA 3TXXA 1PHPA 1OWMA 2ZWPA 2OPFA 3NEAA 1L8AA 3DT6A 8AT1A 1YOBA 1AVTA 4FR5A 3CFYA 2FOIA 1ZNWA 1J0EA 3QI7A 4E03A 2C2WA 3V42A 1DWUA 2BM8A 1CZNA 3CIOA 5EPOA 3QF4B 4PICA 1NLMA 4MWCA 3MRSA 5LYJA 3R0QA 2AT1A 5KOJB 1QCCA 1VIYA 5BWCA 5AW4A 4TRJA 2XBUA 3AO0B 4GE3A 4FFLA 3H5LA 3OESA 4O3FA 4LF9B 1IIBA 1A4IA 5BR7A 2YTZA 4G0NA 3ADBA 5E38A 1QIMA 4BFVA 5B7NA 1L6IA 2X49A 2H2FA 3IP5A 1N34M 3K9GA 1HDXA 4KQEA 1FUKA 3GGDA 1RW4A 1N2CA 2WAXA 1ZI8A 4GNKA 3C7DB 1NAHA 1I7NA 1QV6A 1ISGA 5CGQB 4NMMA 3KVOA 1D0KA 4O8ZA 2FDCA 4DR7M 2QLJA 4IVRA 4YIHA 3A4IA 4ZT6A 1G4UR 2NVBA 3QVGB 3LL7A 3GJQA 4RNCA 2HA4A 3O0DA 3OZBA 3GK3A 4A8JB 4TV8F 3ANLA 2RGEA 2H4HA 4I6JA 4XM0A 1RWBA 1Z2DA 1TQ2A 4TS4A 3KNZA 3QEAZ 3OCWA 1RQRA 1JXQA 2ET6A 4ZOLF 3THOA 3E3NA 1LV7A 2Z8XA 1L5GB 3EXHB 3QMVA 3WSVA 2C99A 3HU2A 1AQUA 1JJVA 4CWAA 1Y7HA 2VN8A 2WZJA 1P1IA 3P2OA 4GMKA 1NVMB 2I8CA 4BMVA 2YYSA 1RM4A 3W2GA 2L2QA 3DQZA 1ETUA 4C6TA 4XR4A 5JADA 3CJTA 1DNPA 2Y68A 4BUJA 1GZ7A 1GLVA 4LSMA 1SZCA 3AESB 4IIVA 5DYWA 2VUUA 3HGQA 4KQWA 2Q1TA 4PT5A 5JJ5A 1EVEA 1SOUA 5JNRA 4IIGA 4HLQA 2EYUA 2I2CA 2WJPA 1I5RA 2BFEB 4O3MA 1FSGA 3K70D 3B3QA 1XN1A 5KYYB 4B3TB 1RYHA 1XQVA 5E1BA 1E2IA 3MYYA 1XEWY 3JQFA 1CS4C 5TXGA 4LHYA 1VE7A 3DO8A 4KX3A 4RVSA 1X70A 4PX9A 3OM0A 4GH9A 4J0KA 4J0FA 2J9GA 4R1TA 3KKOA 2WWFA 7GPBA 4DVGA 2D74A 1RCTE 1VA4A 3NXSA 3ZZMA 3S1AB 5HE8A 1WTCA 3KBOA 4X6XA 4RLHA 1WSAA 4TMKA 3QELB 4EATA 2FSUA 1N1GA 3DBRB 2C4MA 3DKIA 5JC8A 4PD2A 3IQEA 3HHWA 1J1IA 1HYHA 3C3YA 4YCMA 5HQTA 2KSQA 3B9PA 1PJ4A 5A3SA 3AHIA 5EZQA 1T5IA 1YCDA 4QOZC 1J8MF 5KMGA 3DF7A 4DQ0A 3FCOA 5DMHA 5G3YA 3OSUA 1CP3A 3ZUPA 5JS7A 4OHPA 5B30A 4ER6A 3ZQKA 1OYVA 2GK4A 2F3PA 3RABA 3KD3A 3AHGA 3OUTA 3LS2A 2WAMA 1OH6A 3RC8A 2E1PA 2J9ZB 3PDUA 5FNVB 2G36A 4DLVA 2BMFA 5M34A 2EGUA 2XCSB 1G2OA 2J4DA 4RACA 3ETJA 1EG7A 4IDCA 1XYGA 4CM4A 2ZBQA 4W82A 2I3ZA 5AKGA 3TXYA 1W73A 2O05A 2VHZA 1WDKA 4MYSA 3PEVA 4RZ2A 3B3FA 3ZX5A 2ORYA 4DMCA 1O6CA 1XEXB 3KVYA 2A67A 2W2MA 2ZIEA 3RUCA 4GYKA 4I4CA 3IKLA 5D7BA 1S96A 1RQNA 5SYAA 2DAEA 3K2IA 1WZNA 3JQAD 2XE8A 1YTLA 2IODA 5I51A 2Q62A 4HWOA 1DDIA 1PJIA 3H8WA 4CM6A 2OM2A 1SBIA 1DO2A 1FRQA 3V80A 4DXDA 4B3CA 1OLSB 3RTGA 3FYCA 1AK9A 3OMWA 4YTEA 4CCYB 3BWCA 2OGWA 1AHHA 1V8ZA 2D7CA 3EF0A 1RTKA 4WSOA 4EYOA 3JASB 2H92A 3FGOA 2H00A 3F67A 5THKA 2IXTA 2CVPA 5FBKA 2FN8A 4S1NA 3AZQA 2POQX 3AI7A 3D4PA 3JCZA 3A37A 3OU2A 1XTVA 4JNCA 3NH9A 3ZY6A 4PEVA 1E7MA 1ORVA 3T4EA 2D00A 4JI2B 5TEVA 2NVUB 1X8KA 3BWVA 4BO9A 3H9EO 2XCTB 5ICEA 1TYCA 2VUTA 1N6PA 2W2LA 2R8PA 5DISB 3FJYA 2PSFA 2ZT5A 1I4OA 1QG0A 4HRYA 3K0CC 4X94A 2HNKA 1T9GS 1VQ1A 3MCWA 4HBZA 4TLAA 2PFGA 3A9CA 3M89A 3NGXA 3TW0A 3AFOA 4EB6B 2WIDA 3B7GA 3BEOA 1JHDA 2RAUA 3A31A 4JEUA 1XO1A 4PDIA 4UUPA 2CWWA 2NXEA 2MR6A 4ZT7A 2WF6A 3TLGA 2NUAA 1AB6A 3GLTA 5F7XA 2FE8A 4J9VA 4Z0PA 2QDXA 1KE2A 1WB9A 2YWJA 3U6OA 1YRWA 3GFVA 3TXAA 3LXUX 4V38A 5A2QS 1H65A 3M0EA 4RCVA 2DCMA 3I09A 2JLYA 4RTSA 4A6DA 1YU9A 3LI2A 3GDHA 2JLUA 3OP1A 4GR4A 1F12A 2QR3A 1JRLA 1VDLA 4YJFB 2O3UA 3KDAA 3NAQA 3DL0A 2EFHB 2NNLD 1QRAA 2OOSA 3AIMA 3D81A 4RFSA 4WW0A 4TXNA 4D0SA 2BGRA 4EHNA 3TI7A 1LZLA 5D01A 3B6MA 5IARA 5IFLA 1V5WA 5AJXA 3TSAA 2YHAA 1WNTA 4MW9A 2E7ZA 4C1NA 3AF5A 1DXOA 5DX0A 3H2KA 4F7WA 1XVUA 3CONA 5A02A 4LJ8A 4YRIA 2XMQA 3CA8A 2P9CA 4W8HA 4G37A 2OQVA 4S1WA 2IQ5A 3EQ7A 1KEEB 5BN3B 4RANA 1XKTA 1OE0A 4EZBA 3RYIB 3GR6A 3HDTA 4OGKA 3T3GA 2BI8A 1R37A 3WGHA 1EQAA 4OP3A 4WDQA 2OAGA 2L4EA 3A46A 1ZMRA 5ER9A 2J5YA 5K0CA 5EJ2A 5TMDA 3DA1A 1QQ6A 5IAGA 3CVWA 4JDPA 1JFFB 3R7BA 1RNLA 3L7AA 3R75A 2OB1A 4P86A 4TQ9A 3DZBA 2QTVB 4N76A 3E9ZA 1QJ4A 5G53C 3C58A 4OYHA 4X44A 4DKXA 1EE1A 4ZT5A 2P75A 4U7GA 2FA9A 4BNYA 3PFKA 4Y2UA 5IKOA 3MPOA 3TSCA 2IH5A 2DFVA 3GEMA 3QZUA 5DWQA 1TDHA 5JNUA 2VP6A 4ARIA 4XPIA 2CNKA 1OJLA 4P1ZA 4F4DA 2V7WA 2M1ZA 3GGJA 3RWMB 2HB6A 1ARZA 4FYMA 3O8NA 4G4SP 4CDRA 1N5JA 4WBSA 5FYQA 1EM8A 1E9DA 2YJ5A 4M1TA 2FDRA 1FP4B 4ZDJA 1Y6GA 3BMNA 4JVSB 1TDZA 1DIRA 3EIEA 4Y6PA 2R1UA 1WABA 1RJ9B 3RUHA 5IPFA 4FYVA 1TZ2A 1XFAA 5L4LA 4R3UC 4HNAA 5L95A 3GH1A 2WD7B 3PI7A 3DBLA 2AD1A 5T5QA 2QRLA 3ACDA 3I01A 3ESBA 2G63A 1PW5A 1VCIA 1RAEA 2O7QA 4IFEA 5FA6A 3WDLA 2I22A 1X42A 2B9VA 2XRYA 4WLFA 1HTWA 4UTNA 4PPYA 1D7AA 1MV5A 2IEGA 4YR7A 2ZUWA 2GGSA 4M1OA 4GSLA 2IXFA 1BQEA 4LJ6A 2YW9A 4DNFA 5B4VA 5BV7A 3DEIA 3ZIDA 4QRDA 1IZ8A 2XHEA 5I9NA 2DWLA 2ONJA 1M73E 4JK3A 3C74A 3U9TA 1ZCZA 2C0QA 3CPHA 2XZDA 3EXG2 2WTXA 3H4IA 5IN5A 4TMXA 5IDVA 4CEHB 2QGZA 4B09A 4N0EA 2GZ2A 1ULUA 2C8VA 3LBHA 3F8WA 2LUOA 4G4IA 4GPIB 1SUWA 1SKUA 4F9TA 2O6HA 1NZDA 4JB2A 1PZHA 4X8MA 2XWBF 3OT4A 3TNDA 4ZOQI 2HRCA 2GCNA 1DDOA 4HDRB 4Q1EA 3VR5H 3UY4A 4J2OA 4FS8A 1L4HA 1NN5A 4M7OA 5DCYA 2D0DA 4JVNA 3VSEA 1RQ7A 4O25A 1KPIA 4EVRA 2D3TA 2PKEA 1T2NA 2RG7A 2E2WA 1HT0A 2NZ2A 1GQQA 2WZDA 5CB4B 4PLZA 4XI9A 1U2DA 1IWBB 3M7GA 1CNEA 4BXOA 5IVIA 2O2YA 3UFXA 1N2GA 3HVIA 4I3GA 3MW8A 3IAS6 1WW3A 4FR2A 1V4VA 1SJ9A 4K2AA 4FSXA 1JMVA 4ZAFA 3A27A 4BAZA 3M8KA 1I14A 2ZXFA 2GN4A 1T29A 1W5AA 1KSFX 2DAIA 4TX1A 3LG2A 5HKKA 1I6LA 4PAGA 2RH4A 3NDJA 1AT1A 3G9TA 6REQB 1ZSYA 3ZLJA 3UMVA 3LUHA 2ZB8A 4GLOA 3R7WB 1TF7A 1VIMA 1QE3A 1CY1A 3HB0A 5TMEA 1UANA 2PNJA 5KNDA 1XZNA 2D5BA 3TFWA 2YN0A 5TQJA 5ALSA 2XDQB 2PGIA 3S29A 3DVQX 4E3WA 3ECSA 3UWMA 1XRRA 5LM3A 1ZOLA 2F8TA 1CIJA 3ROGA 4TKUB 3NBMA 3IJ5A 1VMKA 4RH0A 4MGZE 3G9UA 3D8HA 5BR8M 5ALTA 1V7QA 3O8BA 5KVQA 3U80A 4A1OA 1X9IA 1XKQA 4L28A 4NCIA 2EBWA 4EEXA 2ZUUA 4WNAB 2IIPA 1CJVC 4Q66C 4A8HA 4DF3A 1WY7A 2EP8A 1ZUNB 2F5SA 4K9OA 2WIKA 4FPXA 2MSWA 2YRFA 2BNKA 3G2HA 1JIKA 1KO8A 5D6NA 2GMWA 2O1XA 4DV7M 2PR2A 1WV0A 2H2AA 2M6LA 2VPQA 1J90A 2PS9A 2VCHA 3KELA 3FSRA 4QL3A 2I9PA 3KQUA 2CMFA 1OUMA 1U7XA 1YZ3A 2EP7A 3TAUA 3IHLA 1JBKA 1J6UA 4V0OA 5HF9A 2P6UA 1G42A 4YDQA 4ZVOA 3BIXA 1R9MA 3RYCB 3AHDA 4H7EA 1IOZA 4R8RA 2AR9A 1NVVR 3IULA 4K40A 3A25A 2BMEA 2N35A 1XEAA 3T0IA 1II8B 3NUGA 4IIJB 3LUKA 3JD0A 3SNKA 1C7QA 2AXPA 4QELA 1DXHA 4JLDA 2ARKA 1C1DB 1B14A 1VPDA 4BQNA 3A4YA 6NULA 2QMZA 3C3EA 3FW1A 4H1UA 1VBMA 3WP0A 3NNSA 4HC4A 2FFRA 2BHNA 1VLMA 1IK6A 5K8CA 1NY6A 2WWVD 4BZQA 1EE2A 3IO3A 1NKTA 3VR4A 4HPJB 5JE8A 3NP7A 1E1QD 4ZCRA 1YDMA 2HK9A 3E9QA 2XH8A 2IPAB 2A2ZA 3M9LA 3TM5A 2GZ1A 3KKLA 3A05A 3N0TA 4B7HA 4GAEA 5EHZA 4C0HA 1NPTO 4XQEA 3GUHA 1Z5GA 1CEEA 1VKZA 1E5DA 3RSLA 3SDBA 1IEVA 3WYEA 1Z75A 3W5BA 1WW2A 2GN8A 3BMOA 2C8KA 4M0KA 5D2CA 4JN6B 2XLBA 3WQRA 3VMMA 1QZUA 1JQKA 3RUDA 3RUFA 3SP1A 2JJ1D 1CLEA 3Q3VA 1OVMA 4WZAE 5JMPA 1H5QA 4IDFA 3TD6A 4MVJE 2M5ZA 5CX4A 4LFCB 4HN2A 2Q8QA 1L2TA 2IV3A 4FNGA 3H5WA 1EFCA 4EB0A 3ROMA 2FNAA 2O9JA 1FJ2A 1LQ2A 1REQA 3SZMA 3V8PA 2O8NA 3MFYA 1E3QA 1OBOA 1TXGA 3GA7A 3GELA 3VNAA 5A71A 4JUIA 3H65A 2DAGA 4D96A 4D1YA 4LDJA 2I3GA 1OB5A 3IMGA 2V98A 4RHXA 1JPNA 2POCA 2CLDX 4GWKA 4CGYB 4KE8A 5DGIA 4LC9A 1HG1A 1CZOA 3IBFA 4EGSA 3A6EA 4W6ZA 3DMGA 2IZ5A 3RGWS 2QL6A 2HHHM 3T8YA 5CA1A 2VZ0A 1DEAA 2ZYDA 3IUQA 2GTPA 3BE4A 2RH8A 1HV8A 5I3ZA 4NMLA 2OLJA 2J3QA 2XAAA 3L4SO 4HEA6 1C7EA 2O2EA 5JECA 4IJUA 2VDLB 3D3NA 4EG4A 2GRUA 2Q49A 4E1VA 3OQIA 5KYTA 4KP7A 3U60B 1NXQA 4HWPA 4NMXB 3ORSA 1PG5A 4KO8A 1CQJA 4BLWA 1ZK0A 4RVOA 2R4EA 2QZJA 3BHJA 4LZLA 4PHCA 4URYR 3VDMA 3ZCBB 1M2FA 2XUQA 3H9QA 2RGXA 4WK0B 3LOQA 4ZOCA 3A4VA 4FVMA 2MSDB 4B44A 4BFWA 5ILOA 1G17A 3E8SA 4LDRA 5EIFA 2LGJA