3ZH9B

Bacillus subtilis dna clamp loader delta protein (yqen)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
339
Chain Sequence
MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETKDFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALESYIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQKTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFELINKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASNLKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Structure and Assembly of the Bacillus Subtilis Clamp-Loader Complex and its Interaction with the Replicative Helicase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords DELTA
total genus 120
structure length 339
sequence length 339
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06144 DNA_pol3_delta DNA polymerase III, delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zh9B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3zh9B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zh9B01
3GCGA 1KOFA 1KY3A 1XZQA 4YXWD 4CEIA 1Z6AA 4JBXA 4NE2A 3PUWA 1AQUA 3A8TA 5TB5A 1A82A 1RW4A 1GKYA 5BYJA 4IFEA 3FFBA 3SJZA 1Q44A 1E2PA 3R9WA 2ZR7A 5SZJA 4JLBA 3MJHA 4XWOA 1XEXA 5CLLA 3P1JA 2ZQ5A 4FCVA 2NO1A 4LBZA 1WCV1 5FL7D 3VR5A 1OKKD 3N5CA 2JJ8A 3FKSA 2DB3A 5AUOB 2JJ1D 3SBDA 1G9XA 2CEAA 3SQXA 3DMNA 5DYGA 1KI6B 2ZI5A 1AZTA 3CZQA 4GOKA 4K46A 2OT3B 3MCAA 3TW8B 4B71A 4BFUA 1NN0A 1PV4A 3DM9B 1IN6A 2ASEA 1KGDA 4JLKA 4V0NA 4DXAA 1U8YA 4DLYA 4DDUA 1RC8A 3SR0A 4B47A 2VHUA 4QM7A 4M1MA 2GF9A 2J1LA 1S0UA 2WWHA 5FBQB 4PAMA 2OFXA 4BGDA 4TT3D 2GHIA 3FE2A 4TMXA 4R98A 3WYAA 2QMEA 2IHYA 1JXMA 4FIDA 2WSSA 4TLAA 2UVQA 5J5CA 1OXSC 4Q9JA 8OHMA 1RPZA 2QAJA 3WMGA 1XFAA 1F2TB 4HAUA 1Z0IA 3KKOA 1FUUA 4G0NA 2ZETA 3RC8A 1SZPA 1TQ2A 4JLNA 1OPXA 1SXJD 2Q3FA 4OQMA 2IS6A 1WXQA 5JCZA 4DSUA 1B0UA 2ZRIA 4TLBA 4M2LA 4CEJA 1YR6A 1XMVA 3T1QA 1E9DA 3P4XA 1N6IA 1YZKA 3F0TA 4IVPA 4ZIRA 4OKSA 3C16C 4DLUA 4FXPA 1F5NA 3RSLA 1EFRA 3ZS9A 4D4JA 2XSZD 4Q00A 3BIFA 1CJMA 2B8WA 2BMJA 1SHKA 4C0LA 4CIDA 2WWIA 5EUMA 5CLQA 4MRSA 3FKQA 3LH5A 4D0LB 1VHLA 3U61B 1Q1BA 2ONKA 2XX3A 4MGZR 4C3ZA 5KPDA 3TSZA 2VQSA 1GDDA 2UZIR 2V1UA 4FMBB 1KDOA 1KO4A 4G5OA 2A9KA 5FI1B 4A0GA 3L82B 3OESA 4P3YA 2PLRA 4JLOA 2OCAA 4LC1A 4Q01A 1QDEA 1G21E 3BS4A 3CRMA 4ZCLA 1G3UA 2JJ2A 3QXHA 4C2UA 4JT2A 2QL6A 2BBSA 4JBYA 3HP1A 5FPKA 2C03A 3ADKA 1IAQA 4EFMA 1KI7A 2OCYC 1XPRA 4GDFA 3CH5A 4B34A 1X1SA 1CJVC 3KX2A 4F92B 2YHSA 4EPRA 5EUQB 3PFIA 2F43B 4E09A 3EW9A 3SHFA 4EQ6B 5DN6A 3RSOA 2QP9X 4BFTA 2RGNC 2IHBA 3GJ3A 4N0DA 3WNDA 4LJAA 3CRW1 5JHHB 2YVUA 4Z8YA 3T1TA 2PMKA 4GITA 2FWRA 2DZOB 1NVVQ 4PXAA 4LBYA 2XXAA 5F9FA 5DYIA 1DPFA 2JEOA 4CT5A 4LYFA 5GVSA 3QF4B 1P61B 4LPSA 4LV6A 3U2QA 3O8BA 1TQDA 4JLAA 3ZVNA 1NF3A 4MKGA 3QBVA 3DOEA 4Q9KA 1AQYA 2VP9A 3QIAA 2E9SA 2KI5A 4FMCB 2Z5FA 3RDPA 4RCYA 1W0JA 1QHHA 2ZVPX 4AIIA 1NMZA 3I1FA 4M1TA 4CDGA 2GBLC 1Z6XA 2BMDA 1R2QA 2VHQA 1OW3B 2XB2A 3ND8A 3CX7A 1E2QA 1XMIA 4B44A 4NCIA 2HT6A 1GITA 1G7SA 2DFLA 2FN4A 4I1OA 5E7IA 3IKJA 5JCPA 3UG7A 4UNPA 2F7SA 2WAXA 3QVUA 1CRQA 5TDHA 1BS1A 5C4GB 3BERA 4C0AC 2ZRNA 1DG1G 5CJ2A 4IDQA 4Q66C 3EZFA 5G53C 4LJ4A 1DOAA 3ETLA 1RRCA 4PHGA 1TX4B 1ZD8A 1Z0JA 5L3SA 3BH6A 1E1QA 3R8CA 4I1UA 1JAHA 1TQ6A 1ZNXA 2A5GA 2XB4A 1FNNA 3K53A 1SXJC 4UNQA 1GILA 1QVRA 3AGPA 3THOA 2JLWA 1Z6YA 2PEZA 2G9NA 1BO6A 2WICA 3I62A 3SFVA 3H86A 1HYQA 2ZEJA 4PZYA 2OZEA 2QAGA 4NKRA 5CM8B 3F5FA 3CUEF 3FFAA 3KB1A 4DSNA 3L0IB 4LRTA 1VIYA 2GJSA 4PSVA 3GFTA 3MHVC 3ZH9B 3U3RA 4EPWA 1SVKA 4DSTA 1ZU4A 2C96A 2FSIA 2QBYA 5DI3A 1VYVA 4TMKA 1F60A 4RJLA 1OXTA 4URWR 1A2KC 4ACBA 3NC0C 3U4QA 3KUCA 2HF8A 5EP4A 5HKKA 2IXGA 1ELOA 4BWYA 1UEIA 3PUXA 1OH5A 4KCGA 2BJWA 3O47A 4DKXA 3A36A 3H2YA 4PQYA 3T12A 1FNMA 2RH5A 5F9HA 4A8JA 2O8EA 1XD2A 1FZQA 4HLUC 2CL7X 3QKUA 3C7KA 1CBUA 1KJWA 2VHCA 2QSZA 1CJTC 2ZIAA 1TAGA 2RCNA 4I99A 2FFQA 4RSGA 4YMTA 4JYCA 3ZIAD 1XWIA 4Q4JA 4MDEA 5JJLA 4D6PA 1MABB 5J4VA 2NPFA 1K5DA 1G41A 1P62B 2OFWA 2N42A 1HA3A 2FV8A 4BFSA 4BFXA 1H8HD 2YJTD 3THYB 1QHYA 4P32A 4E03A 1WE2A 1FMJA 1Z2CA 2PMDA 3MAAC 3QKSB 4IEEA 4ACAA 1XCGB 3GJ5A 1G5TA 4KYIB 5KDOA 1II8A 4HB3A 2LCFA 3BK7A 1KI2A 1DBSA 3TNFA 3FPAA 5DH9A 1COWA 1ZM4A 4A0FA 2F55A 3A1UA 3V4FA 2R62A 5C4MA 5FPSA 4I4LA 1ZM7A 1FTNA 2AWNA 4OI4A 5TVKA 3ZVMA 5KNBA 4C2TA 2IK8A 3CONA 1N6RA 1PUIA 2I3BA 4XSGA 3GP8A 1NJGA 3PCRB 2I1VB 1YE8A 2WJGA 1FX0B 2V1XA 2IUTA 4CW7A 5AUNB 2H16A 5P21A 1IBRA 2ZRAA 2ZM5A 1W47A 5JRZA 5UKDA 1RYFA 4WZ6A 2WJIA 4RZXA 3KJIA 3W9YA 1S9DA 4QXAA 5BN5A 2AR7A 1XTKA 2OM2A 3IHWA 2F1HA 4LUCA 3WBJA 3LAWA 4Q1EA 4OI0A 4J0QA 2ZR0A 4KFTA 2GNOA 1XCPA 3PENA 4EPVA 4ERNA 1ZD1A 1TPZA 1JNYA 2BC9A 4C0HA 1RKBA 3VR4A 3TMKA 2QM8A 2LKDA 3HU2A 4GNKA 4DC9A 3NEJA 1U94A 3V9PA 1UJ2A 2ATVA 2IYYA 3PR1A 1VCIA 2UZ3A 2ZS7A 2R65A 5JJKA 2XTNA 1OF1A 4ASUD 2JJ2D 2QZ4A 3SYKA 4FD2A 1DG3A 5AJWA 4NONA 4PHHA 5LD2B 2XOKD 3KXIA 4EPYA 3LX8A 3IQWA 1KZGB 3U60B 3REFA 4A2WA 1E3MA 3QENA 4Q4AA 3ZQ6A 4TMTA 3LD9A 2VIIA 2OCBA 2B7BA 2HF9A 1US8B 3AP2A 4M1KA 2OSBA 4RCZA 2WKRA 4B2IA 1X8LA 2P5SA 4AURA 4EUNA 2Q9AA 4NTZA 5AR1A 2F1JA 4CYMA 1OB2A 2X8AA 3U3OA 5GADl 4TYWA 2QORA 3FHOA 4QC2A 4UKDA 4DHEA 3MUFA 4QNMA 1KK0A 2DHRA 1M7GA 4DT1B 3UG6A 3A37A 4IFBA 4POAA 3IEVA 1G3QA 2CK3D 3AKYA 2W0MA 5FBWB 1KO5A 4GMXA 2ZITA 4GBMA 5LD2C 4HLCA 3W8RA 4BEBA 4ZV4A 1M6NA 421PA 3B78A 3GLHA 2VH5R 3IQXA 3BXZA 1J7KA 1NBME 3AKCA 1DADA 3ZYCA 5AUQA 3I8XA 2AXPA 1FQJA 3PJRA 2VSFA 4LJ9A 1Z47A 3D8BA 2GCPA 3CH4B 3NKVA 5E7JA 1ZD9A 2RAPA 1DAIA 4W7SA 1OH8A 4URVR 3K09A 4UJ3A 4O0MA 1IM2A 1OKKA 2AFHE 1Z08A 4BLQA 4ZCMA 3REGA 621PA 3LRPA 4LJYA 4AYTA 1S3GA 2EFGA 1U0HC 4MRRA 4WIAA 4DB2A 1G3IA 3IIKA 5G40A 2GJAA 1UM8A 2BBWA 5K8UA 4PSAA 2J46A 3LV8A 3OAAA 3CX6A 2V6ZM 4D81A 3AVPA 3R9IA 3B9PA 1AGPA 2VPPA 3PIRA 2CE7A 5BWMA 2QBYB 3D3QA 2GRJA 3IIMA 3UK6A 2ZJAA 1LVGA 2VA8A 2KWIA 1HV8A 1EX7A 3GMTA 3IGFA 2IA5A 2P6UA 2ZRPA 3CPHA 4US1R 3SU8A 2O8CB 5TXGA 1VCMA 3OE7D 4PTLA 4DLSA 1G8HA 1NBMD 2VP4A 4A4DA 4KO8A 4GSYA 1LW7A 5JI3E 1E0SA 2RGXA 1C9KA 4QHTA 1AA9A 1I4TD 1QRAA 5SZHB 2G0TA 2FJUA 5HCNA 1KI8A 1L4UA 1XMJA 4LX0A 1YKSA 1J99A 5EP2A 5GVRA 2MSDB 4ZDWA 1JB1A 1MO4A 1YJ5A 5A0FA 2GZDA 5EXPA 4R71A 2GBLA 2KB0A 3GLGE 4Q1DA 1W0KD 1XTQA 5TMPA 3KQUA 1P5ZB 2WZQA 1OFHA 1U2RA 3OE7A 4HSEA 2ZUCA 2F3TA 3OZXA 2CCJA 1NNEA 4QBHA 1JR3A 821PA 4D4LA 3RWOA 2XNDA 3VU9A 4AD8A 1M2OB 4B75A 2VP5A 5JSZB 3THYA 1OH7A 1ETUA 3TKLA 2W6ID 4TTRA 1XB2A 1HE8B 1O3YA 1IJFA 3FVQA 1GZSA 4JL6A 2LWIA 3B5JA 1DS6A 3GLIE 2Q9CA 2QNRA 5JBQA 2CLSA 2ZRFA 4C9BA 2IS2A 4BZXA 2ZVQX 2OV2A 4P0TA 2PLFA 4MRPA 4FWHA 2H8KA 1E96A 2I1QA 2ZSFA 4CT4B 2IX3A 2C04A 3BC1A 1P9RA 1MR3F 2IYUA 3E5HA 4RKEA 4LV8B 1E2LA 3HU3A 3NG1A 1P7CA 3FGNA 4KAXA 4GOXA 5DLQC 2QG6A 1S1CA 1R5NA 4TQAA 3TR5A 3ND9A 1AN0A 4QGGA 2QGZA 1W36C 3W8NA 3NIBA 5H68A 3OEHD 1LF0A 2FF7A 2BEJA 5BN3A 1GSIA 2REBA 4CRWB 1AIPA 2VF8A 4K8OA 2KRKA 1LFDB 1X1RA 4MGKR 2QAGB 4G5SA 4DLWA 3B82A 3WRYC 2CHQA 3RLFA 1G3RA 4AG5A 2VYFA 2WMNB 1E9CA 2PL3A 1SQ5A 5IHPA 3SJCA 1AS0A 4G01B 4JJKA 3K0CA 4BFWA 3DL0A 2QT0A 4LWZA 5EE1A 1KZ7B 4M21A 2ZI7A 2ZU6A 1YRAA 5JECA 1U0JA 1OHHA 2ZU0C 2BIFA 5EP1A 1ZM3A 2C9OA 4UNNA 1W36B 2ZANA 3IBGA 4KXFB 1EXMA 2GJ8A 1Q12A 3TSWA 2AWOA 2QE7A 4C0BA 2CBZA 2BM1A 2DWZB 3I4LA 4I1SA 4TSFA 1E1RD 4AYXA 1JEDA 2GXAA 2O52A 1D2EA 3EA5A 5B2ZA 2OG2A 5FI0B 5KSOA 3I73A 1Z28A 2NOAA 1XDBA 1S1MA 3RVBA 4Q1CA 1ZM2A 4QG7A 4TLCA 3KFXA 1E1RA 4BLRA 3LXRA 1KNQA 3VNUA 2N46A 4XD7D 1R5BA 2OILA 5AK0A 5SZKB 2ZJBA 2YOFA 1A7JA 2G88A 1DE0A 2FFHA 3EA0A 4MH0R 3RC3A 2IYRA 2ECKA 4W9MC 1IONA 3SN6A 1P73A 4KVAA 4F7WA 1VYUA 4D82A 2N1BA 4O25A 1FUKA 3VR1A 5JWHA 4AY2A 1F48A 1XP8A 3VQTA 1IXZA 1OXVA 2RGAA 1CKEA 3WHKA 4TSFD 5EJEA 4Y0VA 3QPUA 1XXHE 1KDTA 3K8YA 2GXSA 3ADCA 1E0AA 3PG5A 1DO2A 1RE0A 4FCTA 3ICQB 3KKNA 5EXTA 4M0LA 4R7ZA 3SOPA 1G8PA 3U3MA 3Q7PA 3QKTA 3T34A 4NPHA 1YZLA 4HI0E 4L9WA 3VKHA 4U00A 3KQLA 3IIJA 5CM9C 1NVUQ 3L8YA 3TVTA 2HYIC 4GZLA 2R6CA 2O8DA 2J7PA 2VBCA 3RYTC 1T91A 3E1SA 1SVLA 3BAFA 2O8EB 1S9HA 1EFCA 1ZBDA 2DBYA 1KMQA 2PCLA 2YZ2A 3TVDA 5CJPA 2C8VA 4LYHA 4V02A 2H92A 3ZVLA 4EPTA 1JR6A 2GEVA 1XXHB 4O3MA 4IW3B 4AKEA 5IK2D 3TLXA 2C77A 4QRHA 4RZ3A 3QBTA 4JLJA 1XPUA 2W83A 3CR8A 3KXLA 2XGJA 2F9LA 4URZR 3AF0A 1UKEA 4DB4A 1OYWA 4ABYA 1SVIA 2D3WA 3BFXA 4LDJA 1SVOA 4PC7A 1LB1B 3EXAA 4F4JA 1QHIA 2OAP1 1SVMA 4W5HA 2CE2X 4GOJA 1TF7A 2JJ1A 1FP6A 5IF9A 2IBMA 3VR6A 3G0HA 4MITA 4QFMA 1II9A 3LBNA 2XAUA 1NIPA 1DAHA 1Z2AA 4Q1FA 3CF2A 3B6EA 2IWHA 3IPXA 4BLOA 1GL9B 1NMYA 4ZDJA 2WPDA 3U44A 1NVVR 1Z63A 2G83A 5G41A 2A5DA 4B76A 3RS4A 3L0PA 3AVXA 4LHVA 4DT1A 1ZRHA 3UWOA 4US2R 2ZJZA 3M6AA 4YLGA 3QOFA 2YYZA 4XVUA 3A6PC 4YDSA 4LHXA 3LLMA 1LY1A 2ZRBA 3KKPA 4TL9A 2W6JD 5HCIA 3NDBB 2BMEA 3TUIC 2E87A 2ZI6A 1MABA 2NGRA 1E94E 4WBSA 2G6BA 3SQWA 1EFHA 1ZVQA 2PT7A 3PXGA 2WAYA 3X1XA 1Z0DA 5IDVA 4E07A 3LX5A 4KLNA 1GNPA 4YMUA 3DKVA 4NYJR 4KV9A 2EFEB 4PQFA 4PZZA 2YINC 2KJQA 5FOXA 3CBQA 1XD2B 1HUQA 2J7PD 1TL7C 4YXWA 3H1TA 4HAXA 1HH4A 3FKSD 2DCUA 4PR0A 3VKWA 2XXAB 1CR1A 1DVRA 3LQRA 4R2IA 2A2ZA 2GILA 1G4AE 1XTRA 2FG5A 4Z1MD 1W2GA 2QY9A 4HAYA 5J40A 2HDNB 4NYIR 4JYBA 4NYIQ 3K70C 2C2HA 3B1VA 3BB4A 3FB4A 4OK6A 2PZEA 1BYUA 5EZ6B 4U02A 3OEHA 2P6RA 1RRFA 3C15C 5GJCA 3LW8A 3QJYA 3RRZA 4EJSA 2OFOA 3OIUA 1TMKA 2FA9A 2VSXA 4Q1AA 4CEIB 1R0WA 1ZYUA 2JGNA 1GIAA 3X1ZA 3UPUA 4B3GA 1AJEA 1HE1C 3U3JA 1KO7A 1XD8A 4DIEA 2V6JA 3TW4A 1FW6A 4RZ2A 4RKFA 1KI4A 2CCKA 3MMPA 3QPVA 4OL0A 2WWGA 3N70A 4TMZA 3A4NA 1H8ED 4PPGA 2QTFA 4DCTA 1QG4A 4D4MA 5JRJA 2ZTSA 4M1SA 4Y0AA 4Z1MA 5G3ZA 4JL8A 1HT1E 1Q1QA 3BGEA 4UXIA 3UIEA 4LJ5A 3EPLA 1N25A 1D8TA 1U8AA 2W2VA 1TF5A 4X8LA 3WP1B 4A6XA 4A8JC 2WTUA 5L3QB 1VDZA 2H1LA 3ADBA 4KHZA 4V0ME 2GAAA 5C46F 1U0LA 2IXEA 1ZNZA 3T1OA 2AD1A 2IT1A 4YMSA 1II8B 1TEXA 1SXJB 1NIJA 3C5CA 4MGYR 3EZ7A 4Q19A 2TMKA 1EFTA 2IUSA 1BMFA 1VTKA 4P4UA 2XZOA 3DEFA 5E7MA 3GLFE 1XCMA 5A5GA 4DDVA 4KI0A 1W5SA 1XJQA 4MKIA 3KKQA 3T06B 2XNSA 4BZQA 3MWYW 5L3VA 4NMMA 4EJSB 3AVUA 4TMVA 3NHAA 1NP6A 1WRBA 5KDLA 1G20E 4TYYA 2G1KA 2QAGC 1G8YA 5F3WB 3C5HA 1T5LA 4DRZA 4BUJA 1AM4D 2Z83A 3K09C 4KSCA 2XJ4A 3AVQA 1R5OA 2PT5A 2ZR9A 4DWJA 5EXXA 3VLFB 4N0EA 2J3EA 4GFDA 4OQNA 1A4RA 4AYWA 3BH7A 1MO3A 5JI2E 1RRPA 4WZAE 4TYNA 1DAGA 2NZJA 2WOOA 3LBHA 4G3XA 3KL4A 4E5UA 4JLPA 1Q1ZA 1ODFA 2CVFA 4ZI3A 2JDIA 3Q3JB 4A36A 2JLXA 4JS0A 3KKMA 1BIFA 4Q7KA 5GJWC 2QQ0A 4UXHA 1SKYB 1MH1A 3RRYA 1MO5A 3THWA 1S2MA 2PZGA 4XVRA 1G7RA 1E9RA 1N6PA 3IPYA 2QN6A 1GRQA 4D26A 3WYGA 2YWFA 4F38A 5J47A 3ZIAA 1N5JA 2OLJA 5H1YA 3WNCA 2F9MA 1ZIPA 2RKOA 2AFIE 1H65A 3NDPA 1NLFA 2CXXA 3IO3A 4QL3A 5KTYA 4M1OA 2EFHB 3T1VA 2QQEA 3A1VA 3TH5A 1DAEA 5L3QA 3CWQA 4MRVA 2MMGA 4Q9HA 2FPKA 1NKTA 3RS7A 4NCHA 4ZKDA 1E4YA 5BYKA 5IT5A 2ZROA 4L5BA 4DVGA 1OSNA 1YVDA 3LFUA 4C0QC 4QM6A 3AF4A 2IXFA 4WAUA 3AVTA 2IS4A 3CRQA 1R10A 3QI2A 2IYVA 4AC9A 1UAAA 4LSGA 2P65A 1DO0A 4XWKA 2GKSA 4TTQA 1AZSC 1NRJB 1XJCA 4M1YA 5DO9A 4YMWA 2QP4A 2CK3A 4IRUB 2C5LA 2J0UB 3B1YA 3N2EA 3VKGA 2ZAMA 5H8WA 3KDSE 3AV0B 2IS1A 2O8FB 1UADA 3NXSA 1R0XA 4HAZA 4MKFA 1R8QA 2F6RA 1U9IC 4LBWA 3RHFA 3CPJB 3SBEA 3PUZA 2GJ9A 5HR5A 3EAQA 2PCJA 5TV2A 3CIOA 4HEJA 4ZPXA 1A1VA 4PPQA 1N0WA 1YZNA 2GCOB 2IC5A 3U3KA 5JS7A 4PQRA 1LV7A 1XTIA 2XSZA 4OQXA 3B7GA 2HCBA 3HWSA 2ZE5A 5CYPA 1E6CA 1UKZA 2ZPTX 2XOKA 3SE0A 4FINA 1CRPA 5A4JA 4Z54A 3SC3A 2PX3A 2RGCA 3WRXC 3X1YA 4B6EA 2CL0X 5FTLA 2Q3HA 2WV9A 4JVSB 2WVJA 1IOZA 4JBWA 1JALA 1JJVA 5KO2A 4ZDKA 3H0KA 5EE5B 1VYTA 2R6DA 2AXNA 3A1TA 3FMPB 4IOMA 2XEXA 3CKLA 1FP7A 2O8FA 4I81A 4DLVA 4A82A 3MGCA 1P75A 2BMFA 1PUJA 1VG9B 3KZ1E 1KAOA 3D7MA 3QQ5A 1SVWA 2K5UA 2VO1A 1E2FA 1W4CA 2CCGA 4RVCA 2QW6A 3I5XA 2RHMA 1P60A 3A58B 5C2JB 1Z22A 1CR0A 1E9EA 1OFTA 4TQUS 5B30A 1T6NA 4B6FA 1E9BA 3SZRA 2GXQA 4IOJA 4QBIA 1U8ZA 3ASYA 1WBDA 4W5WA 3IHLA 4EIWA 4NCNA 2A30A 1E9SA 3N2IA 2R6AA 3ADDA 3FDIA 4KITB 4LOAA 1B23P 3ECCA 3TQCA 1U81A 5F98A 2VL7A 4DIDA 5LBIA 1DAFA 5HE8A 3PEYA 2DFKB 1TUIA 4ESVA 3C8UA 2DZNB 4AKGA 4ZIRB 4WW0A 1D2MA 2ORVA 4P31A 5JWOA 3NBFA 1ZUNB 2GVDC 3R8FA 1E0KA 2J87A 2ZUBA 4A6PA 4DLZA 2BCJQ 1KJYA 1KSFX 1RZ3A 2IYXA 4KFSA 2FGJA 2BKEA 3Q5EA 5FFMA 2JIZD 3W3ZB 2WSSD 4PSKA 1GVNB 2YWEA 4GZMA 1RVDA 2RGDA 3VMFA 1ZAKA 3WNBA 5FOVA 2OXRA 5K8IA 1M34E 1NN5A 3AKDA 4DEYA 1ESMA 3E70C 5CIWA 4U7DA 2FEOA 1XJ0A 4X8HA 3RNLA 4B73A 4YQFA 2W00A 1ZUHA 2RGNA 3CTDA 2QMHA 2V55B 3K0FB 1NMXA 4MYHA 4IHQA 4QOSA 3GEEA 2WMOB 2WWYA 1MO6A 1OE0A 3S1AA 3GJ0A 4PZLA 2B8TA 2ZSDA 2AKAB 3AF3A 4RD4A 1QG2A 3BD9A 1XX6A 2VEDA 3M1IA 4LRWA 2P6NA 1ZCBA 4KVGA 1A5TA 1W5TA 3PEWA 2D62A 1KKLA 5B64A 2W6IA 4ZDIA 1UDWA 2EVWX 1YZGA 2GTPA 3QKRB 3LQQA 2P2LA 4NP6A 4RD3A 4EAQA 3IILA 2X1VA 4ILEA 4D0NA 3HYTA 3NBYC 1C1KA 1F6BA 2J45A 5CDFA 2CVHA 3S1AB 1NSFA 1WB9A 2CHGA 3GPLA 2DFTA 3P32A 1NKSA 5AJYA 4CEHB 4QNRA 1IJEA 4JKYA 1E9AA 4QGAA 4BEJA 1UBFA 4Q7JB 4OHYA 3WMEA 4B2PA 2AX4A 5J4KA 2YOGA 3SI7A 4DEXA 5B58C 3OFND 1CR4A 2ZJ8A 4TL7A 3PUVA 3FWYA 3FYHA 2ATXA 721PA 2NZ8A 2CL6X 3ZZ0A 4MKHA 3JZAA 4NCJA 2O8BA 2ZRJA 3EC1A 4DLXA 4C7OA 2KBEA 3DMDA 4WZBE 2QROA 4JVNA 1XEFA 5H70A 1R0ZA 2C78A 5FBVB 4AKHA 2W58A 3SJAA 4Q4LA 4Q4HB 4DCSA 4TL6A 3W5IA 3CO5A 3SYNA 3AM1A 1SXJA 2ZRLA 4C0SA 2GZHA 3JVUA 2V7QA 2VLIA 5FUVA 4K81B 5AWFC 2AD5A 1W36D 1ZC4A 3V4RA 1OT3A 2NMVA 2GK6A 1QHGA 4HDQB 3HU1A 4GT1A 1W46A 3NBXX 3MLEA 5GJBA 2PJZA 3KJHA 3TBKA 3U7FB 5FOUA 5FPTA 1VCOA 3U6BA 4DZZA 4DCUA 1ESNA 2OO7A 2ZSEA 3EARA 4CGZA 1KHTA 2ERYA 2QENA 3WMFA 5IRCD 1BOFA 4S2EA 4C4PA 1VG8A 3BOSA 2CMKA 3X1WA 4RFSA 4V03A 1HY3A 1X6VA 4OHXA 3GLIA 4IJMA 1VG0B 2GESA 3VR2A 3GEHA 3B85A 4HAWA 4BLTA 3QXJA 1G6OA 3F3YA 4UQOA 4XSHA 1P4SA 4G5GA 4QKQA 2XNDD 4KU4A 3B60A 2ZI9A 5EP3A 1IY0A 1G17A 3KQKA 1IN4A 1W2HA 1IHUA 5JHGB 2PJRA 2Q0HA 5C18A 2ZS8A 5FUXA 2FU5C 3PEUA 1DAKA 1YZTA 1COWD 2OHFA 3RRNA 3GFPA 5FL3A 3EIHA 2IYQA 2Q9BA 2JLYA 2AN9A 1SHZA 1MRNA 4KSBA 4RD1A 3Q8XB 1UDXA 2HCJB 3CR7A 3KW6A 4JSTA 2JIZA 2ZRHA 1KO1A 2YWGA 2C98A 4HDOB 4OQLA 3UMFA 1VG1A 2GCOA 2YKGA 1E4VA 1H8HA 2X77A 3L0OA 4PC1A 3OF5A 1EX6A 5FTKA 4I1VA 2QGNA 4Q1BA 1HTWA 2D4HA 4AK9A 1GWNA 3PV0A 4D80A 1F3OA 4UJ5A 4P33A 1YZQA 1JECA 4QJ3A 2XJ9A 4R2HA 3T61A 3K0AA 1KO8A 3LY5A 3I5YA 3L2OB 1GM5A 5JSZA 2J59A 2ZAOA 1A2BA 1HURA 2Y8EA 1RJ9A 4V0LA 3FTQA 1EESA 2GXUA 4G5QA 2AK3A 1TU4A 2ZSBA 4PHTA 3SNHA 5F2EA 2W2XA 2R9VA 4L8GA 1VHTA 1W48A 4XVQA 2WWXA 2QTVB 3OAAD 4HLDA 2DWOA 2HUPA 2HJGA 2AHOA 4HZUB 4A9AA 1NL3A 3EZ9A 4HB2A 3G5UA 3RWMB 4JJZA 3FHCB 4F4CA 3AKEA 4TWZA 3U7GA 3BORA 1JQJC 3I32A 4P4TA 2UKDA 1QBKC 1X86B 2NO7A 4QGFA 3R20A 2A5YB 2OBNA 1ZINA 3C41J 1Z29A 3GEIA 4B35A 2MMCA 1E98A 2O8DB 5HKKD 1LF5A 3GQBA 3VNVA 2BEKA 1YRBA 3A1WA 3Q5DA 3QEOA 4MUBA 2SHKA 1VCNA 1D2NA 1AS3A 1OJLA 1T3HA 3DPUA 4PAQA 4EFNA 2AL7A 2GA8A 1KTVA 4TTPA 2A7QA 2E1RA 4NDZA 3UXMA 1P2TA 3I8SA 4JLMA 4U5XA 1FTSA 1RRGA 3GD7A 4QJ5A 5KSPA 1W0KA 4TLDA 1KDRA 1WQ1R 1Q57A 4PPFA 3RABA 1OXXK 3OEED 4KODA 2Z43A 1XXHA 1TF2A 1E2NA 2GCNA 3X2SA 1E2EA 4JL5A 2P5TB 3K0CC 2NIPA 3IDQA 1M1YE 5HPYB 3UMSA 3QY0A 1FFHA 1GNQA 3OEEA 4EJSC 2WJHA 3U7HB 2IYSA 1QZMA 1DELA 1XTJA 1Q22A 3ZDQA 2QRZA 2GDJA 2NPIA 1N5LA 1I2MA 2JLVA 5FL7A 3HR8A 1CJKC 3ZJYA 1N0UA 2VP2A 3GJ7A 4BRWA 221PA 1F2UB 5FBRB 4B48A 1Q20A 1ZMXA 1M7BA 4GP7A 3T35A 3ZZUA 1ZU5A 4ASUA 2WWFA 3Q9LA 2Z4SA 2J41A 2ZJYA 4MUAA 1IN5A 1T3SA 4GI7A 2H5EA 4LI0A 2NO6A 1N6HA 2DR3A 3QXXA 5FPYA 4C0KA 2FSGA 1QHNA 4DUGD 4L16A 3I3SR 5KNCA 3KJGA 1CLUA 3P4YA 1P9NA 1VKJA 4ESHA 3EX7C 1GUAA 1Q3HA 2NO9A 2GZAA 4KYUA 1TQ4A 4MGIR 3U6KA 1J8YF 5TARA 5SZIA 2ZS9A 5FTNA 3LO5A 3NH6A 4B3CA 2X2EA 1J90A 2QT1A 2WHXA 4TT3A 2NQ2C 2HLDD 3EIQA 1LS6A 5BW8A 1N6LA 5DE3A 1FOEB 4B3DA 4BASA 2C9CA 5FTJA 4LJ7A 3KFVA 2ZI4A 1XNJA 2GETA 1O87A 3CB4A 3EWAA 4ZCIA 1Z07A 3VX4A 1QVAA 1G8FA 3SHWA 1KI9A 4PC6A 1KK2A 4BZPA 2HYDA 5KUTA 3RANA 2FFBA 1NLYA 2ZRKA 1KJZA 3D6TB 3THXB 2XZPA 2C99A 4LHZA 2KBFA 1E1QD 2EW1A 2RMKA 1IXSB 1E9FA 3HYRA 4PO9A 2JLSA 2QM7A 5KNDA 1NN3A 2D2FA 4F91B 4B32A 3U7EB 3B8HA 3WYFA 3VR3A 2G3YA 1N6KA 4BRUA 1NVWQ 4Q47A 2ORIA 1GL7A 5J4YA 1GL6A 3FMIA 4DDWA 4FN5A 4BLSA 3LVQE 5CB8A 2GF0A 1RFLA 2QPAA 2V54A 5DHAA 4F93B 4CVNA 2BCGY 2CDNA 3VTKA 2ZE8A 1SKYE 2CNWD 1DEKA 1II0A 1UKYA 2ZI3A 1L4YA 4FMDF 1V5WA 4IVQA 3THXA 1BMFD 1SULA 3P26A 5HTKA 4XD7A 1D9XA 3CZPA 2JCSA 4JSYA 3R7WA 5G3YA 3BRWD 2WBLC 5EXSA 2ZJ5A 2H17A 4MA4A 4UXJA 3ZVRA 5D3QA 4IKEA 2ZXUA 4RD2A 1OV4A 5J4HA 1OIVA 3B2EA 4G5RA 4B43A 2V3CC 4XJXA 1BH2A 4IXNA 3KQHA 1E2IA 1KMHA 1BKDR 2GAOA 1ZC3A 1WDTA 1UEJA 2VP6A 3AUYA 3B9QA 3NWJA 1E2KA 4OQFA 1OXUA 1GP2A 3A1SA 4Z8XA 2BV3A 1U90A 4AWXA 1OLOA 1T5IA 4EFLA 3U44B 1WA5A 3L0SA 5JZVA 1Z0KA 1X3SA 2OUKA 4HB4A 1E2HA 3NC1C 1Z5ZA 1FPMA 1RJ9B 5DSZA 4L9SA 3UMRA 4NL4H 3VFDA 1JI0A 4AI6A 1CF4A 3FHTA 2QPOA 3OIVA 4XH9B 4S35A 1S4QA 1LS1A 1M7HA 2D06A 4TL8A 1XEWY 4M22A 2ODEA 5JEEA 2ANCA 1N3BA 2BM0A 521PA 1G3MA 2IYZA 1IN7A 4H1VA 3W90A 1E2DA 4R9UC 3WY9A 5C1BA 3CX8A 4US0R 2FSFA 2X2FA 3F8TA 1WF3A 5FR1A 1YR7A 1M74A 3RS2A 3ZGXA 2O8CA 4OK5A 4MYUA 4V0MA 4QHSA 3GLFB 1ZM9A 4HUQB 2YV5A 1XMSA 3C14C 3DKPA 5FUWA 4PO1A 4B3BA 5KYKA 3BWDD 1JAIA 2D7DA 3QE0A 5M04A 2G1JA 4BFVA 3K70D 3GLFA 4HUQA 3W3AA 2HV8A 4JT4A 2DWQA 2ZJ2A 1JXOA 3AP1A 4LYAA 2QMUA 2JLRA 2WJVA 3PITA 3NVAA 3Q85A 3AF2A 2YNMA 3ZS8A 1K6MA 5DIFA 1ZCAA 1AKYA 5ANRB 3GJXC 4DJTA 5GJVC 3D31A 3NBZC 3QXSA 5B57C 1P3JA 5KU1A 1J70A 2FNAA 3QG5A 2FMXA 3EPHA 4FWTA 3GFOA 3CM0A 3OFNA 4IXMA 1CU1A 4PAOA 3K9LA 1ZUIA 3QEJA 5KDDA 2DWPA 1P72A 4MQBA 1PJRA 4IDHA 2HEIA 3KQNA 1TEVA 3GLHB 3NHBA 1C4OA 3QG1A 4PO8A 4B3FX 2VP0A 1OH6A 3K9HA 3K70B 1HT2E 5EE3A 3PQCA 4HLUA 3QSYA 1E0JA 5JWRA 1TUEA 4XTRA 3CRVA 3DDCA 3SYLA 3TUZC 1VIAA 2PX0A 4Q9IA 3GJ4A 4Q5IA 1OB5A 4BPBA 1NVXQ 5E4FA 1E99A 2R2AA 1KSJA 2VF7A 2QEQA 3KUDA 2RB4A 1UFQA 5DNYB 2G77B 2GWHA 1WMSA 2YC4C 5BQ5A 1US8A 3LBIA 2CJWB 4AG6A 3CF6R 2EFCB 2FPLA 1NY5A 5DISB 1M8PA 1YR9A 2V8OA 3MWJA 4UNSA 2DYKA 4F4IA 3FMOB 4Q4JB 3R9XA 3AUXA 1FX0A 1D9ZA 2CJWA 5DI9A 4NH0A 3ZD7A 3BJIC 2KSQA 3L43A 1K8RA 1IY2A 3OIYA 3BB1A 2NG1A 4WA7A 2CLCX 3VU9B 1OYYA 4PPNA 4KFRA 1R0YA 2XTMA 3BH0A 1NVMA 3AGQA 1PLKA 1G7TA 1VMAA 2BKUA 3AF1A 3QXCA 1N5IA 1OFUX 4MRNA 3TSOA 4JZKA 3ASZA 4EPXA 4LBVA 1YHNA 4FWGA 2IYWA 4M9ZA 3EPKA 2VHJA 1PLJA 2IYTA 5JS8A 1XF9A 4TQ9A 1KMHB 1WBBA 2F3RA 2WIBA 4ZKEA 3AB3A 3QKSA 1PZNA 3HPRA 3DZ8A 3PVSA 1OFIA 3CW2A 3SS8A 3UANA 5DI3B 4XTCS 4A2QA 2C95A 1D6JA 1ONBA 3LNCA 2F43A 1G18A 3EG5A 3LVRE 4Q4AB 5CK4A 3BB3A 2PBRA 3HR7A 3BE4A 4XWAA 1AK2A 1KI6A 2FPMA 1G1MA 2ZE7A 4M9XA 2QSYA 3TUJC 4OBEA 3TAUA 3VHLB 3CF0A 1KAGA 3DOFA 4NYMQ 4A1FA 2J0VA 2DVWB 5CB6A 5E3HA 2OE2A 5ELXA 4DBLC 4JMPA 5FOSA 2ZRDA 1ZP6A 5JFGA 4LK2A 2QA5A 1P2VA 1N6OA 5K8TA 5FTMA 4M1WA 3SDZA 1G7CA 4D2IA 1HQYE 2BBTA 3QNUA 1X8KA 1XEXB 3TGPA 1Z3IX 4NBSA 3KB2A 1KYIA 4NZYA 4PANA 2IWRA 5LDDC 2HXSA 2REOA 4TZ0A 2JLZA 4C0JA 3T5DA 1G64A 3JZMA 3LWNA 2OAQ1 1E79D 2EWWA 2HJVA 4YMVA 4AKIA 3G82C 2BWJA 1GOTA 5EQTA 2W6JA 2WWWA 4XOIA 2FEMA 2A5FA 2R8RA 2HT1A 2JLQA 2OESA 1ZW6A 3TR0A 1PLLA 5KSZA 1OIXA 3ZD6A 3MD0A 4PC3A 4L4UA 1DTSA 4PX9A 1MV5A 1NJFA 5LB4A 2QI9C 1CULC 3TQFA 4UNRA 1E69A 2R6GA 4HDCA 1L7VC 1W4BA 4D0GA 5JLJA 1G8GA 3CNOA 4C7OB 3JVVA 1GFIA 5CK5A 1F2UA 4NHOA 3BFKA 1JR3D 1ZNYA 2QE7D 3B1XA 1RYHA 4PC2A 1W0JD 1FMLA 4OHWA 1NG9A 1XZPA 1R7RA 2BJVA 2OBLA 1MOZA 2ZUDA 2O0JA 4A8JB 3M0EA 3I92A 4TMWA 3CNNA 3IBYA 3ZLJA 2JATA 4OJQA 2A5JA 1AKEA 4RY2A 3LLUA 4NU0A 4KLZA 1W7AA 4M8NE 1ZJ6A 1E2GA 1GRRA 4IDPA 1GNRA 2FFAA 3AVVA 1KK1A 2IF0A 2ODNA 2B21A 4PFSA 2WPDD 1G6HA 5L3RA 2X19A 3RAPR 3EC2A 4GRAA 5BXQC 2FOLA 4FWIB 1KNXA 4LHYA 2YOHA 3K9NA 3QKRA 4P4SA 5EZ5A 2CLDX 1HQCA 2O5VA 2P3SA 1MKYA 4Q02A 1OHHD 4IOKA 1Z8FA 4JIMA 1N6NA 5JEDA 3DM5A 1ZNWA 3ZZTA 5LPNA 1Z0FA 1JPJA 1UF9A 2BVNA 1N5KA 3RRMA 3T5GA 1CEEA 1NG1A 2O0HA 5AUPB 1T8UA 1K5GA 3AH8A 3A4MA 3W5JA 2DY1A 3UATA 2ZRMA 1KI3A 4KFUA 1I4LD 5DGXA 3CWZA 4URXR 5L3SB 3SJBA 4LHWA 3U4QB 2R6FA 3BBPA 4HB0A 3LA6A 3WBKA 1G291 2WJJA 2P67A 1X37A 1Y63A 1KI1A 1XD9A 1W49A 2LKCA 4ITRC 3WXMA 3K0SA 2WKQA 4FMCF 4NYJQ 4LCBA 2ERXA 1LTQA 3QPWA 5JJIA 5KSYA 1QZXA 2IEZA 1EG7A 4DLTA 2XITA 4A15A 2PEYA 5CDFE 4B74A 1IQPA 4X8MA 2RGEA 4B33A 1N0VC 4Q21A 4YC7A 3VX3A 2ZYVX 4FCWA 4LZZA 2REXB 2CNWA 2RGGA 2ZYUX 3PEVA 2R9GA 3OHMA 1TTTA 3OIWA 3P20A 1AS2A 2OLKA 2OBMA 3SEAA 4HZUA 2EFDB 4EDHA 4FMDB 4IVRA 4Q7MB 4EKDA 4HATA 2V7QD 4JVLA 5FPHA 4HUTA 3RS3A 4CZ2A 4NYMR 1UBGA 1XTSA 2J5XA 1GRNA 3LDAA 5FUYA 4D25A 3KTAB 1Y3AA 2WKPA 4B3XA 3GJ6A 2Z4RA 3FMFA 3LW7A 5FOWA 2WM9B 4Z51A 2GJKA 4JVMA 1P6XA 4LJ8A 1YZUA 4Q4HA 3HJNA 2QTHA 4Q9LA 4DDTA 2H18A 4EQ6A 1XBTA 3H4MA 1SXJE 2HXYA 2J0QA 3K9GA 1GG2A 1P2UA 1Q3TA 4IDOA 3FOZA 5TY0A 3THWB 4LV5B 2QU8A 4URUR 5DHFA 3R7WB 4CEJB 4QBGB 1VECA 4WVFA 1G5RA 1T0HB 4KBGA 4OJKA 4URYR 1KSGA 3UKDA 2Z6VA 4LYJA 4A3VB 4MDFA 2ZYWX 3AJIB 1MRSA 2VRWA 4O2LA 4ZO4A 1C1YA 5CITA 1Q0UA 3MFYA 2Q3MA 5J4LA 1XEWX 1TNDA 3QF4A 4RFSB 1S8FA 2RGBA 2A78A 1OIWA 2GK7A 3ICEA 1YR8A 2FH5B 2EU8A 2H57A 1CJUC 1CR2A 1E79A 4JKIA 1P9WA 3M4YA 1H8EA 5DN6D 1EWQA 4X8OA 3A4LA 3PUYA 1JQLB 3CPEA 1S3SA 4V0KA 5AJVB 1FL9A 4KJZA 2W0SA 1KDPA 2WOJA 1EK0A 4ON9A 1T4GA 3MWLA 3ONWA 1NI3A 4GL2A 2JASA 3AQ4A 2D2EA 3MRSA 3KXKA 3H84A 3GLHE 4D4KA 4YONB 1R6BX 2FZLA 1NBMA 3I72A 1JEEA 4E22A 3U5ZB 3DHWC 3CLVA 4HZIA 4CF7A 1XPOA 2O8BB 2FE4A 1EFUA 3QVVA 4WXRA 1T0JB 2Q6TA 2ZRGA 5D3MA 2B92A 3UWKA 1BYIA 2Q21A 2ZJOA 4LC0A 3LXXA 4V0OA 1Z06A 1NLZA 1IY1A 1QHXA 2QRNA 1MT0A 4RFVA 5D3MB 4BE7B 5AJZA 1CTQA 2D7CA 1W4RA 2F1IA 3X1DA 4BLPA 2MSCB 2ODWA 2ZE6A 4QGHA 4FI3C 4C30A 1P2SA 1HEIA 3K0EA 3NEYA 4YDHB 5FR2A 3AVOA 1W44A 3EZ6A 1GAJA 2J0SA 3TK1A 3J81k 3K0AB 3QF7A 5FOTA 3IEUA 3B1WA 1KK3A 1I4DD 1QHHB 4RZUA 4M53A 4MYCA 1X8JA 3AVYA 2A3RA 3IUYA 1FQKA 2GVZC 3CRRA 1UBCA 1KSHA 1GKIA 4TLEA 1R4AA 3GLGB 2O0KA 6Q21A 1NN1A 2BHRA 1W1WA 3TRFA 4N3NA 1SVSA 1YQTA 3K0FA 2MSEB 5KOYA 2B6HA 3AP3A 2F1RA 2NO0A 3KJEA 2EYQA 5KHOC 1TADA 2FGKA 3B13B 2ORWA 1XU4A 4M4SA 4LRSA 1QF9A 4OYHA 4RD6A 4CEHA 1JJ7A 2V9PA 2JLUA 3GLGA 2PH1A 3EIEA 3WHLA 2FZ4A 2P0EA 3RS5A 1E2JA 4MYTA 4TYQA 5FH9A 2JAQA 4XIGS 2IEYA 2VHTA 1N2CE 3BGWA 4DUGA 1U99A 2GEDA 1NY6A 3DO6A 1JR3E 1U9IA 1G19A 2D74A 2FSHA 2RHDA 4A92A 2EWVA 2DFNA 5E95A 1EWRA 4W5JA 1EFRD 3TJZA 1Z6GA 3MG9A 2AKYA 3MWKA 4QJ4A 2XTZA 3VAAA 3C4JA 2QUZA 4Q18A 2OCPA 2ZRCA 1CP2A 1Z6TA 3W6NA 2IYLD 1WP9A 4II7A 3HPQA 4WOPA 5HZHA 4LY6A 1PVOA 4DCVA 4JLDA 2J9RA 2FDCA 4HYYA 2QPTA 4M9QA 2EYUA 2KE5A 4O2RA 1DAMA 1NSTA 1GKUB 4IOLA 4BECA 4Q48A 1I2DA 2FX3A 4DSOA 3VHXA 3T15A 1CXZA 2AK2A 1G16A 3EWSA 3O8DA 2G0NA 4OHVA 4TN1A 2WIAA 2CHVA 3AEZA 2JA1A 1AGRA 1KY2A 1V43A 1J2JA 5FBLB 5LB2A 2R44A 2JDID 2PZFA 4OI1A 1VPLA 2GEUA 4B2LA 2VTKA 3AVWA 3NTUA 1Q21A 1T3LA 3DVLA 4LPKA 3HDTA 1W4AA 2J0UA 1ZIOA 3TIFA 4QHYA 1S96A 2YWHA 4PHFA 4A0HA 1RIFA 1TU3A 2IL1A 5EE0A 2IUUA 3V00A 3I61A 2Z0MA 3W6OA 1CIPA 3Q72A 1L2TA 4G1UC 4GMDA 4BFYA 1UKVY 3RS0A 1E32A 1E2MA 4LJ6A 2ODBA 2BBOA 4ARZB 4LGMA 1LNZA 2I4IA 5JMTA 1IXRC 2ANBA 1Z83A 3O8CA 3NH9A 3MSXA 3B1ZA 4KBFA 5HZKA 3E2IA 3IO5A 3CNLA 2V4ZA 4BQSA 4TZ6A 1F2TA 4IEIA 2IW3A 4RD0A 4ZI2A 2OXCA 2ZSAA 1R8SA 5BN4A 1J8MF 1JBKA 4HAVA 2EQBA 3L8ZA 4WXPA 4A2PA 5KPJA 1G4UR 1T8TA 1T9HA 4Q7LA 4TYPA 4DLRA 2YC2C 5CYOA 4ARZA 2C9YA 1UBEA 2J7KA 2QMOA 4Q03A 4A0RA 4FWDA 2L0XA 2VSOA 1IN8A 2WJYA 2IF2A 2QP3A 2WSMA 4P4SB 2OEPA 4N1AA 1G5PA 1ANKA 3Q7QA 2V6IA 1GTVA 3TE6A 4OHZA 3MJRA 2B7CA 2H7VA 5K8LA 4OK3A 4L15A 3P27A 1CS4C 3GLIB 4M9SA 5AJXA 3SFZA 4JN6A 2ZYTX 1DARA 3KTAA 121PA 4NCKA 3WP0A 1JPNA 2BOVA 3W34A 5CIQA 2ZREA 1YU9A 4QBFA 1EGAA 3EPJA 3EZ2A 1UPTA 3K1JA 1D5CA 3GJ8A 1XRJA 4BFZA 4H1UA 1SGWA 4JLVA 3QUSA 1QHSA 4GPTA 4HLQB 1Z0AA 3DZDA 4H9GA 4DCNA 2BDTA 5HE9A 3ZQJA 1KKMA 4GP6A 2XZLA 3O8RA 1KIMA 5IK2A 2ONJA 5L8VA 1L8QA 4IDNA 1Q1EA 3BFVA 1U98A 3W6PA 2HLDA 1SKQA 2W2TA 3EASA 5EE9A 4OI2A 2DPXA 2NTYC 3TAHA 4FW9A
chains in the Genus database with same CATH superfamily
1KOFA 2WTBA 1XZQA 4YXWD 1Z6AA 4RKWA 1TO6A 2WSCF 3KU4A 2PRIA 1I01A 4HWTA 3L7BA 1A69A 2F9FA 3PUWA 1AQUA 4JBXA 4K03A 3U6SA 5TB5A 3R7BA 3FE3A 1RW4A 2R66A 4ZQCB 3ZU5A 3HRIA 5FWDA 4Y2JA 1Q44A 5CH8A 5ALHA 3NS7A 3RC1A 5ADWA 4RMJA 1TYAE 5CEEA 3I2FA 2Z6AA 2Z3VA 3GFRA 2IIPA 1GCOA 3RFXA 3MJHA 3VZPA 2JIDA 2Z08A 3HUEA 2LBCA 3FTDA 3MS7A 2OVFA 2ZQ5A 4XYGA 4EEKA 4FC7A 4I1RA 1QIIA 2NO1A 1QH8B 3VR5A 1NMQA 5FL7D 5CA0A 3HV2A 1GGEA 1W34A 2YVKA 3WDSA 1LDMA 2MU1A 3Q3CA 4GZ6A 3TJMA 3W6ZA 4D8XA 3PJEA 1TKRA 5K05A 2HFKA 3OOHA 3ZIUA 3SQXA 5DYGA 1KI6B 1L4MA 5F3WA 3CZQA 3E3LA 4K46A 5LBTA 3JV7A 3ZWWA 1M2JA 3SSAA 2BMAA 1T4CA 1JQKA 1H2BA 1DC6A 3MINA 3L7IA 2LTUA 3SSOA 3ZU2A 2X49A 3DM9B 3DT9A 2G3QA 4JLKA 5ALIA 1ORIA 1N4AA 4V0NA 3REQB 3LLSA 3TE7A 4DLYA 3HYNA 3PC6A 1J0DA 3P9YA 4B47A 4BNFA 4G4QA 1RCTE 1F14A 1T4CB 4E2YA 1YCGA 5FBQB 1DEXA 1MX3A 4UZEA 3N7UA 3DL7A 1JIIA 1UDCA 4IUCS 3RTBA 3W2FA 3WIUA 3I76A 3L8GA 3RKUA 1Y1PA 3VH1A 4R98A 2X4GA 4IHJB 2C7GA 1JXMA 4FIDA 1D6SA 1W52X 3O26A 4RIGA 2B69A 5GKNA 4XD2A 5MGNA 2G67A 2YRWA 3FOWA 1USVA 1CUEA 1DMRA 4C07A 4HAUA 3X3HA 4PDGA 3CLUC 3GDWA 4LQ4A 2GFIA 3RC8A 3Q5GA 2XDAA 5KNCD 1DX4A 3K4PA 1EVIA 1OPXA 4LE2A 1IPEA 4NBUA 2DPYA 1IH8A 2XCIA 4JBLA 2PS1A 3KQTA 4MUJA 2XXJA 2PR2A 1PG0A 5IM4F 3SWWA 2FMKA 3NV9A 3BGIA 4ONEA 1F4PA 1E0DA 2PWYA 1RJFA 3N1UA 4CEJA 3T1QA 1E9DA 4Q05A 3WGMA 1GG9A 3ZIDA 1NJ6A 2GX6A 1Z18A 3KR1A 1R4GA 1Q0HA 4DLUA 4MPRA 1CERA 1F5NA 3RSLA 1EFRA 4D4JA 1UH5A 2JFOA 4Q3OA 3UMCA 3IURA 4TX1A 1RM0A 2VG8A 1QRDA 4OXYA 4B3HA 4X24A 3PRKE 1NV9A 4NABA 3BREA 2PD3A 4XI9A 5TX7A 2RB5A 1QSGA 1J8QA 1VHLA 3U61B 4MW2A 5ENDA 5EI5A 3OIGA 4C3ZA 2ZUVA 1N2GA 1CZKA 2LXEA 1SQGA 1CHDA 4JXJA 2VNSA 2UZIR 3A3OA 4KKVA 2J3IA 4DMFA 2ARKA 2QYOA 3LU1A 1QS0A 2AEJA 1KO4A 3UYKA 1AKRA 1PK8A 1BHJA 1PT5A 4UU0A 4AJ1A 5K0JA 3ZNQA 4I1PA 5DIZA 5FI1B 3DHNA 5JFOA 4B3SM 4JLOA 4F1IA 3K5WA 1DUIA 4FFPA 1PCXA 3U17A 4BC1A 1CZHA 3CEPB 3FETA 4X94A 1SB9A 2Q7XA 3BS4A 3E9CA 3G8AA 2IDJA 1UPUA 3OQBA 3UO8B 2VQ6A 4DYHA 4E2XA 5AW2A 4BNLA 4JN6B 1E3JA 4RMHA 1Z4PX 2BBSA 3L4SO 2Y21A 1QOQB 4DUZM 1T25A 1QGUB 3G2IA 4ZOQI 5LQDA 2MSLA 2UZ4A 1U4SA 1JDBC 1KI7A 1XPRA 3CH5A 3O4IA 4WUVA 1ML4A 4FKBA 3V8VA 3KLNA 4B34A 1EUQA 1T9KA 1V26A 1XQYA 4OFXA 1CUKA 4EPRA 3WB9A 5KVCA 2VSYA 2HKIA 1ZAEA 2F43B 3FNHA 3JQ9C 2C5GA 4CKWA 3IDFA 1XGKA 1RAEA 2I6UA 3RSOA 1ECBA 1CZRA 1UJMA 3PRHA 5ITUA 4YO7A 5I51A 5GV7A 1OLUB 3VZBA 4MUMA 3G1UA 1I4WA 3CRW1 2YVUA 1H0SA 4L73A 4MKZA 5K4AA 1C4WA 1KZ1A 1VI6A 3L7OA 1JQ5A 1U7DA 3VNQA 3DBRB 1ZHOA 5JAUA 4WLFA 4PXAA 1FNDA 5DYIA 1DPFA 3LRXA 1QIGA 1B26A 2JEOA 2WPNA 4N0PA 5GVSA 3USZA 5ALLA 3PTZA 2G8NA 1P61B 3QHAA 1NX6A 3U2QA 3EIUA 4KQ9A 4JLAA 1OIPA 1HL3A 2BP7B 4B0PA 1B76A 3EODA 1UKAA 4I50B 4XE5A 5LZ9A 1AQYA 4MV8A 1WSAA 1CVIA 2VP9A 4J8PA 1KPGA 1VMDA 1PJTA 3P2EA 3QIAA 4MVJM 2KI5A 1IMOA 5ALWA 1H66A 1W0JA 3FR7A 3PQ3A 2Q45A 4RCYA 4U6SA 2OAGA 2VJCA 4ZV7A 5IMSA 4NCAA 3ORSA 4HH4A 1VI5A 4GM0A 2ZUFA 4CDGA 1TA0A 1TGYA 5KYUB 5HMLA 1IVYA 1CQIA 1R2QA 5AFSA 3AIIA 1VRCA 2YS6A 1LDNA 4DV2M 1A8UA 1MB4A 3SATA 1E8DA 2OCLA 4NPAA 4ZT3A 1GLNA 3NTVA 1T2CA 4F6RA 4TSKA 1VL6A 2PM8A 1G7SA 4X54A 2DFLA 2FN4A 4P17A 2P8JA 3Q10A 1VKRA 1GV1A 1O58A 2TSYB 3H6KA 1SC3A 1H2XA 3IP7A 3UXEA 3ZTWA 4DA7A 2SKDA 3QVUA 1ZEMA 4PHCA 2EKFA 2FN3A 4PAWA 3TKAA 4C0AC 5JQWA 1RPNA 4F4DA 3RGGA 5CJ2A 3BG5A 1R4MB 4IDQA 5LA6A 1T2UA 4LJ4A 3ETLA 1E4EB 1RRCA 4M3NA 2X0IA 3OY2A 3F90A 5L3SA 4R8VA 1Y1RA 1EDZA 3EK2A 1U7OA 4I1UA 3WFIA 4C76A 4F96A 2RGYA 1ZNXA 2GK3A 3E03A 4WZAA 1SXJC 1WZUA 4UNQA 4ZANA 4P35A 4YUZA 1R0KA 2B34A 4AMUA 2Z8ZA 4X1YA 1W75A 2BM9A 1KJNA 3I62A 2J6CA 5IDXA 3CN7A 4RJIA 2OSVA 4DVJA 2D5LA 4QEDA 2OO5C 3C24A 1EYZA 1XRQA 1TK9A 4IH9A 4DSNA 3LP5A 2R87A 2UXBM 3GN2A 1ZISA 4ZK2A 1ZS9A 4PSVA 2NXCA 1LTMA 3AY6A 3GFTA 2G9RA 1XNQM 3NTRA 4BMNA 1LCIA 2XE6A 5KOHA 1SVKA 4K05A 2C96A 1ZU4A 2FSIA 2QBYA 3BZWA 4M0FA 5HRAA 4RMGA 4RC9A 4RJLA 1OXTA 4URWR 5FRDA 4DYDA 1B7GO 3KUCA 4PNZA 4NIMA 1SZCA 4F12A 4UTVA 5KJCA 4GO1A 5EP4A 3CF4G 4O5AA 2Z2JA 3BD6A 4D9EA 3K2EA 1J33A 3GIWA 2GZ2A 2QTWB 1JIVA 3DBHA 1ELOA 1H22A 4BWYA 1NW5A 5JALA 4YHHB 3G02A 1P45A 4EJ2A 4DR3M 5F9HA 1CS0B 2RH5A 2O8EA 4YMIA 1VLZA 6YASA 2CWDA 1DJQA 1GN9A 3L07A 3D3KA 2VP3A 3JARB 5H4GA 1EGVB 1ZI9A 3NDRA 2CY0A 1J06A 2CYAA 1X77A 2ZIAA 5CD9A 2GD2A 1I7SB 4R0NA 2RCNA 4X3CA 4RSGA 3E8XA 4S1VA 4RXMA 1W6UA 4BCCA 2XMQA 3KIPA 4C4YA 1UDAA 5FAXA 3TDKA 3HL0A 3K5HA 2UDPA 3FLEA 2FV8A 3PFCA 1H8HD 2YJTD 1QHYA 5AM4A 2FW0A 4E03A 3GYBA 4E3WA 1Z2CA 3MAAC 2Y0DA 4QQFA 4ACAA 4GC9A 1M2NA 4IEEA 4KYIB 5K3AA 4AMBA 3EXFA 1EFPA 4HB3A 4MGYE 3UMMA 1PZHA 1XAJA 2LCFA 2ZWMA 4NF2A 3J80A 2NUBA 1DBSA 1DGGA 1DRUA 1WCIA 3HBLA 3TNFA 4B31A 2CMFA 4MUNA 3HJSA 5HJ2A 1RAGA 5LJLA 4PFJA 2F55A 4HR7A 3PQEA 2WA1A 3NOQA 1E1LA 3PDWA 4QDUA 2OM6A 1GU7A 1Y3HA 3UV7A 3OTOB 3PLNA 2B0CA 5FPSA 4DDKA 2AWNA 1DRKA 1FTNA 3NO4A 2I2DA 5KNBA 2QZ9A 4CFSA 3ILYA 2XAAA 1T26A 1I5EA 4CHTB 1B6SA 3GNTA 2WJGA 5AKKA 2ECPA 4CW7A 1MW9X 1NXWA 4LC9A 1T8SA 1NOIA 2ZRAA 1UOPA 1VLMA 1RYNA 1EDEA 5CLIA 4N47A 2CXTA 5CCEA 2PXAA 1FDOA 3JASA 1PX0A 4JC8A 3VOTA 1T1EA 2C5EA 4Y2HA 4WX2B 2N3ZA 3CLRD 1VE5A 4RH0A 5D3ZA 3GO8A 1QYIA 3KJIA 1E5QA 3ROTA 1I80A 3G23A 4JOCA 4RH3A 4LJLA 1N2EA 3N2GB 5ECGC 4C4ZA 1ISGA 2QRQA 4Y30A 2GYWA 3FGPA 5GGXA 2R4TA 4QXRA 1XCPA 3PENA 5KYYB 2QS9A 2C88A 3HDGA 3JQ6A 3TL4X 1K0UA 4DBZA 3GAZA 4WT7A 2HDWA 1FW8A 3F4KA 4MO9A 4C0HA 5LVAA 2QM8A 3WGIA 3HU2A 3V46A 2Z5VA 1U94A 1GGHA 1U1GA 2RBKA 1UJ2A 2ATVA 2WV7A 3C48A 4GHLA 3HN7A 3OPMA 4FXOA 4P3XA 4X6XA 4DW8A 3T5AA 1YI8A 2ZS7A 2R65A 2PA3A 3FY4A 3FSEA 4OLJA 5JJKA 3EZGA 2GUGA 4L7QA 5EWMA 4ASUD 1SBTA 1FIUA 3BGVA 4QGSA 1YASA 3EOZA 4X97A 5ENVA 1IBMM 2NVBA 1G5IA 3BMXA 5BR4A 5IG2A 1ZW1A 1F0KA 2DEUA 1DG3A 1CWUA 2OO5A 1MC5A 4LN1A 2JY6B 1D4ZA 1RXWA 1RKQA 4ZYUA 2BZ1A 3KXIA 4EPYA 2PSSA 2ZT8A 4MV4A 4FFRA 5F5LA 5BUCA 2YKGA 3CTPA 3Q6MA 3I0MA 2V7XA 4Q4AA 5TQ0B 2D13A 3OEWA 1FYWA 1WPXA 5AW3A 2QSJA 3JPYA 1GQQA 4CM8B 1V8OA 5KNDH 2B7BA 1US8B 2YBDA 3AL2A 1P5FA 2OSBA 3KELA 3QX9A 4RM3A 3R7NA 2WKRA 3SLGA 1X8LA 3PFFA 2WIKA 4KQIA 2Q9AA 3UA4A 4AURA 5BSKA 2Z8YA 4EHBA 4B2YA 1W1UA 2QORA 3FHOA 1V8BA 2CXRA 4QC2A 4UKDA 1W6RA 2GZ3A 3IECA 4DA8A 1L4HA 1YZ3A 2CF6A 3A37A 4XX1A 4QRDA 2EZUA 4QO7A 4YV2A 1YV9A 2AN4A 2X5NA 3NRJA 5LUBA 3IR6A 1AMNA 4JJ4A 1ZJ4A 5TF4A 3U4HA 4W9RA 1EFVB 4HLCA 3LW5F 4OKNA 3AESB 4LSMA 4J6FA 1VA4A 5TEVA 4ZV4A 4TPKA 5LLDA 3GLHA 3EE6A 3JATA 3LQFA 4FFWA 2VBGA 1X92A 3GLVA 3IQXA 2C31A 2EQAA 1WHCA 1SEVA 3R7DA 5ICMA 3CISA 1W96A 4FBLA 1RC0A 2AZTA 3E84A 2JAXA 1LDBA 1Z47A 3C6BA 1EVKA 1LRKA 3CH4B 8CATA 1EG2A 4F3YA 2JK1A 3VK8A 2UYQA 5E7JA 1ZD9A 1I51A 4J0FA 4URVR 3U13A 1O57A 1WZIA 3A1CA 2Q62A 1HYBA 1IM2A 1BFDA 4R8SA 621PA 4CCYB 5KWVA 1GXSA 2JGRA 1HDOA 2GN8A 5KTKA 1DNPA 1S3GA 4MRRA 1U0HC 1GT6A 4DB2A 4C6HA 2E37A 3T4XA 5G40A 1UM8A 2BBWA 3CLSC 1KZ9A 1UZAA 3HDYA 1LTKA 4MUKA 4PYJA 4B08A 5I5GA 4MCAA 5CM2Z 3B9PA 4FBMA 4I50F 2HHHB 2GRJA 1HK7A 1KARA 1RQLA 2ZJAA 1QIFA 1HV8A 3EEQA 1EX7A 1T3GA 1ESDA 1P1CA 3FLBA 3GMTA 3H1BA 3IGFA 2ZRPA 3T3HA 4FLMA 2O8CB 1ISPA 3BRQA 3OE7D 2QU7A 3DVAB 2QJFA 4DLSA 3TB6A 5DSTA 4CKEB 3PX2A 3L40A 2IU3A 2QVBA 4QTUB 2H1IA 2XT0A 1E6MA 1IPHA 1E0SA 3OUUA 4TWAA 3C3AA 5TC4A 5KI6A 3ZHQA 3ZW7A 5HM6A 3PNKA 1XF1A 4F4FA 3B1KA 1AA9A 5DCYA 2BGJA 1M6VB 5AKHA 2QYTA 3OQNA 2JS7A 5HCNA 2CV0A 3F6RA 2R84A 2BGKA 2X9GA 4UVGA 1XMJA 4NENB 3CZCA 1SC9A 4PGMA 3CJQA 3RHZA 4GGPA 3NUQA 4RV5A 1YJ5A 4CM3A 3DE1X 3R0IA 1Q91A 2PDAA 1EAMA 1Y89A 1IOVA 2KB0A 3GLQA 4GX1A 4KK4A 1M5TA 4L95C 3X2FA 1TD9A 2BEVA 3I6IA 4KMRA 3KQUA 1QDLB 3U0VA 1E62A 2A0YA 4EKGA 1GQOA 4NBKA 2O8VA 3NGLA 2YDYA 1Y4DE 3AI7A 1U9JA 4K9RA 3D02A 2CCJA 4CQMD 1SIUA 4EO9A 4LMRA 1K9SA 2I91A 4D4LA 2NXJA 1HYEA 1PR0A 4AD8A 2IOFK 2ZK7A 1FFYA 2GHTA 2VH2A 1XNRB 3BBLA 2P79A 2W6ID 3PC8A 2CHUA 4NLLA 5C31A 5LMZA 5LQKA 4TTRA 3BE8A 1B15A 2DSTA 3MBKA 5A71A 3OF2A 3E3MA 5FO0A 1IJFA 3LKVA 4A73A 5JS6A 2Q49A 3ORRA 2CYBA 3B5JA 5EESA 5ELLA 2XVYA 3EVCA 2Q9CA 1NGSA 1V8FA 2CLSA 4J16C 3Q40A 4NOJA 4C9BA 4BZXA 5CT9A 1C1HA 2B5OA 3OMWA 1GO2A 4P0TA 5HX7A 4D9NA 2VH1A 5CB4A 4P0QB 1S3IA 1IB0A 2GO7A 2ZSFA 3ELWA 5DFAA 5C7OO 4N49A 2F8SA 4PS1A 1G38A 2D1FA 4NNOA 2PUHA 2W7TA 3A9RA 3MBOA 2X14A 4Y6RA 5AKEA 4WXHA 3RBXA 3LHKA 3W9SA 4CQMB 2F90A 4MQ6A 3DOAA 1CUCA 3NHZA 1G5FA 2CNLA 4KAXA 4R1SA 5DLQC 1S1CA 1GEGA 1R5NA 1XRRA 1K4KA 4JP2A 1U2ZA 3JWJA 1JN0A 1RC1A 3KHUA 4V3CA 4WESB 1XKQA 1W36C 1BXKA 3NIBA 5JAZA 2AZ4A 3HCBA 5JSYA 3OEHD 4KGVA 3V1MA 3EEYA 1GSIA 1UK7A 2RC6A 2A86A 1LRLA 1KE1A 3UAXA 2BI4A 3L8EA 5BV2P 4KIWA 5ITQA 3OZSA 4G5SA 5F35A 2HRRA 4ECEA 3B82A 3HH8A 1QFJA 1L5OA 4N5LA 1G3RA 1BU8A 2EHJA 4FDVA 1JHYA 1E9CA 3ZGZA 1ST2A 3BTSA 5KREA 1SQ5A 3O3CA 1NW9B 2JW5A 2C7VA 1TLTA 2WIDA 3IAAA 3Q3GE 2VJMA 4G01B 2D6FA 1U2GC 4LWZA 2VHVA 5EE1A 3ZJTA 2AOWA 4IGEA 4O02B 4EL0A 5IWCA 1YRAA 3W5CA 4ER6A 1Y9JA 2ZT7A 4JCCA 1C3OB 3ORQA 4D3FA 4UNNA 4LNUA 2ZBEA 3WKCA 4KXFB 2DQYA 2GJ8A 2C83A 2I34A 3HC7A 5LIPA 1K7SN 1UOOA 1O5IA 1JXQA 2O06A 2FMHA 1MAWA 4JH0A 1ZVJA 2XKAA 3TLMA 2B2NA 5B55A 4CMEA 1RAHA 1HNNA 2CBZA 4WY8A 1P7YA 2WYOA 2Y68A 4AYXA 5LZ2A 2UUAM 2GXAA 4BO5A 3HSSA 5B2ZA 1B8UA 3U4QB 2B3DA 3VDPA 3L6BA 1V96A 4P16A 3YASA 1MPTA 2NOAA 4QAJA 1XDBA 2IH4A 1V8DA 2RGOA 4WBNB 5AIBA 1ZM2A 1ORHA 3GRUA 1XYVA 2I2FA 4H7HA 1EXWA 4TLCA 4X45A 1KNQA 4JDUA 3D64A 4O1IA 3SHVA 2N46A 4AZ3B 3UENA 1R5BA 1G0OA 2A92A 2BH9A 5SZKB 1TT5A 2YOFA 1IL0A 2ZJBA 2G88A 4YP7A 1V7CA 3OM0A 4ZGWA 2ECKA 3SN6A 5MN6A 1E59A 3DYIA 4D82A 1Y9DA 3E9DA 4LDPA 3T9DA 3O92A 1AKWA 3L6UA 4KXMA 3VR1A 5JADA 1TI7A 2WSBA 1QKIA 1UIRA 3VQTA 1IXZA 4KN9S 1LUAA 3DBRA 5SYNA 1YZVA 5D8DA 1CKEA 1PQPA 2HBYA 1T43A 2JAWA 2Q3JA 1XXHE 1VKHA 3PNYA 4TSFD 1WW2A 3VU1A 3ADCA 3R44A 1VEGA 2BKVA 4KLAA 1DO2A 5ALUA 4MTLA 1XQ9A 3KKNA 4E70A 4M0LA 3SOPA 2WFMA 3EMKA 1Q7RA 4EBBA 3F2VA 2X7HA 3U3MA 3G8YA 1NXXA 4LF9B 3T34A 2XYHA 4IJUA 1QTIA 1QYXA 2B4TO 3L5KA 4NPHA 4KRFA 4EY5A 2JD0A 4HI0E 4L9WA 1ECPA 2DH6A 2HY7A 3K1ZA 3BE5A 4L07A 4KIUA 4BVAA 3TVTA 1W5AA 2ZCVA 1FNSA 2YYYA 3NP7A 1NRIA 1T91A 1ZCZA 3LP8A 1YHZA 4MVJH 3WGGA 2VSNA 3BCUA 2PMEA 2CFOA 2AOTB 2DBYA 1KMQA 4GHAA 1ODKA 2YZ2A 2G9UA 2GZSA 3P4UA 4MVJE 3TVDA 3QU5A 3DR3A 2IHZA 2H59A 4MVJF 3IMFA 4F1WA 1JB9A 3CNHA 4FP9A 3NT4A 3EXIB 4EPTA 5H37D 4OU7A 5KU7A 3I2IA 4J9VA 2MIIA 5E6SB 3VZRA 2QG9A 4AKEA 1RRVA 3KOUA 3AIMA 1NUQA 3PA8A 4J0DA 4RZ3A 4YY3B 3IOMA 4CIWA 4JLJA 1YBHA 1RHRA 1YFZA 3BJZA 3KXLA 2VS1A 4J4TA 2F9LA 4KREA 1UKEA 1GARA 1NNUC 3T7KA 4ABYA 2D3WA 3EG9B 4CU2A 1C7FA 1IBKM 4DR5B 1H1DA 4B5KA 3S44A 4F4JA 2B1QA 3AXSA 1Y9AA 2EX0A 3ZY6A 1ZLYA 4PYMA 1SVMA 5BMVF 2QTGA 3I5MA 5DP2A 3NM5A 2JJ1A 2J5YA 1PWEA 4J03A 3LOPA 4U2CA 3HKEB 1Z5OA 2E6UX 2X0NA 1KHHA 3L1KA 1WV1A 3QX8A 1FP4B 4KGZA 1B42A 4G1CA 4AWAA 3GQ4A 3O94A 3RRXA 4F5ZA 2ZUEA 1Z2AA 1DGHB 4B3RB 1UBMS 4UOQA 2XIJA 3ZR4B 3CF2A 3W0FA 3B6EA 3L7MA 3KQPA 2IWHA 4BLOA 4X71A 5L95A 2UXDB 4JB0A 5CDYA 1Q1NA 1QTNA 3U44A 1Y6GA 4EX7A 1M5RA 2Z58A 3OM1A 3UQYS 1FTWA 3JQ7A 4TKUA 3FOCA 3K72B 3K7EA 1Y4SA 3W5HA 3AVXA 1FYXA 4LHVA 3PFNA 3OMXA 3W1EA 4US2R 3M6AA 2YFYA 3C85A 3ITNA 4YLGA 3QOFA 3CN9A 2WZBA 4YDSA 3I04A 4L6CA 2ZRBA 1P8AA 1RI1A 4TL9A 3AC0A 1YQ9A 3BRWA 1HR0B 1Z2DA 4GNRA 3FVRA 4S12A 2E87A 3FOFC 4ALLA 4EY8A 2QVYX 3CEHA 5A2GA 4HEHA 3K8ZA 2VNJA 2L7HA 3FFXA 4H4DA 2KEBA 1E94E 2NGRA 7GPBA 2ZQYA 1CIJA 4GSLA 2W70A 5E26A 3X1XA 4N12A 3RVMA 2QN7A 2VK4A 5DM4A 4YMUA 2H51A 3DKVA 1DKMA 1SKUA 3KG2A 1U3DA 4FEYA 4GPEA 4NYJR 1OZHA 4ZVNA 2CBGA 5H9VA 3RKRA 2R46A 2EFEB 4KV9A 2YINC 3LVFO 3Q6NA 5DXAA 4BS9A 2CMGA 3ENNA 1XLTA 1HUQA 2WNHA 1RADA 4YXWA 2WT8A 4CIBA 4HQ6A 2ID9A 2MHCA 2PGIA 3FKSD 1XPJA 3DBHB 4LKRA 2DCUA 4LY3A 4PR0A 3E22A 3Q9NA 1VIMA 4R2IA 2A2ZA 5J2TF 3IP6A 1G4AE 3P0FA 3SG0A 1SBQA 2HDNB 2PV7A 1MIHA 2NU8A 1G8JA 4EJ0A 2KNAA 3SAVA 2BEWB 1PVDA 3NTXA 4NYIQ 4R54A 4AJNA 2Y1LA 4H3SA 5LNK6 3K70C 4AIRA 4U02A 3OEHA 5KOHB 2P6RA 3F6BX 2I6TA 4U7FA 3GOHA 3MA0A 2OFOA 4NZOA 1ECLA 3KR0A 3MC1A 3OIUA 1QZEA 1J42A 1R0WA 5TNXA 4B3GA 2JGNA 1NP3A 3KSDO 1T4DA 3QUQA 1O94A 3E1GA 1HE1C 3I42A 1KO7A 4MCJA 4D9BA 5HHTA 4CXMA 1I94B 1ESCA 1KYZA 4RZ2A 4RKFA 1YKFA 4FT2A 1IUNA 4ISBA 3GUHA 4N8SA 2WWGA 2P68A 5FFNA 4D4HA 2M6SA 4DCTA 4OQEA 3ESYA 3FBWA 1PEDA 4AJJA 5C51B 2IV2X 1T3TA 4M1SA 4WKBA 4Z1MA 5K20A 4JL8A 1HT1E 4M55A 5KCMA 1ZCJA 2ZQZA 2NUTB 1P1RA 3EPLA 5JZSA 3JR7A 2YQ4A 5L4LA 3ILHA 1U8AA 1DBRA 4IGIA 4FYKA 1TF5A 1XT6A 2ESRA 4FEAA 4PXYA 4X8LA 5K3FB 2BISA 4MLCA 1VDZA 4U0JA 2H1LA 3C2QA 3ITEA 2AJ8A 5IC5A 4G0QA 2UU9M 1UMDB 3DKKA 1WCIB 3HDJA 3UAZA 1I3MA 1AURA 1LI4A 3FCEA 4F86A 2AD1A 5AM5A 1EFPB 2J08A 4MUEA 2R8EA 2D8MA 3EZ7A 1HT0A 1K7EB 2TMKA 4PE5B 3WIDA 3C3WA 4ALMA 1BMFA 4FI3F 1K6EA 1NRWA 1XAIA 3DEFA 3NI2A 4RQUA 2G63A 5A5GA 1XNGA 3ZEIA 4DDVA 5MDHA 2P3OA 4AF7A 1SUSA 3KKQA 3RC9A 1EFKA 1P17A 4Y1EA 1ISSA 2QXTA 2IH5A 1IWOA 3TZQA 4H3HB 4XVHA 1SJ9A 5FWNA 3NALA 2JFVA 5L7WA 2J3HA 1KJJA 2QAGC 3GAMA 1N1GA 1RLTA 3SGLA 1W8DA 1GG5A 4WERA 3QWIA 4WASA 3UK7A 4DRZA 3BCRA 4CM6A 2DLDA 1R5OA 4DWJA 5EXXA 3CSSA 3QOWA 4KG7A 3ZDYB 3TCKA 1IPFA 3U6DA 3E22B 2Q0SA 4GFDA 1EWKA 3OU2A 3DTVA 1MO3A 5KZMB 1GVHA 1Y80A 5JI2E 1K9VF 1RRPA 2FWAA 2I78A 4U4AA 2RONA 1UJBA 4ENUA 4W8HA 2VRBA 1DAGA 2NZJA 4TYNA 1Y33E 3KL4A 4E5UA 2DAPA 4L50A 3LC2O 1ODFA 4C3OB 2JFWA 3G9ZA 4J43A 2OZLB 4CFYA 1PZFA 3HVIA 4B3RM 2JLXA 4QDTA 4W9NA 2M6LA 1BIFA 4M8KA 4Q7KA 1MJGA 1MQAA 3M82A 3M3DA 1PNVA 3IP1A 2O5EA 3N05A 2J5QA 2VCHA 5CFNA 2ZR8A 1S2MA 3LCJA 4P5DA 3WFJA 2YX1A 1TMOA 5GPBA 3A7DA 2R7AA 3OWOA 3I58A 2OQ4A 4E31A 3FWPA 3HNOA 5BRJA 1GRQA 5CYFA 5AK3A 2YWFA 3QTTA 3VR3D 4CWAA 1OXKB 3ZIAA 4UTRA 1N5JA 3DFIA 4DCJA 2ISQA 5H1YA 1DINA 1HDYA 1QX4A 1JEAA 2ZDHA 2I76A 1S2DA 3KP0E 2R4EA 2B37A 2A9OA 4B87A 4TXLA 5HILA 4QL3A 5KTYA 2QHOB 3K6SB 2YJZA 3DWEX 4M1OA 4Z0TA 3NR2A 3UV6A 5AVQA 3CWQA 2NU7B 1E4EA 3CZAA 3OA0A 4HWSA 2MMGA 4MV9A 2FPKA 3Q7RA 1TVKA 1J24A 3WKEA 4ES6A 1NA5A 3ADOA 2NUTA 1U3VA 4G0ZA 4Q9NA 5BYKA 3RUHA 4AZ0A 2PUFA 4DVGA 3TG2A 3IB6A 3LFUA 1PV1A 2R25B 3INGA 4GKAA 4FOOA 4DJAA 4RJTA 1R10A 1H42A 1LKZA 4IX9A 4DM7A 5CD1A 4JY7A 3FPGA 1B8VA 4I1IA 4O1HA 5DOVA 1VGVA 4AC9A 3GFQA 1DO0A 4XWKA 3SAUA 1ZN9A 1AZSC 2F3SA 5GONA 2EGUA 2CK3A 3EBPA 4HVLA 5BYBA 4DV1M 2C5LA 1B3RA 2R6R1 3B1YA 2GYVA 1M1XB 4HAIA 2WYHA 3F5SA 1Y1LA 3AV0B 2C1EA 3OPYI 5C34B 5H8WA 2O8FB 3DB1A 1GHTA 1XUOA 4OL9A 4MKFA 1R8QA 1U9IC 4LBWA 3LVWA 1JQ3A 3H2IA 2GDZA 4L3VA 5IBRA 4ECAA 3ZU4A 5DGCA 4BVGA 5JXHA 4NE9A 4UQPA 3CIOA 1JEOA 4ZPXA 3UGJA 2E4VA 1UBKS 3DQPA 4R1UA 4PPQA 3UAVA 2BP7A 2FFJA 1N0WA 1SCUB 4JD5A 3UT6A 4MO2A 4C4XA 3UHPA 2XGJA 3LM8A 1ACMA 2H3HA 5JS7A 3D8HA 1BJTA 4GZ5A 4OQXA 1JIUA 4JI1B 3TD2A 2HCBA 2ZE5A 3S2IA 1E6CA 4QUKA 3WX0A 5B3LA 2EG9A 1ADFA 4FINA 5AXCA 1QVWA 3K71B 1ZGAA 4Z54A 3NVDA 5DMHA 3TOSA 1V34A 2GN2A 3KRTA 3LQ4A 3QFHA 2CL0X 4LY9A 3WRXC 5FTLA 3C5WP 2Q6KA 1VXRA 1OBCA 2CXSA 4PYRA 1PU2A 2NQTA 4O4JF 2DWMA 3M4XA 1N2XA 4AS2A 4JJFA 2YIVX 4I46A 3Q8KA 1JMVA 4I2VA 1GNLA 4IOMA 3KR9A 1MIOB 2EXXA 2XEXA 3CKLA 3DT8A 4KIGA 4I81A 4DLVA 3WLAA 4M89A 2VT7A 3E0XA 3UHJA 1O95C 1GCIA 4ZCSA 1VL2A 3QQ5A 3MNFA 3ONVA 2CXPA 1O94C 2OOBA 2A35A 3N2NA 1UXHA 4J0IA 5BO5A 4EKEA 1ZIXA 2GM5A 2CCGA 4XPZA 2QW6A 1BS9A 1ZGJA 3N5KA 3RS8A 2OYCA 5CVEA 4G4SO 3MEQA 5EHNA 3RYFB 3TOCA 3IJ5A 1FDUA 2PBFA 4DIKA 5C2JB 2PUEA 2Q3EA 3DEYX 3OURA 3QE3A 1YD7A 2O20A 4N5NA 1OFTA 3ESDA 4HP8A 4H7EA 4Y7DA 4EP1A 4B6FA 3KV1A 4ZMRA 4JI8M 1EIJA 2HMTA 3TGLA 4AKTA 1D0LA 4KHPB 3GPUA 3E8SA 4IICA 4IOJA 4E88A 3DP7A 4LTDA 4ZYTA 2J3MA 2EF0A 5TT1A 2EBWA 2H4JA 1XZ8A 2EERA 3LXUX 1E9SA 3WWEA 3NIGB 1U8CB 1AKMA 4KACA 4BP8A 1K2WA 3H83A 2O07A 4LOAA 2UUBM 4WCFB 3MJEA 1DOZA 3TQCA 1U81A 3DHVA 3MELA 4N39A 5FQNA 2Z56A 2YMPA 3TIXB 1SOVA 3EGEA 2DFKB 2ATEA 1A9RA 2HTFA 4KXWA 1I7QB 4ESVA 4DREA 5JWOA 3SXJA 4CETA 2WC1A 2X0DA 1ZUNB 2GVDC 1EWYA 5ETJA 2CC2A 2ZUBA 4XQEA 2PXCA 5JASA 2IYXA 2W6ZA 2N35A 1UKBA 5J3JA 4JYAB 5FFMA 2JIZD 2EBFX 5F73A 4UUNA 1GVNB 2Q46A 1M6WA 2YWEA 4GZMA 2RGDA 2WJZB 4ZODA 3UJ3X 1ZAKA 3BGSA 2JAHA 5FOVA 2FMUA 2OXRA 1QAQA 4GZ3A 3VHQA 1NN5A 2QV7A 2ZIXB 5T4BA 1YDMA 5CIWA 4OF4A 5NULA 2IPNA 4H15A 3WAGA 4YQFA 5FI3A 2OGTA 2VYVD 2QMHA 2V55B 1E3EA 1ODJA 3LPNA 4MLZA 4YRMA 1B8PA 4MYHA 5LYJB 4IHQA 2IOFA 2MSNA 2WG1A 3D7LA 3GEEA 1L5RA 4L2IB 1MEJA 3QMWA 4FUTA 5GZ1A 3RUDA 1V5FA 1WVMA 1N5MA 4OSOA 1JVBA 2ZSDA 4MVJI 2AKAB 1R6XA 2P91A 1LSJA 4TS3A 3CCCA 1IN1A 3SBJA 2IHTA 2D62A 4L57A 1D1SA 3SP1A 4I0WB 5EEHA 1PL6A 2GTPA 5AHWA 1R8XA 3UZUA 2DECA 1X80A 5DYTA 2EZ4A 4MR9B 2JFQA 2X1VA 3OECA 3IQFA 4ILEA 4LVUA 1XZHA 3R5JA 4JU8A 4J0GA 3UBTA 4YRDA 4NOLA 3GJQA 2CVHA 5HP4A 3KV3O 1RXCA 4I5GA 3CYFA 4ZWNA 3ZJ5A 3GPLA 3UM9A 2O3UA 5AJYA 1N32M 1QONA 5JDCC 1G59A 1GUDA 4P08A 3HBAA 3U6MA 2O59A 1E9AA 4IDBA 4QGAA 1BD3A 1A98A 4RK5A 2ABWA 2VDJA 7AT1A 5ALGA 2GPYA 1I0LA 3ZKWA 1CR4A 3ENQA 4TL7A 2QIOA 3PUVA 4K6CA 5K1ZA 1JS1X 2ATXA 4L4XA 5KS2A 2NZ8A 4MCHA 1V95A 4MIYA 1A9SA 1G8SA 1M0TA 3EVEA 3NHMA 5EIBC 2W6CX 3GPIA 2O8BA 4HDAA 1WGNA 4HDRA 3FUVA 2WVAA 2KBEA 2GBPA 3DMDA 3HY6A 1J9GA 4K1XA 2QROA 4M49A 4NDNE 1UZMA 2LVNC 1UXIA 4G41A 1JEQA 3HWRA 3DS8A 3OOWA 4I08A 5ER9A 2C78A 4LF6M 4WJZA 4DR1M 2R85A 1J20A 1O9BA 2WJPA 1X13A 2W58A 3RVDA 2F3PA 4CG0A 4Q4LA 4Q4HB 3KSBC 2HJRA 5JH7B 4GLFA 3W5IA 4WXEA 5DW0A 3CO5A 4UUQA 2PQ0A 1VE3A 1XU7A 1SXJA 1T9BA 2ZRLA 5ITXA 2D7JA 1T34A 3MAGA 3PD1A 4RORA 5FA6A 4CDRA 3GH1A 1NQWA 3T5TA 4HQRA 5AD1A 3LQ1A 2O3QA 1EM8B 2DG2A 3VUEA 3RYIA 1X1QA 4M7OA 2JL1A 1YR1A 2VNIA 4BBPA 3ZV7A 1P77A 3I4YA 1TDZA 1C7YA 4JBNA 4X1IA 4GT1A 1W46A 4ARVA 3CLSD 5EINA 1GPMA 3HU5A 3KJHA 4XUEA 4QFCA 5ALYA 5KHAA 4BGEA 3D5EA 3A6HA 4FX2A 3U7FB 3DVQX 5A3RA 5C32A 5HW0A 2QJWA 4DCUA 2QZPA 1JSRA 1MN6A 5FOQA 4NENA 1SUEA 4MWTA 5SY4A 2GPSA 2NSDA 2Q5LA 3AHFA 3FG9A 1BOFA 3HCFA 3H2GA 1OR8A 1VG8A 1QHEA 1NU8A 2B4QA 2CMKA 4IWXA 5T6MA 3C1AA 4DV6B 2YMMA 5C7IO