3ZH9B

Bacillus subtilis dna clamp loader delta protein (yqen)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
339
Chain Sequence
MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETKDFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALESYIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQKTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFELINKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASNLKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA
publication title Insights Into the Structure and Assembly of the Bacillus Subtilis Clamp-Loader Complex and its Interaction with the Replicative Helicase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 339
sequence length 339
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06144 DNA_pol3_delta DNA polymerase III, delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3zh9B02
1.20.272.10 Mainly Alpha Up-down Bundle Zinc Finger, Delta Prime; domain 3 Zinc Finger, Delta Prime; domain 3 3zh9B03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zh9B01
2ZQ5A 1T9HA 2VP0A 3LD9A 4IOMA 1UADA 2J87A 1XPRA 2OILA 2IC5A 1GNRA 2WWXA 4M9XA 4Q9JA 4AG5A 3SN6A 4ESHA 5LD2C 4IVQA 1KSHA 4A6PA 4DZZA 1G16A 1YU9A 2GNOA 2Z43A 3W34A 1KJWA 3RS7A 4TTQA 1GKUB 2G1JA 1W0JA 5FUVA 4V0OA 4Q7LA 1OT3A 4BFUA 4JL5A 1YZKA 4YMUA 2QP4A 3V4RA 2AKYA 1H8HD 4NHOA 2GDJA 4ZDJA 4JS0A 2ZETA 1HUQA 4GFDA 3W90A 1FW6A 2ZREA 3LXXA 4D0GA 4ZCMA 4HYYA 5F9HA 2QTVB 1T8TA 2BJVA 3ZQ6A 4QHYA 4XJXA 1MKYA 2ZXUA 1J8YF 5FBQB 2VSFA 5FL7D 4PFSA 4NCJA 5DYIA 2OAQ1 1T3LA 2VLIA 2WWIA 3WBJA 3DKPA 2PZGA 4Q4HB 1E9EA 3UKDA 3DO6A 4MYUA 5FBLB 1A82A 1UEIA 3EASA 3CB4A 2GETA 1L8QA 4FCWA 3QXXA 4C0AC 5FPKA 2BM0A 1S96A 3UANA 4B3DA 4A0RA 3QKRB 1IN4A 2QPOA 1CRPA 1OH8A 4DCSA 1EFCA 4LV5B 1N2CE 2FN4A 1T8UA 3B1VA 4D0NA 2ZUDA 5D3MB 4TYNA 3GJ0A 1XFAA 2WVJA 3ZD7A 2F55A 1GFIA 1KAGA 1KGDA 1BMFA 3OAAD 4LK2A 4LX0A 4GDFA 3AEZA 1ZBDA 2RGGA 3NHBA 3LH5A 2KI5A 2BBTA 3WMGA 1N5LA 3CR8A 2DWZB 4FWHA 2YV5A 3SHWA 4ASUD 2BKEA 2OFOA 4G1UC 4V0NA 3HWSA 4LCBA 1FZQA 4MYCA 2GHIA 3FKQA 4BWYA 2FWRA 3CIOA 2CHVA 5GJBA 5HCNA 3KJIA 2C2HA 2GA8A 3HYTA 5DE3A 4AI6A 2CBZA 4MYTA 4X8OA 4ILEA 2G9NA 3LLUA 1NLZA 1E2KA 4JL8A 4Q7JB 3U3MA 2GF9A 2AXPA 3QEJA 4Q4HA 3IDQA 3TRFA 3SEAA 2A9KA 2DFKB 1W4BA 4M1WA 3LX5A 1OB5A 2GBLA 2GJ8A 4NPHA 3GPLA 2IS1A 1CR2A 2QMOA 3PR1A 4URXR 1J7KA 1G3MA 1NKTA 3KQHA 4EJSC 1WMSA 3NBFA 2AR7A 1UBEA 2ZJAA 1KI4A 1VG9B 3AVPA 2BMEA 3ZVLA 1FP7A 1NN0A 4JKIA 3K9LA 3CRW1 3I72A 4EPTA 121PA 4LBYA 1W1WA 2JIZD 2ZUBA 4UNNA 1U81A 5GJCA 3AVUA 3U6KA 3P27A 4DIEA 4OHWA 1ZM2A 4IFEA 2PH1A 4PANA 2GZHA 3GP8A 4BFWA 1F2TB 2C8VA 3B5JA 2WM9B 4TSFD 1AKEA 4HLQB 3T61A 5IK2D 3FFAA 2BVNA 3BGWA 3DMNA 1F48A 4TMTA 3O8RA 3CPEA 5DI9A 2XZPA 2UZ3A 5IF9A 1E2QA 3UATA 3EAQA 5FR1A 1SVKA 4O2LA 5DGXA 3RRMA 5KNCA 3BXZA 3P32A 4NU0A 2JLUA 1ZD8A 1RJ9B 4DLSA 1S3SA 5G40A 2G88A 1NVMA 3QUSA 4DLVA 1P3JA 1DAEA 1DE0A 4RY2A 3WY9A 5EXXA 3U7GA 2I1QA 4IOJA 1D5CA 2CK3D 4L16A 1VTKA 2NIPA 3QVUA 2A5DA 2VEDA 2BC9A 2YKGA 3FGNA 1WB9A 1JPJA 4Q1EA 4QBGB 2QMUA 3AGQA 3OEEA 1G5RA 2ZRLA 3KKNA 4JYBA 1VDZA 3BB3A 4KBGA 4B48A 3TQFA 2VBCA 4R2IA 2D2EA 1AQYA 1I4TD 4M1TA 4Q18A 3NBXX 1F2UA 1DBSA 3QE0A 4JKYA 2ZI4A 4Q1FA 1ZW6A 5DLQC 2GESA 1DAMA 2ZE7A 4WA7A 2CE7A 4YONB 4QXAA 1T0JB 1DARA 2WIAA 4FI3C 3CNNA 3DM5A 1RRGA 3TUJC 5KYKA 3VR1A 1E96A 5EZ5A 4YDHB 1G3RA 2NTYC 1HV8A 1JR6A 3HU1A 1AZSC 1Y3AA 3KB2A 4PSAA 2VA8A 1RJ9A 3EPLA 4TQ9A 1R6BX 2Q6TA 1ZM3A 1NVUQ 4RD3A 3CWQA 3BD9A 4FMBB 2DWQA 4C7OB 1KKMA 1DEKA 1R5NA 3IIKA 2W83A 1JALA 1OLOA 4ACAA 2MSCB 3KX2A 4UJ5A 3B9QA 1JI0A 2ZYWX 3T15A 4PTLA 4PZYA 1HEIA 1Z6TA 2WWGA 3EARA 2FGJA 3O8DA 1M74A 5DN6D 4URYR 3REGA 3CUEF 2FPLA 1U9IC 4HEJA 3QQ5A 1NF3A 4QBHA 4CEJB 4LPKA 2OO7A 1E2PA 3W9YA 4EKDA 4QOSA 4X8LA 4CF7A 4I99A 5EUQB 3EG5A 4Q03A 1XXHE 3RS5A 4TL8A 3CRMA 3ZYCA 3GJXC 2ZUCA 3C5HA 4Q7MB 4B75A 2JA1A 1R8QA 4ITRC 4JLBA 4MUBA 3LX8A 3X1DA 4DLUA 3I5XA 4C30A 2Z4RA 1KI9A 2JGNA 2YWHA 3CH5A 4BFYA 1AK2A 4TL6A 1T5IA 1GP2A 1DVRA 1X1RA 1ZINA 4NYIR 5TXGA 4YQFA 3PV0A 4DEXA 3AP2A 1IM2A 3BRWD 4HLUC 1G1MA 4C7OA 4LYFA 4Q21A 4JLOA 1CS4C 2QP9X 1SXJC 3A58B 4PQRA 5SZIA 4DB2A 2BWJA 4B47A 3T06B 3W3ZB 5E7JA 1E99A 1KDTA 1VCMA 2FH5B 1S9HA 4Z51A 5F3WB 1N0WA 1OH7A 5KTYA 2J0QA 3E2IA 3I62A 1G21E 2QMHA 3QKSB 3SE0A 2JLZA 2ZIAA 2G83A 3HYRA 5A5GA 1LS1A 1VG0B 4OBEA 2R6GA 2IXGA 3EZ7A 2JJ2D 1QG4A 4CEJA 3IHWA 5E3HA 1EX7A 2P5TB 3UMFA 3IO5A 4DLYA 4FWTA 1M7BA 1IHUA 3KXKA 5K8TA 1OHHD 5KU1A 4HUQB 5IDVA 1KSGA 3J81k 5F9FA 3HDTA 1RRCA 3GLGE 1ZNYA 4BRWA 3KJEA 1KDOA 5FTNA 3RAPR 1JEEA 1CJUC 2FFHA 2VPPA 1MH1A 3D6TB 4DBLC 2CCGA 4E5UA 2QAGC 4NYMQ 2CEAA 1V5WA 3FKSD 1OJLA 1EFRA 4B44A 2CVFA 3U7HB 3D8BA 2Z83A 4KODA 3NC0C 4AWXA 1G7SA 1KI7A 1QDEA 2ZEJA 4U00A 4EFLA 2ZRIA 4LJ5A 1SXJD 2IK8A 3PEWA 3SU8A 2ZSBA 4ZDWA 3U7EB 1OF1A 2XSZD 4DSOA 1SXJE 1DAFA 2DFTA 2VIIA 2Q9AA 3QKSA 4QJ5A 3ZZTA 3Q72A 1HQCA 4A9AA 3W3AA 1FMLA 4LHWA 1W44A 3VMFA 4NYJQ 2YNMA 1MRNA 3TSOA 3L0SA 1ZIPA 2ZR9A 3VR6A 2GCNA 4MRVA 4PPNA 1Z07A 1F6BA 1OB2A 1LF0A 1D2MA 4HUQA 2C95A 3ZJYA 4YLGA 5AJWA 4BZPA 1YJ5A 2PCJA 2QQ0A 2VO1A 3RS3A 4GP6A 3UMRA 3VR3A 3RVBA 4C0BA 1VHTA 4BLPA 1FNNA 1QF9A 3K0EA 1VCIA 1YRBA 3WRXC 3RWOA 1P4SA 4YXWA 3BH0A 1W36C 1E2MA 3ZGXA 3NTUA 1FUKA 1SKYB 2FZLA 3BH6A 3AVTA 3VX4A 4M22A 3GLIB 1T3SA 2ZSEA 3ZZ0A 4A4DA 5HE8A 4RZ3A 5CJ2A 2ZVQX 5A4JA 1GDDA 4IJMA 4NH0A 2JLYA 5IRCD 3PJRA 4EPWA 1GZSA 2L0XA 5EXTA 3ZS9A 3I5YA 2BMFA 1XMSA 4PQFA 2QG6A 1QHYA 5L3RA 2UVQA 5FR2A 2JDID 1XX6A 3H2YA 4M8NE 3QKTA 2P2LA 2QY9A 4M9SA 2C99A 5J4VA 1GM5A 4US2R 3ND9A 3ETLA 2V1UA 4RJLA 3WNBA 1V43A 2JJ1D 3G5UA 1AIPA 1WA5A 4Q5IA 2QEQA 4E07A 5H1YA 3AVVA 3GFTA 3NVAA 4LJ6A 3I1FA 3ZVRA 4Q19A 3FMPB 3SI7A 5EXPA 1E9BA 2E9SA 5B57C 3MWYW 2X8AA 1Q1EA 1ANKA 2KJQA 3EZFA 4N0EA 1M1YE 1W5TA 2IYLD 3QF4B 3LW8A 2ORIA 2QN6A 1RRFA 3WMFA 3LFUA 3GLIA 3CH4B 1U98A 3SYNA 1W36D 4HAZA 4DLTA 2O8EB 2X19A 1KK3A 5L3VA 2RHMA 4JT2A 1G7RA 2NO9A 2ZI5A 1J8MF 2YINC 4LPSA 2C98A 4IVPA 3C15C 4OQXA 5JI3E 3I8XA 4PHTA 2ODBA 1OXXK 1RIFA 4PC2A 1TQ6A 4URZR 1TQ4A 2J1LA 1Z29A 4LUCA 2GAAA 1TF2A 1MO3A 3B1WA 2NPFA 1XTSA 4IW3B 1HT2E 4MKIA 4FMDB 4JLPA 4RFVA 4FW9A 2GXUA 2V6ZM 2HYDA 2KB0A 2Q3HA 2XZOA 1K5DA 5JWOA 1E2JA 1HT1E 3CX6A 5EE1A 3H84A 3TBKA 3WP0A 1E1QA 4B32A 3AVXA 3FMFA 2VRWA 1KHTA 1C4OA 3BFVA 1XEXB 1RW4A 2F43A 3LRPA 421PA 1RE0A 1UBCA 2ORVA 2ZROA 4MRPA 4O3MA 4LJ9A 3DL0A 3ICQB 1K6MA 3BOSA 1P5ZB 4OL0A 2O8EA 2G77B 4LHYA 1LS6A 4QFMA 4DUGD 4TMKA 5EE3A 5CDFE 3SQWA 1B23P 3VAAA 1OXTA 3B6EA 4N0DA 4H1VA 1G41A 2WPDA 3CBQA 4LV6A 3NG1A 1ELOA 4BECA 1TMKA 1U0JA 3AJIB 2EFGA 4HI0E 2RMKA 3H86A 3VKWA 3VX3A 4L5BA 3IQWA 4YMTA 1G8PA 1N5JA 1QHHA 3MJRA 3O8BA 3BORA 4MRNA 1II8B 1Q1ZA 2QRNA 3H4MA 4A3VB 4PPFA 2RGNC 1R2QA 2BIFA 2H18A 3QBTA 3KXIA 4LYJA 1Q3HA 2ASEA 1JQLB 1BIFA 4TZ6A 5AR1A 1FTSA 1TEVA 4A82A 3FFBA 4KAXA 3VHLB 4TLBA 5G3YA 2PZFA 1XEXA 3VKGA 2J5XA 1E0JA 1DAIA 4C0JA 5KOYA 1RRPA 3TJZA 3PG5A 2IYXA 4KSBA 1E2FA 1YVDA 3PENA 1HQYE 2AN9A 1ZYUA 3TH5A 1DELA 1TF5A 1Z6YA 4IRUB 4PZZA 4ZDKA 5KPJA 1ZCAA 5AUNB 4DXAA 3KW6A 4BZXA 1II9A 4DRZA 1YE8A 5CK5A 1DO0A 5LB4A 2ZM5A 4GP7A 2F9LA 2NO7A 4F92B 1W4AA 1X3SA 4BASA 1KI6B 2HXSA 1IAQA 3QVVA 4PO8A 1K8RA 3IUYA 3VTKA 2R62A 3WRYC 1KYIA 2ZJYA 1SZPA 3QI2A 1OW3B 4PQYA 1XRJA 4ZCIA 2F1RA 1II8A 1KO5A 1OFUX 1Z3IX 2B7CA 4POAA 5AK0A 3AVYA 3PEYA 4KLNA 1OE0A 3T1QA 2V9PA 2KBFA 5L3SB 2GCOA 2ZYUX 2RAPA 2BEJA 3EXAA 3LWNA 3CF2A 3MLEA 5HPYB 2ZI9A 2FZ4A 1A2KC 3HP1A 3BAFA 4S2EA 3X2SA 1E0AA 5J4YA 1GSIA 4DIDA 4LJYA 2F1HA 1JB1A 2JLRA 2X2EA 4HAWA 3EPHA 1Z63A 1Q1BA 2C77A 1NIPA 1S1CA 3SQXA 2WAXA 3L82B 1CF4A 1KSJA 4DDVA 3SBDA 1E2GA 1KO1A 4R2HA 1EFHA 5FTKA 2FA9A 3RYTC 2E1RA 3NEYA 2CHQA 3AF0A 4DCTA 2PL3A 2O8CB 3ADKA 3IIMA 4JMPA 3IBGA 2VH5R 1M34E 1QRAA 1E6CA 3JVUA 1KDPA 2DB3A 3U5ZB 1MR3F 2C03A 4WZBE 5EP4A 3TVDA 4OI1A 5FTJA 2QAGB 3K70B 2HV8A 1IJFA 2BKUA 3LQQA 1KI6A 1N6NA 2FG5A 4URVR 4BLOA 3IHLA 4M1OA 4DLXA 2P6RA 4QG7A 3LY5A 5G41A 1COWD 1XEFA 2J7PD 2G3YA 3V4FA 4FMDF 4N3NA 4EPYA 5GADl 4MDEA 1QHIA 1R0XA 5HKKD 5K8IA 4QHSA 3G82C 3ZZUA 521PA 2OUKA 2V55B 1Z0FA 3AGPA 2ZRJA 3IKJA 2RGAA 4ZKDA 3B2EA 2AK2A 2QTHA 2XNDA 4H9GA 5KDLA 3THWB 2CDNA 3LBHA 5EE0A 2IUSA 5HE9A 4UNPA 4PXAA 4XD7D 3QBVA 2J0UB 3QIAA 2VL7A 1ZM9A 1E79D 5D3QA 2J45A 2OE2A 4KFTA 3CW2A 2WZQA 4XWKA 2AHOA 4QM6A 2ZRAA 2AL7A 4O0MA 4XH9B 1UBGA 3W5IA 2ZYVX 1YR8A 1RVDA 5CB8A 3VQTA 3KQLA 3R8CA 1X1SA 3LW7A 3PIRA 4GL2A 1G9XA 1LY1A 3UWOA 3RANA 1Z6AA 1ZU4A 3NHAA 3P4XA 4WZ6A 4WW0A 3DDCA 4OJKA 4LC0A 1DAHA 2PBRA 1GL7A 3L0OA 1AN0A 2IT1A 1NBMA 2ORWA 3I73A 2ODWA 4JLJA 1WP9A 3X1ZA 4PAMA 5JBQA 1PUIA 2H5EA 2HDNB 2VP9A 4S35A 2OLJA 1ZAKA 2ZITA 3B82A 1G19A 4OQNA 3THWA 2G1KA 2HCBA 2IEZA 1T3HA 4UXHA 4V03A 1HYQA 2WWYA 1W4CA 4LJAA 1XU4A 1YZQA 4B6FA 4JVSB 2J0UA 4WVFA 1CIPA 4XSHA 1N6KA 1P75A 1IY1A 4QNRA 5TB5A 1EFTA 1N5KA 5KUTA 1NVXQ 2WOJA 4V02A 1G6OA 4UNSA 4IXNA 1AGPA 1GRQA 4F91B 3P1JA 2EFHB 2QE7A 4ZI2A 3AV0B 1GL9B 2CXXA 3KKQA 4Q1AA 1E1RA 3V00A 1D2NA 1GUAA 1I2MA 4LC1A 2D2FA 4Q4AB 5CK4A 3AKCA 1WQ1R 4RZUA 4Q00A 4A8JB 2GXQA 2NG1A 1NL3A 3NC1C 1Q57A 3X1YA 2JEOA 2P5SA 4Z8XA 4GI7A 1T0HB 2B7BA 2ZE5A 3T12A 3GQBA 3AQ4A 4PHHA 4A2WA 1Z22A 2NO6A 3PUYA 2FSGA 3T5GA 2BEKA 3KL4A 2P3SA 2DZOB 3C5CA 1KIMA 4PC1A 2NMVA 3OESA 2O8FB 4IDNA 4BEBA 4DCUA 4R9UC 5DIFA 1P2UA 3TLXA 2VQSA 1OH6A 4U7DA 4X8MA 2GXAA 2PCLA 3VHXA 1SHZA 2GJAA 3C7KA 4GRAA 2FU5C 5EQTA 3EZ2A 4D81A 2A5FA 5CLQA 2XZLA 3JZAA 2YOGA 3LVQE 4A2PA 2DWOA 3W8RA 4JLNA 3BH7A 4G01B 4MUAA 5JJIA 2H92A 3WMEA 5JSZB 3CTDA 5AJYA 2R2AA 2RGDA 3AVOA 3RSLA 4TT3D 3OFNA 2IHBA 1R0WA 1XTKA 2VHQA 4Q4AA 3BIFA 3FTQA 4PC3A 3OZXA 4NDZA 1H8ED 4EPXA 4LYHA 2WSSD 1NY6A 4A8JA 1GWNA 4G0NA 3QKRA 3W5JA 4DVGA 3QSYA 4MGYR 2IXFA 2WJHA 3U44B 2HXYA 1R10A 5B2ZA 2FPMA 3SZRA 3B1YA 3KUDA 2ZJ5A 1AZTA 4KXFB 2GXSA 5BYKA 5BXQC 4KU4A 1PZNA 2HJGA 3I61A 5D3MA 3PVSA 2KSQA 4B2IA 3ZIAD 2RB4A 4LOAA 4MQBA 4B33A 4KHZA 4LV8B 1SVSA 4Q1DA 4LSGA 2O8FA 2ZVPX 1YZTA 1MRSA 1NMXA 1Z0DA 2QQEA 3HPQA 4B3GA 2W6IA 2B8WA 3K0CC 1U0LA 1UBFA 2P65A 4YC7A 1S8FA 4RD6A 5KSOA 2F3RA 4DEYA 1XTIA 3TR0A 4M9ZA 1JNYA 2ZS7A 4GOKA 3VLFB 4TLDA 3IEVA 4JYCA 2ZANA 5FI0B 5FOWA 5JSZA 3FHTA 1IXZA 3OE7A 4EPVA 2QNRA 4AC9A 2AD5A 1A7JA 2IYTA 2PX3A 4Z54A 4CEIB 1R0YA 2V54A 1ZP6A 5JECA 3WBKA 4P4TA 2NZ8A 1MO4A 4GMXA 2CCKA 1XJQA 1IOZA 1DS6A 4FXPA 4G5SA 1XEWY 1KJZA 5FTLA 4D4MA 5GJVC 3L2OB 3GEHA 3U44A 2ODEA 4LI0A 4RD1A 1GILA 3LO5A 4QNMA 3EX7C 3AVWA 3V9PA 4ABYA 2XTZA 1NLFA 1UJ2A 2AFHE 1ZVQA 5FPYA 2OG2A 3U3RA 2YJTD 1U99A 2GF0A 4JLMA 3CONA 3U61B 1Z47A 1F2TA 5F2EA 4LJ7A 1XD2B 1Z08A 1W0KD 2IUTA 1MO6A 4KV9A 5BQ5A 2ZU6A 2XAUA 1ZC4A 5J47A 3MSXA 2D4HA 4B2PA 4Q02A 1L4YA 4CEIA 4GZLA 3AM1A 3SYKA 5FOUA 1U2RA 1ZUHA 2ZJZA 2ZRNA 4IEIA 1XP8A 4B3BA 4IDPA 2W00A 2FSIA 5AWFC 4TYWA 2GEVA 2B21A 3BE4A 4EFMA 3CR7A 1RYHA 5FOSA 2XOKA 3MJHA 5FUYA 2XB2A 1S1MA 1JR3A 3WYAA 4PX9A 1KOFA 2GZDA 1OKKD 4LRTA 5FBWB 3K09A 1W4RA 3TE6A 1P2VA 4M0LA 1XNJA 4HLCA 2Z5FA 2DY1A 3ECCA 4HZIA 3KUCA 3I3SR 4M21A 1R7RA 4F7WA 2OXRA 4BFSA 3H1TA 3LNCA 1XCGB 1B0UA 2ZRHA 1E9FA 2DFLA 1S9DA 4ARZB 1Z2AA 3BWDD 3SOPA 1CU1A 1P60A 2PEYA 3X1WA 4D80A 4GBMA 4HATA 4M1MA 1ZUNB 3EWSA 3T34A 3O8CA 4ON9A 1IN6A 3FDIA 4Z1MD 2MSDB 1QZXA 2IUUA 1TUEA 2QW6A 1KKLA 4CVNA 4XVUA 3ADBA 1WRBA 4JLKA 2W6JA 1JQJC 2XNSA 4DDWA 2V6JA 2ZI3A 3MGCA 4QKQA 5HR5A 2Q9BA 4RKFA 1OPXA 3SR0A 1L7VC 2V1XA 3T35A 2Z0MA 1G3UA 1P73A 2IHYA 2V7QA 2OSBA 1S2MA 2XEXA 1XPUA 1G5PA 2W0MA 4BRUA 4CZ2A 2XX3A 3RWMB 4L9SA 1WE2A 5AJXA 5JMTA 4P4UA 1YZUA 2A7QA 3GJ3A 4B35A 3U4QB 1X8JA 1MABB 4JBYA 5JCZA 2H57A 1RKBA 4IDOA 1KZGB 1AM4D 2A3RA 4FN5A 4JZKA 1M8PA 2RGBA 3FOZA 5LD2B 1JAIA 1RC8A 2WAYA 1JJVA 4Q9IA 2CCJA 1P9RA 2FDCA 2F9MA 4LHXA 3A36A 2EW1A 4ARZA 3K1JA 1KY2A 2X77A 4I1VA 3WXMA 5KNBA 3TGPA 2GEUA 3NXSA 1EWQA 2ZAMA 1H8HA 4G3XA 1KK0A 2IF2A 3BS4A 4OQLA 3IPXA 2C5LA 5E95A 1GIAA 1CKEA 2IXEA 2QM7A 1PUJA 2CL7X 1Z06A 1ZD1A 5JLJA 3UIEA 4GSYA 3THXB 1U94A 2CNWD 2OBLA 3FB4A 5FL7A 1E4VA 1EGAA 2N46A 2EWWA 2VSXA 3DPUA 2YZ2A 2WJJA 1BS1A 1AQUA 4HB3A 1KAOA 3TSWA 1G4AE 3ASYA 1IQPA 5UKDA 3U4QA 1MABA 3QY0A 5C4MA 2NOAA 5DISB 1N3BA 5A0FA 2CE2X 2WWHA 4C9BA 2AKAB 3FYHA 4RCZA 3KTAB 4GT1A 3CLVA 3AUXA 3QOFA 2EFEB 3OIVA 4YMVA 4W7SA 1VG8A 4TMVA 1W47A 4B6EA 2QM8A 4PO1A 3OAAA 2GWHA 3RDPA 1TADA 4V0ME 3OEHD 4IDHA 5FBRB 3LBIA 2H16A 4WXPA 4PO9A 1TTTA 4TTRA 3OIWA 5FL3A 4ASUA 3F8TA 4LBVA 2ATXA 1U8AA 4L8GA 4EFNA 3THXA 3M6AA 3H0KA 3AVQA 1RYFA 4LRSA 2VHCA 2W58A 721PA 2IL1A 5FOVA 3TUIC 4ERNA 4JLDA 3U6BA 4DSTA 2ZJOA 5M04A 1MT0A 3DM9B 4RKEA 1R8SA 4UXJA 1E98A 3PEVA 1E0SA 1JBKA 4P4SB 4BLRA 3ASZA 3UG7A 4DHEA 5FBVB 1OSNA 3KKPA 3I4LA 1ZMXA 3Q7PA 3ONWA 3THYB 4WBSA 2OT3B 2DBYA 2IF0A 2OM2A 1Z0IA 2WICA 1OIXA 3MG9A 1E4YA 2HLDD 4AYWA 3EZ9A 3K0FB 2PZEA 3Q3JB 3NH6A 2OESA 1KI3A 4EJSB 4MITA 5B58C 2ZI7A 4LZZA 4P31A 2WMNB 4Q1BA 5EXSA 4JJKA 2JIZA 3RRNA 3TMKA 4QGFA 4A2QA 3SYLA 1K5GA 2H7VA 1NY5A 2PT7A 4AKIA 1HURA 4NZYA 2R6CA 1FX0B 3KZ1E 1LNZA 1NSFA 3VR4A 1E2IA 3U60B 1XB2A 3MWJA 1NP6A 3CX7A 4KLZA 4UQOA 4AYXA 1FMJA 2HUPA 3PXGA 2OV2A 1NMZA 5EE5B 4C3ZA 3DOFA 4TSFA 1CXZA 1SQ5A 5IK2A 3X1XA 1XCPA 3RS0A 4A92A 1W0JD 4AURA 2BMDA 2BOVA 2P6UA 4DCVA 1YZGA 4KI0A 2IS6A 1G8GA 1O87A 3AF2A 2V4ZA 3HPRA 1XTRA 1OXVA 5J4LA 1KZ7B 4MKHA 4PZLA 4TLCA 2GCPA 3R8FA 2YWFA 2ZJ8A 1XMIA 3CRQA 1XJCA 4P4SA 4JLAA 2IYRA 3WYGA 3Q5EA 3T1TA 1TF7A 1UKZA 5JEDA 2O52A 5C2JB 5C46F 3WNDA 3KJHA 2A78A 4KFUA 3D31A 3THYA 2NO0A 2OZEA 3BERA 2CK3A 2XTNA 4P0TA 4L4UA 3DMDA 4GPTA 1U8ZA 1CEEA 3K0FA 3QJYA 4EJSA 4Q01A 1E9RA 4JJZA 2GBLC 4BE7B 4Q47A 3VKHA 3BC1A 4G5QA 5G3ZA 1Z0KA 2WJYA 3IIJA 5EP2A 1QBKC 3AKEA 2ODNA 2FJUA 4HSEA 4QJ4A 5GJWC 3CZPA 3CX8A 3R9IA 3CM0A 5B64A 1GKIA 5KSPA 1GRNA 3WHKA 1XZQA 3N2EA 3VNVA 1FOEB 1XXHB 4GMDA 1UPTA 3K8YA 3MRSA 3MHVC 1X37A 2OFXA 4IFBA 1DG3A 4MGZR 3B9PA 2VP5A 2RKOA 3LBNA 1CJKC 3P26A 3T5DA 4XTCS 2MSEB 3WP1B 1WBDA 3TQCA 2Q3MA 2C04A 1BMFD 4HAVA 2JLQA 4IVRA 3QF4A 2IWHA 1KI8A 2IX3A 4QHTA 3ZS8A 3JZMA 4PPGA 1CTQA 4OK6A 3QKUA 3WHLA 4IOLA 1QHXA 5EE9A 2C9OA 4B73A 3HU3A 3ZH9B 1EX6A 5KDOA 3A1UA 1SHKA 1ONBA 1KI1A 2Q3FA 1E9SA 2OXCA 2F7SA 1Z28A 2DFNA 3SJCA 1WXQA 2NQ2C 4PC6A 1EG7A 4MRSA 1VPLA 1DTSA 4BLTA 1G7CA 4PHGA 4BPBA 4MGIR 1OXUA 4ACBA 1BYIA 4YDSA 4AY2A 2JLWA 2PLFA 3EA5A 5DHAA 1W7AA 5C4GB 2E87A 1DAGA 5DN6A 1IY2A 2F6RA 2PT5A 2IYYA 4TYQA 4M53A 3DKVA 1P7CA 3K53A 1XXHA 1CJMA 2ERYA 2XGJA 1ZRHA 1LW7A 2HCJB 1CP2A 3GLGB 4JSYA 2GRJA 2A5GA 2C9YA 2EYUA 5FPTA 2LKDA 1XDBA 1AS0A 1T4GA 4EAQA 4A36A 1SULA 2BMJA 2OHFA 3AF1A 3U3JA 4OQMA 2X2FA 2ZI6A 2WMOB 3GEIA 3UXMA 4LRWA 4HDQB 4M4SA 4G5RA 1XWIA 3LQRA 4TYYA 2NZJA 3UPUA 4RCYA 5LBIA 4Q7KA 2WKRA 1N5IA 4C4PA 4WOPA 2VSOA 1GG2A 4C0KA 2FE4A 2OCYC 3DHWC 4FWGA 3GLHE 4FD2A 1P61B 1QHGA 2I3BA 4LGMA 3OHMA 4OI2A 5BWMA 1SXJB 2DPXA 2ZRDA 3WNCA 2RHDA 5JJKA 3PUXA 2XJ9A 3TUZC 4MDFA 2K5UA 1NVVQ 4B34A 1JECA 1P2TA 1DADA 2WJGA 4TMZA 1EESA 1Z2CA 1G20E 2RGEA 2G0TA 3KQKA 1HY3A 1SVWA 2JJ2A 4D0LB 3K0SA 1Q12A 5HZHA 1E94E 1GOTA 1YR6A 1LFDB 1U9IA 1NMYA 4MKFA 3GLGA 3EIEA 1II0A 1VHLA 4O2RA 1OHHA 2C9CA 3OEED 4OKSA 5ANRB 3MAAC 4CYMA 5TV2A 3ICEA 3W6PA 3DEFA 2GAOA 3AB3A 3LA6A 4IDQA 5KSYA 1P6XA 1OIWA 5J5CA 3UMSA 3HR7A 4NONA 4QGAA 1BOFA 3D7MA 4FWDA 2RGXA 4EDHA 5H70A 3FKSA 1QVAA 2WV9A 2ZR0A 2QI9C 2ZRBA 3AKYA 3Q7QA 4NTZA 4D6PA 4RFSB 3KKMA 1QVRA 3QPVA 4HLUA 1S3GA 1UFQA 5DI3B 4DLRA 1SXJA 2IYUA 4KO8A 2HEIA 3TSZA 3K9GA 5KHOC 2QORA 4HB2A 1TU3A 2XSZA 1UEJA 5DNYB 4EQ6B 5J4KA 5FUWA 2CLDX 3EZ6A 2QENA 4JBXA 4OK5A 1NN1A 2PX0A 3BFKA 5FOTA 2J3EA 5L3SA 3T1VA 4RSGA 2QGZA 3PITA 4BLSA 1VCOA 2CMKA 3MUFA 2ZS8A 3QXJA 5P21A 1G8HA 1Q21A 1YRAA 4X8HA 4M1SA 3AH8A 5FI1B 5AUQA 1WBBA 1IN8A 4MYHA 1KNXA 3B7GA 3QEOA 2GILA 3A1WA 1VIYA 2ZRCA 2XTMA 3IPYA 4ZI3A 1KTVA 1A2BA 1M7HA 1GAJA 1GKYA 2QU8A 4RD2A 3QENA 4CT4B 4F4JA 1AKYA 3ZVNA 2O8CA 4D2IA 3KQUA 1KDRA 4LBWA 1E32A 2FSHA 2HF9A 2GJKA 2ZE6A 4ZDIA 1FTNA 4Q4JB 5C1BA 4TLAA 1EXMA 2W0SA 1AA9A 4RFSA 4NCIA 2LWIA 2V6IA 1W36B 2QAGA 1CULC 4N1AA 2IS2A 1J99A 2QBYB 4F4CA 2QA5A 1G3QA 4W5HA 1SVIA 3BBPA 2GVDC 2FNAA 4DJTA 3EPKA 3GD7A 1KJYA 2AD1A 4EQ6A 2FF7A 5TMPA 2JDIA 1UKEA 4Q9HA 2EFCB 2Q9CA 3EW9A 1QG2A 2EU8A 1NLYA 3BGEA 2GVZC 2JATA 2VYFA 2JAQA 4KYIB 2FOLA 4RD4A 1IN5A 1CJVC 1P62B 4PSVA 2VF8A 2JJ1A 1W2HA 5B30A 5BN5A 5JCPA 4ZV4A 3LDAA 1A4RA 4ZIRB 1Q20A 1XTQA 1IXSB 1UM8A 4DDUA 2Z6VA 2HF8A 4R98A 3LV8A 1NN5A 1P72A 1JJ7A 2F3TA 1VECA 5FOXA 2H8KA 4TTPA 1E2EA 1Q22A 3K9NA 4KITB 2ZJBA 3N70A 4K46A 3VU9B 3U2QA 4FMCB 4Q4JA 3SJZA 2QUZA 4PPQA 1G3IA 4QM7A 2KBEA 3TW8B 1C9KA 4JVLA 5EUMA 1XTJA 1XF9A 2QBYA 4Q48A 5JFGA 1E2LA 1LVGA 5DH9A 4FINA 2GKSA 3IO3A 1G64A 1IY0A 2QRZA 4D82A 1KO8A 2YWEA 3Q85A 4JL6A 1A1VA 2HJVA 4B3CA 3GCGA 2LKCA 2O0JA 1EFRD 3SNHA 2AK3A 3B78A 4LJ4A 1E2HA 1CLUA 1ZNWA 2ZRKA 2BBSA 2IWRA 3NDBB 1AGRA 1JAHA 2DHRA 3C8UA 4KJZA 1VG1A 4XWOA 4O25A 1ZUIA 2IS4A 2GK7A 4ZIRA 1DO2A 3MWKA 1M2OB 2V8OA 5SZKB 1T6NA 5L8VA 3ZLJA 3QG5A 2ZSDA 3CKLA 3L0IB 5HZKA 4BFZA 1GNQA 3BB1A 4RZXA 4XTRA 3RRYA 2QL6A 2AFIE 4IEEA 1KSFX 1ZNXA 3FE2A 3IGFA 4P32A 3RNLA 2AWNA 3VU9A 2R6DA 1WDTA 3KXLA 4HZUB 3REFA 1Z6XA 1PLJA 1QHSA 4PAQA 1R5BA 4QGHA 2BBOA 3NIBA 2YWGA 5FPHA 5CDFA 1FP6A 1S0UA 3PUVA 1NJGA 1NIJA 5DSZA 2DYKA 1C1KA 2ZYTX 4DUGA 5H8WA 3W6NA 3GLHB 2W2VA 4LYAA 2VHTA 1PV4A 3GJ5A 1ZM7A 1H65A 3LAWA 1Z6GA 4TQAA 5FH9A 8OHMA 2V3CC 1G4UR 4YXWD 5JRJA 5TARA 1N6OA 1DOAA 1YZLA 1OYWA 4GITA 2VP2A 3AKDA 4EIWA 3AF4A 1O3YA 2JCSA 4FCVA 4C2UA 4ESVA 1BKDR 1QHNA 3A1SA 2BM1A 4GOJA 4B76A 2ZTSA 1SVLA 2IEYA 1E0KA 3QXHA 1HE8B 4C0SA 1PVOA 3RC3A 2C78A 3GJ8A 3W8NA 1MV5A 2VP6A 1NI3A 4MA4A 1YQTA 1ODFA 2VF7A 3NBZC 2FEMA 3Q9LA 3A8TA 4YMWA 3VR5A 2OCBA 2QTFA 4HZUA 2B92A 1Q44A 2P67A 1SGWA 1FQKA 4EUNA 3RLFA 4NYMR 1N0VC 4TL7A 1F2UB 4JN6A 3F3YA 3GLHA 4A6XA 4DDTA 2ZR7A 1UKVY 1E2NA 1ETUA 4AKHA 4IKEA 5JS8A 1M7GA 1Z8FA 4LY6A 4MGKR 1ZJ6A 4TMWA 4F38A 1LV7A 2ECKA 5HTKA 4AD8A 5EJEA 1W5SA 3BK7A 3NDPA 4NBSA 1SKYE 4AYTA 5KDDA 4H1UA 4QBIA 5E7IA 2O8BB 3GLIE 1R4AA 4NYJR 1EK0A 2OCPA 4ZCLA 2BHRA 1RFLA 1KMQA 2EYQA 2IYSA 5GVSA 2RGCA 4M1KA 4ZKEA 4QJ3A 1X8KA 2FSFA 1UDWA 1Y63A 2GZAA 2RGNA 4I1OA 2XJ4A 2Y8EA 2D7CA 3QG1A 2CVHA 5KSZA 3A1TA 1GNPA 4OI4A 3CNLA 4AG6A 1HH4A 3WYFA 4A15A 3KDSE 1NNEA 1D9XA 1NN3A 2D06A 3ZD6A 3BB4A 4US1R 3ZQJA 4XSGA 3SFVA 4HB4A 3LXRA 4FMCF 3C41J 4F93B 1KNQA 2D74A 221PA 2NPIA 1OXSC 4FCTA 1G6HA 4DB4A 1E1QD 2H1LA 2R9VA 3SHFA 3VNUA 1GL6A 3R9WA 5GVRA 2J0VA 2O8DB 1JXOA 4NCHA 3EA0A 2IBMA 2OFWA 4W5JA 1XJ0A 5EP3A 1N6PA 5BN3A 4D4KA 3SJAA 3B13B 3SDZA 4Y0AA 4CRWB 3TAHA 3B1ZA 4OJQA 4PSKA 5CITA 3SBEA 3CNOA 4C0HA 2EWVA 2FEOA 1COWA 2J7PA 2KE5A 4LJ8A 1KK2A 2ERXA 2PLRA 4XVRA 1NJFA 2O8BA 1TX4B 5HKKA 3CPJB 1W48A 4TN1A 3UK6A 3A4MA 4YMSA 2TMKA 4D25A 1XD2A 3B85A 4XVQA 4A1FA 3DZDA 3PUWA 5DO9A 1VIAA 4TZ0A 3W6OA 2WPDD 4BFTA 2FMXA 4HB0A 2EVWX 3M1IA 4II7A 1NRJB 2F1JA 4R71A 4V0KA 5K8UA 4PR0A 2GEDA 4I81A 2PMDA 5HCIA 4KSCA 4XD7A 3UWKA 1E79A 1C1YA 1J70A 1KI2A 1ZM4A 3TW4A 2NGRA 2QSYA 4PAOA 1AJEA 2WWWA 4JLVA 2PEZA 3GFPA 1DAKA 3R7WB 1HE1C 4NP6A 3FMOB 5JI2E 5ELXA 3E5HA 1VYTA 1E9DA 3DZ8A 1XD9A 3FHCB 2IA5A 1FNMA 4Q9LA 2O8DA 2PJRA 1F3OA 2A5JA 3CF6R 1E69A 3SS8A 1L4UA 1UDXA 2EFDB 4BFXA 4ZPXA 4QBFA 2OEPA 5JJLA 5BYJA 3AUYA 3A4LA 1N6LA 4EPRA 1VMAA 2DVWB 2EQBA 3PCRB 2R6FA 2WOOA 3PQCA 1TQ2A 2QT0A 3CZQA 4TYPA 2BCJQ 3ND8A 2YYZA 3B8HA 4B3XA 5JS7A 1UAAA 1RZ3A 1OIVA 1XMVA 3IQXA 2UZIR 3EPJA 1IXRC 1NG1A 4JSTA 1VYUA 1AS2A 4IXMA 2ZS9A 5DYGA 2ANCA 1KMHB 4V0LA 4DC9A 5KPDA 3VFDA 1N0UA 4KVAA 3EC2A 2CL0X 2P0EA 4P33A 4C2TA 4KFRA 3R20A 2ONJA 3E1SA 5F98A 3U3OA 4KFSA 1OFHA 1XEWX 3L8ZA 4AKEA 5H68A 5C18A 3R7WA 3TK1A 4CT5A 1GRRA 2X1VA 1R5OA 1G17A 2GJ9A 2IYQA 4JVMA 5JRZA 2LCFA 2F1IA 2QROA 2QT1A 3KFXA 4WIAA 3ZDQA 4W9MC 1HTWA 2JLSA 4G5OA 4Z8YA 2HYIC 5KNDA 5KO2A 3NBYC 4BEJA 2W2TA 4B3FX 2ZSFA 1Z83A 5CM8B 1YR9A 1GVNB 3CRVA 5FPSA 1R0ZA 5BN4A 2AWOA 4NE2A 1JEDA 4UNQA 2Q0HA 2YHSA 2OBMA 3FWYA 5CYOA 1N25A 1TNDA 3B1XA 4TMXA 1GITA 1YHNA 3CWZA 1LF5A 2GK6A 2AXNA 5AJZA 3K70C 1OH5A 2I1VB 1G5TA 1BO6A 1J2JA 1T5LA 5IT5A 3RABA 1U90A 1KMHA 5CIQA 4M1YA 2ZRGA 1WCV1 5EZ6B 3QPWA 1N6RA 5AJVB 1PJRA 2ZE8A 2QPAA 1X6VA 4L15A 3SC3A 2DWPA 2OBNA 4RZ2A 3MD0A 1VKJA 2ZSAA 1FPMA 1SVMA 2J46A 6Q21A 1ZU5A 4OYHA 2BJWA 1SKQA 1NVWQ 3K0AB 2Z4SA 1BH2A 3MFYA 2KWIA 1XPOA 5CB6A 2GTPA 2WKPA 2YVUA 4DLWA 4XWAA 2BCGY 4U5XA 2O0KA 5J4HA 3ADCA 2C96A 1X8LA 4CIDA 4CDGA 1LTQA 3PFIA 2NO1A 4LWZA 5FFMA 4TT3A 3CF0A 3GLFE 1FFHA 2XNDD 4B43A 2IW3A 4NCNA 1TU4A 1Q1QA 4URUR 4QGGA 1D9ZA 1H8EA 1ZC3A 3KB1A 3P4YA 2WSSA 3NKVA 2WWFA 4HAUA 4CW7A 2R9GA 2I4IA 3VR2A 1ZNZA 2N42A 4BLQA 1NG9A 4Q4LA 3KTAA 4QL3A 1KK1A 4OK3A 2YC2C 2FPKA 2DCUA 1UKYA 1G8FA 2J41A 1JXMA 4IOKA 3QXSA 4P3YA 4BGDA 1CJTC 1NVVR 3ZIAA 4AK9A 1Z0JA 1ZD9A 3ADDA 2ZAOA 2Q21A 3ZVMA 3KQNA 4JBWA 1PLLA 2RCNA 2QP3A 3K70D 1GTVA 2DZNB 4E22A 3MMPA 2A5YB 2VHJA 2ZPTX 3LVRE 3U7FB 2O0HA 3JVVA 2A30A 2N1BA 1D6JA 1F60A 4R7ZA 2CLSA 4C0QC 3MCAA 2FFQA 2WKQA 2D7DA 3K0AA 1NBMD 1F5NA 4W5WA 4TWZA 4NKRA 1I2DA 1NBME 3GMTA 1CR0A 4OQFA 2QSZA 4TLEA 3F0TA 3K9HA 1XMJA 5CM9C 2HT1A 1OFTA 1TPZA 5TVKA 5TY0A 1N6HA 2JLXA 2WHXA 5TDHA 4DLZA 2ATVA 4I4LA 2XITA 1TAGA 4URWR 3M4YA 1KO7A 3PEUA 4CGZA 4ZO4A 4RD0A 2IYZA 4B2LA 4E09A 2WTUA 4BFVA 4MRRA 1VYVA 2CLCX 3TKLA 2QE7D 5FUXA 4HDCA 5FTMA 2F43B 3HU2A 3QNUA 3SFZA 1N6IA 4NYIQ 1TQDA 2JJ8A 1CR4A 5CIWA 4A8JC 3A6PC 1E1RD 1FX0A 5SZHB 1I4DD 3FVQA 2YOFA 3AP1A 3T1OA 1IONA 5K8LA 3S1AB 3O47A 3IEUA 3L43A 4G5GA 4DSUA 2ZU0C 2VTKA 3CPHA 1E3MA 1W0KA 4KCGA 1OFIA 1E2DA 4UJ3A 4OHYA 2G0NA 3K0CA 5L3QB 4D4LA 2MMCA 2BBWA 4F4IA 2R44A 3DVLA 1XBTA 1KY3A 3UG6A 4BQSA 1NKSA 1SVOA 4OI0A 3FHOA 2CL6X 1RPZA 1QHHB 5LB2A 2DR3A 2PMKA 3OIUA 4PHFA 2OLKA 4D26A 3L0PA 2JASA 1OYYA 1XZPA 1D2EA 4B71A 1E9CA 4RVCA 4JT4A 4HAXA 1MO5A 2J0SA 1TUIA 2QMEA 821PA 1CR1A 5SZJA 1OKKA 1NSTA 2FGKA 1YR7A 5E7MA 2ZRMA 4B74A 2IYVA 1P9NA 2WIBA 3OFND 4UXIA 3TNFA 4LBZA 1PLKA 3QPUA 4L9WA 3GFOA 3NEJA 2D3WA 2FFBA 3S1AA 2IYWA 3C4JA 3KJGA 1L2TA 1TL7C 1U8YA 3IBYA 4CEHB 3RS4A 5JEEA 2ANBA 4JVNA 3KFVA 2WBLC 4OHXA 3RHFA 2REXB 5L3QA 1XD8A 2D62A 3I32A 4BUJA 5LPNA 3L8YA 4Z1MA 1US8B 1Z5ZA 2VP4A 3E70C 2R8RA 4FWIB 5J40A 1X86B 3EIHA 4DCNA 2B6HA 4GZMA 1Q0UA 4A0FA 1DG1G 4MKGA 3EIQA 3M0EA 3A4NA 2W6ID 2P6NA 3BFXA 5CYPA 1JPNA 1HA3A 2GCOB 4XIGS 4HUTA 5G53C 3B60A 1VCNA 2PJZA 2SHKA 3PUZA 4J0QA 4NL4H 4QC2A 4BZQA 2CJWB 5JHGB 4TL9A 4QRHA 4Q1CA 4KVGA 4DT1B 3A1VA 4HLDA 2QPTA 3TAUA 3OE7D 2QAJA 4DWJA 4OHVA 3SJBA 1CBUA 2GJSA 5BW8A 2J9RA 2W2XA 2CHGA 3EWAA 3GJ6A 4I1UA 4JIMA 1KO4A 2REBA 1FUUA 3P20A 1P2SA 2OCAA 3K09C 1G18A 4CEHA 4MH0R 5JZVA 1CRQA 3KKOA 4GNKA 1ESNA 4Q66C 1W49A 5JHHB 3AF3A 3HJNA 2G6BA 3FMIA 3LLMA 4LHZA 3G0HA 1G8YA 1J90A 1US8A 1FL9A 2HT6A 3OF5A 2UKDA 4Q9KA 2WSMA 4WXRA 5E4FA 2XXAB 1EWRA 2J7KA 1FQJA 1LB1B 1TEXA 2BV3A 4PC7A 4WAUA 2CNWA 4IHQA 5AUOB 3DOEA 4KBFA 3A37A 4K8OA 1W46A 3C16C 3QF7A 3NWJA 4GOXA 4NMMA 4E03A 3GLFB 1AS3A 4U02A 1IN7A 2CJWA 1G7TA 2ZRFA 4XOIA 4OHZA 1Z0AA 4DT1A 3RS2A 3EC1A 3Q8XB 1E9AA 1OV4A 1UF9A 3GEEA 3N5CA 1YKSA 4M2LA 4AIIA 1U0HC 3IILA 3TVTA 1W2GA 4NCKA 2A2ZA 2FFAA 4KYUA 2J59A 3GJ4A 5EP1A 1M6NA 4US0R 5IHPA 4UKDA 2XB4A 2B8TA 3RC8A 2QZ4A 2BDTA 3I92A 3NH9A 4HDOB 5CLLA 5AUPB 4V0MA 3U3KA 4C0LA 2ONKA 2XOKD 2REOA 2ZRPA 3I8SA 4TQUS 1EFUA 1ZCBA 2FX3A 3BJIC 1JR3D 2KRKA 1QZMA 3OIYA 3TR5A 4K81B 3OEHA 3GJ7A 4I1SA 1D8TA 1JR3E 1WF3A 2H17A 1S4QA 3RRZA 2YC4C 621PA 1IBRA 1T91A 4HAYA 4LHVA 5LDDC 5DHFA 2FV8A 2XXAA 4AKGA 4A0HA 4D4JA 1ZIOA 3AP3A 1P9WA 3MWLA 1I4LD 3CRRA 2VHUA 4UNRA 3GLFA 1G291 2O5VA 2AX4A 4M9QA 2OAP1 2ZJ2A 2RH5A 1BYUA 3FPAA 5JWHA 1XCMA 5JWRA 4FIDA 1A5TA 3N2IA 3Q5DA 2QGNA 3QXCA 3CO5A 1DPFA 2R6AA 4Y0VA 5DI3A 3RSOA 3THOA 1IJEA 2MMGA 2W6JD 4DKXA 4A0GA 2R65A 3TIFA 1YZNA 4WZAE 4LDJA 5CJPA 3C14C 2WJIA 3D3QA 1ESMA 2HLDA 2WJVA 1Q3TA 2JLVA 2V7QD 3F5FA 2YOHA 3HR8A 3R9XA 1MOZA 4DSNA
chains in the Genus database with same CATH superfamily
2VDRB 2ZQ5A 1RZVA 1UADA 4M9XA 4ESHA 4RPGA 3SN6A 1KY4A 3RS7A 3T3HA 1X2EA 1JZSA 4NU6A 4DLKA 3AB7A 1EP2B 2AZDA 1GZ6A 2JAWA 2AKYA 1H8HD 2BCEA 5C8ZA 3G8AA 3LXXA 1U1IA 5IZ7D 1JLHA 1T8TA 4XJXA 3FCEA 4O4IA 4BC1A 5BO5A 1J23A 3BHNA 3NBIA 3PUIA 1A82A 4LAFA 4EKGA 3QXXA 1SZDA 1S96A 1WW8A 4RJTA 2Z98A 3FMVA 5EKUA 1XC7A 3BXXA 4D0NA 5D3MB 3T5MA 4C78A 1UK8A 1N8TA 3LH5A 3DUFA 3V1KA 1L8AA 2X0FA 2M1ZA 4MYCA 3T5AA 2GHIA 4PM4A 2FWRA 7ADHA 3OQBA 1RI5A 2XWPA 4Z99A 2AXPA 3IDQA 3NM4A 2KW5A 3QYPA 3N0XA 3TGWA 1WJ7A 2WSFF 4B7CA 4Y2XA 2PZAA 4AN4A 2EATA 1KJIA 1ZM2A 1DI0A 2ZBFA 2IU3A 4MV9A 5IW8A 4UBIA 3CW9A 4PGGA 4XYEA 2W9XA 1BE0A 5KYXA 3UATA 5FR1A 1QYRA 1FW8A 2CVPA 4GXNA 1D5CA 2A5DA 3TQSA 3LKBA 4B3TM 4B3SB 1ZEJA 2PQMA 5C8VA 1OC2A 2UUBB 1OLUA 2X0IA 3LSTA 2YXDA 3RHTA 4HT3B 2PS0A 2OB1A 1VP3A 4R2IA 3Q6IA 5F12A 2WB2A 4WP2A 2YFQA 2H5LA 2WIAA 2NTYC 1U2DC 1AKQA 2QE6A 4ALLA 2CW5A 2AUMA 2PWAA 2Q8PA 3FX2A 2RHWA 2X2OA 2MSCB 4UJ5A 1EUDB 2YRFA 2DFDA 4MVXA 4F12A 3G7SA 1Z6TA 5CXXA 3E7WA 3U6MA 2VHXA 4URYR 1W96A 2GHQA 3Q8LA 1E2PA 5B53A 4X8LA 2H2DA 1R64A 4HXEB 3RVSA 8GPBA 2JBHA 3MT8A 4AQYB 4G1CA 1KI9A 1AK2A 4EVRA 1G1MA 1T5HX 5E2BA 4M3NA 1U7XA 2BWJA 1YBAA 4REZA 1MMFB 3Q3EA 5DB4A 4EUHA 1V71A 1X19A 5E9QA 3WIDA 2R6GA 5KQDA 1XKTA 2XECA 4RHXA 2ZDQA 4PLZA 4XIIA 4E6PA 3SHVA 4CG3A 1KSGA 1Z7YA 2EDAA 2JGJA 3K72B 4DR7M 2H63A 3IMFA 1SUFA 2OOBA 3O9MA 1A5SB 3QGMA 3LBAA 3VPXA 1PSDA 3Q8WA 2ZJ6A 2ZSBA 3CE9A 4CLOA 1SXJE 2Q9AA 1JEAA 1FMLA 4FFLA 2WVGA 1W44A 4XVHA 1FFWA 1IEQA 3NLLA 4XW2A 2YNMA 3MIZA 3R40A 2HHHB 3CX3A 3HY5A 3B5IA 3M33A 5GM1A 4C0BA 3QK7A 3RGGA 4TVSA 2W6PA 5A4JA 1RC0A 4IJMA 2BZ0A 4N6OA 3OX4A 4B6PA 5IASA 4AJIA 1F8YA 4UVIA 1QHYA 1LBTA 2R5FA 1N57A 1X7HA 4MW0A 3KHKA 3H65A 1T5SA 4DDMA 2JJ1D 5LVAA 3OZVA 4PLYA 7MDHA 3CLSD 2B69A 4ID9A 4IIXA 3OWHA 4L5IA 3TZBA 1A88A 4B7HA 2QQGA 2R86A 1AX9A 1S8AA 1Q1EA 3BSWA 2L4FA 4HPJB 4HEA1 3UXYA 3FBWA 2ZCVA 1G7RA 1Z0UA 3RT9A 2YINC 3F7MA 4ENVA 4OQXA 1NURA 2HNAA 3M9LA 4GMHA 4CKEA 3OM1A 4RFVA 3NFYA 2XZOA 4KRGA 2NU7B 3E4DA 3M5WA 2HOQA 4R1QA 4I3HA 3ICQB 2R4JA 4C4OA 1HI9A 2YHIA 1WABA 1T2VA 1LS6A 3QEKA 3VAAA 3HV0A 4YIHA 3CSDA 4HY3A 4UPEA 3VKWA 3E9QA 3BORA 5I8ZA 2A92A 3BCSA 1YOBA 4PPFA 2BIFA 1Q3HA 5L7TA 3VKGA 1QK3A 2G4LA 4MQ6A 2XVZA 4JX9A 5DXJA 1CUIA 3TPFA 4DMGA 1ZCAA 1PT8A 2W43A 3ZNNA 1EGHA 1XLVA 4M88A 2G9VA 2ZBEA 3DOCA 5I4IA 5B6JA 4AJPA 4J1NA 2OXIA 5J4YA 1K5PA 4BQPA 4GH5A 4ZOBA 3BSYA 3FPGA 2EKQA 4R2HA 1QRAA 3CEPB 3TWOA 4PYOA 5FTJA 2QAGB 4YA6A 3SZLA 3GBPA 4BLOA 2ZPAA 4FMDF 2Y27A 5K8IA 2LE0A 2OUKA 5C5CA 2WFLA 2PM8A 3L7OA 1IOWA 4BAZA 4JU9A 1ORHA 1ZM9A 1QBGA 1OT5A 5HBGA 3PQEA 4RGVA 1CY6A 1Z8NA 4YT4A 3DWIA 3UMCA 1IBKM 4OYLA 2QRHA 3AF5A 2XPCA 1OLSA 4PGFA 2RGYA 4JQCA 2ODWA 2Q3EA 4KH1A 3CUWA 4LRXA 3THWA 2VT3A 4JVSB 3LUGA 4QPCA 4Y2QA 4XR4A 4WHMA 1BDHA 2QR5A 1YE5A 3DWEX 3ILVA 4EEKA 3EGXA 3INYA 1NBOA 3RNOA 2D2FA 4Q4AB 1OBOA 1A97A 3LCRA 4HDKB 3IOBA 2V7GA 3LP6A 2B7BA 4DTCA 4CT0A 2OK7A 3ESDA 4UTNA 2FQQA 4K3UA 4DCUA 5DTRA 3DYIA 5U4XA 1JFTA 2PCLA 1SHZA 2Z2KA 2MINA 3E82A 2JKVA 3CZAA 1RYNA 4W1SA 1R0WA 2PIDA 1TVKA 2XIJA 1OILA 3EFHA 1XXLA 2MOKA 1Y5NA 4ZVPA 4WNAA 2HXYA 3PPYA 2GXSA 3EH1A 3NIFB 1NYTA 5K4HA 3GA0A 2Z1NA 1QO9A 4BWFB 3CUSA 2NVUB 5TQ0B 2KMLA 1NXQA 3PZRA 1UIMA 4YV1A 1GZVA 3ACDA 3OQVA 5E8RA 4F84A 4ZVQA 4ER7A 4CEIB 3MEQA 1O6GA 4FGUA 2VNSA 5CPFA 2G04A 1ZP6A 4KBYA 3FZEA 2NSHA 5DLDA 3GEHA 3NJRA 4JB3A 4NNPA 4RD1A 4CUKA 4BATA 4PVDA 3LX6A 1ZFNA 1RKVA 4EEZA 1HNZB 3U61B 1Z4OA 4LJ7A 3ZHUA 2VCYA 5FOQA 1ZN2A 2QTWB 1H9AA 2GBPA 1S2IA 3NXKA 3T3EA 1XP8A 5JCJD 3FZQA 2B21A 5TEWA 4EFMA 3KLBA 1X7XA 2PZBA 4K1LA 1X7ZB 2QF7A 5AW0A 3A4YA 2VP3A 1P2VA 3PZBA 3JWIA 4AJ2A 1X77A 1HC7A 4OFBA 3H6GA 1YMQA 2A33A 2ZRHA 4BNXA 3X44A 3RSSA 4FUQA 4JLKA 4OA5A 2LTAA 4M8SA 4LRYA 4EZEA 3MGCA 2CJPA 2ORED 1YB5A 1G3UA 5F73A 2OCXA 3HU5A 1CIJA 3R0JA 5AJXA 5GMOA 3A7DA 3Q8GA 2ZKLA 1RC8A 5HQJA 5AW4A 1EDOA 4HMPA 4WBNB 1R74A 4LHXA 4CM4B 1IK6A 4DMUB 3ZKAA 2GZSA 4G0PA 5A9TA 1PUJA 4AKSA 1WVMA 1JPUA 4ZZ1A 4GSYA 4IDCA 1SURA 1HDOA 4DLAA 4N7JA 1L5QA 4KV7A 3OETA 4C7XA 3R76A 1E6EA 2Q0SA 3K31A 4G4IA 1N7JA 3A98B 5K3SA 2JZ0A 1Y8ZA 5F1KA 3I4CA 4WXPA 2YMQA 4G8JA 4J6FA 4EMSA 2GB4A 5AKEA 5FCDA 1PS9A 3AI7A 5CFOA 2CYBA 1N2GA 1E3SA 1NW9B 4M76B 3SXUA 3KKPA 1A3CA 1FS4A 3EFBA 3V42A 4RTJA 4CUJA 4JOCA 3TM4A 1KPGA 4EJSB 4WWHA 4EATA 3SEFA 3UKOA 1HURA 5AVVA 2EJCA 3IQIX 4QAJA 4YB8A 1O87A 3I53A 5J4LA 1CUXA 1FRVA 1OROA 1QTIA 2HBZA 4L27A 4Y18A 1PK9A 3D31A 4RADA 2FW0A 4M6WA 3G23A 1VSBA 4MQFB 3Q10A 5EFZA 2EJWA 3KKEA 3VI3B 1GRNA 4ANRA 3ZV3A 4Q9AA 4L4YA 1KYZA 1BMFD 2FN9A 1TYZA 1PDVA 3QF4A 2IX3A 1TDHA 1P1CA 4B4KA 1QF7A 1WDKA 4B73A 1XMOB 4FW8A 1KI1A 2OXCA 3IQZA 2F7SA 3EJ6A 3B8EA 2NWQA 5JG7A 3OTGA 3IOYA 1V9CA 1MN3A 1CV2A 1XCJA 3OC0A 2FMUA 2VNHA 3CG0A 1E62A 3GY0A 5BT8A 1G98A 3PYMA 2FRDC 2OV3A 2X0KA 2C9YA 4EYSA 3TI7A 3PK0A 5LKAA 1GGVA 3H8JA 4ANFA 3UPUA 1M5RA 4DR5B 4C0KA 1GG2A 2I6GA 3Q3VA 4D6XA 2UV8A 3SS9X 3IA2A 2I3BA 3S6JA 1SXJB 4TMZA 2XDAA 3PXXA 3ACBA 4HNHA 5FEMA 2C5SA 1T0PA 1E1MA 3OEED 3QHQA 4EYQA 4CYMA 1J2TA 2CZCA 3WLOA 5DW0A 2FTKE 2HTFA 2QOEA 4NONA 4UASA 3NYWA 3PHJA 4BB9A 3OQ6A 3G5AA 4PSUA 1A9XB 4C7JA 2PBLA 4JBXA 1E1DA 3ONFA 3H8VA 4BLSA 3W7BA 1KQOA 5TQ2A 5BN5B 2WTMA 1L5LA 1OREA 3WX0A 4DJEC 3GL9A 1GKYA 2KNVA 4CT4B 3MJ4A 4RIGA 2HF9A 5C1BA 5LJLA 2R85A 2ST1A 1ESCA 2OKCA 1WW3A 2QA5A 1UZNA 5KJ1A 5KYUA 1Z5NA 5BWCA 3MB5A 1WP4A 3SP1A 3BDVA 1CJVC 4G4SP 1TI7A 3B1FA 5JCPA 1W4LA 2BMVA 4C4RA 3I1IA 2A59A 1VECA 3HKBA 2B4TO 4FMCB 2NU9B 5G2OA 3I3OA 1LPAB 3SATA 3ICVA 3SMVA 5E4TA 3DW3X 2LKCA 3KOUA 3D1JA 2ZIFA 5DJ5A 5EYPB 3KP0E 3DV2A 4GEGA 4PN7A 4D9IA 4CLRA 4BKQA 2E55A 4WCFB 3NGMA 5FBKA 1O97D 4IEEA 3FE2A 4LF6B 1VEGA 2HREA 3LX4A 2C8KA 3VUEA 2LVPC 2E4XA 4PLFA 3VR3D 1NX9A 3R3XA 3AMVA 4UDXX 4G6ZA 3ELBA 3GQVA 1KU0A 1HXHA 1P3QQ 4G0ZA 2X41A 1J9EA 3DOHA 4GIPA 1GKLA 3NBZC 4I1RA 3NHPA 4U3JA 4L08A 3K16A 1QSGA 5TSDA 4JN6A 3FNFA 3PQ6A 1NXOA 1TO6A 1KYVA 2J9ZB 2R84A 4KZKA 1LV7A 2HZBA 2DRIA 1W5SA 1W0CA 3OJ0A 2G08A 4X1KA 2WMDA 1MJNA 5J2UA 2CVHA 4HFNA 4AG6A 2JBAB 4OB6A 3WYFA 4C7BA 5A02A 1ARZA 4DMRA 2NPIA 3P0IA 3KZCA 3SPXA 2H1LA 2R9VA 4WZBA 1HKUA 3BMQA 5BN3A 4QELA 1CUUA 4GS5A 1JLMA 1KK2A 5ITVA 1ZR2A 3UK6A 1XD2A 3Q2IA 1QOZA 1L9XA 1NRJB 4PWYA 4S1TA 5FWDA 4Y98A 5A5FA 1DAKA 5IBRA 1XT6A 4EHKA 3FMOB 2Y1FA 3A4VA 5K3FB 3PI7A 1DBVO 4R1NA 4JI8M 5TR9A 4EPRA 3PVZA 4D9MA 1SCJA 4LG1A 2PH7A 4ZWNA 1DIGA 4Z49A 2XYRA 3BHJA 3NIGB 1E3IA 4JNCA 3OKFA 4EBFA 3RC9A 1RBMA 2ZB2A 2QD4A 2I29A 2HYIC 3DFZA 1T9KA 2X3FA 3HDQA 3ESRA 3U6CA 1J0DA 3IESA 2AWOA 3FWYA 4OH1A 2AMJA 1N25A 4M7WA 1F4IA 4PYQA 4EFKA 1OH5A 5FHRA 3EXEB 2G8LA 2PZ8A 1U90A 4G8BA 4D9FA 4DE5A 4KO3S 4BP8A 2VDLB 3D7RA 4FJ0A 2VQFB 4UM9B 2BFWA 2G1PA 5FAKA 4E14A 4URUR 4PDIA 4N7MA 1V1MB 1R6DA 1BQ4A 1H8EA 4CW7A 4IG4A 2N42A 3ZK7A 1U9ZA 5I5EA 2FPKA 1L4EA 4MW2A 3E3OA 2COEA 5BR4A 2F48A 3KQNA 3SF8B 2RCNA 5CW2A 2QX8A 2WM3A 3K0AA 1NBMD 3N6RA 4JDPA 3KAQA 1BD4A 1R9JA 2VDQB 3PUJA 2BN4A 1GQFA 3UHPA 4LF7M 1T9GS 3EF1A 4EY4A 2F43B 3JD4A 2M6LA 3E18A 1X2BA 1DKRA 3WWOA 2HU5A 3MUNA 1LBEA 3DVLA 4XI9A 3CE6A 3IAXA 2ZJ3A 4IX9A 5F51A 4D26A 2IDMA 1E9CA 3QVSA 5HIIA 5TEVA 4JUFA 3AIOA 5DNDA 3PDHA 1FU4A 5T5QA 1BCSB 1IMOA 3IAM6 1PLKA 4BL5A 2LGJA 1Y6JA 4DZTA 4WD3A 3IR7A 2HMAA 1T8YA 4H7JA 3IEKA 5EJ8A 4ENSA 4R3WA 4ALNA 4EFDA 1OX4B 3B60A 1EWTA 1T5OA 2VT2A 1B3BA 3EVAA 2X9NA 3BZUA 4MR8B 3Q2KA 1O0SA 3TWMA 2OCAA 3K09C 2EKFA 4J29A 1NU8A 1HEYA 3S55A 1SEVA 4CL3A 1TMYA 3KC2A 1AD2A 1WJGA 1K97A 2O2ZA 1YZVA 1Z5AA 4XOIA 4P81A 1VSTA 1FFYA 1UF9A 1M6NA 2YJ5A 3JVIA 5B2FA 4IGAA 2QZ4A 2ZZMA 4L50A 2Z5GA 4CMEA 1EQ2A 1AZLA 3TR5A 4HWSA 2FWIA 2PVSA 2BRUC 1JR3E 1EX1A 621PA 1JHQA 3W5AA 4FQ8A 3L8DA 1C7ZA 4K6KA 3D3EA 1V92A 2QGNA 4N5LA 3ANNA 2OZLA 1EZ1A 2MMGA 3UMVA 2JI8A 2WJIA 3CLTC 2DQKA 2Y9MB 1Q3TA 4HOYA 2B5OA 3EXG2 4J0HA 4NOKA 4CTMA 2WWXA 2G67A 5LD2C 1UJ5A 4QLAA 4IVQA 5EESA 3SSNA 4DZZA 2GNOA 4JI7B 4M0MA 5T3YA 4X61A 2R8BA 4YMUA 4RCVA 3CQ9A 1YI1A 2ZETA 4LQ4A 2ZBDA 5F9HA 3BILA 2FPGB 1LLFA 1DJNA 5E9JA 4OHBA 3L4KA 3L18A 2VLIA 1XCBA 2DKLA 3OX3A 3UANA 3ZWBA 1OH8A 5LQCA 3PC3A 1JKXA 3PLRA 4ZT2A 2YV5A 3SHWA 1MX3A 2BKEA 2OFOA 2ADOA 4LNUA 4BGEA 1IQ0A 4Q7JB 2H1IA 3Q8KA 2QTGA 3LX5A 2E5WA 3HB5X 3QW4B 1MV8A 3GP5A 1YK0A 1VG9B 4ZICA 4B4UA 1OAIA 3AVPA 3K9LA 2QVBA 3BSFA 1XELA 4BFLA 2VNJA 4YAWA 3M7IA 3HTXA 2VXOA 4XOUA 2FHPA 4CV3A 1H05A 4UM5A 3FWKA 2E6KA 5C53B 4JC8A 5IF9A 3EAQA 1EB8A 1C50A 4DLSA 3NUQA 5JW6A 1ZNQO 3EDCA 4F6CA 1GQYA 4ZQHA 2Y20A 4RK0A 5J9FA 1ZA1A 2RHJA 1R12A 2Z1DA 1F2UA 5KX5A 5EHIA 1ZXXA 4FDAA 1RRGA 2EJUA 3HU1A 5ITSA 4UUQA 4KI7A 4F5EA 1O6FA 3E21A 3U4DA 4IO0A 4MP6A 3KX2A 5DX1A 3P0EA 2P9BA 3EZXA 4Q34A 3FB1A 4LNHA 3KVRA 2DMRA 3KQQA 1VDMA 2R8ZA 1NF3A 3HY4A 1TRHA 5FWNA 4IUBS 4O63O 1PR9A 4Q7MB 2A0UA 4PZPA 3TRKA 4LNAA 3QYFA 2ZVJA 4M60A 4RHYA 1KDTA 2ZYAA 4WLFA 1G21E 2PV7A 3SE0A 1I7QB 3DCJA 1V47A 2GOYA 1EINA 3TX2A 3CF4A 3VTAA 3OVMA 3DKKA 4B45A 1M72A 2J67A 3C3AA 1CEQA 5LP6A 1KDOA 3LCUA 1JEEA 2FR8A 2C2OA 3FKSD 1OJLA 3WGHA 3L7NA 1KQNA 2ZGVA 3G13A 1B6TA 4D3FA 1DAFA 3C3JA 4BKUA 3Q72A 4A9AA 2H48A 4KL8S 1H6BA 1Y7PA 1WCXA 4TKUA 2GWRA 3FOCA 4RETA 3TKYA 4LZOA 4HEHA 2FMHA 1KFKB 4WJLA 3OQPA 1YJ5A 4GQIA 4GP6A 2AHMA 1N9ZA 4QEKA 3WGYA 1XVLA 3K0EA 3WRXC 3AUAA 3U6DA 5HBRA 1X1DA 5BWNA 5C7OO 4YGYA 4BNNA 4MO2A 3BMOA 3KE8A 4IH9A 4DGSA 2ZCUA 4RGYA 3OTOB 5L3RA 3WGKA 3H2YA 1RAEA 3JW8A 4U63A 4K03A 4QTTB 4AM8A 2VAPA 2BM8A 5JH7A 5A03A 4FNAA 4N39A 5DM60 1CQJB 4QT4A 1IY9A 1ODLA 1JFLA 1W5TA 2D4AA 1PCXA 2QN6A 2O8EB 3MB8A 3GEDA 2ZI5A 4YT5A 4WY8A 4JJIA 3UJCA 1B6SA 1RIFA 1WBJB 4LUCA 4EGJA 1DV1A 1RJDA 2EW8A 4LHEA 2Q3HA 4RK6A 1VA4A 4BO5A 5LBTA 3ZG6A 3H2ZA 3H83A 2NVBA 1ZKMA 3OJEA 4NMHA 3IALA 3II6X 4O3MA 4P7KA 4OL0A 3N2GA 2I4TA 4WN3A 3LCCA 1OXTA 5J58A 3I6YA 2CSXA 3TB6A 3T9DA 2I54A 2JGMA 5CCXA 4PQEA 4RVUA 1JL3A 1LTKA 1CR6A 5G3YA 2AVNA 3FGPA 1YWGO 1L4NA 5DRTA 3VR5D 3PG5A 2R60A 5AI8A 1E2FA 1YI8A 4C07A 1LFAA 2GQ0A 2HRCA 4ZDKA 2QMZA 4N49A 4KQGA 3I58A 2PT6A 2ZM5A 3HSKA 4XGQA 1IAQA 2R62A 2JEYA 3CZCA 1KYIA 1V45E 4PQYA 3QLEA 4YR7A 1I14A 3KALA 1QUFA 3LWNA 1NDUA 4FT2A 2FZ4A 2HMYB 3EEQA 1GUBA 2X2EA 4Y6QA 1QLJA 1YXMA 2ENWA 1QZ3A 5IF3A 4XXHA 3Q7SA 1I7LA 1RRKA 1T9GR 1SC6A 4QUJA 2D1SA 5IAEA 1KXJA 2GBFA 3ESXA 4DLXA 4YROA 5HKKD 3DZIA 5EMKA 2GI4A 2E4AA 2AK2A 2XNDA 5MGNA 3LBHA 3T7EA 4MLPA 3HNPA 2NUPB 3H2SA 5LCXA 1TAHA 3KZMA 2Z58A 4U8GA 5JANA 4KJXA 2WM8A 3N8HA 4RF5A 4XR9A 4S2UA 3KQLA 3JQ7B 4NRWA 3PD0A 2AQ8A 2PBRA 4EY5A 4K6CA 1WZEA 1XMQM 2GZ1A 5AHOA 1T9AA 1T2UA 3GQBB 1OBHA 1JG1A 1LZLA 6LDHA 2C20A 2J0UA 3GU3A 4QNRA 1S4MA 2OO3A 2PS1A 4IXNA 2Q6KA 3W9SA 3P1JA 1QB8A 2C2GA 3TF5A 5HEKA 3EEOA 3MT0A 4Z9FA 1NAIA 3ELWA 3NC1C 3FVVA 1A96A 1W87A 2O8FB 4JYAM 1J0AA 3N2NA 1OH6A 3KPUA 3TQIA 2IOFK 2DWOA 2R2AA 1RM3A 1V5IA 2XE6A 4P6VF 3OZXA 3UC5A 4LYHA 2WSIA 3AERA 1GJTA 4G0NA 2XZTA 3IHTA 3TZCA 4CG2A 2W22A 4KU4A 3H1EA 1W2WB 1Z4KA 4ZCSA 1XP5A 1YZTA 1NMXA 3L8FA 4YC7A 1TD1A 4OX9B 5G4KA 5KHLB 1BE1A 2ZS7A 5CFNA 2VJAA 5KTTA 4F3RA 3IDSA 1EK5A 3TD6A 4I3GA 3WBKA 2JUJA 2OZVA 2WTBA 4AP6A 1COZA 5FTLA 4Y1GA 4U6NA 3M3PA 3PFFA 1T1GA 4C4YA 4F6RA 2YWDA 4KE7A 3EMVA 2IUYA 3OLXA 2XDQA 4NG5A 3GV0A 3RFXA 3L02A 3GX1A 1M8GA 3JWJA 5IEBA 3B5EA 4DUYM 4DPMA 4ZCRA 1HDZA 4OL9A 2XLJA 2ZRNA 2FDRA 1XZHA 1W75A 1ZCJA 2GTIA 3GUYA 1QRRA 5ALYA 4D98A 3KLNA 5K51A 2PRJA 2GZDA 4NDAA 5AM2A 2DAMA 4MKRA 4HZIA 2Z5FA 1RWOA 1F0PA 1POWA 2WLSA 2OXRA 1SH7A 1S9DA 3BWDD 2Q3JA 4GBMA 1RAIA 4ON9A 3ZI0A 3K1ZA 5HJ7A 2VJMA 3T3GA 4CVNA 2P75A 4DDWA 1J8VA 2XEXA 3TL4X 4QPZA 1NVDA 1XMPA 1S5PA 1YB1A 1TMOA 4BZZA 3UC9A 1U9JA 1D09A 5COAA 2P4HX 3MW8A 4LWQA 4JQOA 5CURA 1IBLB 1RHMA 1WSAA 4X1YA 2A3RA 3NWLA 2AH5A 3KYIB 3FBTA 5D8DA 2I9KA 4BJ5A 4EA9A 4K9NA 3NXSA 1WKVA 5CVUA 1M6HA 1QAMA 5BR7A 3I9FA 3BWBA 4GLFA 5BSWA 1VPDA 3ASVA 5LLTA 2QYTA 4NR0A 1KAOA 2Y0PA 2X1MA 2VR1A 2X23A 3GDFA 4LI3X 2CE2X 3OO0A 2H85A 2LIVA 3KLMX 2D1QA 2D7JA 3N3AC 4E30A 3HN7A 5DTJA 1HE3A 3G1TA 1DLIA 1E4EA 2QUAA 4F9EA 5EJCA 2QR3A 2HSGA 3H4VA 3TUIC 1AK1A 4C6TB 4R31A 3I83A 2CWDA 3QLJA 2XCQA 3T5BA 4TZTA 1Y8AA 4D8YA 2A58A 3EZ9A 4CV0A 3GZTB 1U0BB 4J07A 1X13A 4HMQA 4BNGA 3M6VA 1K5GA 3Q98A 1NY5A 2R6CA 1NSFA 3VR4A 3CX7A 2VTBA 3ZLTA 3RTGA 4I1PA 5KYVA 3AF2A 4NVRA 3L6UA 3TL3A 5LQSA 2XMSA 2QRPA 4X6UA 3NHKA 4C0XA 4PF1A 1JJBA 2A78A 1FY2A 5K8JB 3H5OA 1F7VA 1ADGA 1P1RA 4TS9A 3JWEA 4KP7A 4RVNA 5I4KA 2VPXA 4JEMA 3KEOA 1T6YA 3RBAA 1GKIA 2X2PA 4G97A 2FQ1A 2VP5A 2FN7A 5JSQA 2E82A 1QG0A 3C1TA 2JLQA 4RJIA 1J7JA 1OX6A 3GBVA 4OK6A 1VKNA 4ZVNA 3OQIB 5CMLA 1WXQA 4OUDA 3TIGA 4KHPB 3RKUA 1G21B 1D3AA 2NAPA 3EVDA 1ZVKA 4CI9A 1W7AA 1T8PA 4M0CA 3ED1A 4EJ6A 3F3SA 4DQKA 1P1KA 3G5LA 1NF2A 2NUAB 1RCFA 1X9GA 4M4SA 2C4TA 4Q7KA 4DUZB 4EEXA 4WOPA 1LVUA 1R50A 5E6SB 5DOVA 3AY3A 1HGXA 4OI2A 2VQEM 3HACA 2V59A 2OPFA 4IJUA 2FPXA 2VPIA 1YR6A 1II0A 5BR8B 1ZN8A 3CKMA 3DEFA 3UK0A 1Q02A 4CIVA 3CURA 3KKMA 4YY3B 3W79A 4Q82A 4RE5A 3VPAA 3R23A 4KQCA 3K9GA 1TU3A 1UANA 4QARA 2XSZA 1SQSA 5DNYB 3LT4A 2QENA 4ARAA 3IT0A 1K7XB 3OOSA 5BVHB 1Q21A 2VUIB 2Q2NA 3IP6A 3R3SA 5AUQA 1IJBA 2MSLA 1HDCA 3IQHX 2A9PA 4HTFB 2J3IA 4CMIB 2IPOA 3WKEA 2DBQA 1YA6A 5FWYB 3S2IA 4KIJA 4OGGA 3T9CA 1AGXA 4XAQA 4OW0A 1SFRA 5CVDA 3KYCB 2GVDC 4R1PA 4V1CA 3RGSA 2Q3DA 2VUHB 1DBIA 3RVOA 2EU8A 4UCWA 3DXYA 2FKAA 5EWMB 3PE4A 2FZVA 5HA5A 3ZDAA 3IVMA 1JT9A 2WUFA 2KBEA 4WRRA 4MW7A 2CB0A 3LI2A 3JYPA 1XE3A 3RGWS 1KEKA 2AQHA 3AR6A 3RCBA 4ZQIA 4B3CA 3GCGA 1A5ZA 5KVQA 4K0KM 2FLWA 2ZRKA 1KVQA 1FJGB 5SZKB 3HBFA 1T6NA 4NRDA 4RZXA 1CQPA 4HZUB 2ORYA 4DLBA 3DOJA 4ER0A 1S0UA 3PUVA 5DSZA 2WG1A 1ZM7A 1QU2A 3O4FA 2VJOA 3PQ5A 5TARA 2VP2A 3ORRA 1M9NA 4GKKB 1SCAA 3NGLA 3QXHA 4TS3A 1ZAEA 3MMSA 1MORA 4DIFA 4B3MB 3DLBA 2Q6LA 4YRJA 2B92A 2KYRA 4CGYB 3UH1A 1RVV1 4OJNA 3R77A 1E2NA 4XJSA 5EGNA 1PKXA 5HTKA 5IMBA 5HVNA 2BFCA 4PLWA 2A1TS 2IHZA 3SVTA 4HKTA 3DTYA 1SCNE 4XB2A 1A98A 1OOEA 3NHYA 3R9WA 2KNZA 1JIUA 2IZ6A 1N6PA 2RI0A 4Y0AA 4I4TF 2WP8J 5IX8A 5CITA 1YE3A 2FEOA 4MS4A 2O8BA 5KMGA 4XGRA 1P4HA 2TMKA 1C0LA 4BFTA 2GA9A 2EVWX 2P2DA 3NCHA 4Y9UA 4I81A 1HE4A 4PAOA 2WWWA 3ZHYA 1CNMA 4IX1A 1GPBA 4Q7EA 6PFKA 4XUCA 1R4MA 1UDXA 1NP3A 4BFXA 2OEPA 5K1ZA 3DZFA 3K2QA 4TYPA 3W2EA 3ND8A 2EKLA 1H3NA 2H9YA 2FW9A 3IQXA 5IYZB 2UZIR 5LDHA 2AA3A 3DZKA 2GD6A 2A6PA 1GQQA 3H5TA 1Z59A 1Z3CA 2XVYA 4H3KB 2WHPB 3DLPX 3ZDQA 4Z8YA 2FJPA 1UMDB 4DARA 4BNDA 1POXA 1V2HE 1Z83A 3BCRA 4BO6A 1GVNB 4BJ3A 1SC4A 2PSHA 1W29A 1ACLA 3AZOA 1GITA 2DG2A 2I1VB 1J2JA 4INZA 3RABA 5H9VA 5EG5A 3TJMA 2J7NA 1GFSA 4DQVA 4OYHA 4L2IA 3AXTA 4U5XA 4PDGA 3CVXA 2DEUA 4NCNA 3LL4A 1DGHA 1V35A 4EZBA 3I9V1 4QFBA 1JXMA 1JF8A 4P3YA 4BGDA 2K47A 1NVVR 3K8ZA 1Y42X 4F3YA 4D96A 4N8SA 4DILA 1F60A 4W5WA 2IZ7A 3PTAA 2SBTA 1XMJA 1OFTA 1O58A 5ADHA 4YV0A 3WNVA 2QE7D 3QNUA 2JJMA 1CR4A 4A8JC 2X6TA 3A6PC 3UO8B 2VHWA 3EVBA 4OXXA 2H1RA 5SV2A 2BGJA 2FMTA 3KOZA 3N7UA 4A0QA 5L3QB 4F4IA 4ZTUB 1XBTA 1NKSA 1G8AA 3HB0A 1P7WA 1CY4A 1RPTA 2OYCA 1ULZA 1PKEA 1MGPA 1DIOB 4C20A 1KEZA 3ZDBA 1WUKS 1L5GB 3KETA 3DOOA 3RVLA 1J24A 1P9NA 4BGUA 1JU4A 3PFHA 2JPDA 4AB1A 3IBYA 3GZNA 1NQVA 3D6UA 3LHDA 4LSMA 5J40A 3QX9A 3HK2A 3WLFA 2M9MA 4MA5A 4DNOA 3C3XA 1SOVA 2J9FB 3VXKA 4J0QA 3GRCA 4Q1CA 4EB6A 3OE7D 3NTVA 2YW9A 5DNAA 4UPVA 5AKXA 4QYTA 3G8CA 3HBJA 4KIFA 2AI2A 2QX4A 1IVSA 5JZVA 2POQX 3BKWA 1QOPB 1X1QA 2FUNB 2IX9A 4CCWA 5E4FA 1EWRA 2J7KA 3TNJA 1FQJA 1LB1B 1ODIA 1PYGA 2VPZA 3DOEA 4GOXA 3JAKA 2JIBA 3NNNA 5BORA 5CNIA 4AIRA 4N7BA 1OTXA 2QRKA 4HQ6A 3ZZNA 3GJ4A 5EP1A 3HYLA 4DMCA 4UHJA 3AIKA 1DEXA 3I8SA 1Z35A 1YOVA 4I1SA 3QYEA 2YC4C 4QDOA 2XXAA 4ZYXA 2HK6A 4DADA 3QIVA 4W5TA 3IAS6 3EXFB 3A2LA 3WLSA 4GUDA 1ISIA 3LDHA 2XUIA 1XNQB 3RSOA 4MS3A 1DWUA 1EEXB 2FEPA 4B7AA 3D81A 4EJ0A 3DE2X 2EX0A 1XPRA 3NV7A 2HBQA 4M8KA 2KA6B 1GKUB 4AWAA 3C6BA 3U4CA 3AJ9A 1OT3A 1RZUA 3GLQA 1SHUX 3ZE8A 4NHOA 4KX5A 1R6AA 2YY7A 3LP5A 4AKTA 4O4HF 3AHEA 1WXGA 1MJFA 4LMRA 2P9ZA 2ZBUA 4RHEA 1KEPA 2IY7A 4E3ZA 2VNAA 3QKRB 1N1EA 1GYRA 5KQLA 2FN4A 4PONA 4R54A 2C8LA 3V2IA 2X40A 3KR2A 4ZEMA 1XFAA 3HDGA 3JVDA 1N5LA 4JI5B 2CDBA 5B7PA 3JQPA 3IP8A 2Q5JA 2RAFA 5JNUA 4QSHA 5HCNA 3V4OA 4N6GA 5FNVF 3OFJA 4IDBA 3SEAA 2A9KA 4LZPA 3R5FA 4G26A 1R1DA 2EXXA 1Y3DE 1C0KA 1NHGA 1FP7A 4QQ8A 3OP1A 1PSZA 3H4IA 3FZNA 2ZUBA 3AVUA 3P27A 3SFTA 4Y2HA 3GP8A 4BFWA 4IJFA 4JZYA 3FFAA 2AMLA 5K3AA 2XZPA 1XU7A 1XAJA 3UHFA 1PK8A 4Q05A 2XGMA 1P3JA 3PHIA 4TLMB 3GWZA 2GN9A 4Q1EA 1QUSA 1QS0A 2Y1XA 1X1EA 2HA3A 1G5RA 4DNQA 3HGQA 4MB6A 4M1TA 1PZXA 5FV7A 2W42A 5ALDA 5D1HA 4EKYA 4YDHB 3ND7A 3QUBA 5CG2A 2VCEA 2W6QA 3CF4G 4RTKA 4GM4A 3BD9A 4FMBB 4PWZA 4K26A 4G0WA 4KXVA 2YMPA 1OLOA 5HNKA 4PTLA 3VAYA 1O6BA 1Z17A 3GFVA 2FPLA 5AVQA 4LPKA 2OO7A 2GCIA 4Y9SA 1GGKA 3RS5A 1RCUA 4D56A 1KL7A 3M3DA 3ZYCA 1OBCA 1Y7HA 4CKXA 1DVRA 1C3LA 4X20B 2QP9X 2O7VA 1BWSA 4I4IA 3KZXA 2PSSA 1KEUA 2WT9A 2ADFA 1HWYA 6NULA 5CVJA 1N0WA 3IPAA 5CGQB 3U7QB 4W8OA 2JJ2D 3GMSA 2EBHX 3KBBA 3MQ4A 3DBIA 1Y3CE 4MHOA 5K8TA 5B1HA 3WV4A 4Y2SA 1GAEO 5B1YA 3U7RA 1K06A 3RAPR 1XTZA 3AY0A 4Z4QA 1G38A 1KAQA 1RWMA 2OD2A 5K6AA 2PRIA 1NYRA 1Q7CA 3KQWA 1QJ4A 3CLSC 3FGZA 16PKA 4B6GA 4HUQA 1FSPA 5IZ4A 2QN1A 1CPYA 2C7PA 1QF9A 5I7UA 4D8TA 2QLMA 1DUIA 4UE2A 4GECA 1L8XA 4ZYLA 4YAJA 3WHIA 2ZYIA 2QG6A 1ID1A 4FZ3A 2FX2A 1GM5A 4Q37A 1KERA 4XFDA 4FVMA 1YUNA 2QUHA 3G5UA 3A6ZA 4OVZA 2J31A 4Q19A 1R3UA 2VH1A 3CH7A 1E9BA 5LWHA 2XOEA 3JARB 3HADA 4RA6A 3ZI4A 2PUAA 2GNPA 2AKEA 4PHTA 3RT7A 1OWNA 1OXXK 2SCUA 4FCCA 4MRMA 4W5RA 2V96A 1Z29A 2J3JA 1VJTA 4FMDB 3D2BA 2GXUA 2V6ZM 4HLNA 3HP4A 4LXHA 5KVCA 5ED4A 3GAZA 3W8DA 1FP4B 4Q3OA 4NX2A 1PJIA 3QU5A 3BCHA 1QK5A 3FMFA 3BFVA 2BLLA 3LRPA 1FP1D 3NVMB 4I19A 1LWNA 2DWUA 1E2UA 2WWTA 3I0MA 2NQ8A 3RTEA 3B6EA 1TMKA 2VWGA 4N4AA 3GUHA 1ZK0A 2B1IA 2ZB4A 3GI1A 3MSCA 4O4HB 4B85A 4WKNA 2J5XA 1DGQA 1XL1A