3ZHDA

The crystal structure of single domain antibody 8-4 scaffold.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MG8-4 SCAFFOLD ANTIBODY
total genus 31
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zhdA00
1UB6B 4F8QA 2Z4QA 3DMMA 1PQZA 3HI6H 3N85H 1FGVL 2F54D 1CT8A 1P4BL 1C12B 4L4VD 3ECBB 5I1DB 2ERJB 1AGCB 1QR4A 2H6PB 3I3EA 1YN6B 4P2RD 4Y5YB 1T1WB 2AQ3A 5J12B 4JFEA 4P59L 4EN3A 4R7NB 3WIFB 1JFQL 1UA6L 2NCMA 2OTPA 4FFZH 4R4BA 5CUSH 3VXUD 5IR1B 2VZVA 1GJIA 1WAAA 3WMSA 5JZ7C 3QCTH 3S3PA 3EUUA 2BMKA 1HDMA 4KWUA 5HYQB 3MMEB 5C07E 3HB3C 5I8EA 1MCQA 3TN0D 2YRLA 1IT9H 2DIJA 2IQ9L 4LQFL 1TITA 2XWBB 2HA1A 5IFHL 5D7KE 5IROC 1H3WM 1E4XH 5ENWA 4QHMA 5EUOE 4E42A 1HHIA 1TJHH 1MIEL 4NKMB 4U6HB 4MQ7A 1RJYB 2H2SC 4Q6YA 5CIPA 4BSWA 2JJVA 1BX2B 4LLMA 4XPTH 3S35X 4X0KB 1C5BH 5I1AB 4NQCD 3WFEH 3SE8H 1FFOB 1ED3B 4Y4FA 4LCUB 1G7HA 1BQSA 3WIIH 4LKCA 1LEIA 4U3XA 4XZUA 3KJ6L 4KK6D 2QQNL 4DTGH 3EAKA 1NDGB 2XKUA 4M48L 4NZUH 1M05A 3FQRA 3RUGA 1B6UA 3BT2L 4RX4D 1U3HA 4O2CA 5ETUB 4D8PA 2YBRB 4HLZH 2ZCKH 4JFDE 3CPLB 5D1XD 2AEQH 3FN0H 4JDTL 4HK3N 1TZIB 1ZAGA 4Y4KA 3CFJA 3WJLC 3TWCH 1CGUA 1I1YA 1S9YA 1ORQA 3HC0B 5DFVD 1G9NL 2XKNA 3VXRE 3IDJA 3IKCB 4U1SB 4P23D 1EVUA 4XNYH 5SX4H 1LILA 2EC8A 5F9OH 4I2XB 4HK0A 4UMGA 3T3PF 1CE6A 4O9HH 4AYFA 4JKPH 4XPHL 3EFFA 3UTZA 1AIFB 5CBEB 2VXUH 1AO7B 4EJ1C 3AMLA 3LHPL 4NRZB 3S88L 4HG4K 3QZWG 3TNMA 4JFED 5CEZE 3HAEB 4BJLA 5KSUA 4PLOB 3BP6A 2G60H 1T6WA 4IOIB 2A6DB 4DVRH 2XA3A 1WF5A 2EDFA 3P0VL 5TJWK 4FABL 2FJGB 2AK1H 1HKLL 2O5ZL 1WISA 1I85C 5ADOH 3I75A 2XWJA 4PJGB 3T65B 2NMSA 4DCQB 1INDH 1MCPL 4WI7A 4Z78A 2CQVA 5F88A 3BXNA 5D6CA 2RHEA 4X80L 1ES0A 3KPPB 1UXSA 3IETB 4DWHA 1NSNH 4JLRB 4U6VH 3V4PL 4HKBA 4Z95L 3MLRH 3P11L 3F6LA 4HJJL 5A2LH 4KTYA 3B8SA 1EXUB 2OL3A 1P84K 5GGUA 1CFTA 3HUJF 4YBHA 1EFQA 2X4NA 4YEEA 4AM0B 3PHOB 1A02N 1DFBL 1B90A 3OJDA 1F5WA 1CI5A 1S7WB 3MLXL 3INUH 1J86A 4NNXA 4OLXH 1VB9A 1NL0H 1IGCL 3F7PC 4KTEH 3X11B 5SV4A 2F15A 3GHBL 4ONHB 2ZUVA 5C0IB 1BVKB 2Y6SD 3FFDB 3MROA 4FFYL 1NEUA 1TVHA 3ARUA 4S10A 5J7CC 4JEGB 2P5WB 4YNYB 3RX7A 3RZCA 2N1KA 4CBPA 1AXTL 4K3EH 4PRPA 3D39E 3QQ4B 4JFQA 4FQXA 1KN2L 2ZKHL 1HXYA 4LLVB 1W0WA 5D8JL 4AMKH 3BMWA 4WO4A 5IMMB 1LEKB 1H5BC 4PB9L 5EA0L 5AAWA 1RJZA 1LE5A 2W0LA 4JHAL 4RZCA 2ATPB 2OR9H 5IQ9A 4N0UA 1CDJA 1YEIH 4P9MH 1SY6H 3G5YB 1BQHA 2OSLA 3VI4E 5IG7A 3IXTA 1IC7H 3UTSD 4NC1E 4U1IA 4PD4J 5IJKA 3BPOC 4G7VH 1TCRA 4KQ4H 5EC1B 1Q94B 3DI2B 4MJ2A 3ARPA 4PBXA 3RDTC 3QG6A 3ULSA 4EUPG 2VZUA 5JQ6H 2HT4D 3REWB 2J8UB 4DW2H 5C0FA 3PABB 4M8QB 2NY6D 4P48A 3SDAB 2HT2D 3LQAL 5CJBA 5L7XH 1MHEB 3DLQR 3KPNA 4JY4B 4M61B 1YYLH 3C5ZC 5EU5A 5EZOL 5F7DA 3VWJC 4HUVB 1EIBA 3QHTC 1UACL 3OG6B 1VA9A 3MGTA 5JPMA 1UH3A 1YN7B 2DLIA 3EYVA 5D2NA 1SVZA 3V8CA 4ZUVA 4QHNA 1J7VR 5JO5A 4G7YL 1PEZA 5F21B 3GMRA 3BMVA 2VOTA 2I9TA 2CDEB 3O4LD 5SX4I 3ZYZA 1Q0YL 5ERWB 43CAB 4XCYA 3WN5B 4N68A 2VLLB 3I6GA 4RBPK 4OI7A 5HDLA 1G7MB 3N85L 4UIKH 4B41A 1A4KA 2R0ZH 3WDIA 2EO1A 3BWAA 5D1ZB 3C9NA 3RGHA 4HCRL 2XY2A 1S7TA 4P59H 4XVSH 3RWGB 1CIUA 4H1LH 1WWBX 3QWQB 1HEZA 3DGGA 3QUYC 3T77B 4G9DB 4R7DB 4OIIH 3ZE2F 4LSSH 4XX1E 1BPVA 1KCRL 3SDCA 1JGLL 1BLNB 1C7SA 2WP3O 1A4JB 4PJXE 1KTLB 2XRAL 1IT9L 4LQFH 3C2SA 2ZNXA 4EI5B 1Y18B 4EKXA 2V17H 1HHHA 4JPIA 5F3BB 1PG7H 4Z77A 5B39A 5FFLA 2NZ9D 4X5WA 3LS5L 5IP4A 5JUEH 2R0WH 4HH9B 3GSUA 3G04A 4EBQL 2EIEA 4LCWB 1AHWA 3MJ7A 2X4SB 1MPAH 5CEZH 2E7LA 4OM0L 1I7TB 3SCMB 3PGDB 5IBLD 4OIAA 1C7TA 3LH2L 4H8WC 1I4FA 4ACPA 1MSPA 1IQWL 4NPYA 3QEQA 4ODBD 5EWIH 2AEQL 4JDTH 4OD3H 1SJEB 4EVNA 3T0EE 2D4FA 4ISVA 4R4NC 1NC2B 1SJHA 3X3GL 4OLUH 4P4KA 3CLFH 3ARZA 4LCYB 3QDAA 4XPBH 2CKBL 3GBNL 1QPPA 3SBWA 3I50L 4JJ5B 2VLRA 5GGRB 4JFOB 2UY6A 3IGAA 4W4OC 3OKDA 2GQHA 4HIHA 3W0WA 4XAKD 4O9HL 3OX8B 4Y89A 3UTSB 2VDNL 2Y36L 3D39B 5GRVK 3P4MA 3VXUB 2BOCB 3ZTNH 2BHYA 2VXUL 4R6UA 4P4KC 3CH1B 4KUZL 4P3DB 4X8JA 1HXMB 2HRPL 3W39A 4ZTOL 4F9PC 2A2QT 2MQCA 4YO0B 1BFTA 5IFJB 4GAYB 1T5XA 2ORBH 5E7FA 2ICWB 5DK0B 3P0VH 1WC7B 1D6VL 4MXVF 5C0CB 3FO0H 2NR6C 2A77L 3FZUD 2NNAA 2GTZB 4XXCC 3ZT5A 1RIHH 5CCKL 2AJVL 3KNBB 3JVGA 1AR1C 2G2RB 3VFOB 1NSNL 3R4DA 1WAAF 2EDXA 3V4PH 3GMOB 3MLRL 3P11H 4ODUB 1A6AB 2X1WL 2UVEA 1UJ3C 2R2HB 3EFDH 3KPSB 3GNML 1A1OB 3H3KA 3OJ2C 4PJFA 5DRXB 5BZWB 4OLYH 3HE6C 3VE0A 3LQZB 3WE6A 4Z7VF 5BRZA 3U46A 5IFAL 2W0FB 1DQQB 1RZJH 3SDDB 3HE7D 4G8GB 4ZXBB 4TN9A 1S7SA 1IZJA 2VNCA 2YD4A 1NL0L 4LPWA 2OJEB 2R2BB 3ESUF 4YDLB 4KZDH 1S9VA 2HJKB 3P4NA 4QHKJ 3BW9A 3HG1B 1IKFL 2FRGP 2DM3A 2WK2A 4MGXA 3C5JA 3CUPB 5C2BH 3VRJA 3QFJE 3VXPA 4K3HA 4XT1C 3BDBA 3EOAB 1IQDB 4OZFB 1YY9C 5E0QA 4GBXB 1RUPH 4XC3H 4HIEA 3B3IB 4M6NL 3NPSB 3MREB 1Y0LB 3NMEA 2QTEA 1YEIL 1NC4A 1MY7A 4P9ML 3VXSA 1UQSB 5EZLB 3JVGC 4WI6A 4N1CA 2CK0H 3KYOA 5DJ8A 4H8WH 3ARGD 3RWHA 1IAMA 1BGXL 1VADB 4Y19E 1JPST 2HLAB 2NY7H 1PLGL 1A0QL 1BOGA 5DJCA 2VC2L 1FVDA 5CP7A 5JW4M 1EUTA 1VPOH 4L3ED 1H8SA 4OTXH 5EBWB 5EUKB 1QLFB 3SE3C 3C09C 2PTTA 1U8PB 4D0BA 3RJQB 2PW1B 5E6YA 4PLKD 4HJGA 3E1F1 1V7MH 5GJSH 1I1AC 4WU7A 4K8RL 4MX7A 2NW3A 4F33B 5JQHC 3LKRA 3MFFB 2E27L 4MCYB 3LRSA 3ZT7A 4LGPB 5DS8A 3X14A 2ICCA 5I73C 4NCC1 4XP6H 4LCWE 4ONFL 4L3CB 1A7QL 4Y8AA 2APFA 3MYZA 4WEBL 1MQ8A 5KOMC 4EUPB 5AAMA 4QHLA 4DAGH 3AY4A 1N2RB 1UZ6E 5E8PB 3WJJA 1VFOA 2XN9B 4BZYA 1UCBL 4JPKH 4OCSL 4P4RB 1MAMH 4S1RL 1IARB 4JKWA 3R0MA 1PY9A 4NN5B 1IGIL 1J8HE 8FABA 3WLBB 4QRTA 4H25A 5C2UB 2Y25A 1KSRA 5FCSH 3QFJD 4ZS6D 1U3ZA 4JFFA 2EH7H 2VIRA 4BKLB 4U3HA 5I2IB 4WFFD 1KLFA 4NQCB 4OZHB 3VXNA 2X4PA 3HZMA 2EYTB 5C0CE 1FO0L 2XZCL 1XIWD 1DLHA 1AGFB 4DN3L 3CVIH 2VXSH 3K2UH 4I13B 2NX5A 1U8MA 4XC1H 3HC4H 4ZPTB 2X9WA 1FPTL 1TZHB 2HRLA 3MRPA 1A8JH 4QY8B 4N8CH 3T0EC 4ZPTA 3DO7B 4F37F 2R8SH 2DMBA 4AL8L 3B9KB 3RZCC 4U3CA 3MLVL 3H7BB 1RZFL 3OB8A 2NY0B 3TPUA 4OCMC 3C6SB 1II4E 3VXNB 3L5JA 4UOW0 1BAFH 2OTWB 1CD9B 4PRAA 5EBLB 2DTMH 1WT5C 5FUZH 4PJCF 4PIRF 5F6IB 5LVEA 4U7MA 3DGCR 4Y4KC 1Q0XL 5HVHB 3PHQB 4PY8J 3BKYH 1JZ7A 3RVUC 4GRLB 5IHLB 1NEZB 3V0WH 1H3PL 3L3KA 1KEMH 1CL7L 3RWEB 4D9QD 2WLYA 3LH2H 2WUBH 1VSCA 3RIFK 3RRQA 5ITFA 1S7XA 2ENYA 4LCCB 1YPZF 4EUPA 3EJJX 5JPNA 4L3CA 5GSVA 3WUWB 5LQBH 4OLUL 4TUOB 5T3ZH 5E24E 1GZQA 2IPKA 2CKBH 2X89A 4NZTH 3ILPA 5SWZA 3RL2A 4HIXL 4KJQD 1RU9L 2GJ6A 3SOBL 2C1OB 4HWNA 3LKRB 3MFFA 2RCSH 2IJ0C 2NW3B 4JO3H 4PGEA 4YDLC 1ZLUK 5C0JB 4Q0XH 4HJGB 2VR4A 1JPTH 1U8PA 4KJPD 5T3XL 1QLFA 1OAZL 1IKNA 4KUZH 5JR1L 1L4IA 3LKQA 3J7HA 4D9LL 5I6XB 3IFNL 1E27B 4JN2A 3OAUL 1BOGB 1S3KH 5DJCB 4TUKH 3TGXA 3MXWL 2NYYC 2YZ8A 1HCVA 5I1CL 2HFEA 5JW4R 5DJ8B 1QUNA 3MRIB 3LMJH 1KGCE 5EZLA 4K71B 2A77H 1H3UA 2Q7YB 3MREA 2L7JA 4K55A 3MRKA 3B3IA 5HI4C 4OV5A 2WAHA 4JFDB 2FB4L 1FRGH 2MMXA 4JG0H 3EOAA 3HPJA 3CVHL 3TVMA 3PXJA 3VXPB 4C59B 3VRLF 1DLFL 4AQ1B 4GRMB 3D3VA 3C5JB 3EYUL 1DEEA 1KENH 2IAMB 1KPVA 1R5IB 1P69B 3LKPA 3PIQA 3HG1A 3IAQA 3BW9B 1PKOA 3LZFL 2YD7A 1S9VB 3MA9L 3VRLE 3QPXH 1DR9A 4NUGL 3FL7A 3PGCA 4HEME 2W38A 4AZ8A 1A7NL 1X5XA 4ZAKA 1X6LA 4OCLC 5I1EH 4HPOH 1J8HD 4F15B 4JHWL 2GJJA 3F5WA 4OFDA 5I73B 1T2XA 3RVVD 4YHZH 3VE0B 5C2BL 2WLZA 2NXZB 1IAKB 2Z31A 5BS0E 5EU6D 3GMOA 1JGEA 3RQ3A 1GIGL 3CJJA 2YK1H 3TBYA 4XC3L 5INCA 3U7WH 3AVEA 2KUTA 4M6NH 5JXEA 3PP3K 3H9SB 4OI9A 4DGYH 1TNNA 2DJSA 2EDNA 4ONGH 1VACA 2NNAB 3BGFC 1MCBA 1NAMB 1G7QA 4FZ8L 4XNUL 2CK0L 2IH3A 4C56D 3MLUL 4H8WL 4F7MA 4YIQB 3C08L 4AY0A 3K74B 5HTSA 3MRGB 1Q9LA 4I2XE 3DMMD 5DK0A 4HMEA 4RGNE 4GAYA 1GGIL 5KN5A 4YO0A 4K23H 1MCWW 4ZFOB 4PJBF 4S2SB 4FN0A 2OTUB 1OD9A 4WWKB 1DQLH 4ZSOE 4L8DB 3RU8H 2VXQL 4JVUA 2BOCA 5F71A 3RBSA 3P4MB 4Y19D 1H3VA 5FGCE 4DEPC 4OUOA 5GJSL 1GAFH 2AV7B 1U92A 3ROLB 3ZE0F 1J88A 4HIHB 1WEJH 5BOPA 1J1XH 1D9KB 4CMMA 1DE4B 1J0JA 3AS1A 4YHNA 3K46A 1V3KA 4XNXL 3OGCA 1BBDH 1T89C 4EI5D 1JMZA 3JTTB 4ISVB 4JCLA 4EVNB 3OKNA 4JZOB 1YEKL 3PQYB 4ZNCD 4JFHD 3PWUA 3T3ME 3OKLA 2VLJD 4NPYB 1JUFB 1S8DA 4FNLL 3ARSA 2LAGB 3KYAA 3UMTA 2NY5L 4JPKL 4OCSH 1NCCH 4PJ8C 4S1RH 2WM0A 5E2WH 1OAUL 4LDEB 4Y2OA 3MJ7B 2WIIA 1I3GL 4I0PC 3NIDF 4Y5XA 3GSUB 2WIIB 1W72L 1IC1A 2FATL 3FFCA 2VDLH 4XMPH 5B21A 3BHBA 4WHDA 3RBGA 5F3BA 2I25N 1HHHB 1CTOA 2V2WB 1TZGL 4ZYKA 4UT9L 1G9ML 4M3KB 1Y18A 1AR1D 4M7KL 3JWDL 5FGCB 3PQYA 4F9PA 3OV6A 1FAKT 1F4WH 2F58H 4NM4H 3WO3B 2NY6C 1N4XL 4TOYH 5F7HA 3ZKSD 1CWVA 2WW8A 3F58H 5D70L 1DE4A 3T77A 4F7PA 3ESVF 2ZG1A 1D9KA 3Q6GL 3M17A 1JGDB 4YFEA 5E2TL 4GG6F 3RWGA 1EFXD 1ZKAA 1S7TB 3AC0A 1DVFC 3C9NB 1INQA 3HC3H 3PL6A 2YRPA 5E5RB 4L8DA 3T3MF 4WWKA 2DQJH 1CZ8H 1VFMA 4S2SA 1G7MA 3DJ9A 4Y19A 1CQYA 2NTFB 3BKYL 5JNYB 1PBYA 5EC2B 2DBLL 2DYPD 4HMCA 2Z31D 2GYSA 2JCCF 4W68A 3V0WL 3V6OC 3WN5A 4XCYB 1QNZL 3S6CA 3E8UH 1Q9LB 1JTPA 1KEML 1ZT4A 4I3SL 3BUTA 3HRZA 2I9TB 2V5RA 4PJEA 3GMRB 5DTFA 4XAKE 3BQUD 5DUPH 1NAMA 2R56H 4JFEE 4NWTH 1KCVH 2FJHA 5DURB 3LRGA 5JO5B 3QXVA 5D1XC 4QHNB 5LQBL 4ZUVB 4I0KA 1DQML 4GAGL 2VB5A 1IC4L 3EYVB 4QXUL 4C54A 5DEGB 3MGTB 1YMHB 1WCQA 2Z31B 3SOBH 4XMLH 5EU5B 3FQXA 4M61A 2GJZA 5F7MC 4JY4A 4JO3L 1KB9K 4GO6B 2Z35A 1ZS8A 3TA3A 4I4WA 3LS4L 3KPNB 5GRVL 3PABA 1TJGH 3MPCA 5JMOC 3H3PL 3I02B 4P2OC 2MSPA 1QHPA 4LKXB 3VFPB 5KVDH 3MCKA 3REWA 4ZAKB 5CD5D 4AENB 2PN5A 3QG6B 3ULSB 5CEYB 4LMQE 4XCFL 1RIVH 1I8LA 2PETA 1MFAL 1CDGA 3LKPB 5CJOH 1CU4L 2IAMA 4WI8A 4UINH 3EDEA 3RPKA 2MTPA 3KPQA 3G5YA 3QUZC 1E4JA 3TVMB 2R9HC 3LKNA 5IQ9B 5EU6E 1A9BA 3HS0B 5B3NA 3TCXA 4NBZB 4JFDA 4DUWA 4OV5B 3GBMH 2X70B 3RVTC 4WO4B 2EDOA 3O0RL 1SBSH 2Q7YA 3O8XB 3N9GH 5K9QG 3IDXL 2F53D 3VXRA 1NMAH 5EO0B 2AS5M 2P5WA 4X5XA 5JHDD 4AK1A 4UNVA 3MROB 3MV11 3S37X 2CUIA 2HFEB 3WNLA 1K4CA 3C60D 3ARFC 1IGTB 3X11A 5D72L 3BFOA 2VKXA 4W4OA 5D71H 4DVBB 3C5SB 5L88H 1QFWL 3NA4A 5L0QB 3LKQB 1JI1A 4MHHI 1MOEA 4KROB 1J18A 1YEEH 3BAEL 2KZ1B 5IVXA 3CMOH 1NCBH 1NC4D 2QSCH 2X4NB 5I30L 5CZKA 5BRZD 5C0JA 3OZ9H 5I76B 1FNEA 4PGEB 4YHZL 5FUOL 2P44B 2F53B 2C1OA 4TTGA 4YHLH 5SWZB 3RL2B 4A6YB 1GIGH 4R90H 1F58H 3TO4D 3U7WL 2FEDC 2XTJC 3DVIA 3BXNB 5D6CB 4L4TD 4YBLC 5F88B 3EJZD 2EDWA 5DA0B 4Z78B 4I18B 1UCTA 4DCQA 4K94L 5ITFB 3IU3A 1FNFA 4V1DA 1MWAH 1KB5L 4XCCH 3MLUH 4OF3A 4JO4L 1NGXB 4ODHH 1TETH 3QBTB 4HF5L 1NEZA 1IEAB 4PJDF 3UO1L 3RDTA 3HAEA 3TNMB 5FM5O 2ZCLL 4RCAA 5C09E 3UPAA 2DWEA 4OSUH 3CXDH 4NO2B 5E4EC 1DQLL 4I3RL 3LDBC 1S7QA 5FHAH 4PRAB 2QQLL 2WWMC 3C6LB 3HNVH 2AJXL 4LLYA 1CE6B 2SEBB 4Y16A 5K9JL 3AFLA 2MQ3A 1CK0L 1F90L 3EYSL 5GRYA 5CZXC 3IKCA 3SGJC 2NY4D 1S9YB 3I3BA 1I1YB 4PRDA 2PYEA 4Y4KB 2ZP0T 3DYMA 1MFEL 1J8HB 3CPLA 3AM8C 4M02A 3O9WB 3U83A 5FM8A 1U3HB 3ULUF 3TO2B 4FNLH 4JKLA 4OZHA 1UG9A 4UAOC 4ERSL 4P5MB 4GAJH 1AGEB 4GMTH 5I2IA 4BKLA 2A73A 5DZLA 5C09A 1CDUA 2VLJE 4IRZH 2EKJA 3HUJB 4ZFGH 3BPNC 3Q0HA 4R0LA 5TPWL 1ITCA 3HLAA 3VG9B 1NUNB 3MLSL 5IM7A 4X83A 4XMPL 2C3XA 4X99B 1IMHC 2DAVA 4U6HA 2XN9A 1HHIB 35C8H 4CJ0A 4E42B 1XF4A 2ZUSA 1G0YR 3GKZA 1MREH 5L2KE 3JWDH 5IEHB 3RVTD 4QHLB 1OTTC 4MA7L 3MLPA 1OAQH 4UBDC 4XPFL 3D1MC 2VLRD 1A3LH 4EZMA 3F58L 3Q2CA 4OUUA 2GTWA 1KCUH 2MOVA 1CF8L 3RP1A 1T66C 2RR3A 4GKNA 4NQSA 5IGXH 4MX7B 2AJUL 4NNPH 2A1WL 3SE9H 4JFEB 2PW1A 1YN6A 4V1DD 1VCAA 2ZUUA 5GJTL 5EUKA 4FQ2H 4PTUA 1C12A 5CP7B 5IBUG 3SEPA 2FR4B 4Y2DC 3LRHA 2HLAA 3RDTD 4RFOL 4C4KT 1ZHKA 2NY3C 2OX5A 3MRFA 3S5LA 5DD6B 4DGVH 5C8JA 3KPRA 3QAZB 1WBZA 3MCG1 5DUPL 3VXSB 2DF3A 5EO9A 1NC4B 5FDWA 1SYVB 1L6XA 1L0QA 4N90D 5I8OH 1V7NL 1Y0LA 2HJLA 3IDGB 2X89D 4XPAL 5D5ME 3BSZH 1KV3A 3OKKB 4HIEB 5HPOA 3N1PC 1EBAA 1IC4H 1IQDA 3S96B 4PJIA 2NY2D 4PG9A 3D87B 4H26A 3WXWH 4XP1H 3VRJB 3OB0K 3CUPA 3STBA 1FZMA 3CDGA 5IWLA 1KIRB 3BYYA 3QULB 4ZO8A 4AG4L 1TJGL 1A6UH 3D69B 3PG2A 1QBLH 4Y1AD 2R2BA 2OJEA 1FLRH 1KG0B 5DJDB 1WBXA 1QLRB 3UTTB 3IS0X 1M6OA 1S7SB 6CGTA 1I9IH 3FQUB 3SDDA 1XR8B 3SGEI 3T09A 1QTYT 1GCFA 5SWSA 3DV4A 5DJAA 1LK2B 4L4VE 1IKNC 3L1OH 3HFMH 4YWGH 1LP9B 2FBJL 3ARBD 4LRNH 1CGYA 2ENSA 4PJFB 3KPSA 4YHIB 1A7BA 1UZ8B 1CD1A 1MVUB 3T04D 3QWRD 3WFHA 2B5IB 1JWSB 5E4IA 3V6FB 3WIHH 1NCDL 1T83A 1J0ZA 1QKZH 4NZJA 3HR5A 1PX3A 3KNBA 2Q8BH 2C1PA 2FDBP 2IH1B 3OR6A 2AXJA 5C0NC 4PBWD 3EO1A 3N9GL 1NAML 4CADB 5KZCD 5M95B 2WP3T 1FFRA 5ESVA 3GMMB 2NXZC 3HE6A 4Y8DC 3OKMA 5JW4N 3MFGB 1KIPA 4U1JB 1X7QA 2HKFL 3CNKA 4BFGA 4ELMA 2ICWA 3SDXF 5F96H 3ZKQD 3VGHA 5E8EA 1CR9L 4KJQC 4WIQA 2ICES 2BFVL 4K7PY 2DKMA 3D25A 3P2TA 4KPHH 1HXMA 3CH1A 4P3DA 4PY8I 3CMOL 5I30H 4PD4K 3DUSB 4AIXA 1JPSH 1QFHA 4MQXC 3IGAB 1LEGB 3LD8B 4TSAL 4M93C 4OLVH 5GGRA 5C08A 5GHWL 4Y16C 4XHJD 5MI0B 4M9OA 4WFED 5I15L 3D9AL 4P4KB 4WWKC 1LO0L 1FQ9C 3RVWD 1AY1H 4GW1A 1O5DT 3KXFE 1IM9B 1DVFD 5DRZB 1RUKL 4RRPA 3QEQB 5CIPH 4PFEA 2GIYA 4JHZA 1FG9C 4PJCA 3G08B 3SPVA 4L1DA 5HI4D 2FX9H 4NRXB 3ZO0A 1A5FH 3QUXC 1LO2H 3BVNA 2VDPL 4LPTA 4HF5H 5GSRA 5JW4Q 4Z7UF 1HIMH 2WWKO 1AHWB 3TN0C 2IALB 1P1ZB 4OSUL 1EAPA 5DI8B 1VFAB 1ZHLB 2W91A 3TLRA 3ULVH 4XNQB 5JOFA 4KZEH 5B39B 1Z5LB 4Z77B 5FA4A 3DX7B 3DROB 3O6ML 3B83A 2YA2A 4BZ2L 1XIWC 3DHJA 5D96C 1S5IH 3M8OH 4EI5A 5LWYH 1EPFA 1P7QD 1A4JA 2D0HA 1OT2A 4B7LA 5HD8C 1IVLA 4GW4A 4OLZH 4KC3B 4LCWD 3SDCB 1BD2B 1JN6B 4KK6C 1CVSC 3BP5A 1F45A 1HEZB 3DGGB 2BVTA 4QRSB 1AFVL 4ZD3H 5J9PA 3GSRB 2AK4B 2H1PH 4JFZH 4F37K 3MBED 1N7MH 5D1ZA 1I3RA 3SHSA 2CLVB 3GHEH 1PJ9A 3TF7C 4YHPA 5FOJA 3GMLA 25C8H 4RDQG 1YEHH 2JELH 2IFFL 3SY0A 4Z7VB 1CD8A 4RMRA 2DQUL 5E03A 4N90E 1BWMA 3TYFA 3KPSD 2GJ6E 2VLLA 3I6GB 4O4YH 4OZFH 2VH5L 2IQAA 2RB8A 2V2XB 3DXAA 3KLSA 1D9KC 2YWZA 3BUYB 3NA9H 3MUJA 4KI5E 4NKIL 2HFFA 4R2GB 4XVJH 1BM3L 2BVPA 1XCQB 4U7KA 4APQB 2A38A 4RIRA 3BGMA 4NBXB 5BMFH 4NJAH 2VABB 1IGFL 2EZ0D 5D2NB 1F6AA 3MRMA 4KI1A 1KCUL 5JPMB 5MENE 4O5LL 1KYOK 4MXQC 5DXWA 4TSBL 1ZA3B 5DK2A 2W07A 5L2JB 4X7EC 1FJ1A 1Z9OA 3D18A 4UIMA 3SDYL 3S34L 1MHEA 4G8IA 3JXAA 3GMQB 1DL7L 1NBYA 5JW3H 1X4XA 3NFSL 1FIGH 3QDMD 1ADQL 1OGTA 2EDQA 1QFUH 1DBBL 5K59E 1XR9B 5HGGS 4YQXH 1QRNE 1WZKA 2X1QA 1SM3L 1A7RH 3LSOB 1Q94A 4F3FB 4RFOH 4A6YH 4N5ED 5EC1A 1F3DH 4X6CF 3SQBA 3MJ9A 3IXTB 4JPWH 4DGVL 1VEMA 4DQOL 3C5ZD 1DQJA 2JCCE 3CC5B 4JN1L 5IK3A 2NY6B 2D7TH 4N0UB 4XHJC 5DD1L 4RZCB 1DBML 5F3HA 1W0VB 1U8QB 4HFWA 5TFSH 1ND0A 1RJZB 4YHML 4QTIL 1FC1A 4KV5F 3KLHC 1RHHA 1HXYB 3VXQB 4FQXB 4MAYB 3QQ4A 3DECA 4E41D 4WTXA 2X10A 4L4VA 3EYQD 3LQAC 1N64H 1TVHB 1DN0A 4LRIA 1GPOL 1Y6NR 2ARWA 4JY5H 3QXAA 3MRDA 3VXME 1OTSD 2IEPA 1QBLL 1T2QH 5KJRL 1C16A 4ZUUA 1JJUA 2JJSC 3T08A 1FLRL 4F57L 4JZJC 3K4DA 1TQBC 2CRZA 4Z7OF 2LU7A 1S7WA 1I9IL 3C60B 3RPIB 5E2VH 3B5HA 3PHOA 4L4TE 4AM0A 4PJGE 2R4SH 4WCYL 5GS3A 2PW2A 1WCBB 5EU3A 2OL3B 4HHAB 1EXUA 4LRNL 3O2DA 4RGNB 4NO5A 1DQDH 1KTDA 4ZFZB 1TFHA 4NFDA 1NKRA 1H3GA 4PR5B 3TNNA 2ATKB 1UXSB 2VSCA 3IETA 3KPPA 3JUYA 4G6JL 1MI5D 4HQQL 4G8GE 3MV9A 1TJIL 5E8OA 3PGFH 2ITCB 2YPLD 1AI1H 4EI6A 1MCLA 4RISH 4Q9RH 1G6RA 3F7QA 1DBAL 2A6DA 5JORB 3EDFA 4IOIA 3ZYJA 5F96L 3BP6B 3M07A 1GH7A 7FABH 1U8IA 5KSUB 3IDYB 2A6JA 3TBVA 2F19L 1KUMA 2APBA 3V9FA 3W11C 4L4TA 3P4LA 1JZ5A 5CBEA 1AIFA 1N0XH 5J1SC 5ID1A 1RJCA 5DJXA 2C9AA 5CD5C 4GXUM 3WFDH 4TSAH 5CGTA 4OCXL 5IB1B 5GHWH 1U8JB 1XGYH 2FSEB 3GRWL 1HN1A 4MNGB 1RURH 1WIUA 3LN5A 1U3YA 5DD0L 5KG9A 4E41A 1IGJB 2P5WE 5D7JB 4HS8L 4ODXA 4U49A 3WNPA 1GOFA 2DI7A 1AQDB 1CE1L 3MRJA 4OF8A 5FKPB 3FQRB 2YHGA 1JZ8A 1A5FL 4WI5A 3SQOL 2X7LB 4YXHL 4OT1H 3VWKA 3T0EA 4XVUC 5ACMA 1JPFB 5L0QC 1G7HB 5B8CC 5AWNL 3WJLA 1EK3A 1ED3A 4Y4FB 1YQ2A 1DUZA 4JDZB 5I1AA 1KB9J 2EXYC 2NXYB 3FB8A 5AYUH 4HV8B 3MGOB 1BX2A 1K6QH 3NTCH 4N5EC 1Z9MA 2ZOLB 2BNRD 5B3JF 4NKMA 3O6MH 5ENWB 1UB5A 2CLRB 5HHME 2IPUK 2NY1D 2XWBA 3GK8H 3M8OL 5LWYL 1ROWA 4O58L 2BRRL 2R2EA 4LVOB 3PDOA 4G5ZL 2FH6A 5HYQA 1RV6X 4OLZL 4XCEA 2BMKB 1TCMA 3VFSB 1GZPB 2BERA 1T21A 1U36A 3ARDB 3QA3A 2W92A 3QJHA 2P43B 3QR2A 1S9XA 5C0AA 1Y6MR 5HI5D 4FQPA 3PL6D 4R4BB 3R06B 4TQEH 5GS2D 1OVZA 3S4SG 1P5UA 2NXYD 1T5WA 4LEXH 1YYMH 1FE8L 4I77L 1NMBH 2ADIB 4N9OB 4Y5YA 1XGRA 3ECBA 4J3OC 25C8L 3G6JB 2QQKL 2Q76A 4X4XB 1UB6A 1N6UA 4ZQKB 2R15A 2EIDA 5HGDA 3A67L 5JA8B 5E5MA 2NY0C 4D0DA 3FOLB 1H5BA 2R0LL 4Q9CA 5FO8A 1F02I 1VESA 1ZT1A 3SGEH 3CDFA 5C07D 2OCFD 4YAQA 5I19L 4JFYB 3REVA 3O3EA 4CL7A 1KLUB 3MZGB 4NJAL 4KHXH 3JV0A 1JWMA 3HZYA 4IHOB 2W0PA 4WUUE 5I1IH 2X6MA 1QEWB 4JY6A 4X8XA 5IJVB 5BW7A 3D0LB 4OCRL 4H0HB 1HHJA 5E1AB 2NQCA 4XBPA 4POZD 1RSFA 1SEQH 3LEVH 1R3JB 3BIBX 2GITA 2IANE 2W9EH 4R26L 4S1QL 5ESAB 1YMMA 2CGRL 1FN4B 1NGPL 3NBNA 5ISZA 4HUUA 5BXFA 1UXWA 4RFNB 4JFHE 3ZHLA 4KQ3L 3U0TB 3RNKA 3LN4B 3NCYS 4A6YL 3RNQA 5D5MB 5JMRA 3KWWB 2CDFB 1X9QA 4L8SA 4DKAA 4BK5A 5CMAA 5TE6L 1T1ZA 3OBAA 5FYKL 2ZG2A 1KJ2B 2QEJA 5DLML 5EIIB 2OS7A 1JTTA 1XGQA 5TDPB 5F93C 4IRJB 3GI9L 5D96B 4QO1A 5I66A 5TFSL 3BZ4A 4D3CH 2G9HB 4G6MH 4U1LB 2DI9A 1DDHA 4GMSH 2QV2A 1XGPA 2CXGA 1PFCA 3HPLA 5DMIL 3KPOB 4FG6D 1BIIB 5F70A 1UJ3A 3L6FA 5DVLA 3SKNA 4PJAE 2Y7QA 5EO1B 4JY5L 2VE6B 3FO9B 2ZZUT 4WFHD 4OM1L 3C60C 5IESH 2KZWA 4JFXA 1WTGT 4HUXA 2EYSB 3F7YB 4XXCA 4Q2ZB 4YZFE 2XACC 3L3HA 2EE3A 2BC4B 3TCLA 3EIFA 1HYRC 2FWOA 2HT4C 3TYGH 1A6WL 2HJFA 1B0WA 1J05B 4PV8B 3AROA 4MAUL 5FM5M 1X5AA 5EOCL 2N7AA 2Y06H 3MJ9L 2YKLL 4KK9D 4DKEH 3FB7A 1AJ7H 2D7QA 4ZPVB 3U0PB 1IC5H 3BRGC 5SWSD 4KHTL 5J6GB 5FKAA 5C0GA 1AI1L 3MYJA 3C8KA 2VKWA 1OF2A 3QCUL 4PJ7B 4PV9A 4NC0B 4ZDHA 2ZWLT 5B38G 3RTQB 4DN4H 5SWZE 1CICA 2I5YL 1MFDH 1U41A 3FTGA 3UC0L 1CGSH 1R3LB 2JJTA 2WQRA 4PP1C 4HKXA 4YHYC 1MUJB 2CKBA 3HNSH 4N0RA 3P9MB 3TPKA 3GI8L 3O6LH 4DUXA 2E3VA 2PKDA 3GSOB 3UJTH 1RZ7L 3P77B 4UT6L 3HI6L 5DDHB 1T04A 2UZIL 4NCC2 1EEQA 4JAMB 3RIAK 5T1KD 4OCXH 2I9LA 3ABZA 4YGAB 5E99L 2AEIT 2FD6L 2IPTL 3RZWA 3FONB 4TNWK 5DD0H 2JB6A 5E9DD 1DSFL 2J5LB 2XKSA 5JZ7D 3I85A 5DD5L 1P4IH 5D9SB 1I8MB 4U6YB 2QBWA 4LSTH 3D0VB 3LIZL 2W0KA 4XP9H 4OT1L 4KJPC 3TBSB 3QUKA 1P7HL 1S5HA 2IQ9H 4LNRB 5CJXC 3ZHDA 3IVKB 1MIEH 3G5VB 4X98B 1IL1A 2OZ4H 4FTVD 2EIZA 1G7JA 1FYTB 2LAAA 2Z91B 3MCLL 3OAZH 4GLRI 1WZ1L 2DTSA 3BH8B 1NJ9A 2AAVA 5ACLA 1MCOL 3JZ7A 1CFVH 1X44A 5H2BA 1S7VB 3FQNA 1YNKL 3UJIL 3VXUE 4LASH 4DTGL 1AD0A 1QSEB 3UBXI 2VAAB 3MC0A 2CDGB 1I9JH 5FCUL 2ZCKL 4JO1H 3Q1SL 3QQ3B 3EOTL 4PYGA 4G6FB 2XG4A 3NIDE 2FX7L 3Q5OA 3Q3GB 2BOBA 4LU5L 1EZVX 3TWCL 1D5IH 1RVFL 1G9NH 3FT2A 3SGKA 2Q6WA 3TN0B 4ZFFA 4BFIA 4PGCB 5IMKA 3PWVB 5L2KA 5HHPB 5F9OL 4LPXA 3R8QA 2CJUH 4PRNA 3BESR 1NFDF 1ZT7A 4XPHH 2C3GA 3ROOA 3L3IA 1KC5H 4OFKA 1DVFB 3EZ8A 4WFGE 5D1XA 2V7HA 4P2OA 3V2AR 1L9MA 3UYRH 4IIQC 2P5ED 3IFLH 1YUHA 4JG1L 1JZ6A 4FFWC 1NUGA 5I19H 4QHUA 3MUGB 4TYUA 1A6ZA 3CXHK 1OSZA 3FB5A 3U6RB 1MHPH 2DBJA 4KUCF 5KTEH 3TP4A 5KSAB 4PUBH 4UB0H 3HCVB 5ADOL 3GO1H 2HT3C 2AGJL 4HEPG 5K59F 4LVEA 2Y9RT 4GW5A 2FGZA 4NWUL 2PYEE 4ZUTA 4NKOB 3WD5L 1PEWA 3HN3A 4MDJB 4X80H 5E1HB 1JHTA 3AAZA 4U1MB 1KPUA 4QRPE 1WLHA 4G80A 2DWDA 4NHCH 3WV0A 3TESA 2ICWI 2H9GB 4G6KL 5H35B 1FL6A 2AW2A 3L3JA 3MRCB 1UH2A 3KPMB 3CFEB 4M7JH 2O61A 3NZHH 3QEUB 1YDPA 4XTRC 1C5DA 3TBWB 4OZGA 2W65A 2VLJA 5J57B 3D3VE 1MVFA 4P3WA 1AC6A 1XIWA 3JV6B 3QI9D 3KLAB 3GSXB 5KANG 4LF3B 3LD8C 3QIUD 3PWPB 4DKFL 2E7LC 1FC2D 2NTSP 3L3OA 4G6ML 2CO7B 4G8EB 5ELIA 4KAQL 1F4XH 4I0PA 4P2QB 5F9JA 1P9MC 1CGXA 3PWJA 1T66D 1UM4H 1MJ7L 3QIWB 5DR5L 1NCWL 4QRPA 2VL4A 1TDQA 3UTTE 4HAFA 2VTFA 1PVHA 3IU4H 4XP5L 5T1LD 5IBTH 3IT8D 4B53A 4IRJD 1MFNA 2DQEL 2J4WH 3EYFA 3PJSB 3QIWA 3R8BB 3MLTA 5L2KD 4FA8A 1J1PH 2A83A 2FO4A 2UZYB 1Z3GH 5J3HD 3WNKA 4P2QA 2IFGA 2ZG3A 4U0RC 4X6EB 1NLDH 3TYGL 3L3OB 1G7LB 3MRRA 2FO1A 4UDUB 4JE4B 1AR2A 3GJEA 3ZL4L 5DRNB 3PWPA 1P6AB 2HKHH 6FABL 4DW2L 5EZIH 3K1KC 2OL3H 1XIWB 5HHOB 3LQAH 5L7XL 2YKLH 2YC1A 3O3BA 4EDWH 1MJUL 5FO7B 5FYJH 2AJZB 3TBWA 1H0DB 3B9VA 2IF7A 3QEUA 3DYPA 4P5TA 2ADGB 5I1HH 4IDJH 4TSCL 4D9RE 5DD3L 3KPMA 1ZLWK 3BP7B 3SJVD 4BQCA 2XG5A 5H35A 4KVNL 4YUEL 4YXLH 3U9UB 2NPLX 4Q9QL 2RBLA 3KYKL 3NIGE 1G7PA 1F11B 3ZHKA 5L6YH 3VW3L 3AREA 1OAKL 3R1GH 4PP2B 4W70A 2ZSWA 4GW5B 3B5GA 1ZTXH 3UJTL 1QSFA 1KCSH 3MA7B 1KJ2H 1XF2A 1A7OL 2HFTA 2HTKC 1EHAA 4UIKL 3FB5B 3U6RA 1PZUB 3MUGA 3PDDA 5E99H 3FO1A 3HZKB 1P84J 1MEXH 1UC6A 2GCYA 5ICYB 4NQDA 4MB4A 3BPCB 4P2OB 3BPLB 1DVFA 3V5DB 3NABH 4RAVA 1WGOA 5DD5H 5C0ND 4OIIL 2E7MA 1DJSA 3QNXB 1KCRH 4NZRH 4WJ5A 3ROOB 3MQIA 3TH3T 4Y88A 4OZHE 1ZT7B 1JNHA 2DLFL 2V9RA 2XRAH 5EFIA 5I1KL 5MP6L 1EHLH 5L2KB 1HYSC 3VA6A 5E94A 4LCIL 4P9HC 2VDKL 1T7ZA 2I07A 3TN0A 4ZFFB 4BZ1H 2V17L 5E8NA 3FT2B 4TTDC 4WEUD 5K93A 1EO8L 3QUMH 1CICC 1U3HC 3Q3GA 3L3DA 2EDTA 4ZAKD 4V2BA 2X4TB 3DBXA 4PB0H 4MCZB 3TIDB 2D4DA 3SE4C 4GSDH 4AH2B 3RUGF 4Z8FL 1MCOH 2J6EH 2Y5TB 4PJGF 4Y1AE 4G42A 3UJIH 4R3SB 4O2FA 2IADB 4LASL 3TT3L 3GSQB 3FQNB 1CQKA 4BFBD 3EDKA 5AD0B 4F7EB 5A2JH 5EORH 1M7DB 1IQWH 3QI9B 3P0YL 1FHGA 4U05A 1P5VA 3EOTH 1FYTA 1SQ2N 3P4OB 2EIZB 1HE7A 2CRMA 1IL1B 2N7BA 3G5VA 3ARVA 4MJID 3U79A 4Z7WB 1L6ZA 4H88H 4L8BA 2ZJSH 1T1XA 1EV2E 4CN4A 4YX2H 3CFCL 3DRTA 2VR9A 3M45A 4LNRA 5CLTA 5D5MF 3V95A 3GJFB 5FA3B 1A6TB 3PDGA 4JCMA 3VXOB 4PJBE 1HOCB 1QD0A 1OW0C 4D0CA 3B6SA 3O4LB 4U1GC 3EOBB 1F2XK 2HRPH 1NDMA 4PJBA 3JWNC 4NFCA 4TVPD 2BSRA 2C7UB 1CDHA 1E6OH 3H8NA 1D6VH 2BJMH 1PSKL 1SMAA 4C58B 4LEOB 4JAMA 1NGZA 4QTHB 1F3JB 1LO5B 2FIRT 2AGJH 4QWWC 4GH7B 1OQXA 3WD5H 4U31A 2BCKB 5HDBE 4A2LA 4NQEB 5AG8A 4GT7A 1MUJA 1FZJB 5FGSA 4RSVA 4B7IA 2HAZA 4NUJA 1CBVL 1JF5A 3FTGB 4Y4HB 1QQDA 1FL3B 1OQOA 3V5HB 4P5TC 3MLYL 1K4DA 5IHBA 3IYLW 4J3SA 1RZJL 4KKAD 4R4FH 3HE7A 5C0GB 2ZNWA 5FKAB 5J6GA 4P46D 3NVQA 4JRYA 4KK5C 1CFQB 2F5AH 5IB3B 3EGSB 4NO0B 3FT3B 2ED8A 1RY7B 4ZUSA 2OK0L 4BQ8A 3QWOB 3MV7E 3WLWD 3F12A 2YD9A 3FT3A 4P5KB 5C7XH 4DKFH 5IB3A 4PV8A 4ZS7L 2DLHA 1CFQA 3BOVA 4YDJA 5HI3D 1QOKA 1JNNL 4JRYB 4YHKH 2QSTA 3JBG7 1CG9B 4LLDA 1IEBA 3QUMA 1QA9B 4BK4A 4ELMF 5C0BB 5CJ5A 2BC4A 2NY1B 1K4DB 3L3HB 4G3YH 4RWYH 3V5HA 1FL3A 1KN4L 4NOBA 2J1KA 3ZKMD 1Z0MA 3QDMB 1FZJA 4NQEA 4RFEB 2P46B 4PG2C 3AXLB 3QG7L 4NN7B 3SKNB 1YQVH 1BZQK 4N9GA 1BGXH 4Q6IB 4JDVB 3MV8E 1DDHB 3C8HA 3MODL 5I8CB 1TNMA 4U1LA 1LO5A 4XBEH 2B1AL 5M7QA 2G9HA 4OF6A 4LEOA 1CXIA 1A14H 3STLA 1D9KD 3X17A 1K8DA 2BSRB 4YPGB 1RZ8B 4JGJA 2NY5C 1XGQB 1KJ2A 1VDGA 3TBTA 5CMAB 1T1YA 3O4LA 4PJDE 5BO1H 4D0CB 4TVSa 1FORL 2YZ1A 1FL5B 1IAIL 3KWWA 2YMXH 1HOCA 3RNQB 3SO5A 5I1HL 4JJHA 5TGBB 3HMXL 1A64A 3O3UN 3RNKB 4K2UL 5BW7C 4ONFH 5H37H 4N1HB 5FA3A 2R1YB 4KVNH 4YUEH 4YXLL 4GUPA 1OTUC 1R5WA 1X5HA 5FK9A 1OGAB 1UXWB 3DVNB 4J7RA 4Q9QH 3MV01 4HUUB 5FHBL 5J13B 1YMMB 1MIML 2R39A 3UAJD 5ESAA 2J5LC 1R3JA 4Z7WA 1I3VA 2CIIB 4FQJL 4LSPL 1UCBH 3GSNL 4HGKC 4R8WH 1HHJB 5E1AA 5DHXB 4LPVA 4WNQB 4CVWA 4HIIA 4IHOA 4KROC 4QNPF 3HZYB 1A7OH 1OLZA 1BD2D 4H1LG 3PP3H 3GSQA 2BSED 3DXAE 1C1EL 2IADA 4HULB 4O2FB 3MRQB 4OB5H 1MEXL 2XI9A 2Y5TA 1FO0H 5IW1A 3VRIB 1JFQH 3SCMC 4KMTH 3CVIL 4M1DH 1XF5A 5BOZG 2X4TA 2EE6A 3DBXB 2NX5D 1CLOH 4QXTB 1FFQA 2WBJA 4WW2F 1Q72H 4UV7H 5T3XD 15C8L 3VD4A 5E8NB 1REIA 3QUZA 4DKDC 4IIQB 2W59A 2J3SA 1JV5A 4PJAB 1WFTA 2ADIA 4DGIH 4EDXB 3ULVE 4N8VG 4WUUB 2X4OA 1EO8H 3VA2C 3QUML 3QNXA 4WJ5B 3CZJA 4HC1L 3T0XA 3VXRD 4U7SA 1C5CL 3V5DA 1NCUA 5C0AB 1CDIA 1W2KT 1LP9E 3QA3B 4NQDB 1NFIB 2J6EL 5ICYA 4XCEB 1EGJH 2FGWH 5DHVB 3P73A 3FO1B 3HZKA 5DFTA 5HI3C 5F89A 1CL7H 1S9WB 3U30B 2P5WD 1UJTA 4P0DA 5KSAD 5C70A 4Z6AT 2GW5A 4ESKA 3LOWA 2EH8L 4NJ9H 3DETD 5F9WB 3SN6N 4OCWH 3MUY1 4HV8A 1N59A 3KPSE 4NIKB 1RK1B 2B4CH 5T3ZL 3AREB 4H88L 1NAKL 4CNIB 3U4AA 3MV7B 2HT3D 4UZGA 2DS4A 3IDIA 1H3TA 1MLCA 4OFVA 5LBSL 3BP7A 5GZOD 4HXBH 2EEAA 4PPTA 2PYED 1S7RB 1CXEA 3MRJB 5FKPA 5T3XH 4Z5RB 3IAPA 3TV3H 1ZGLP 3ZDXF 3OB0H 4TUJA 4OF5A 2AJZA 3S88H 3CX5J 3DWTA 5FO7A 4TUKL 3ZSTA 3O3BB 4E41B 2PUQT 4E5XB 5ISZD 5HHOA 3T1FB 3ZE1F 4MNGA 4DVRL 4YE4L 1E6OL 2FSEA 4GOSA 3CFIC 2OR8A 3WHE1 1PSKH 5GS0C 4POYA 4BH8A 1A22B 2VDML 2J8OA 2WBJD 2PR4H 4UDUA 2AJSL 2BNQE 1J0YA 2P49B 4NGHH 5CEXA 5IEKA 4PS4H 2W60B 4GRLC 5ID1B 3MOAL 3QUZD 1IBGH 2A83B 2FO4B 4L4TB 3WYRA 2BY0A 1FBIL 4YXKL 1QBBA 4OI8A 2FB4H 3MLTB 1I8LC 2CRIA 4HKJA 4U6VL 4Z95H 4YC2B 2Q3ZA 1U8IB 1KPRA 4JREC 2VISB 4LP4A 4KTDH 5ANME 5JORA 3OGOE 3HRPA 1F00I 5KS9E 4YJZL 4HWZB 4WI9A 2R2CA 3SDCC 3TA3C 2VJXA 3LEYH 3MV9B 4MXWH 1EMTH 3PUCA 3OJMB 3O4OB 4KTEL 1P7KB 2DQHH 4KJYA 5J1AA 1JHKL 3ELAT 1MH5A 2XPGA 3KR3L 1U8KB 4NO5B 5C0EA 5C7XL 4HJ0C 1UKTA 2Y07H 4HHAA 1AXTH 5SWQB 4OZGB 4K3EL 5EU3B 2GK0A 2R9HD 3O2WH 2HN7B 3RPIA 2YK1L 3L3JB 3MRCA 4GQ9L 3QEHB 4Y7MA 1J10A 2X40A 4HX1B 3U2SB 2H9GA 4KRLB 3NCJL 1C16B 4FZEL 4G9FA 4G80B 1W0YT 1AXSB 1KPUB 4FZ8H 3G9AB 3AAZB 1XGUA 4HUWA 1E4KA 3QG7H 4TRPH 2XIDA 1RUML 1IC7L 4IBLT 4PRHE 1TTFA 4KQ4L 1OAXH 4CUCA 3SKOA 1JGVL 5KSAA 1MJ8H 1ND0B 1W0VA 1JRHH 1LO4L 5ECJE 2VL5A 3ES6B 5B38B 1YUHB 5HHVL 4XMKL 1YEJL 4HUKB 4OQTA 2EECA 5BO1L 2DLGA 3HMWH 1VFBB 1H15B 4F3FA 1QSFD 4EIGB 5IMOB 3S37L 4BSJA 4FQQB 5IMKB 1URLA 4J3TA 4G7YH 4TVPH 3VFMA 1OGTB 4PGCA 1AQKH 3DTXB 3BQUB 4PJ8D 3GMQA 1EHXA 2J88H 5KVMC 1NPUA 4WU5B 4UIMB 1MRDL 5C0DA 3BIKA 1FJ1B 4YHOH 1NCCL 2BOBB 1Q0YH 2EE9A 3ALPA 3QIBB 1F6AB 3MACL 5IJKC 3I2CH 4I9WE 1QSEA 2R0ZL 3BGMB 1AD0B 2Y6SC 3TT1H 1XCQA 5TF1H 4NZDA 1TZGH 4AQOA 3KLHD 2HFFB 3JV5A 2I60H 2V5MA 1HWHB 1ZHBA 2IQAB 1JPGA 1MAKA 1G7JB 1F4WL 4WO4C 4YH6A 2F58L 4NM4L 1E28A 4UV7L 3QFJA 1JGLH 1MHHA 1U0QA 4Z7UB 5CSGA 4Z7VA 4PJ9D 1GGCL 5D70H 3WIHA 4HXAH 4YEFA 4YHPB 1S5HB 2UYLB 3TBSA 1EDQA 4QOKD 5HHMB 4DGIL 2CLVA 1U93B 1I3RB 4DFIA 4PP1D 2Q3AA 1VGEL 2GY7B 3D0VA 3VI3E 4NSKB 4U6YA 3QXTA 2XQYG 1C5CH 3UDWA 5JUEL 1FFNB 1GGBH 1ZE3C 2OLDA 4BUHA 1AP2A 2HG5B 4HJ0D 2JB6B 1NBVL 1J9CT 4MVBD 4ZO7A 3L7EA 1QNZH 5JXEC 1KJVA 3E8UL 1INEL 4I3SH 5A2FA 3PQYE 4P2CG 3IFOB 2E9IA 1BP3B 4X5LA 3QJFA 5DEZA 3P77A 4J1UB 3DX7A 2IGFH 4G8FB 5EWIL 1X4ZA 2H41A 1ZHLA 3NCCB 2YD5A 5T5FH 4X4ZA 1ZLVH 5TE4L 3V7MA 2BXZA 3C87A 3P9MA 4XCNA 1QFWI 2IALA 4QXUH 3U4EA 1M7IA 1NAKH 3QEGL 3KG5A 3BVNB 2NY2C 3WXVL 4JPVL 4XNZB 3O45A 3RTQA 1Q1JL 1SHMA 3OF6A 4NRXA 2VDNH 4PJ7A 1SEBB 1JNLH 3PWLA 1OF2B 3G08A 4Y1AB 2P5EE 3ZTNL 1KCLA 4JKMA 2YD2A 2GK2A 5DRZA 1J12A 3TV3L 2BVQA 1IM9A 3U0PA 1TVBB 2IG2L 5D7IA 4L5FL 5TDNB 3OTTA 3RVXC 4XCFH 1MCSA 3DRQA 2AJ3A 2NY3D 3QI9C 1JYWA 1DP0A 4UILL 5AG9A 4TULH 5C08B 1LEGA 4MNHA 2VDMH 3ET9F 2AJSH 3GSWB 1YJDH 2XFXB 3VD5A 3MRNB 3BKMH 5KZCB 4JZNA 2IAND 3CLEL 1IBGL 3NGBB 3TCLB 1ACZA 3BO8B 4GG6E 1XGTA 2EYSA 4JQXA 3O0RH 5E8EB 3IDXH 5HVFB 3HAEH 3VD9A 2XTJE 3MV8A 3FO9A 4KTDL 5EO1A 3X12A 3T0ED 2XWTB 2DL9A 3L6FB 2JKXA 3L95A 1UJ3B 1BIIA 1KIPB 4U1JA 4MA1C 4U2YA 4LSQH 1XGPB 4X7SL 3HE6B 5IB5A 1KLGB 2J6EA 1N5AA 3RY5A 4CADA 5D72H 1NCAH 4X9FA 2WNGA 1PYWB 4FQIH 1JHKH 3V6FA 1JWSA 3MO1A 4HWEL 5J4MA 5JXED 2C5DC 4Q7DA 5I66B 4IRJA 1CD1B 1MVUA 3F65A 4YHIA 4CDHA 3FMGL 3OZ9L 5EIIA 1HINL 5D1ZD 1LP9A 5EU6A 2Y07L 1KXQE 2I24N 1LK2A 1BFSA 5L8KB 4O02L 2CDFA 2EICA 5D7SH 4R4ND 4LBEA 5D5MA 3FQUA 2F5BL 1T20A 5C6TL 2E8YA 3DNKA 3FN9A 3DOSA 1KG0A 3RAJL 3DX8A 4FOMA 5E9DE 1FN4A 4JQVA 2NW2A 3OJVC 2GITB 4HZAA 4M43H 5CINH 1CVRA 3QULA 1RUMH 4K94C 5C0AE 4XBPB 2YXFA 5F8RC 4KDVA 1FZMB 3D0LA 1Q38A 1D7FA 5IJVA 4H26B 4JY6B 2DQCH 1PLGH 3GJFK 1KNOB 5DGRA 1JWMB 5LGJA 2ZCLH 2G75A 1VPOL 2DJUA 1NGQH 3RVXD 1MJ8L 3CXDL 1JRHL 4OZIA 1H8OA 3REVB 2R4RL 5FDWB 4U1HA 4XMKH 3RX8A 1UM6L 5K9JH 4GKZA 1JF1B 4H0IA 3S5LB 3NACL 1D5MA 1H5BB 2JCCA 4LIQL 4L9LC 3MRFB 3EYSH 3HMWL 3EW3B 2EYRB 4D0DB 3DX9A 5HSFA 3UP1A 3WEXA 4K7FB 5HGDB 4OD1H 3WO4C 3S37H 1A7QH 2Q76B 3W9DB 3WBDA 4WEBH 4F80A 5HDQH 3V4UH 3MUHL 3BD4A 3GJFH 1AQKL 3JV4A 4NN5C 3EYOB 2BHZA 3WNNA 1MAML 5GISH 4GKNB 4J12A 1FDLL 3VCLB 1KJ3H 2P7TA 1S9XB 3QJHB 4MMXC 2GTWB 1T21B 3ARDA 1GZPA 2HVKA 3PDOB 2R2EB 4LP5A 5EN2B 4HCRA 5IEHA 4M7ZC 1I1FB 1XF4B 1UB5B 2CLRA 2NY0D 3MJ8A 4FFZL 5AZEH 3OMZA 5L8LB 4MJIA 4OQ1A 2ZOLA 5D7LA 5IM7B 1I1AA 2M2DA 4GG6A 4ENED 4R96B 4R0LB 4N8CL 3KPTA 1TLKA 5I1LB 1DUZB 5C09B 1LNUA 2FBOJ 2IWGA 1JPFA 3L9RA 1CGTA 3EDDA 4H0GA 1AGEA 3T0EB 3VGFA 3VWKB 1MI5E 4NQVA 2X44D 5IMLA 2X7LA 5F9WC 2CK2A 3OSKA 1NFDB 3OAYH 3TO2A 3WFZA 1M71B 3O9WA 1D6EB 3VFUB 1C5BL 3BKCL 2ZUWA 4YFLI 5L9DH 3SE8L 2PYEB 3O2VH 1IGJA 1F8TL 5KG9B 3LN5B 3KJ6H 2H32B 4M00A 3WNMA 1U8JA 4ZSOA 2K9UA 4F8TA 3D85B 4M48H 3QRGL 1RK0A 2SEBA 3BT2H 4Y16B 3T4YB 1XEDA 4LIQE 5GRUH 2IGFL 5DJXB 3VXMD 3C6LA 4XPAH 3BDXA 1FNHA 1S7QB 1YECL 3TJEL 4BSVA 5T5FL 1CDYA 4NO2A 3CGTA 4L1HA 3TBVB 4PJXA 2FH8A 5E00B 1IEAA 1L7TH 2OZ4A 4XP1L 2YA1A 2PXYD 1MLBA 4JKPL 1G6RB 1OTSC 2FEEL 3RWIB 4AG4H 4OZGF 2M8XA 4V1DB 3UZQA 4EI6B 2ITCA 1OAZH 1QSZA 4WV1A 3B8YA 2EEDA 5DQDL 4I18A 3OL2A 3S4SA 2IG2H 4OBRA 2FHBA 3QUYA 3SE3A 1RULL 2ATKA 3QDJD 1L0XA 2G60L 4QOKB 5HHMD 4PR5A 2RJMA 4EXKA 2CUMA 1AGDB 4TULL 2F53A 5D2LF 2O5XL 5EUOA 4M5ZL 3LMJL 4LLWA 5H94B 1MCRA 2PW2B 3KVQA 5MERA 3V6OE 3LEXB 5DUMH 5CBAA 5IVXB 4PJIE 5FGBA 2CIKA 1OT1A 3CLEH 3C60A 3VI3F 1NBQA 1D5ZB 1QKZL 1FRGL 2AKRB 1VKXB 1DUYA 4DZ8A 1K4CB 3QXAB 1U8OB 4LVOC 1DN0B 4JQVC 4LVHC 4X5XB 4L4VB 1JZ2A 2R1WA 3ZE2E 3BD5A 4PJAF 3ORJA 4MAYA 2MPAL 3BN3B 3VXQA 5DMKB 3EO0B 1RHHB 3INUL 4OLXL 1A1NB 1QBML 1U3HD 2BFVH 1W72B 1U8QA 1MY5A 4ODWA 5ICXA 1A9BB 2X1PA 4HBCL 3UPCA 4QNPE 4FFYH 3CC5A 2AV1B 4YDVB 1NKOA 1DQJB 1QZ1A 4IMLA 4LHJB 4Z7UE 5DWUH 5GGVH 5J89A 5D8JH 4AMKL 4WTZA 5EA0H 5C86A 1G9NC 4TVPE 5HDOA 5CEYA 3C6LD 3NZ8B 5T5NF 3F7VB 5FYJU 4W6XB 5CKGA 3RAJH 3Q6FB 3MCKB 5DO2C 1QP1A 3VFPA 4LKXA 1XR9A 2X4QB 1SY6L 1S9KC 4XNUH 1NUFA 2O5YL 4M43L 3X3FL 2B5IC 1YJDC 4M1CD 3NAAH 3D18B 3TA3B 1ZS8B 5L2JA 4JVWA 5F9DC 2GJZB 3TZVA 1QSFE 5ILTL 1GGIH 5C08D 4DZBA 1HIML 1V05A 4X7DC 5DEGA 3VJ6B 5I1GH 2A6IB 4MWFB 1BJMA 4MD4B 2HT2C 4P2OD 3RU8L 1ACYH 2DQTL 4RIRB 1IFHH 1VEPA 4NCDA 4H5SA 4CAGA 4Y16D 1ZLWH 5D7KD 2FJHB 4AEIL 2XOTA 2UZXB 4L9LB 3KPLA 4PJ5A 2BVPB 3LCYA 5DTFB 1A6VL 4PJEB 1FNSL 2ADJB 3NACH 2ZCHL 3PWNB 1UACH 4NQXB 4YGVA 3HRZB 3U0WL 4G9FE 4CKVX 5DZNA 2X09A 4KXZH 3E2HC 3TYFB 5EC2A 1MCEA 4WDIA 2NTFA 4Y19B 3QXUA 3SY0B 4QWWD 3SKMB 4PRHD 1BFOA 3GMLB 3V4UL 4H20L 1IAIM 4ZD3L 1OTUD 12E8H 3FQWA 4JO2H 3ZKMC 4A2MA 2H1PL 3PL6B 5I75B 3WFBL 4YHYB 4GRWH 2WZPD 43C9B 5GISL 5JOPD 3GSRA 1JGDA 5FO9B 4QRSA 1KJ3L 1S78D 1LDPL 4RMWA 2WWMD 4F7PB 5CKAA 1UM5L 3BP5B 1JN6A 1BD2A 5GS1B 4MAYD 4NM8L 4GW4B 3ZTJG 4APQD 1W72H 3QUXB 4KMLB 4GKSA 1CDCA 4HCRH 4UV4L 1BQHG 2ICEB 5HHQA 3FAXA 2EXWC 1U42A 2V2WA 4ZYKB 5GRZA 2Z31C 3DROA 4Q9BA 4G6AD 4P2QD 1VFAA 4PLNC 1EX0A 5DJ0B 1EAPB 4E41E 3MBEC 5T1DH 4KRNA 1IGFH 3UTPD 5I6XC 5E2UL 2BY2A 2P8MB 1P1ZA 4CVZB 4X4MA 1A1MB 32C2B 3ULUC 2AK4D 4TSBH 1CICD 2UWEB 3AMKA 4M1GL 3CX5K 5E9DA 4PJCB 5GRWA 3BEWB 1MHCA 3OKLB 3AS0A 2R0WL 1I9RL 2DQGH 3BKCH 3OKNB 4JZOA 2D7MA 1GC1L 1V3LA 4S0SD 4EBQH 3ZE1E 3JTTA 1WTLA 1SM3H 5F1NA 1RZIA 5BJTA 1MPAL 4GBXD 5F7UA 3OGCB 4YR6B 5IW3A 2NY2B 3QQNA 2LV4A 5ANMB 4PBVC 1MCHA 3T2NL 5F7EH 4ALAH 3QRGH 1U8LA 3ROLA 3DUSA 5GRUL 1ZVYA 1Z0NA 2AV7A 1MCKA 3ZLQC 4KK8C 2W1NA 5HYJA 3NPZB 2BVUA 1YECH 1D3CA 1HZHH 4XPBL 4ZFOA 4WGVB 2ICWJ 4R2GC 2P42B 1Q9WA 5I71B 3EJYC 4M7LL 5KN5B 1T83C 1L7TL 2BVOA 3E3QC 4IEFB 4EUPH 3C2AH 5DJ2A 4ELMB 2Y36H 3OKYA 4L3EE 1X7QB 4YIQA 3ILQC 5KVGH 2YUWA 4J23A 3VDBA 3C5ZA 1GPOH 3KLDA 3PV6B 1KYOJ 3VH8G 5ESVB 2UWEE 5IIEA 2WUCH 1GGYA 4L8SC 4OGZA 3HR5B 5INCB 3X13B 4JQXC 1JGEB 1KTKE 5E2VL 1UZ8A 2R4SL 1X5IA 1IAKA 1FH5L 4UINL 1QSVA 1Q9KB 2DM4A 2EKSB 2WSKA 3D48R 3DSFL 3DV4B 1HHKB 5SWSB 1F3RB 5HY9B 4V1DE 1XR8A 1FSKB 1OARH 2DQIL 2EDRA 1B0RA 2E8ZA 4O51A 4WHYH 3TVMC 1QLRA 3UTTA 5MHSD 4LHUD 4OQTH 4DOHB 3PGCB 1UVQA 4RMVA 1TJIH 4OZHF 5BS0B 3D69A 1FVEA 3I9GH 2VN4A 3PIQB 5LAXA 4DEPB 3IDMA 1KPVB 1R5IA 1KIRA 3BRFA 3CDGB 4Z7VE 1DEEB 1YNTA 1DQTA 3D3VB 2L7UA 4GRMA 3KXFD 3WHXB 2R23A 2VDOH 4PG9B 4P23C 5D2LA 4PJIB 3HPJB 4WFHE 1OHQA 4FXGB 4M6AA 5F7KC 3OKKA 3MRKB 4S1SH 2EDYA 1YEEL 3IB4A 4LSVH 4OZGE 3U9PH 2HJLB 2GUOB 1GC1C 3IDGA 4N0CC 3V5KA 5DSCB 1IKFH 1SYVA 5EO9B 3PP4H 1OGAD 2VZOA 3MRIA 5C8JB 5DD6A 2B7DT 1XGYL 1F58L 5HYEA 1RUPL 2FR4A 4JN2B 1DEDA 1CDBA 3BZFA 4PTUB 1N8ZB 1PD6A 4K94H 2QADC 3V7AG 2O93L 4JQIL 3QIUA 1H8NA 4NQSB 4X7CC 5I0DA 1ZV5A 5ILTH 2EDKA 2NY7L 5C92A 4U0QB 2VDQH 1A0QH 3ILPB 1OD7A 4OUUB 5IUSA 3ARGB 1HQ4B 1R6VA 5EU4B 5DUBB 1E4KC 1MELA 4IS6A 3U82B 1K6QL 1GOHA 3NTCL 5JPNB 1S7XB 5DC0A 2W9DH 3HNVL 5FV2A 3LPWA 3ARXA 2AJXH 3NIFF 4K8RH 4X7FC 3VWKC 4V2CB 1N6QL 3CH8A 5K9KA 4X99A 3GK8L 3RWEA 4J3WA 3U0WH 1F90H 5FYKU 3QEQE 4OZIF 5TE7H 5C0BD 3S3JA 3L3KB 5MENB 5IROA 3HLAB 2QR0B 2GSGB 4P46A 3HUJA 3D2UD 5BV7B 3SDXE 3PL6C 4XBGB 4KH2A 4JM4H 1HSBA 2A73B 5FOBB 2X05A 2DM7A 2AXGA 4TQEL 5EBLA 4P5MA 4HDIA 2OTWA 4CJ1A 1U9KA 3C6SA 1GXEA 4J2XA 3U1SH 4GAFB 2A9ML 1WFUA 3H7BA 4LRIC 4OLEA 4BUGA 4GMTL 3LB6C 3J8F7 4P46C 5FIEA 4ZS6C 3B9KA 1J8HA 1UM5H 3B9EA 3QDHA 4PRDB 4ZFGL 4Y5VA 3A67H 4I1NB 5TPWH 1QLEL 5HYSB 4G43A 4PJEF 3MNZA 3BRDA 1U8MB 2NX5B 5JIHA 1JE6A 1JBJA 2R0LH 3MV7D 2VITB 1QRNB 2XTLA 3OXSB 1DLHB 4LLYB 2EYTA 3TVMD 2YD6A 3V6ZB 4B50A 1ZXQA 4AEHL 4NQCA 1RUQH 8CGTA 2AERT 5I18L 3ZYIA 3RIFF 1WQVT 4JFFB 5T1DL 2DWEB 1BQLL 3HI1A 3PV7A 4H25B 4QRTB 4AEEA 3CFBA 3UXFA 3G6AB 3RDTB 5I1IL 3WLBA 8FABB 3UX9B 5LGHH 2BSTB 1NGXA 3V8OA 2AJUH 4MNQE 4J4PC 2A1WH 4M6OH 4LLAA 2DTML 3IU3B 5BCAA 3BDYL 2CGRH 4GXVH 4OGYL 5BV7C 1GC1H 3VDAA 5TH2B 4KQ3H 2A9NL 4HH8A 4P5TD 1H3PH 1X5YA 4A6YA 3X14B 5DS8B 3D5OF 3RFZC 4LVNB 3LRSB 3O8XC 3CK0L 2AEPL 4F33A 4IRSA 4WU7B 1CXLA 1FNEB 5I76A 2UUDH 1V7NH 1MCDA 3GI9H 4D0BB 2E6QA 5EBWA 1BJ8A 3VWJD 4P57B 3H9SE 1MRFL 3C5SA 4NZTL 4DVBA 1IGTA 4Z9KB 3TO4A 2AI0H 1JMXA 5DMGC 4NFBA 3O4LE 4RAHA 3CD4A 5EO0A 3VXRB 5B4MC 4Z7NF 1MI5B 2APVA 5JR1H 5MEOB 1UQSA 3WS6A 4D9LH 1KXTB 3EZJB 3O8XA 2J7LA 2G5RA 3OAUH 4CDGC 1T22B 2CRYA 2X70A 3E6FA 4OZFA 3HS0A 4X6BB 3QCVL 3A6CL 3LKOA 1JGUH 3LKNB 4QT5B 3IAGC 3HA0A 3KPQB 1T7WA 2KQMA 2YPLB 3QDJB 1B0GA 1OTTD 2QQQA 2R1XA 4ONOA 4OBSA 1Z2KA 2QKIA 3P4NB 4J8RA 2HJKA 1JYNA 3BE1H 5CGYC 5ACZA 4S0TD 3WIHL 3W2DL 1AJ7L 1B3JA 4AENA 1F6LL 4Q58C 1AHWC 3I02A 4G8GA 3MV8D 1E6JL 3WKML 4LHUG 1DQQA 1EUUA 2LU4A 1G0DA 5GS0H 4YDIH 3U46B 4I4WB 2HKFH 2Z35B 4DN4L 2OJZH 3WE6B 3LQZA 1YY8B 3FQXB 4K3GA 1T2JA 3VG0L 5BZWA 3JTSA 2D03L 5DRXA 3QPXL 3E6HA 1YMHA 1A6AA 2DOCA 1FCCA 1A7NH 3VFOA 2G2RA 5I0ZA 5LG1A 4HKZB 5C09D 3F6IA 5JXAH 4LQ1A 1JPSL 4UT6H 1FV1B 1XMWA 5DC4B 3FOMB 3DPBA 5KW9H 1ZT4B 1U8HA 4MDIA 2HLFC 4Z18A 4AIZB 5ABDE 5HJ3B 3ZDZE 1ORSB 2FD6H 2IPTH 1T5XB 5I15H 2B4CC 2J12B 1LO0H 4LCCC 5IFJA 2EO9A 5JNYA 1DSFH 1CL7I 3WL9A 1N5YH 3FRPA 4HAGA 2FYYA 3VG9C 2P45B 2K1MA 3VXUA 2VUOA 1INQB 2BDNH 2FX9L 3UTSA 5CEZD 3OX8A 3IJYA 4WHTB 4NN7C 4NQEE 3ARDD 2VDPH 3M17B 1MQKH 5JA9A 4JFOA 4EOWL 4JJ5A 2VDQL 2V2TB 5BRZE 4FXLA 4C56B 3HE7C 5IW6B 3UYPA 1EVTC 3SKJL 1SJHB 3BQUC 1NC2A 2ESVE 5BS0D 1SJEA 3MCLH 2W9DL 5T1LB 5GS0D 4QRRD 4LHUB 4HC1A 4LAQL 4OD2A 3HG1E 3BHBB 4WENB 5BQ7A 5TE7L 3FFCB 5D1QA 1G9EA 1I7TA 4PJXF 3SCMA 3U7AA 2F53E 4LCWA 1OP3H 4Y5XB 1X5LA 4MNGE 2ZOKA 4JM4L 3P9LA 1VERA 4M6MH 5I17A 4JRYE 1H9VA 3Q1SH 1OWRM 4X5WB 4Z0XB 3RX5A 2ESVD 1RHFA 1N3NB 3AM8A 3UTOA 4FFVC 2Q86B 1JUFA 1S8DB 2M26A 4NQCE 5E2WL 1OAUH 1WV7T 3SDCD 3PWUB 5B3JE 1BECA 5HYIA 1UADC 2JELL 5E4EB 3BKJL 4OKVA 1P7QB 1KTLA 5D2NE 1KFAH 1N6VA 1CN4A 4PRHA 3GUTA 3NFPB 1LE9A 2NY1C 4ZAKC 3BH9A 2Z93A 5GRJH 4YHNB 4G9DA 4CGTA 4CMMB 3VGEA 3VXMA 4JFDD 1ZK9A 5IVZB 3UYRL 3WFCL 4XVJL 1U92B 3S36L 4M7KH 4JG1H 5ICZB 3BWAB 4AEHH 3W9EA 5LKNA 3RVWC 2OTUA 3WUWG 1ZGLA 4RNRB 4ZUWB 5BVJB 3OKEB 1F42A 4O5LH 3GO1L 5I75C 5MEPA 3EHBC 5ERWA 5E2TH 3LY6A 3WS3B 4LOUD 3B4NA 3MRGA 2F74A 3SDYH 2F54E 1U91A 2VDRL 3C09B 4F7MB 2IH3B 1FIGL 1G7QB 1LD9A 1NLBH 3BDYH 1TPXC 1DBBH 1MJJB 3FN3A 4HUMB 2OXHA 2DQJL 2P47B 5ALBH 3RY4A 1VACB 4WRLA 1L0YA 3H9SA 3ZZ1A 4N1EA 3QH3A 2DBLH 3TBYB 1MFCH 3EO9L 4PLJC 1GL4B 1YN7A 3OR7A 4M7JL 2XQBH 3RJDA 5LGKA 2EDEA 1SJXA 1OP5H 3MUZ1 5F7DB 4JPWL 2AEPH 5GZND 5LCVL 4KVCH 2DDQH 1KCVL 3SDAA 2HTLC 3F5WB 5C0FB 4PJ5E 3RWJB 4YHMH 5TQ2L 4FXKB 4OLWH 1L9NA 1MRFH 4PRPE 1OL0A 3V6BR 1A3RH 2EEBA 5EZJA 5KVFL 3QIBC 4ZOBA 1TCRB 4P2RA 5D93C 1OGAE 3SDXA 4U1IB 2VLME 1HILB 3WHE0 1N64L 3H42L 3ISWA 2OSLB 3NGBC 3K8MA 4HS3A 5KVDL 3QXWA 4PJDB 4RBPH 2BHUA 5J06A 2IANB 2ATPA 2H3NA 3PQYD 1LEKA 4R0LC 5IMMA 3QCVH 1RIVL 4I8DA 4MSWB 1TQBB 1JGUL 1LHZA 3MBXL 3NFNB 2YPVH 5B8CA 1CU4H 4PRPB 3L5XL 3LDBB 3W0WE 3DV6A 5DA4A 4YNYA 3HR6A 3RZCB 3ZL4H 6FABH 5GGQH 1BVKA 3L7FB 5MHSE 3BE1L 5C0IA 4KKCC 4JHBA 4Z76B 1BVZA 1CLYH 1E27A 1SBSL 3QIWD 1YZZA 2QHLA 4FMKA 3CU1A 4ODVH 5IT2H 2HYMA 5HHXL 1CTNA 5D1QC 3QHFL 4QGTA 4OFPA 4OF0A 1C8PA 1CFTB 2QHRL 4H1LB 1DBAH 4ELKB 4PRID 5DQJB 4AT6B 4KI5D 3QO0A 2EDJA 2D03H 1G7IA 7FABL 3KYKH 2GJ6B 5I1JL 4HKBB 2JJUA 2IPKB 1GZQB 3HMXA 5ADPH 3GMNA 1ES0B 4TUOA 4OJFH 3WUZA 1AE6H 5AUMA 3WUWA 5GSVB 4MNQD 2HH0H 4LCCA 2NYYD 2WBKA 2QSCL 5KSVA 4TPRH 5IHZA 2XWJB 5CWSB 3L5WB 5BZDA 5EU7E 2BY3A 1FGVH 2K7PA 3WFDL 4Y4HD 1P4LB 2FJGA 1F4HA 4ODTL 2C4FT 4C83A 2PTVA 3O3DB 1RD6A 4GRLA 5GGSA 5HHOD 1KF9B 3PHQA 3ARED 1ZMYA 1A3QA 4NRZA 1AO7A 3MLZL 1RJLA 1CE1H 1IAII 4XCCL 2BNUB 3UTZB 3A6BH 3FKUS 2BDNL 3TPUB 4JO4H 4RGOL 1FNGB 4YXHH 4ODHL 4HK0B 1U2CA 1TETL 5MP6H 3G6DL 3O6FC 4KJWD 1EHLL 3UO1H 4MD0B 4XWGL 4FG6C 2VDKH 2VAJA 4PJ9C 2KDGA 5I9QB 5D7IF 3DO7A 4BZ1L 4CVUA 3GIZL 2XKNB 4QY8A 3DX6A 2OMBA 5AYUL 1TZHA 3MRPB 3SKJH 3CFJB 4K8RC 4XPTL 3GDBA 1AD9A 2Y1VA 3FT4A 2DI8A 4MHHG 4XB7A 1AGFA 1AGBB 3TZVC 3QWRA 1BHGA 4LAQH 4R9HA 5ETUA 1DTUA 1M05B 1YEFH 3RUGB 2BX5A 3HZMB 1NDGA 2X4PB 1HH9A 1NANH 3JSSA 2VN7A 3PNWB 2ARJQ 4XZUB 1PDKA 3QIBD 3TT3H 4LKCB 1LEIB 2VIRB 4QF1A 4LCUA 4P2QE 1FFOA 1HHGA 5A16B 3B9AA 4P2RE 1MFEH 2X5PA 3DVGB 4LLMB 4NOFA 5CIPB 4BSWB 4IJ3B 2YEZA 1RJYA 3B5TA 4P4RA 4QF1B 1MCIA 4MQ7B 1FE8H 2F9BT 3EYQC 3PNWA 4QHMB 5E8PA 4ERSH 1N2RA 3HE6D 2ZJSL 4WUKL 5HYJE 1HH9B 4YX2L 3ARGC 1KIUA 2QLVB 3D2UA 1TTGA 1AGBA 3FRPG 4UTAH 5EBGA 5KANI 1AD9B 1UFUA 4K3JH 1ZLUH 3ULUL 4MCYA 1QSEE 3K0WA 5IR1A 1NQBA 2C4XA 2GI7A 4NKDA 3S36H 4GS7C 4MD0A 4ENEC 1QFPA 1T1WA 1MCCA 2WBJC 1FNGA 2PTTB 2H6PA 4LDLB 2FLBT 1CT8B 2ARJB 2H2PD 1PQZB 1FVDB 2Z4QB 3V6OA 1KJMA 5CP3A 3ZDZF 4F7TA 1VADA 4I18C 1A9EB 3RWHB 5T33L 4NNPL 3SE9L 5GGSB 5DO2D 3ETBF 5F1KC 3L3GB 3KYOB 5C07B 4IRSC 3TH4T 3H7LA 2XXCB 3K1DA 2IAMC 1P4LA 4GLRH 1T0NA 5CLWA 4N0FA 2BNQD 4C55A 1YPZE 5BZDB 3L5WA 4GBXA 3VWJA 3SO3B 5KSVB 4MD5B 3E3QE 4MQXD 3FO2B 4KK5D 3FRUB 5IV2B 4WW1B 4X4YB 5LXGL 2AXFB 2PCPB 2VQ1B 2E6PA 3KS0J 4XH2B 3FCTA 4KVCL 2CR3A 3GHBH 1G7IB 3VFVA 3H9HA 2AABH 4ELKA 4RQQB 3GBLA 4KUCD 2VLKE 4RGMB 4D3CL 4ELME 4YHKL 5SV3A 1A3RL 3I6KB 3LN9A 4ZXBA 4GMSL 1P9MA 2W0FA 1A7PH 1I3UA 5HYSG 2PO6B 4U1NB 2LABA 1RZKC 3TH2T 4Z76A 4ZO6A 5BRZB 2JF1A 3ZYOA 1A6UL 3GIVB 1A1OA 1T03L 2R2HA 1AH1A 1KACB 3DV6B 4ODUA 4K8RD 4MB3A 3KDMA 1OWWA 5A3IC 5C9JA 5K9OA 5GGSY 5T3ZD 2GTZA 3BPNB 5DVKA 2YPVL 1I1RA 2CMRH 3FAWA 1A6WH 4XBEL 2C3WA 4PREA 3KXFA 2FBJH 5C0CA 4MAUH 1MRCH 2X4UA 2BNRA 3OKOA 3RWFA 1WC7A 3IDNB 3DI3B 1NGYA 1JK8A 3KYNA 1K8IA 2E5EA 1FZKB 3SDXB 5C6WH 2YOCA 1CLYL 3W39B 3ZDYF 4JM2C 4OFYA 4X8JB 5EZJB 4M62H 1FORH 5E5UB 2YMXL 2KBGA 4IRJC 4FXKA 3QHFH 1XCTB 1BJ1H 5E08L 1AKJD 3D39A 3RWJA 5T3XE 3P0GB 3W0WB 3OKDB 3MNVB 3OF6D 2LE9A 5EPMB 4IDLA 2VLRB 3S97C 4MA1B 1FVCB 1OLLA 1OPGL 3UZVB 5KVEH 4LCYA 3GGWA 2AJYH 3GI8H 4R8WL 4LSUL 3G5XB 3O6LL 4Y4KD 5DFWH 1ZSDA 2AK4E 2VXVL 5E70A 5GGRY 1LWRA 3QH3B 4D2NA 1CGVA 3W0WD 1I4FB 2XN9E 1AKJB 4EIZC 1C1EH 1LD9B 2F8OA 4ODTH 3PGDA 3FFCD 2BP3A 3D9AH 4KY1L 2X4SA 2F74B 3WS3A 4QCIB 2JE8A 4CU8A 3G04B 3VGDA 4HH9A 4M1DL 2NX5E 1M7XA 4J4PA 3OWEA 1CLOL 2D9QB 2ZSVB 3QUXD 4LSSL 4RNRA 4ZUWA 2Y4SA 5B22A 5BVJA 3UTSE 3MRLA 1JI2A 3A6BL 3B9KD 3LIZH 4JPIB 4RGOH 3W9EB 3MRBB 2YUVA 5ICZA 5MEQB 2CLZB 4K9EL 3BPOB 1BD2E 5CZVH 5DEFB 3K4AA 2DQFA 4PJEE 5IVZA 4BM7A 1XT5A 1YMMD 1BLNA 1PG7L 4KDTA 4KU1A 3BH9B 4R7DA 4KZEL 4MQSB 1IAOB 4F2MA 3LS5H 4P9HH 3NFPA 4PRHB 3GUTB 1WZ1H 3G6JE 2NLJB 5EUOF 1E4XI 4OCNC 2DQFB 4OKVB 3SCMD 5HYFA 5DEFA 1LVEA 1EGJL 1I75A 4ODSL 2JTDA 3W81A 1J11A 3ARYA 1TQCC 4KK9C 1A4KB 2AP2A 5JHLL 1I9JL 5FCUH 4JO1L 2EH8H 3ARFB 5GQBA 4HBQA 3UROR 5A40E 2ZOKB 4OCWL 43CAA 4QCIA 5EOQH 4JFZL 1ZLSH 1RVFH 4U6TA 2CDEA 3OHXB 4TTDD 1NCTA 4POZC 4JRXE 2B1HL 5D1QB 5J12C 3GBNH 1G1CA 5A3ID 3W5MA 2X9YA 1AKJA 3D39D 4OD2B 1ULVA 5LBSH 1OSPH 4L3AA 1ZSDB 4S1DD 4XX1G 5E6ID 4KKBC 4GS7B 4HMDA 2WQ8A 4HUVA 4NKIH 5C9KA 4WTZG 3IFLL 2V2TA 5JW5A 1HKFA 5EPMA 3DETC 1J0HA 4M8QA 3VWKD 2EZ0C 3IJYB 4WHTA 5EH1A 5BMFL 2J8UA 5KTEL 3I6LE 3T3PE 4KGLA 2UUDK 1EBPA 1UWXH 2FYYB 4QGYA 4BH7A 1K3IA 1J5OH 5J8OA 3WL9B 1LK3H 5DK3A 3S34H 3KYNB 1NGYB 4HIJB 5IG7B 1Z9LA 4N0UE 1B4RA 5HJ3A 1HNGA 3NFSH 1BQHB 1U8HB 3H9SD 3RWFB 3OKOB 2BNRB 3EFDL 4PJFE 4NHCL 2X4UB 4PREB 4JKKA 3LB6D 1FV1A 4G6KH 2COQA 5F1OB 1A7RL 1MFBH 1LE5B 5JIIA 4Y2DA 5D93B 5IFAH 3QFDA 3RGVD 4HKZA 1W0WB 5C0AD 3NZHL 5C9JB 5K9OB 4LLVA 4JFQB 3HG1D 2CKNA 3KDMB 4Z7WF 2IMNA 4K7PX 1X3DA 1I7ZB 1RUAL 3U36A 3E6HB 4JN1H 3FFDA 2MKWA 1KTRL 5DD1H 3VD7A 1DBMH 1BJ1J 1TVDA 2VZ1A 4ONHA 1ZA6A 4FP8H 5GXBB 4IMKA 4U1NA 2PO6A 4L29A 3P9WB 1I8IB 3GFUA 1ZEAL 4NNXB 4O00A 3I6KA 1N0LA 3OJDB 1F4XL 2Z8SA 1BIHA 5AZ2H 3KHQA 3HZVA 3SE4A 3V4VH 2CSPA 4XI5D 5DFVC 5GGUB 4RQQA 5FYJE 4K07A 1MF2H 2QKIB 3VFVB 5D2LE 2L4OA 1B0GB 2R1XB 3G5ZA 3FCTB 1CIDA 1CFSB 4XH2A 1FNAA 4JLRA 2VQ1A 3HI5L 3ZT6A 1KIQA 2MFNA 4X4YA 4WW1A 1IILE 5IVNA 4CW1B 3FRUA 5IV2A 3LKOB 1ZWIB