3ZHDA

The crystal structure of single domain antibody 8-4 scaffold.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MG8-4 SCAFFOLD ANTIBODY
publication title Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zhdA00
1LILA 1DE4A 1NEUA 5GS3A 4OZHB 4U1GB 3TIDB 2DI8A 3O81A 3LKRB 3B5GA 1FH5L 4X7TB 3T4AB 4X80L 3VWKB 1L7TL 2E9BA 4QHMB 4PY7A 1WQVT 5DFWH 3WN5B 2UVFA 3VXPB 3JVGA 5T3ZE 5C0DB 1FAIH 1R5VA 5E7FA 2UV3A 3CK0H 2G75B 2R0KH 3HS0A 2OZ4H 3GKWL 4EQ3A 3G6JE 4XNQB 3QNYA 1J86A 2V7HB 4G6FD 3WE6A 1KTRL 4O9HL 4WW2A 1AJ7L 2WBJD 4Z7OE 5EOQH 1TPXB 3MZTA 4ACPA 4YDVA 1BVLA 3WFHB 3T4YA 4AMKL 4U1MA 3ARFC 3PXJA 3LQAC 3X14A 5DVMA 5C08A 2VISB 4UOJA 1RJLA 4POZD 1OP3H 5E2UH 2KBGA 2HFEA 1NBVH 4LSPH 5F3BB 3GMOA 2ZWLT 3RTQB 2WMPA 5I8EB 3P4OB 1UA6L 2B7DT 1M71B 1S7UB 4LRIC 1VFBA 2I07A 4X9BA 2VLLA 3DX6A 2VDKH 5KN5B 5ICYA 3QCUL 3QUXD 4H20L 1U8OB 4N8VG 1NL0H 3IU3B 1ZLUK 4JKPL 1QTYT 3EYUL 1S7TB 5GISL 5GQBA 4LSVL 4YBQC 1A9BA 1CLZL 2O93L 4RMWA 5EN2B 4X4XA 5F7HA 2IGFH 5HHPA 1TJGH 3MCKA 5CUSH 2P43B 3LIZL 2DWDA 5I1KH 3ES6A 3E8UH 1WC7B 1P6FA 3QIUB 3PWPE 5JDJA 3ALPA 1P7HL 5F89A 1BGXH 2XZCH 4U1KB 5TE7H 2EYTB 3UX9B 3OKNA 5BQ7B 3TH4T 2BNQB 4ZQKA 5FO9B 3CH1A 4LQ1A 4RFOL 1UYWL 2A9NH 3PP4H 5IROC 4KMTL 4HT1H 4XPGL 5ISZE 3HI1B 2APFA 3MRJA 5KTEL 2AQ2A 2CJUH 1HHKA 3SDDA 4Z76B 3U1SL 4DJMA 5I1JL 1DQTA 5DMGD 1SMAA 4FABH 4WI2A 2DQIL 1JP5A 3R4DA 1FFNB 4YC2C 2ZUTA 5JIHA 3Q5TA 5BJTB 5IK3A 5CGTA 1QYGL 5GRJL 4DFHA 1JZ6A 2A1WL 4OUUA 1RK1B 1IQWH 4I0PD 3ZT5A 4JO4H 1MFDL 1H8OA 4O2FA 3TF7C 5ADPH 4J6RL 3GM0A 3V5DB 3MGOA 3KLHD 4DN4H 2V6HA 3OPZL 5C86A 2D7TH 3G5VB 5B3NA 3UTSA 3ZT6A 1OTUC 1GGUA 4ZS7L 3VWJA 3LD8C 3QCVH 3GB7A 5EC2B 3TGXA 5DTFA 1MLCA 2QSTA 3JVGC 3D9AL 4JFDB 1NMAL 2DI7A 3FJTA 2ARJQ 5DMIL 1QFUH 4IBLT 5EU5B 2ZUYA 4NBZB 5F9WC 2DM4A 1FIGL 2ENYA 3L3IB 5JOFA 5GRYA 1BVKB 4MA7H 2CK2A 3QP3A 2AJ3A 4XVJH 3OZ9L 5DJCA 1A6ZB 2LAAA 5CSBA 3QXWA 1JZ4A 4PJHA 2YA1A 4YXKH 2DQCH 5E2TL 4PRPA 2QQLH 5DGQA 1NGQH 1FZKB 3RZWA 5MERA 1GGIH 3HKFA 1NEZA 2AXHA 2V2TA 1LO5B 3V7AG 1C16A 5HGGS 4JZOA 2VLKA 1P7QD 5GS1B 5IV2B 5DDHA 3REVA 4HG4J 2IBBA 1H3XA 3CDGB 5DRWA 4YHYC 2Z31D 1L6XA 5DQJB 4KRPD 1IM9B 2YKLH 4OKVA 1I8LA 4FMFA 4KK5D 4ZUTA 3RI5K 3ZYJA 3V6OC 4O51A 2VAJA 4S1DD 2C3VB 3GMLB 5LAXB 4PG2A 4Q58C 4XH2A 1TJIL 3U7WL 2HAZA 5CHNA 5GRZA 1NAKL 1XGUB 5D93B 3B2VH 5DI8B 2ED9A 1NUDA 1FCCA 1N59B 4LPVA 3MV8D 1GZQA 3NH7H 5ITFA 2IAMC 2EEBA 3OV6A 2QR0B 1L6ZA 1K5NA 3KS0H 3L3JB 5F8QC 1Q0YL 4WEMB 4PRHB 5IF0B 4BFGA 1FGVL 2ZNXA 1LP9E 4MZ2A 3EYFB 3FOLA 1JRHL 2BX5A 3L1OH 5KS9B 1UFUA 1A1MB 1N6UA 3BPNC 4HXBL 1U58B 2A77H 5A2KH 3H3KA 4XC1L 2EDJA 2C3HA 5HHNB 3ARGA 1G9MH 3SDDC 3B6SA 4Y4FA 1FG9C 2VLME 5EBWB 1LVEA 1FNFA 3UPAA 4U4BA 5F7YC 3ZHLA 4MCYB 3LPWA 1ES0A 1Q9OA 4YX2L 5IWLA 1EEQA 3BPOC 4HUWB 2P5EE 5LCVL 1RFDL 5T1LB 3G9VA 4LDLB 4U1IB 5CEZD 1HI6A 1EFXA 4G8GD 4YK4C 4YBHA 5DFTA 1RZ8A 1FC1A 1N5AB 4OI9A 4XNZC 4X8JB 2DQFB 3L3OA 5E8DL 3S5LA 3QXTA 3NFPA 4MWFA 3NCYS 4XCFL 3KPOB 4R97C 1AC0A 3B9DA 3CXDL 3VWJC 5IR1B 2PR4L 1RJZA 3AXLB 3UJIL 1WAAF 1DQDH 3LS4L 4FQHA 2CKBB 1HOCA 3ARDD 5HYQB 1U8KA 5ESQB 4UQ2B 1ZTXH 1R6VA 5FUCC 1JHKL 1RURH 2E6QA 3KLSA 1MELA 4OKDA 3V7MA 1T03L 3OKLB 5IJKA 1OAZL 5CEZH 1ZEAH 1D5XB 3P77A 4NKQB 2P5WE 3DTXB 1UWGH 2CDEB 4Y4HD 4MZ3A 2BVEA 1QA9B 2J7LA 3FO1B 4OCSL 3GSOB 3S36H 3VI3E 2ARWA 4D0DA 5HHOA 4MA8L 4Y1AD 1MI5A 4LLWB 1RVFH 5I1IL 4G6FB 3L3GB 1P7KA 4LVHB 2IG2L 3FQNA 3V2AR 4MNQE 1M05A 3T77B 1BMGA 2OR7A 1I75A 4N0UA 2ATKA 1A1OB 4X6EB 5FK9B 1J0IA 1G1YA 2BNRA 1MJJB 1JWUA 4NO5A 1QFHA 2FX7H 3KHOA 5IGXH 1I8LC 3FT2A 1AQDB 3MNZA 2E27L 4KJPD 4I48B 1ZWIA 3NCJL 3C2SA 5HGBA 1CDUA 3QG6B 3CX5K 1MFBL 4QYOA 4U1HA 1JPST 3QULB 5D7IA 4JPKH 1RHFA 1RK0A 4HUKB 4PG2C 4GXUM 5KS9F 1W0WA 3F7VA 4J3TA 1NBYA 4O4YL 1YEFL 1L7IL 5DHXB 5B21A 5HHQA 2X89A 3QUXB 1F6AA 4O2EA 4HFWA 4GO6B 2FO4A 4L4VA 2MKWA 1CD1A 3THML 5JW5A 4JZJA 3GSVB 5J3HC 2BVQA 3O4OB 1JGDB 3LAFA 1WGOA 3G5XB 1ADQL 1AIFA 3BKMH 5D1QA 3MV11 1K2DA 1OP5K 1KULA 4RDQG 2HKHL 5E56A 1Z9OA 4HWEH 2QSVA 1CQYA 2BSSA 3DIFA 1S9XA 3C5SA 4B7LA 3VG9C 1I3GL 4LEXH 4OSUH 3UTPD 1BQHA 4Q0XH 3MRIA 3ARGC 2IWGA 3DGCR 5EU3B 5INDB 3HR6A 3BH8A 4RWHA 4OBRA 2VZVA 3F7YB 5C09E 1UQSB 3O2WL 4I4WA 1ZLVK 3DYOA 3SKUD 3C5ZD 4PGJA 1QSFD 1MUJA 4MD5A 2R0ZH 1RUAH 2GJ6D 2W07A 4HC1L 2D31B 4KK8C 5IWLC 1DJSA 3CLFL 3IETB 4PJ7A 3PWNA 3WO4C 2B4CL 5CGYC 1CVSC 4GFTB 4IRSA 5JHDE 5I18L 4LNVA 5HI4C 5KBNC 5MEOA 3OAZH 4KTDL 5D70L 2I9TB 3MYZA 5DHVH 3JV6B 4Y5VA 4CVXA 2W1NA 4M7JH 4HEPG 1NLBL 4JVWA 1RMFH 3QJFA 5FYLH 4I0PB 1PYWA 4UI2A 4NN7B 3NTCL 5J11B 4QXTB 3V95A 3WIIH 1I9IL 1JGLL 2FHFA 4QEGA 1EXUB 2FIKA 4JRYD 1CIDA 4KK6C 3MUGA 3KVQA 4WGWB 1KIPB 1FPTL 3K80A 4L5FL 5KVDL 2MNUA 3RVVD 2JK5A 4HWNA 2F8OA 3BIKB 4I3SH 3IGAB 1S9VB 5I1GH 4HKBA 1DANU 2B5IB 2BOBB 4PRDB 4G9DA 1ETZA 4TSAH 2LTQC 5JLZB 3UYRH 1NJ9A 1Q9WA 4PJEE 2DQGH 4ENEC 5SWZE 3T0WA 4Q2ZA 1OSZB 1A6WH 2P8PB 5E6YA 2XQYK 4DGYH 4OZHA 5F70A 2R29H 3TFKD 2APVA 3TIDA 2X1XR 4HJ0C 2HP4A 3LKRA 1A7PL 3DBXB 4X7TA 3T4AA 5T3XD 1GOGA 2UWEE 1X6NA 1NMBH 3OR7B 5EORH 3VWKA 5GGVH 2NY4D 2VN4A 1U2CA 2W59A 3WN5A 3OB0K 3VXPA 1P7QB 4PJDF 3VW3L 5TJWK 4U33A 1CFVH 2VXQH 2CLZB 2B0SL 1A7OH 4XNQA 2M2DA 2Z31B 4RGMB 5KSUB 4KRPB 1X5YA 3EOAA 1IC5H 2BXYA 3C09C 3RGVA 1FLRH 2YS4A 4XMPL 1J1PH 3FN0L 3EJYC 5C6TH 3WFHA 1QQDB 2X05A 1PQZB 3D3VE 4HGWB 3CLEL 2H2PC 2VZ1A 2VISA 4NQVB 5ALBH 1S9YB 4JZJC 2PYFB 1A6UH 4GAJL 4MD4B 3HTLX 5FUOH 5F3BA 5LGJB 4NFDA 4DTGH 3MV8B 1JPFB 3RTQA 3SGDH 4HS3B 5I8EA 2EIZB 2ERJB 1MCWW 3P4OA 2VRAA 1QNZH 1A3RH 1S7UA 2ED8A 3BH9A 1ZVYA 3RDTC 4LPWA 4LAJH 5L8JB 4MNHB 5JXAL 4IIQB 2OR8A 2ZG2A 1U8OA 2DKUA 3IU3A 5CJQH 5MEQB 2J6EL 3PIQA 5D2NB 5AUMB 2ZUUA 1S8DB 4ONFH 5EN2A 4NNPH 3BFOA 3ZKND 2Y07H 4OFVA 1OW0A 2NYYD 3EDJA 3EYVA 4V2CB 3DVGB 3S4SG 1ADQA 4IRSC 1JTOA 1HIMH 1AR1D 4NQDD 4U1KA 1KJ3L 2EYTA 3AAZB 1JYNA 1FAIL 5BQ7A 5HXMA 4N8VB 2RAMA 1KBGH 2BNQA 2B1AL 2R0KL 5FO9A 3TPUB 3CX2A 4MMXC 3VXTB 5LKNA 5IMOA 3X3GH 4YEFA 4PGBB 3U9UB 3OKOB 4ALAH 4Z78B 1G7LB 3TJEH 3HI1A 3ESUF 4BK5A 5C2BH 1UACL 3PGFL 4AZ8A 2VNCA 1AE6L 4Z7NF 4YR6B 2CKBL 5JTWA 4RFNC 1OT1A 4HC1A 1GGBH 4JLRB 2IAND 2AJZB 1FFNA 3LZFH 5F96H 4P2QE 5BJTA 1RULH 3OXSB 3NFSL 3QQ3B 3QI9B 3O0RH 4A2MA 1ZGLM 3HN3A 2YUWA 4OCLC 4OLYL 1J0ZA 3DARA 1WZLA 4JVUA 4Y4HB 4PJFA 4U1GC 3AB0B 3V5DA 4M5YL 2VDKL 4Y1AB 5L2KD 4KZDL 5DK0B 3G5VA 2A6KB 4HCRH 3S7GA 4AEIH 1VFMA 1FNGB 1IEAB 4JFDA 2Z92B 4ZFFB 1YN7B 2L4OA 5CWSB 5DRZB 1DQQA 3AC0A 4HAFA 5AZ2H 5CUSL 5EU5A 5I1KL 4X7DC 4BFEA 5HHXL 1DBBH 5JQ6L 1SQ2N 1BVKA 3RGVC 4HBCH 1FGNH 1W72B 3F58L 4XWGL 1WEJH 4Z8FH 2R2CA 1F3RB 2XZCL 1FZKA 5HI5C 3OGOE 1TTGA 4XP5H 1LO5A 4PTTB 1FC2D 1F8TH 1P6AB 5IFHH 4EKXA 1WAAA 4MLSA 2R1XB 4FXKB 3WFCL 3EDEA 3CDGA 5B38G 4WV1A 5DQJA 1FN4B 3RTQC 3MFGB 2CJUL 2PXYC 5C0CD 3DETD 1J7VR 1IM9A 2F58H 2VE6A 4HHAB 1UVQB 1IVLA 2C3VA 3GMLA 5LAXA 3U7YL 2R15A 4Z9KB 1G7PA 3WIHL 3TWCH 1KYOJ 3VRIB 4LOUC 1P1ZB 1IQWL 1N0XL 4W4NA 5ESAB 2JTDA 2VYRE 1I3RB 5DI8A 3V6ZA 3AM8C 1N59A 1OW0C 1S7WB 1B2WL 5F1IA 1NANI 2E7HA 4OCYH 5E2JA 3TYFB 1IGIH 2LFGA 5DR5H 1YY8B 4OFYA 2QR0A 3C5ZB 1QSFB 1BREA 2AS5M 4M7LH 2GJ6B 3L3JA 1N6QH 3QZWB 3MLVL 5L2JB 5IF0A 2EC9T 4HJGB 2X4UB 1KGCE 1W8NA 3EYFA 1J0HA 1QFUL 1SBBA 1A1MA 1U58A 2LU4A 2XKUA 5DF0A 5HHNA 4PJBB 2J6EA 4LLAA 5CKGA 4N1CA 1AXSB 2JB6B 5EZIH 4YXKL 1XT5A 5EBWA 4OLWL 4NZTH 2QQLL 4MCYA 1LGVA 4WI5A 2BSED 1GGIL 4JQXC 3OJMB 4HUWA 4JRYB 1DL7H 3QUMB 2G9HB 3N1QC 5T1LA 4U1IA 2X4QB 1MIMH 5I76A 3BRDA 3WS3B 3VD5A 2YKLL 1N5AA 1MCOH 4P59H 3RU8H 4X8JA 2DQFA 12E8L 4L3AA 3TN0D 5AAWA 1F2QA 5AZEH 2D0HA 3P4NB 3VGFA 3IF1B 2VITB 3KPOA 4PB9H 4OGXL 5IR1A 4D3CH 2CKBA 5HYQA 1GIGH 5ESQA 4MHHG 3SKMB 3F12B 4PBWD 5CJOL 1OL0A 2B20A 3OKLA 4MA3B 4M6AA 5T5FH 2NY4B 1RJYA 2X1OA 3QQNA 4Y4KB 3NH7L 1RZKH 4WI4A 1D5XA 4LLYB 2CDEA 4P5MB 2N7BA 3FO1A 1QA9A 1FZJB 1U93B 3GSOA 3GO1L 4HLZG 5HDQH 4P2OB 5C0FB 1BX2B 2BNUA 2QBWA 4M6NL 4LLWA 4NRYB 4Z7VB 2BY2A 3L3GA 1FQ9C 2X9XA 5TH2B 5IQ9A 3VXSE 4WWKD 5HI3D 3T77A 4Z0BH 4R2GD 1LDPL 1J87A 3WFDH 1A1OA 3X3FL 4Z77B 2A77L 4H1LG 2KZ1B 1MRDL 5BZWB 3B2UC 2G60H 4IDJH 4NOFA 4WV1C 1CXFA 1XZ0B 4J3VA 1UG9A 3L5HA 4QNPF 4EI5D 4R4FH 4KKAD 4KVCL 5ILTL 3R8BB 1IM3A 1AQDA 3QUZD 4I48A 3EDFA 4WFHD 5DO2D 3JWDC 3QG6A 1ZVSB 3O6LH 3QULA 3BX7C 1AFVH 1VEOA 4X6FB 3O2DL 3EOBB 5MEPB 4YHZL 4Y88A 1F4HA 4J23A 4PJBF 3QUXA 5D93C 1UZ6E 2E7CA 5CKAA 3SDCC 4G6AC 3SQOH 2VZSA 1VGKB 4ZUWB 3AU1B 3GM8A 3RIFK 2W0LA 1ORSB 3LB6D 3L5XH 2DLGA 1JGDA 3HB3C 3G5XA 1KCUL 3HUJE 5LGKA 1BBJA 2PO6C 3BZDA 3WFBH 5IUSA 3K4ZA 2AK1H 4PJAB 1JL8A 1RURL 3QEGH 1A6PA 4WI3A 2ID5A 3HMWH 4NQDB 3N1MC 3WIHA 4YJZL 5CEZL 4XB8A 2JB5H 4Y19A 4UAOC 5EU3A 3S36L 5INDA 3F7YA 1UQSA 3K74B 3SDXE 3HR5A 1FBIH 2J8UF 1FNAA 3LV3A 5CINL 2D31A 3IETA 3NABH 1T2JA 4AIOA 5B3JE 3P0YH 1UXSB 3BXNB 1PKQE 5DMYA 4F8TA 3OKEB 2IANB 1AQKL 3FT3B 5D2LB 4CMMB 3PNWB 4F57H 2Q8BL 2I9TA 3EGSB 1YEGH 4DVRH 5IGXL 5CZVH 3I84A 2YSSB 3U7AA 2H41A 3JV6A 1ZA6B 2A9MH 1UB5B 2DI9A 4I0PA 4JPKL 3UEZA 4B50A 1I3VA 4QXTA 5I74B 1YPZB 4FQ2H 1E27B 1G7MB 1T2QH 5T3ZD 1EXUA 4OCMC 5L2KB 1KIPA 3PDOA 2C4FT 3MCLH 1T4KA 3BIKA 3IGAA 1S9VA 4XX1E 4WUKH 4HLJA 2QQNL 4NJAL 3WNMA 1OWWA 3GK8H 2BOBA 4PRDA 4HKZB 4JPVH 3WXVH 2G5BB 3BKML 3IFPA 1W72L 3BP4B 4PTUB 1OSZA 2P8PA 1A7QL 4BZ1H 3ZMRA 5DK3A 5SWQB 3DBXA 4Q0XL 2CRIA 1I7RB 3IKKA 2X9YA 4KQ3H 1IEBB 1OAUH 1OM3H 2O5XH 1P7QA 4O2CB 1EZVY 4POZC 5C08E 5AG9A 1OAQL 1L0YA 2CLZA 3VRLE 1NFIB 3DWTA 3I2CL 2Z31A 1VFAA 5KSUA 3OHXB 5BS0E 5H37G 4PJAF 4RGOL 4W70A 4ZOAA 5C0CB 4D94A 2ICWI 3VFTB 3GI9H 4LVEA 4XBGA 1G7QB 1RZIA 1QQDA 4M1CC 4NKOB 2KL6A 4GRWB 3V6OE 4HGWA 3O2VH 1KN4L 2I27N 1OPGH 5IT2H 1S9YA 4TOYL 3PWPD 1WBZB 2EE3A 1HQRB 2PYFA 1ZHBB 5I8OH 4MD4A 1FE8L 3F7RA 3WIIL 4S1RH 2VDQH 2EYRA 2XPGB 5LGJA 4LVOC 3MV8A 4HS3A 4RDQF 2EIZA 3ZDXE 2I60H 5D7JD 4L3ED 1BD2E 4ZUSB 5D2LF 1GRWA 1YMHB 4CGTA 2P7TA 4MNHA 4IIQA 4HGKC 4OTXH 4I3SL 2Y6SC 1BIIA 5I1GL 3O2DA 1H5BB 4NUGL 5K33A 4M5ZL 5MEQA 5ISZD 1X4XA 1EX0A 1WTGT 2D2OA 3DVNB 3MRRA 3MPCA 5D2NA 5AUMA 1S8DA 3UYRL 5FF6B 1H3WM 1CG9B 2DQGL 2H2SC 2W9EH 3CJJA 3DYMA 4KHTH 4BK4A 1YPZF 1UC6A 5I0DA 3OG6B 4DGYL 1IGJB 5CP7B 3UBXG 2R29L 1AGEB 2YR3A 3O3DB 1YECH 4L3CB 3DVGA 5DMGC 2O5YH 3NIGE 3FO9B 3MMEB 3QUML 1MAMH 2XG4A 4HF5H 2DD8L 3AAZA 3SO3C 5E7BA 4N8VA 4H1LH 4JY5H 3TPUA 4QTIL 4XPHH 3VXTA 3WDIA 4WJ5B 4C57C 1R3LB 2W0KA 4YNYB 1TNMA 1MCSA 3U9UA 3WNLA 3OKOA 3ZDZE 4Z78A 1FLRL 1G7LA 2YPLA 4LQFH 3C60D 1MY7A 5E2WH 3TA3D 3FRUB 3KLHC 3TN0B 1CXIA 1F3DJ 5KOVC 4YR6A 5C6TL 1DVFC 3F62A 4QXGL 1I4FB 4JLRA 1WCBB 1HDMB 2JJWA 3RZCD 1DP0A 2AJZA 5T3XL 3UYOD 1U91B 3UC0H 2ADJB 3OXSA 3WSQH 1H0DB 3QI9A 1LO3H 1KV3A 1A6UL 3PL6D 3MGTB 5FUOL 5DZNA 4ONGH 4OM0L 4R4ND 1T89A 2N7AA 3F6IA 1CLOL 4JFXB 5I2IB 5FUCE 2Z93A 4GKOA 4ONOA 1QNZL 1A3RL 2P8MB 3IXAA 4Y4HA 4NKMA 4LLUB 1MQ8A 1SJXA 4Y1AA 5IOPB 4GRWF 4PJHE 3AY4A 2A6KA 1UH3A 5MI0C 1LE5B 3GMPA 4TUOB 4WWKB 1FNGA 1VFUA 1T1ZB 1IEAA 4R2GB 2Z92A 2XXCB 1YN7A 4ONFL 4ZFFA 1Q9KB 5CWSA 3NIDE 3VMOA 3QDAA 4DUWA 4FZ8H 2CUMA 3ZHDA 1HKLL 4RMQA 4A2LA 4XP6H 4HPOL 4EI5B 1Q1JH 1QLFB 2Y9RT 3MQIA 1W72A 3O9WD 1HIML 3WIFB 3CNKA 4UQ3B 3WNNA 4JEGB 4F80A 4PTTA 1KBGL 2R69H 3LKQB 4WW1B 4HJJH 4GW4B 5C3TA 4IRJA 1U3HB 2R1XA 5LJYH 1BEYH 2CXKA 4ALAL 1BFVH 5KSAC 5DMJB 1FN4A 2YD6A 1ZXQA 2OP4L 1P69B 1J0KA 4YDLB 4ZTOL 4K7PY 4IIQC 1UVQA 1QBAA 2H26B 3BE1L 2ZUVA 1FORL 4YZFE 3O0RL 1U92B 3T2PA 3VRIA 5FOBB 2OI9B 2VLMD 4K9EL 2I5YL 5GZOD 1P1ZA 1K3IA 3CMOH 3V5HB 5ESAA 1MPAL 4EDWL 4XP1H 3SPVB 1I3RA 5JIKA 2XYCA 1S7WA 1S78C 2P5ED 3TYFA 2AI0L 3O6KH 4LF3A 3C5ZA 5H35A 1QSFA 3E1F1 5DD1H 4HCRL 1B4JL 1DSFH 1A14H 3QZWA 1RV6X 4K8RH 5L2JA 5ECJE 1O7SA 5FDYA 4HJGA 2X4UA 1PX4A 1PEZA 4MJ4A 1ZS8B 3ESVF 3RI5F 1IILE 1WFNA 4GG6B 1JNLL 2YA2A 1DBBL 2R4RH 4PB0L 1TTFA 5FA3B 4XHQA 3UZEA 1FGNL 1AXSA 2CSPA 2JB6A 4TVPE 1J1XL 1WEJL 5DFVC 2ZSVB 4YGAB 4ZD3H 3LSOB 1A4JB 2Q6WB 5H37H 1B6UA 3P0GB 2OJZH 5CBAB 3B9AA 3C5JB 3W5MA 1HSAB 1SY6H 3VG0H 1S7RB 2P5WD 3QI9C 2A6JB 1U8JB 5FYJD 3QUMA 2G9HA 2C1PB 1T89C 3QAZB 3MJ6A 4X6DE 2DICA 2X4QA 4KGLA 1HHIB 3WS3A 4MNQD 1CL7H 2F58L 3AB0C 3K0WA 4UTAH 3I50L 4U2ZA 3CVHB 4NPYB 5IG7B 2CLVB 3UDWA 5K59E 3IF1A 4G8EA 1D5BB 3AY4C 4ZSOE 4NRXB 5HHOE 2VITA 2AEQL 3EO0B 3UO1H 1MI5E 3V8CA 2NY0D 4UINL 4WO4C 4BQBA 4BQ6A 1OAXL 3S3PA 1GH7A 3SKMA 5C9JB 2AJUH 4N0UE 3UPCA 4MA3A 5GGVY 2BNRE 4HH8A 3QQ4A 4Y4KA 2FATL 5EBGA 5FGCE 5TFSH 4FTVE 1IGIL 4LLYA 4P5MA 1FZJA 1U93A 5CFHA 2OS7A 4JFFE 4P2OA 5C0FA 4M7LL 5FB8A 1N6QL 3C9NB 4QF1B 4NRYA 4Z7VA 1KLUB 4XGZA 5TH2A 1I1AD 3OAUH 3DI3B 4OBSA 1MRFH 3RBGA 4Z77A 3ARUA 4IRJC 3W9EB 1C5CL 5BZWA 4PS4H 1IKNC 4G6MH 5EG6C 5TDPB 1KTLB 4P99A 1T20B 1NCWH 3DPBA 1IFHH 1ZKAA 1XZ0A 4L4VE 3BKYH 4NZTL 4DW2H 2J3SA 3PWPB 3L3DB 5FYKD 4NDMB 1NCCH 3LRGA 1WITA 1MFAL 5I1EL 3BMVA 4P9MH 4DZBB 4ETQB 4J2XA 2YK1H 3VXOB 5D7JB 1DL7L 2A6DB 4OGAC 4X6FA 4L3EB 3EOBA 5MEPA 4GG6F 5C09D 2X5PA 1S3KL 2X1PA 5F1KC 1MIML 3HE6C 2VDNH 5DC9B 1VHPA 5T1KD 4OI7A 4KKNA 4P59L 4W68A 3RU8L 1J8HE 5ISZB 2IMMA 1VGKA 1QKZL 4ZUWA 1KB5H 3EFDH 1EUTA 3IJHB 3TEUA 3AU1A 3HE7D 5BCAA 3C5ZC 1ORSA 5JHDD 1IT9H 1J18A 1G7HA 1OCWL 5F6IB 3VFNA 1NGPH 4JG1L 4OD3H 4K71C 4P9HL 4D3CL 1BBDL 1QSZA 3BPLB 2FJFB 3G6JF 4PLJD 4PJAA 2XZQL 4PJ7E 5TE4L 1FFRA 5B8CB 4LCIL 1A5FH 2YEZB 4QHKJ 2Y5EA 4NQDA 4OZGE 4MXVE 4XPAH 4S11A 4Z7OF 1ZHNB 3QXAB 5FM5O 3GSQB 3NZHH 1BZQK 4JJ5B 1EIBA 1NCNA 1AP2B 3C60B 5I16B 1U42A 4UBDD 4EBQH 2G60L 3DRTB 1UXSA 3BXNA 3MBXL 1G84A 1MNUH 5EO9A 5C0JB 3RZCB 2IANA 3OKEA 3FT3A 5D2LA 3PNWA 5SX5K 1JZ2A 1TQCB 3E3QC 4I3GA 3S34H 5EOCH 3RVTD 2FGWH 3PL6B 2D7QA 4RRPA 1ZA6A 4CJ0A 1B0RB 1UB5A 5J56B 3N85H 2C3XA 1OF2A 4M6OH 4UILL 4NCC2 4ZNCD 4JGMA 3LS5H 2IFFL 3L5WB 4DKFH 1YPZA 1E27A 3TFKC 4YXLH 4YLQT 4QXWA 4GS7B 4OZHE 5L2KA 2ICCA 5EIVA 1KCVH 1BJ8A 3QCTL 3CFCL 3VFVA 3FQTB 4IMLB 4OQTH 2GIYA 4EDXB 1YQ2A 2MPAH 4Y4KC 2DKMA 5JMOC 5LWYH 1BFSA 3WUWG 3SHSA 3IXTB 3L5XL 4P2OC 1YNTB 4HKZA 1V3JA 2VDOL 2G5BA 5L88H 3BP4A 1JHLH 4PTUA 4YO0B 4HUUB 3D3VD 2ZCKH 1T80A 3WFBL 3DOSA 2VIRB 2AK1L 5GRUH 1FL6B 3O9WB 1VACB 1GGCH 5SWQA 9CGTA 2AEIT 2FSEB 2MQCA 4O58L 2QLVB 3KPRA 5DJZB 2D9CA 1I7RA 1OAKH 5AYQA 4QT5B 1JWSA 4ODHH 1IEBA 2HRLA 4OIIH 2VZ3A 4GBXD 4O2CA 1I9EA 1TDQA 2JF1A 5IVXA 1VEMA 2GAZA 3GBLA 4BFBD 1NFIA 1WISA 3QHZL 4OF8A 1SEBB 4D0BB 3OHXA 5T1MB 4HUVB 2H32B 1DLHB 3BUTA 4PD4K 5C0CA 1A6VL 3P0YL 2A6IA 2QQKL 1XR8B 3EYOB 2HKFH 3VFTA 2IPKB 3ARYA 5EU4B 3RAJL 4WI7A 4UDUB 4FS0A 4JRWA 1GC1C 4WHCA 1G7QA 3ELAT 4ZMAT 1YEGL 1F4XH 5CZVL 3NCMA 5B22A 5BMFH 3JV4B 4MAYC 5E8PB 3CVIL 3R0NA 4FFZH 3LMJH 3LN9A 4UT9L 1HQRA 3LKNB 2R23B 1ZHBA 4U49A 5K93A 5FUZL 1TCRB 2XPGA 4FQ2L 4DEPB 3HI5L 5E6ID 1IZKA 3S37L 2NYYC 5BW7A 2P5EB 2F19H 3FZUD 4LGPB 5DWUH 4E41A 4XCEB 5KW9H 3HHRB 5CSGA 4ZUSA 5L8LB 2HLFC 5GS0H 1YMHA 1ORQB 5LQBH 3MCLL 4WGVB 3P2TA 2PTTA 1H5BA 3QXUA 1XF2B 2R2BA 3DVNA 3DYPA 4HMCA 1D5IH 3V9FA 1V3MA 1NC2D 4LLDB 5FF6A 5EFIB 1CG9A 2IADA 1HYSD 2BNQE 5SV3A 2Y1VA 1PG7L 3U4EB 3KYNA 3CX5J 5CP7A 5IEKB 4P2QD 4ELME 1ZLWH 1AGEA 3O3DA 5BV7B 4L3CA 4ODTL 4YHLH 3OAYK 3VXUB 5T3ZL 3RBSA 1T04B 3CSPA 3UJJL 3FO9A 1IC7L 5CBEB 3SJVE 3MMEA 1OAUL 2O5XL 2P5WB 4XCCH 5J12B 4M62H 3V52H 3AGVA 3Q6GH 2Y06L 2EIDA 4WJ5A 3GMNB 1R3LA 3CVHL 3DX7B 4QHKI 4J3XA 4XVTL 4MVBD 3RKDC 3VFRB 4NQEE 4UTBH 4MNQB 5I74C 3QXDB 3FRUA 3EOTH 1G6RH 3CZFB 3UBXB 3KPLB 4PJFE 3B9EA 3LY6A 5IBTH 1I4FA 1WCBA 1HDMA 4LSSL 3PXHA 2NY0B 3MLPA 1U91A 2VL4A 1UCBH 2E7BA 4LIQE 2ADJA 2KQNA 5I1AB 2EDEA 3MGTA 1FRGH 5GGTA 4JFXA 4S1RL 3MA9H 1LP9F 4ZFGH 3SY0B 5I1LB 3ULUC 4JHWH 5EUOA 1X5GA 4EIZC 5TQ2L 2WLZA 3SN6N 4GXVH 2VB5A 5D7KE 4LLUA 3NACH 5IOPA 5HVHC 4MQXC 1LK3L 2EC8A 3HC0B 4CJ1A 1LE5A 3QNZB 1JPTH 4TUOA 4WWKA 1I1AB 4AIXA 4RX4D 1YZZA 4X98B 1T1ZA 2VXTH 4XWOD 3IJYB 1P5VA 4KHTL 3G5YB 2XRAL 5F71A 4LGSB 5DVNA 3EZ8A 1MCCA 2IPUG 3KYKH 2G5RA 3E2HB 1R5WB 1QLFA 5F7WC 4U3CA 4BZYA 4WU7B 3TT1H 3K8LA 2FWOB 3L7FA 3W2DL 1F6LL 3WIFA 4JFHE 4UQ3A 2FX9H 2UZIL 3HZYB 4H5SB 3GI8L 3NCEB 3LKQA 1QFWI 4J3UA 2AJYH 5C09B 4UOW0 4WW1A 4GW4A 5TQ0L 4WI8A 1U3HA 4LSUL 4O02H 5I8CB 3IDUA 1U8QB 2RCSH 4ODSH 4OCNC 4YXHH 4LQFL 2OMNA 4FOMA 3NMEA 5E2WL 4YPJA 5BW7C 2GY7B 2EDQA 4LCCB 5T33H 1T1WA 2X09A 3HE7B 5HPOA 3IDMB 4CU6A 1KGCD 5IQ7L 5JHDB 2OCFD 1J0YA 4XX1G 3ET9F 2AV7B 3B5TA 4QRPA 3VI3F 1RD6A 3MRGB 1U92A 5FOBA 5LGHL 1NMCC 1CYGA 4WHYH 1N7MH 4CN4A 3V5HA 2WAHA 1R3JB 3SPVA 1QUNA 2NY5C 4OLUL 4BSVB 5I19H 3MRLB 1AY1H 1FFPA 3RY6A 4YHML 2VMFA 3VXRE 3HNVH 3G08B 1I1FB 4NN5C 1YA5A 2VC2H 2ZOKB 2F74B 2HT4C 4KKCC 5CD5D 2E9WA 4EXKA 1ZS8A 4PJEB 4G9FD 4GG6A 4N9GB 1YNLH 3MLXL 3OKKA 1GYAA 2EDYA 5FA3A 4WUUD 1LNUB 3TNMB 1OGTB 2EICA 4H8WH 4K3HA 4TYUA 3W39B 4Y16B 3IU4L 2UWEB 5A3IC 3VGAB 1A4JA 2Q6WA 4NCC1 5CBAA 3S3SA 2B2XH 1HSAA 1L9MA 2R69L 5IVZA 1DBJH 2WQ8A 1JCKA 1S7RA 3RWIB 5HHME 1YNKL 1WV7T 1C12A 4TULH 2AKRB 2KPNA 2A6JA 4MCZB 1U8JA 1BEYL 2C1PA 1BFVL 3SGKA 5DT1L 1I8IB 2F54B 2NY6B 1HHIA 2JJSA 3VXSD 4JRXD 2QJDA 4J3WA 2WBKA 5JORB 4R90L 4LRNH 4XP9H 5LBSL 3CVHA 3TVMD 2PNDA 4NPYA 4RMUA 5IG7A 1PDKA 1J88A 1E4KA 1J05B 5HTSA 2PUQT 15C8L 5ALCL 1DQLL 5DMKB 2I25N 5C9JA 2NMSA 4M1GH 4BZ2H 4WWID 2MOVA 3BP7A 3QDJE 5E5UB 4GBXB 3IAGC 1JPSH 4MX7B 5DD1L 4OM1H 2R0WL 5JA9A 3RA7H 3ARWA 4HBQA 1A14L 3C9NA 4XBEH 4QF1A 3EJZC 1KLUA 2NLJB 1FVCB 3RWDA 3WKML 1DBAH 3T8XB 3VJ6B 4HEME 5E1HB 1UZ8B 3R1GH 1U3HC 3LQAH 1MLBB 2R4RL 3H42L 3FMGH 4HQQH 1KTLA 5TDPA 1T20A 3JWNC 4YBQD 3IFNH 3OGCA 5EPMB 1GGTA 3WDJA 3T04D 4F58H 3L5IA 3PWPA 5SX4H 3LB6C 4ZD3L 3L3DA 4NDMA 1EO8L 2WW8A 2OJZL 5I73B 3MJ9L 4PYGA 4NM4H 5E6IB 3VG0L 4DZBA 4ETQA 4R4BB 1JNNH 1LWRA 5A16B 1IEHA 3VXOA 5D7JA 2A6DA 3S3JA 4L3EA 4PJEF 4U3HA 4FFWC 4EUPA 3KJ6H 2J4WL 4ISVB 1NFKA 4R96B 5ISZA 4AEEA 1JZ5A 4YHIB 1W0YT 2FCBA 2DB8A 2VXVH 2UWEF 4HPYH 4Y19E 4HIHB 5BV7L 1INQB 2QADC 4BYHA 5B39G 4P2QB 1FO0B 4GMTH 2FJFA 1KUMA 4HH9B 2AJUL 4QGTA 3TBYB 4G7YH 2YEZA 1IAOB 5FYJL 2NQCA 1B3JA 5TFSL 4IRZH 3D1MC 4LASH 1ZHNA 1U8IB 5ADOL 3QXAA 2D9QB 3QYCA 4H88H 4NM8H 3GSQA 4NNYB 5FECB 1KCRL 1LO4H 1LO2L 4XNUH 2CUHA 3E6FB 4JJ5A 1AP2A 3C60A 2FEEI 3OAUL 5I16A 1OARH 1OTUD 2LABA 3SEPA 3FOMB 3DRTA 1NQBA 3QAZC 4WIQA 1TMCB 3HAEG 1NCWL 3SGKC 5C0JA 1NUFA 1IFHL 3RZCA 2XNAB 1NCUA 4M43H 1MCWM 1BFOA 4R7NB 2JLLA 3K4DA 4DW2L 4U1LB 1NGWB 3PL6A 1NCCL 3NA4A 5IM7B 1B0RA 3ECBB 2BVTA 1E4KC 5JW4Q 4P9ML 1S7XB 1FNHA 4OF0A 4OCXH 4JQIL 5EH1A 1EVTC 3EYSH 1PEWA 4DKEH 2IBZY 1MF2H 5GZND 2X2YA 1VESA 4FQ1L 3CFJB 4DVBA 3FQTA 4G80B 4KJQC 5H94A 4IMLA 4S1SL 4YAQB 3B83A 3BP6B 4EDXA 5BS0D 1DTUA 5I8KH 3SBWA 1AXTL 4NQXB 4XHJC 4NC0B 3BEWB 1F90H 2RQ8A 1YEHL 3IXTA 4V2BA 2BC4B 4RFEB 1YNTA 2CXGA 4P5TD 1WIPA 5FYKL 3FB7A 4MXQD 1NGPL 4YO0A 4HUUA 3JTSB 2VIRA 5CEYB 3OBAA 1FL6A 5HGDB 5C6WH 3O9WA 3WD5L 3DGGB 3M8OH 5K9JH 2FSEA 4D2NA 4B7IA 3EW3B 4NFBA 1X5IA 4ZUUB 4XPAL 5DJZA 1O5DT 1G0DA 1UKSA 5DC4B 3T0AA 4QT5A 4UT6H 4Z7QE 3V4VL 1QR1B 1EJOH 2HLAB 4M4RA 5HD8C 5ICZB 1BD2D 4DGVL 5ITBH 2X1QA 1ZLWK 2IAMD 3MXWL 1SEBA 2VERN 4D0BA 3FQRB 4HUVA 2JIXB 2H32A 1DLHA 1H3PH 4NZUH 5J4MA 1XR8A 3EYOA 2APBA 1Z9LA 2IPKA 4IMKA 2F53E 4U6XB 4LHUG 3ROLB 4UDUA 4TTGA 5LG1A 5EA0H 5F9AC 5M7QA 5C0RL 4O5LH 4S1QH 3M1BB 3S34L 2FGWL 3JV4A 3D5OF 5KVEL 5E8PA 3VE0B 4XMKH 2WUCH 2R23A 1F97A 4G8IB 4F33B 4AQ1B 3RFZC 3INUH 2DOCA 2DQEH 3LS5L 4ZAKC 2GY5A 5HDBE 1TCRA 1UM5L 5DEGB 4YXLL 4AL8L 3B9KC 2P5EA 3BPLC 3STBA 5ANMB 4XCEA 5DJDB 5BO1H 3RIAK 3VFWB 3SDYL 32C2B 3MJ9A 3WV0A 3ZTJG 1ORQA 2VDPH 3DRQB 2MPAL 1RHHB 3LKPB 4LCYB 2VXSL 3QFJE 2BOCB 1XF2A 2P46B 3VDBA 2VKXA 2D7MA 3R0MA 4WTWA 4I2XE 3VFUB 1P4IL 1WF5A 4HK3N 4ZODA 4LLDA 5EFIA 4G9FB 4HIXL 2HMIC 3MXVH 4R0LB 2E7MA 3U4EA 4HZLB 4WUUB 1OAYL 5IEKA 4Z5RB 3WL9B 3ZL4H 2YPLE 1XGQB 3VXUA 4F9PA 4OGZA 1L4IA 4ZOEA 5HY9B 3OSKA 5CBEA 3K2UH 5T1DL 1F11B 4J3SA 4LSQL 4ODHL 3KNBB 2P24A 5CEXB 2P5WA 4YFEA 5DD0L 4TNVK 3I9GL 4X9GA 4RNRA 3GMNA 4QRUA 1IE5A 3DX7A 3H7LA 1WWWX 4JFEE 3PHSA 2HJFB 1P4BH 3VFRA 3ALXA 3C8HA 5EDXA 4MNQA 4JRXB 3VXSB 2HKFL 3D39D 3QXDA 4UT7L 4GS7C 3TVMB 1T5WB 3CZFA 3WUZA 3KPLA 2WQRA 1BQHG 2X4PB 2V9TA 5BMFL 1FDLH 1N5YH 4IOIB 2BSTB 4Z7WE 2ZUQB 1H8NA 4OLXH 3LMJL 5I1AA 3DXAA 1D9KC 4JKWA 5JW3H 2FRGP 3D25A 4POUB 4X83A 1CK0H 1N4XH 1T83A 1BQSA 2DIAA 1D5ZB 1R3KB 5HSFA 2COQA 3H6JA 3HC0A 1IRAY 1FH5H 3QNZA 4X80H 1I1AA 1D6EB 4X98A 1L7TH 4RWYH 4MJ5B 3IJYA 3G5YA 5LXGL 2R2HB 4ORZC 3PWUB 3MFFB 1KJVB 3HUJB 2CKNA 1G9EA 1XF5B 3H3PH 1X4YA 5KJRH 3PG2A 2ZOLB 3CSBA 35C8H 4YHLL 1R5WA 2FBJL 3UTQB 4GT7A 4HUMB 6FABL 4Z6AT 5HVWA 1BF8A 4WU7A 3EUUA 1M7XA 4NO2A 1MSPA 2FWOA 1ZT7B 3ZE0E 1AJ7H 1UCTA 5E8OB 2UZXB 3GSWB 4PBVC 4LU5H 1TETL 1I1YB 2DDQL 3HZYA 1U41A 2H1PL 1ZT1B 3BESR 3Q6GL 3ARGD 5C09A 5INCB 1KC5H 1JGUH 3SDXB 1I3UA 5I8CA 1U8QA 5HYEA 1S9WA 5DVKA 2CK0L 2Q76A 4DEPC 2A38A 5C7XH 3VFOB 4MD0B 4LCCA 1FO0L 3HE7A 2X4SB 3IDMA 3VD7A 4KXZH 1M7DB 2W38A 5JHDA 1PKQB 4H25B 1UA6H 2AV7A 4K2UL 5TF1H 5HI4D 3MRGA 4WEBH 1WWCA 3QCUH 3MJGX 1X44A 4TVPD 4YC2B 5GRWA 1IJ9A 5E5MB 1KCSH 4JKPH 3MA9L 4NBYB 3P30L 5GISH 3VDCA 1J0JA 1R3JA 1EHAA 3UP1A 4JHWL 2GYSA 2XICA 3PDDA 4BSVA 4GXVL 2BERA 5M94B 5BV7C 3MRLA 3LIZH 5J13C 5GHWL 4F9PC 2ICES 3UPRB 3J7HA 1V5JA 4KK6D 3G08A 1I1FA 1JPTL 5CILL 5D5MA 5DRXA 1QZ1A 4PY8J 2XWJB 1A8JH 4LHUD 4OCWL 2ZOKA 1JUFA 2F74A 2AW2A 1NC4D 3QPXL 4UUJB 3KG5A 4PJEA 3GJFK 4N9GA 5HHOD 1ZANH 2CQVA 3HS0B 5D72L 4RFOH 1MI5D 1UYWH 3S88L 1PBYA 5F9WB 1P9MA 4ENED 2J88L 1LNUA 1OGTA 1Z3GH 3NCBB 3Q5YA 4HKJB 3TT1L 4KMTH 2EC9U 3E3QE 4XPGH 1UZ6F 4Y16A 1T0NB 3T0EC 2J8HA 5KTEH 2UWEA 4UV4L 4HJ0D 3T0VA 3U1SH 5I1JH 2BNRD 4MDIB 4LHJB 4MYWB 3JV5A 2DQIH 4FTVD 5D8JH 4WRLA 3RWIA 3I6LE 1URLA 2AKRA 4O02L 3HUJF 1KPUB 4JFFD 1U3YA 4LCWE 2RCSL 4ODSL 3V5KB 4F7MB 4K94C 2Z35B 5BS0B 4KDTA 1I8IA 2F54A 1QYGH 5GRJH 5GS2H 2HFEB 1N0LA 2A1WH 3GMOB 4JM2C 4YHYB 4F7PB 2WNGA 5T33L 5H2BB 5JORA 4HUNB 3EKCA 1F4WL 2JJUA 5A43C 1MFDH 3MRHB 3C08H 4P5TB 3NN8B 2I07B 2JJVA 3L9RB 3BZ4B 2VLLB 1DFBL 5EOTB 3EJYD 3OPZH 1I1AC 4Z7VE 3SDXF 1CQKA 4L4VD 4ZS7H 5DMKA 1ZLSH 3ZTJH 4I9WE 1OSPH 2H2PD 4OLVL 1KNOB 3D9AH 1NMAH 1A9BB 1BHGA 1X4ZA 4FQLH 4OIAA 3WHE1 5B3JF 2A0LD 2Y25A 5DMIH 5F7EH 4GBXA 4YHKL 3E2HC 1FIGH 2ATPB 1BD2B 4MX7A 1JWMB 4DWHA 5TDOB 3GSNB 1CDIA 3PWVB 3HNVL 2IAMB 3RHWF 1QR4A 5CZXC 3ARSA 2VC2L 3RDTD 5E2TH 2NLJA 3D0LB 4R26L 3LEYL 3AUVA 1J8HD 1EAJA 1CBVL 1IAII 3T8XA 3VJ6A 1OY3B 3TZVD 2WZPD 1UZ8A 1MLBA 5DJXB 1SHMA 3BPNB 4JANB 4YE4H 2XA8L 2VN7A 1NUGA 5JOPE 4I18B 1REIA 1YY9C 5EPMA 4LCCC 5IESL 4GSDL 3OF6D 5A2JH 5IMLB 4Q9RH 4C54A 3RX8A 4XI5C 4C55A 3AFLA 4IRSD 1XF4B 5E6IA 1KLGA 1HSBB 4OUOA 4M8VA 5A16A 2EE2A 4U0RC 2DMKA 3DX9B 3FHQA 4ODWB 5ETUB 3BPOB 3BHBA 1ZOXA 3QDME 3GSRB 2BRRH 1TJIH 1CXHA 3U7WH 4ZFZB 4L8BA 4KAQL 4M7KL 4FQIH 1B9ZA 4R96A 4YK4B 4YHIA 3MV01 1NAKH 4XP9L 1N64H 4NO3B 4GMSL 4YFLI 4O2FB 1KJ2B 1HEZB 1GZPB 5GRVL 2NR6D 1INQA 3G6AB 1SBSH 4P2QA 1FO0A 4UBDC 4R97B 3VRLF 3VFGL 1Q0YH 4HH9A 4K3EH 1T1XB 4M1GL 3TBYA 1HXYB 3EBAA 4C83B 4GW5B 1IAOA 3BQUA 4MMZC 5D6CB 2Q20A 1JRHH 4DUXA 2LU3A 2Z8VC 5C3LD 1JPSL 1F42A 1U8IA 4APQA 4OM1L 4DN3L 1Z0MA 5DJCB 4Y16C 1U8PB 5FECA 3K3QA 4XBEL 1PVHA 5GGRB 5EZJB 3E6FA 2XY2A 4GG8B 3D39B 1DBAL 2OQJB 4M3KB 5F3HB 4ZUVB 5MERB 2EDTA 3HZVB 2YN5A 4YX2H 3PUCA 3FOMA 3LQAL 5B39B 5CZKA 4KVNL 3FMGL 3REVB 2XNAA 5LCVH 3ZDXF 1RFDH 4KDTC 3IFNL 3ZSTA 2E6PA 2NY6C 5DRWB 4OD2B 4R7NA 3OMZA 1KG0B 4U1LA 1RUPL 1PKOA 3RGVD 5IM7A 4XC3L 3HA0A 3ECBA 1MCBA 4E42B 2FECL 3BZEB 2AJSL 4JO1L 1S7XA 4HIIB 4XCFH 3VMNA 1NDMB 1X6LA 5HI5D 3UAJC 3ULUE 3CXDH 4FQCL 4XH2B 4AIZB 3UJIH 4AH2B 3LS4H 4XPFL 3ULVD 3KJ6L 1K8DB 1VERA 3CFJA 2OLDA 4G80A 4YAQA 3BP6A 1JHKH 3KPRE 1VFOA 3HAEB 5F9OL 3NIGF 4NQXA 1T03H 3T2QA 5DUML 3BEWA 3ZT7A 1NCDH 1I7UA 2QQQA 4ONHB 4WU5B 1OAZH 2PXYD 3RTQD 2HVKB 2EDKA 2UVEA 2BC4A 4RFEA 5ITFB 2MCG1 3L6FA 5IVXE 3ZKQD 4OCSH 4BA8A 1XCQB 2C4FU 4PGDB 3JTSA 3BUYB 4JR9L 2X1WL 5CEYA 5I1IH 5HGDA 4N90E 1TTUA 4G7YL 1OLLA 3DGGA 2IG2H 3VI4F 3ZDZF 1FNLA 3PF2A 3KDMB 3FOLB 4W81A 1PD6A 4ZUUA 4LASL 2YBRB 4HS8L 5IP4A 1BF2A 5E24E 4NM8L 1AGDB 1BP3B 2HLAA 3EZJB 2B1HL 3HG1E 4YQXL 5I30H 1ACYH 4U7KA 2GTWB 5ICZA 2AGJL 43C9B 4PRAB 4IDLA 3VGHA 5I73C 2E27H 3FQRA 2JIXA 3NCJH 3MV9B 4PP2B 2YZ1A 1MFBH 2VUYA 3HRZB 1UH4A 5GGQH 1CZ8L 3NCFB 3WO4B 4BQ9A 3N0PB 3KPSE 4MGXA 4E41E 4HWBA 3RL2B 4U6XA 1YJDC 2WUBL 1J12A 4NQSB 3X12B 4O4YH 1YEFH 3JV0A 5FO8B 1P53A 4EIGB 1HI6B 3M1BA 4Z0XB 4WI9A 3D87B 3VE0A 4PJHF 3KHQA 3OKYA 2Z0BA 2R2EB 4LPUA 3THMH 4G8IA 4F33A 4AK1A 1FZOB 1BOYA 3SJVD 2SEBB 1Q0XL 5DEGA 3NIDF 1AXIB 4PBXA 1ADQH 4DKEL 1TZIB 3B8SA 5ANMA 2W60B 5DJDA 3VFWA 2HKHH 4UIKH 4X6DB 3BQUC 4PJGA 4YDIH 3DRQA 4RAVB 1I3GH 1RHHA 3LKPA 1IMHC 4LCYA 4XVSL 4NQED 4APQC 4LHUB 2BOCA 2EIEA 3CC5B 1NC4B 3K8MA 1JGEB 3VFUA 4CVWA 3IKCB 1CE1L 4G9FA 4ZSOB 2J5LC 3O2WH 2LTQB 1MI5B 3FO2B 2HT3C 3PGDB 4WUUA 4DCQB 2XXMB 4Z5RA 3WL9A 4HC1H 2PYEE 3M07A 3CLFH 5DLML 5HY9A 1CXKA 5JA8B 4G7VL 4JDVB 3BZFB 3TYGL 4FXGA 1F11A 3ORJA 5FGCB 4FTVB 5CEXA 5I18H 4CDHA 2YXMA 4NO5B 3SDAC 5D70H 2FLBT 5D7KD 4JFPB 4JFFB 1J11A 1DLFL 2D3VA 3BGFC 1ZWIB 4YZFF 2IH3B 5DZLA 1H3PL 1NLBH 4JB9L 5IFAH 2HJFA 4CMHC 1JZ3A 4JRXA 4QCIB 1Z0NA 3AS0A 3NTCH 5EUOE 3MLSH 3QEHB 3TVMA 4HXAL 1JGLH 2X4PA 3OR6B 4O5LL 4S1QL 1QG3A 4IOIA 2BSTA 3QH3B 4HFWB 5KVDH 4XMKL 1MIEL 2Y36L 4L4VB 1HINH 2EECA 1C08B 2NPLX 5KVGL 4H0IA 3QRGL 2DQEL 3PE9A 1CFSB 4JFHD 4OZFB 4RBPK 5DEZA 2NTSP 1K2DB 4LP4A 1G7JB 5IW6B 3PV7A 5E0QA 2DN7A 1D5ZA 1R3KA 3K4AA 4WFHE 2XACC 3RDTB 1A7PH 1J8HB 3LCYA 3TZVB 4Y2DD 1KEGH 4MJ5A 3SDCD 1X5AA 2AVGA 3MXVL 4NZDA 2R2HA 3AVEA 3K81A 3PWUA 4PJXB 1KJVA 3HUJA 1XF5A 1TENA 3HB3D 1XIWC 3TBTB 4PREB 4X6DF 3UTQA 4PJ7B 2Z8RA 2NXZC 2PO6D 2F5BL 3LRHA 1ZT7A 1BLNB 4FG6C 4RISH 5E8OA 4OZGB 1WK0A 1X5JA 1I1YA 3H3BC 5C0GB 5MEOB 2DL2A 1BAFL 4HZAA 5K59F 4QRPE 5INCA 3DROB 3CLEH 3SDXA 4KI5E 2DLHA 1EUUA 3NA9L 1P4BL 3BDYL 3RWEA 3VXRD 4AYFA 1FSKB 3MNVB 3ZZ1A 1A7RL 2X4NB 3FB5B 4GAJH 5JW4R 4JN2B 4MD0A 2YWZA 3QA3B 2J2ZA 2X4SA 1EA9C 4JFQB 1ROWA 1M7DA 1QHPA 1PKQA 4H25A 5L9DH 5J7CC 4RFNB 4X7FC 1NANH 4EZMA 2UY6A 4KH2A 1P5UA 2JK5B 3FRPG 1LHZA 5CD5C 2X4OB 5E5MA 3O11A 5TF0A 3MBEB 1KF9B 2BXZA 3U46B 1TZGH 2J6EH 4G9DB 5HPMB 2E7LA 3TC9A 5IB1B 1DDHB 4RMSA 1IC4L 2DLTA 4PD4J 1WIOA 2A83B 5HHMD 3BKJH 3UPRA 4K3JH 3CDCA 1MWAB 3AROA 4HK0B 4KMQA 4RWYL 2XWJA 3Q48A 2B8OT 3MRBB 4UUJA 1KJ3H 4NZJA 5MHSE 1H3TA 3H3PL 1FIEA 5KJRL 2B1AH 4XMLL 35C8L 3EOAB 1ZGLP 2GCYB 4HKJA 3RGVB 3TVMC 1T0NA 3SO5A 4LU5L 1UACH 3PGFH 1U8LB 3PWJB 1AE6H 2CKBH 3QDJD 3PQYE 4MDIA 2ZUQC 1KC5L 1JGUL 1WBXB 5I0ZA 2GK0B 1KPUA 3NFSH 5GIRB 4PV9B 3V5KA 1KPVB 4F7MA 4J1UB 1U9KA 3VU2A 2Z35A 3HC3L 5BS0A 1CDBA 5C7XL 4PJ7F 4LARH 3D48R 5K9QI 4F7PA 2H9GA 3FO0L 5TE6H 5H2BA 3NOIA 4OLYH 2LV4A 2PXYB 4OZGF 4MXVF 3ZSSA 4BJLA 3MRHA 3BH9B 4P5TA 5BZDB 3NN8A 3GHEL 4M5YH 3L9RA 3BZ4A 5TF1L 4WEBL 3JWOL 3V6OA 3P9LB 5EOTA 2CR6A 4KZDH 3FB6A 1F13A 4M1CD 1KCSL 3TP4A 2DWEB 1YYLH 1SYSB 2A2QT 3PIQB 2AJXH 4JPWH 1KNOA 3D6GA 4S0TD 1XCTB 1BFTA 3ZKXB 2ATPA 4P2RE 1BD2A 5HHXH 1JWMA 3EYVB 5TDOA 5JQ6H 1KSRA 3GSNA 3PWVA 2IAMA 1HZHL 3RKPA 1FAKT 3F58H 2DQHL 1FYHB 4XWGH 1RZKC 3D0LA 4HIJB 2Y6SD 2YPKA 1MHPH 5JZ7C 1BWMA 3WHE0 1WBYB 4XPBH 1NCAL 4Y19D 3LHPH 4TVPL 4L3EE 1ZVHA 1ZANL 2FL5B 2FJGA 2M1KA 3BWAB 5D6DA 4I1NB 2QHRH 5DJXA 4ZYKB 8CGTA 5IMOB 4JANA 2H2SD 4L9LB 4I18A 3WFCH 1Z3GL 4OZHF 4ELMB 4P49A 3QDHA 4KK9D 4MXWL 4JM4L 5I75B 3N9GH 3PP3K 4P3CL 3SJVB 1XF4A 5D8JL 1HSBA 3HFML 4OZIB 2MQ0A 3DX9A 4ODWA 5ETUA 3U7YH 5F7DB 4FQXA 3GSRA 1H9VA 3WIHH 3Q1SL 2IBGA 3QEQE 4GAGL 3U30C 2E7LC 4F2MB 4ZFZA 4NQEB 4MQTB 2X9WA 3CSYB 5DJ0A 1N0XH 5E9DE 4GLRI 4ZXBB 4NO3A 5DUPH 3C08L 1KJ2A 1HEZA 2AEPH 4PJFB 1GZPA 1B2WH 4LLQB 2DMBA 4FNLH 3G6AA 5E70A 1CGYA 1DVFD 3FN3A 1RIVH 4Q74A 3C6SB 4P5KB 4TN9A 2GSGB 4DUVA 1ZLSL 3MLVH 1OSPL 4OLZL 2PF6A 2VJXA 1T1XA 4C83A 1HXYA 5CAYB 4GW5A 1DQQB 4FQLL 5D6CA 4BFIB 5D1ZD 5F7EL 1S7SB 4J7RA 4NO0D 4QOKB 2OL3H 5IMKB 3I75B 1HHGB 2P4AB 1U8PA 3DV4B 3A67H 3IVKB 1NSNL 2L7JA 4OLWH 5GGRA 3S36X 2J12B 5EZJA 4JHZA 2O61B 1R5IB 3D39A 2OQJA 4GG8A 4ZUVA 5F3HA 3HZVA 1OTSD 5B39A 5GZNC 1MAKA 3Q0HA 3GFUA 3IDYC 3VD3A 4YE4L 4NZRH 2P8LB 4OD2A 4WV1B 4X7EC 1KG0A 1MEXH 2DLEA 1ND0B 4FP8L 4Q9RL 3FQXB 5IHUH 2HRPL 2UUDH 3S96B 1X5KA 5BVJB 1N6VA 2VE6B 4P5TC 3QZWG 4MXQC 12E8H 4E42A 3FT4A 3BZEA 2DJSA 1UT9A 5GGSY 4HIIA 1IGCL 4U6VL 1I9RL 1Q94B 1NDMA 1G7PB 4OGXH 3RWFB 4AIZA 1R3IL 2R0LL 4AH2A 2BRRL 3V8OA 4ELMF 1K8DA 1S9KC 4FQIL 5BRZE 5CJOH 3HAEA 1N64L 4Y2DB 1UWXK 3V6ZB 4ERSL 5KSAD 3PHOB 3SDCB 2J8OA 5F1IB 2P47B 4ONHA 4WU5A 2HVKA 1OT2A 4FFYL 1CICA 5EO1B 2F53D 5DHYB 2OR9L 1NKOA 1SBSL 1XEDA 1XCQA 3GO1H 4PGDA 3LPGA 1IBGL 3BUYA 2BDNH 4M6NH 3LH2L 2PO6B 4K3EL 3TIEB 5E8EB 4K3DH 1KENH 3KDMA 3RX5A 1LDPH 5D6DC 4CRPA 3S97C 2YBRA 3X3FH 1QRND 3GSUB 3QHTC 1MRDH 1FNSL 4I18C 4PJFF 1AGDA 2ZCLL 4UAOB 2GTWA 1EAPB 1S78D 4KVCH 43C9A 5ILTH 4PRAA 3VXRB 2FLRT 4YIQB 3M17B 3ALWA 3MV9A 4PP2A 3QFJD 4GUPB 4UNVA 3HRZA 5IMMB 1Y6NR 4FQXC 3RL2A 2HFFB 5E03A 3O2DH 4NQSA 4YHZH 1OD9A 1IQDB 3X12A 5FO8A 4Z0XA 5I76B 1MCFA 4BSJA 3H9SE 5IHLB 2IPTL 2YPLD 3NPSC 2R2EA 2X7LB 5H8DA 5FGRA 2FB4L 2Q3AA 1J1OL 5CP3A 3ARBC 1FZOA 3CFDB 1K4CB 4BKLB 1BJMA 2SEBA 4PJ5E 5DSCB 3MCG1 2ICEB 5DFVD 3VFMB 2Z9TA 1MWAL 1MCHA 2EDDA 1UWEH 4KKLC 4OAWB 4X0KB 1MOEA 1KCUH 1TZIA 5HHMB 2W60A 1PSKH 1R24B 4WFFE 3QI9D 4X6DA 2VL5B 4F9LA 2H45A 3VXUE 2WWMD 2PCPB 4RAVA 2Z91B 4JE4B 4JFED 2DRUA 3VCLB 4LHUA 4C4KT 1RJYB 3CC5A 1NCDL 1NC4A 2D7OA 1JGEA 2NXYC 4DGIL 4P46D 4LBEB 4D9RE 3IKCA 2GSIA 4ZSOA 5FYJE 3OTTA 2BNUB 3FO2A 2NY1B 3PGDA 4YDJB 4PG9B 4DCQA 3ZKMC 2ZUSA 2XKNB 3MV7E 5IQ9B 5CINH 4WO4D 3DNKA 2ED7A 4ODUA 4JDVA 3BZFA 4ETYA 3T0EE 5HVFB 3AMKA 3ULVL 4OV5B 3QDJB 4WFEE 3HZMA 4FTVA 4PFEA 5I30L 1LDSA 4QRQB 1AQKH 1ACYL 5FV2A 4TQEH 2Q8BH 4JFFA 4JFPA 1IM3B 2YUZA 5ENWB 3DXAE 1PW3A 2IH3A 3O3EB 5KG9B 1GCFA 1YDPA 5GGQL 4QCIA 3WFEL 3WFZA 3QEHA 3OR6A 4TRPH 1ZV5A 4IRJD 3ZDYE 3QH3A 3CFKB 3JBG7 1DZBA 5IHBA 1C08A 5F44A 1MHEA 4W6YB 2FX8H 1CICC 4FRWA 5DURD 2QQNH 1S5IL 3MLTB 4NJAH 2YZ8A 1CFSA 1QBMH 4OZFA 2JJTC 3EO1A 1CL7I 1W72H 1BBJB 4LVOB 2ZUXA 1G7JA 4TNVF 4UIKL 1A7QH 5J1AB 3IRZA 2ADIB 5IW6A 2VLRE 3KXFD 4F8QA 4OGAD 4YDIL 3JWOC 1QSVA 1FNEB 5FYKE 3EYQC 3RDTA 1QBLH 2NW2B 3HE6D 1J8HA 4XXDB 1JBJA 4RRPG 3TZVA 5DA0B 1EHNA 4Y19B 4NJ9L 3PV6A 1BM3H 4PJXA 4F7CB 4X4ZA 1OAQH 3HR5B 1MCKA 4LPTA 2X10A 1AC6A 3LV3B 3TBTA 3I2CH 4PREA 3OF6A 4RGOH 1CXLA 1BLNA 4JCLA 1KACB 4OZGA 5C0GA 1QD0A 2OTUB 3GJFB 1YUHB 3KJ4B 3DROA 3SO3B 1KN4H 3KPNB 5IFAL 4LFHD 3SE9L 2OL3B 4TOYH 3MNVA 2X4NA 3V0AC 3FB5A 1FE8H 4JN2A 1RZJC 1T2XA 5EZOL 4G5ZH 3MLSL 1AD0B 3QA3A 5DD3L 3M45A 4JFQA 4LIQL 1GJIA 1WT5A 4F9LC 5KZCB 3QHFL 3PDOB 4PRID 3WYRA 1DVFB 3TO4A 4X5LA 3W82A 1DQJB 4C58B 4MS8C 3CZJA 1HINL 4OJFH 1T4KB 5D5ME 1OP3K 2ZUWA 5ACMA 3U0TB 2X4OA 4NUGH 4M5ZH 4OF7A 3MBEA 4NHCL 3U46A 2ZJSL 4UB0L 1T6WA 2M26A 3P4LA 5D1ZB 3CDFA 5HPMA 5GJTL 2W91A 3IFPB 5CLTA 5IB1A 4NO0B 3WJJA 3RRQA 1DDHA 1CDYA 1B90A 2A83A 3I6LD 2Q7YB 4X6CE 4K3GA 4LCWD 5F7FA 1MWAA 3DLQR 3WHXB 1A3LH 2VLJE 4HK0A 1KEGL 3DO7B 5MI0B 3QUMH 1TQBC 3MRBA 1IGFL 4Y4KD 2WM0A 2DD8H 5D7LE 3NFNB 4P2OD 4QTIH 3ZE2E 1OTTD 1VFAB 3W9DB 4R8WL 2AAVA 4EI6B 4KZEL 2F54E 3JWDL 2GCYA 3P9WB 4KROC 3RUGE 1CFNB 4RISL 2IQ9L 4I9WD 1RZGB 3Q2CA 1U8LA 3PWJA 4JFZL 4XBGB 5AWNL 1WZ1L 4QXGH 1RZIB 4LGRB 4PLKC 2BCKB 5EU6E 4QTHB 1A4KB 5T3XH 1AO7E 1WBXA 2ICWB 2GK0A 2W65B 5GIRA 4PV9A 1KPVA 4J1UA 4EXPX 3MX0A 1F58L 3BI9X 3MROB 5FYLE 3CD4A 4OM0H 2A0LC 1CLOH 4QNPE 1MFEL 5KSAB 7CGTA 2EYRB 5CD3A 1F3DH 3VMPA 1UM6L 2PXYA 4RGND 5L9DL 2F53B 1L0QA 1K8IB 2MJWA 5BZDA 2V17H 4JO2L 1K3ZA 2P7TB 3P9LA 4YHNB 4C56E 5JOPD 1BIIB 1NAMB 3SCMA 3TZVC 1TZGL 1YMMA 2DWEA 2OTWB 1SYSA 4MAYD 3MRRB 1CGWA 1B0GB 2DJUA 5IVNA 1QRNB 3TLRA 1CU4L 4Y5YB 2QSQA 1XCTA 1HKLH 3AM8A 3BKJL 3MTRA 3W0WE 4HPOH 4K3JL 3QDMD 3KPPB 3WDHA 3DJ9A 1NPUA 1FP5A 3B3IB 2HLFD 3GHBL 2JCCE 4KWUA 3QFJB 3SKJL 3BT2H 4HIJA 4J3OC 4I2XB 1WBYA 3SOBL 4NQCB 5GRXG 2FL5A 3BWAA 2VWEC 1VGEL 4ZYKA 3PDGA 1FSKC 1DBML 4D9LL 4L9LA 4Q6IB 1W0VB 4ELMA 1QSEB 1I85A 2YPLB 1JMXA 1DN0B 1V3LA 1T7ZA 3U0PB 2NR6C 1WT5C 2OP4H 4QGYA 5EU7E 3SJVA 2DYPD 2J8UE 3TO4C 5FV1L 2EDHA 4ZTOH 4JQXA 4OZIA 3C6LC 4MNGB 2HFGL 3WJLC 3BE1H 3C8DA 5F7DA 3RJQB 1AI1H 1FORH 3GIVB 1YYMH 3MBEC 3UZQA 5BXFB 4X99B 1C1EL 4XPTH 4LARL 4JFEB 4K9EH 4F2MA 2I5YH 4NQEA 4U31A 3CSYA 3WJJC 5TE6L 2Z93B 2N1KA 1CD8A 4ZXBA 1MPAH 4EDWH 1A6TB 3RKDD 3T08A 3IXAB 4LVNB 4P46B 4LLQA 4NKMB 4Z7QF 3QG7L 2AI0H 1INDH 4K7FB 1Z5LB 3Q5OA 2MFNA 4Z7WB 5CJ5A 3H0TB 1B4JH 3C6SA 3GMPB 4P5KA 2GSGA 1LEIB 1YYLL 4WO4B 3D2UD 1EGJA 2AJXL 3A6OA 4JPWL 3T0XA 1D6VH 4Q9CA 4BFIA 2J1KA 1J10A 1V3KA 1S7SA 1HWHB 1JNLH 4QOKA 3FFCA 1YEKH 5IMKA 3I75A 2FD6H 4JFOB 3ULUD 1H3VA 1RUKL 4PB0H 1HHGA 1A1NB 4QRSA 1NUNB 3DV4A 2DTML 1J1XH 5JDSB 3IVKA 1EO5A 2HT2C 1Q72H 1OQXA 2O61A 4MQXD 1R5IA 3KPRD 1MHPL 4XPBL 3LHPL 2XA3A 3CUPB 5HDBF 3ULVC 1HWGB 2QHRL 4IRJB 5KAQF 1KIUA 1WJ3A 3AS3A 3KWWB 2P8LA 2RR3A 3GRWL 1ND0A 1HHJB 3FQXA 4TPRH 1BZ9B 3O8XC 4N90D 3N9GL 3S96A 5DURB 4HX1B 5BVJA 4N1EA 3I50H 5DQDL 2P49B 4M6ML 3NZ8B 4BQ8A 3SCMC 4EVNB 1Q94A 2AEQH 3HG1D 1ZLUH 2VTFA 4PR5B 5E2VL 3KXFB 4UINH 3CU1A 3RWFA 4QWWC 1SMOA 1OAXH 4MSWB 5I1DA 3DHMA 2VKWA 4LPYA 4U6TA 5CJBA 1B4RA 3HE6B 4XNMB 1F00I 1I1RA 4Y2DA 2X41A 5DUPL 3FN9A 3PHOA 1VPOL 3L3HB 4P4KC 3SDCA 2AEPL 3ZKXC 4F15B 2FATH 1T1YA 3KPSD 3DURB 3FFDB 5EO1A 4FNLL 4JO3L 5DHYA 4E41D 4LF3B 5H35B 3CGTA 2ZP0T 1RIVL 3F5WA 3CFEB 1VADB 4KJWD 1CFTB 4TUKL 2PO6A 4K71B 2VXUH 3TIEA 5E8EA 1EO7A 4GAFB 4AM0B 4GRWH 5K9OA 1UM4L 1KEML 4Y0GA 3GSUA 5IBLD 3VD4A 4L9LC 1C5CH 2OL3L 4LPCA 1BJ1J 1I85C 1EAPA 1CIUA 5I75C 4Z7WF 3S9DB 1YQVH 3A67L 3VXRA 3TESA 4YIQA 3M17A 1HXMB 4UV7L 5CIPB 1MFAH 4GUPA 3T0BA 5I1EH 5IMMA 1RJCA 3KGRA 2QHLA 5DRNA 3P11H 1AHWA 4KKBC 1MCJA 2HT4D 2HFFA 5ANME 1EHXA 4JGUA 4KKCD 4PRIB 4LAQL 4AT6B 1IQDA 3MRCB 2H6PA 4NZRL 1S3KH 3MR9B 2NX5E 4PJGE 1MEXL 4ZXBC 5IHUL 4S0SD 3BP5B 2PYED 2X7LA 7FABL 4ORGB 1QEWB 25C8L 3MNWB 5D7SL 1QKZH 4G3YL 3CFDA 1K4CA 5DSCA 4BKLA 4G9FE 3SE4C 5JQHC 2ICEA 4G8EB 3VFMA 3LQZB 4I0CC 5A3ID 4X0KA 2XTJC 4OAWA 1V7ML 4RIRA 1OCWH 4WUUE 4P9HH 4JG1H 1R24A 5EUKB 1BBDH 2CDFB 2WINB 1KELH 4LCWB 2Y72A 2VL5A 1ZT4B 3S37X 5TE4H 2XZQH 1GVIA 2PCPA 3WXWH 2Z91A 3DI2B 4LCIH 3VCLA 1PX3A 2IMNA 3ZE0F 2ICWJ 2X70B 3QQ4B 5GS0C 4LBEA 4TSCH 5EBMB 2EKSB 5FB8B 2BDNL 2CMRL 4KV5E 3OL2A 4YDJA 4PG9A 4XGZB 2XKNA 4K3DL 1CGUA 1KENL 4JRXE 1HCFX 3CPLB 3MLYH 1PG7X 3PABB 3IFLH 4EUPG 1A2YB 5IJVB 1CI5A 3GZKA 4OV5A 3QDJA 3MBXH 3NBNA 4KPHL 4TSBH 4XNXH 4JQVC 4QRQA 2P48B 5GGTH 3P3YA 4K07A 5ENWA 3RY5A 3O3EA 3MLUL 5GXBB 5KG9A 3T3ME 3CDYA 3EJZD 4UILH 4IHOB 2IFFH 3FHAA 4RGNB 3MRMB 1NAML 4X7SH 3OAZK 3T1FA 3VFSB 4NC1C 4XAKE 1U3HD 2HTLC 3CFKA 3QCTH 2OX5A 4PJCA 3CFCH 4Y2DC 3O6FC 2XQYG 1GHFH 3LN4B 4MAYB 2V5MA 4L8SC 3HNTH 3MLTA 1JN6B 4ODBD 4G6KL 3GRWA 1UWEL 2OBGA 1G7HB 4WNQB 2VDOH 1OP9A 3VFNB 4MB5A 5HYJE 1PSKL 5GJSH 4QRPD 3QDMB 4X6BB 5J1AA 2ADIA 4M93C 4RQQB 1YEJH 4KI5D 1FNEA 5J1SC 1LO0L 1SEQL 3IAQA 2FGZA 2NW2A 4O58H 2YRPA 2C4XA 2GITB 2DQTL 4XXDA 4FFWD 3TO2B 2DQDL 1QBBA 1NBZB 4X5WB 2MQ3A 1TCMA 4Y5XB 4F7CA 5C9KA 5IB3B 1QFWH 5D96B 4BM7A 2QADD 3ZYOA 3QHZH 2CRZA 1QHOA 2R39A 5IHZB 1AHWC 2OMBA 4CU8A 1A6VH 1LE9B 4UZGA 2QQKH 4L1DA 3BOVA 2DYPB 3IDGB 4P2YA 1JZ8A 5EO9B 3H9ZA 3TT3L 4MQ7B 3RAJH 3BN9C 2D03L 2OTUA 3GJFA 4TQEL 2GT9B 1YUHA 3LKOB 4X5XB 1MCQA 3X13B 3KPNA 3CVIH 4Z7VF 1EHLH 5A2FA 2OL3A 4UT9H 4JY4B 1OF2B 2XI9A 1CT8B 4OCRL 1RIUH 4CDGC 5FUZH 1XGYH 1AD0A 4JCMA 5F7MC 5SX4I 3HI5H 3MJ7B 3S37H 4TRPL 2NW3A 2E9JA 4BELD 5MHSD 2NTFB 1DVFA 1DQJA 3VFVB 1O7VA 4POYA 2G2RB 3D2UB 3U0TA 3S6CA 2FX8L 4G8FA 4M02A 1RUML 1ZA3B 1L9NA 1E6OL 2R56L 1QBML 5JW4N 2VH5L 5D1ZA 4YDKL 2NY1C 3PQYD 4NO0A 4UNUA 3MLWL 3S35L 1PG7H 2Q7YA 1MCLA 1QBLL 4ODTH 3WKNA 3T3PE 3WHXA 1E4JA 4OLEA 5T3ZH 5HVHB 1YC8A 3KPRB 4U6YB 3VGGA 5GGUB 4YBLB 3UJJH 3OWEA 4NNXB 4KJQD 1IC7H 3DO7A 1JWSB 1XR9A 3K2MC 5IB2B 1BM3L 1L0XA 1UJTA 4XHJD 3FRPA 5IVXB 3NFNA 4LSRL 2GAZB 1PG7W 4Q7DA 1PZ5B 2Y06H 1OVZA 3W9DA 3CVHH 4EI6A 4XVTH 1EEZB 3HRPA 2Z4QB 1CFNA 2A6IB 4Z7UE 2DF3A 3C2AH 1RZGA 5JXEC 4AG4L 5DZOA 2BCKA 4QTHA 1A4KA 3HG1B 2DLFL 3BAEH 4H8WC 1OGAD 4LSSH 4XRCB 1NDGB 2ICWA 4P2RD 5DD6B 2EDWA 2W65A 5HD8D 3DSFL 1MFNA 3U83A 1CF8L 3MROA 1KJMB 1SVZA 4G5ZL 5KSAA 1GXEA 3V4PH 1HHHB 4IJ3C 3CU7A 3KPSB 4E41B 1GAFL 2F53A 5TQ2H 1FL5A 1K8IA 3WNKA 4OJFL 4CW1B 3QQ9D 3HMXL 4YHNA 1JNHB 1LK3H 2PTTB 1NAMA 2HG5B 2XKSA 3G9AB 3MOAL 4BSWB 2R2BB 3O41B 2OTWA 1ZLVH 1B0GA 2PW2B 1NMCB 3T65A 1QRNA 2IADB 3VA2C 4WEUD 2XRAH 1S7VB 2VABB 4Y5YA 3K7UA 4ZAKD 3JZ7A 3KYNB 2CO7B 4KK9C 3B9KD 3RPIB 2PW1B 5DEFB 5E94B 4HLZH 4CADB 3KPPA 1ZGLA 1A3LL 3QEQD 2R1WA 3B3IA 1TJHH 3O4LE 3W2DH 5I1HH 3QFJA 3SE8L 5E9DD 4NN5B 3U6RB 2UZIH 3KJ4C 4I2XA 4NQCA 1X5HA 3GI8H 4EUPH 1FFOB 1KTDA 5DXWA 1K85A 4K23L 3ULUF 5TQ0H 3ILQC 2HMID 4LSUH 4Q6IA 1W0VA 5ABDE 1QSEA 1RSFA 1DN0A 2PYEB 5F93C 4LKXB 1PAMA 3U0PA 2BJML 5HDOA 5F7LB 2HH0L 4HFUL 1E6JL 5IQ7H 1MJ8L 5DS8B 5HVGB 2C3GA 1EZVX 4MNGA 5IVXF 1MRCH 5KVFL 3GIVA 5BXFA 4CL7A 4X99A 4L4JA 3G6DL 3RWGB 5D1ZC 5LGHH 1GOFA 4JFEA 5GSVB 2OK0H 3IYLW 4A6YA 3QJHA 2AABL 2NZ9C 5JUEH 4PJ9D 2Q86A 1A6TA 5CSZB 5EUOB 4P46A 4OLUH 2V17L 1XFPA 3RL1B 4K7FA 5I15H 1Z5LA 4Z7WA 3H0TA 4YHMH 5C1MB 1CFBA 4X4ME 1OTSC 2I9LA 3OB0H 1LEIA 4WO4A 3D39E 3CH8A 3MLZH 5ELIA 2Q87A 1LEGB 3QIWC 5SWSE 4ZPTB 4MDJA 1T66C 1D9KD 4KTEL 1WZMA 1Z9SA 4ODXB 2EXWC 4E5XB 3ISWA 3MLXH 4JFOA 4HIEB 4W6WB 3VH8B 1A1NA 3P73B 3HPLB 1AKJD 1OLZA 1JHTB 3I6GB 3L7FB 5JDSA 2C3WA 2CGRL 5C70A 4ZNEA 3BT2L 3IU4H 4JPIB 3EO9L 5BRZD 1E4XI 4URTB 1GC1L 2BFVL 4RSVA 3CUPA 2RHEA 3QO1B 4NUJB 3U9PL 3E6HB 4OQ1A 4OT1H 1YNKH 2Y4SA 3K1DA 4M8QB 4W6XB 1IKNA 1RUQL 3KWWA 3IDXH 2VDRL 5DT1H 3MACH 1SJHB 1HHJA 4MJIE 1BZ9A 5ACLA 1X7QA 3ULSB 1T1WB 4HX1A 1NLDH 4LPXA 1LMKA 4R90H 4TNWK 3L5JA 5LBSH 3NZ8A 2Y5TB 1M6OB 5CJ8A 2DQUH 3DECA 4EVNA 4QRPB 1AI1L 2XN9A 1YYML 4PR5A 3KXFA 3OKMB 4XPTL 15C8H 4MSWA 5ALCH 2ZCHL 1DQLH 3P0VH 5IB5B 1OQOA 2XZAL 4Y5YC 3HE6A 4XNMA 3IDIB 1JGVH 4NQUA 3L3HA 3MYJB 4HUXB 2RB8A 3I02A 4OB5L 3DURA 3FFDA 2H32H 2NY3D 1INDL 1FFPB 3NIFE 4WY7L 3MO1B 1JF1B 3O45B 2R0WH 4L1HA 2QADB 3QDGD 4HS6B 3CFEA 3VA6A 4LEOB 1VADA 1CFTA 3H9SD 3MV9E 2W9DL 4J4PA 1D6VL 4M9PA 4AM0A 3K46A 3WKMH 3HMXA 1A21A 4WW2C 5ACZA 1M7IB 1MFCL 3VXNB 4PJ5D 4Q6IC 5EUOF 5GGSA 1YEKL 4U1NB 3RWCB 2FD6L 3OKKB 3H42H 3DUSB 2CLRB 2P42B 2RGSA 3A0OA 4LCUA 4WFFD 1Q72L 3VXUD 3AS1A 1HH9B 1I8MB 3ZYZA 1HXMA 3MRKA 1EO8H 5CIPA 3MJ9H 2RBLA 1U8HB 3LDBC 4FFVD 5FKAA 4FZEL 3QB7C 4Y8DC 5IVZB 4LP5A 4QXUH 4D9RD 1C12B 2WWMC 4PRIA 1HN1A 1TFHA 4AT6A 1CS6A 3MRCA 3W81A 3MR9A 2UYLB 1ZK9A 5MP6L 4TPRL 1A3QA 3BP5A 2J4WH 3BSZL 3MV7D 4LVNC 4P46C 3ULUL 4ORGA 1QFOA 4R6UA 4RMRA 1QEWA 4K55A 1W8OA 3MNWA 4N8CL 4E9LA 3T0ED 1WFOA 2HA1A 4OV6F 5BV7H 3PQYB 3LQZA 4FMKA 4WFED 1HNGA 4R3SB 1QOKA 5DVLA 1KXTB 3E0GA 4KXZI 5KSBE 3T2NL 5EUKA 2CDFA 2WINA 2VZUA 4LCWA 1WWBX 3O6ML 1ZT4A 3DXAD 4KUZL 2FYYB 5F6HJ 4M9OA 5FYJH 3BP7B 2JE8A 2X70A 3N06B 2GW5A 3RVUC 4JM2D 5ADOH 2VDLL 4K7PX 5EBMA 1VENA 1E4WL 2EKSA 4PJIE 3BVNB 5I17B 2BVPB 2AJVH 3QUYA 3F7PC 3LKSB 3V6FB 2VXUL 4KI5F 1KCRH 1LO2H 4P23A 3RWDB 2EH8L 3CPLA 3KPQB 3PABA 3O3AB 5L6YL 2NY7H 1A2YA 2BVOB 5IJVA 4NKDA 3S98A 2AP2A 1OGAB 3OGCB 4P2RB 4K94H 1YQVL 2VLRD 1F02I 4Z95L 4M61A 3OX8A 5CZXD 5J8OA 2IC2A 4IHOA 3P11L 3MRMA 1H3GA 1NCBH 3VFSA 4PP1D 4JQIH 3DVFA 5FYJU 4FQ1H 4EUPB 4YFDB 4PLNC 2H3NB 4F15C 4S1SH 3LN4A 1YY9D 4MAYA 1AXTH 2NY5L 3MLRH 5C92A 1JN6A 2KUTA 4BH8A 1YEHH 4ZAKB 4XI5D 4WNQA 3IFOB 3KAAA 4PJXE 5FHBL 5FYKH 4EQ2A 3QDMA 1KELL 3B9KB 4J4PC 1XGTB 4X6BA 2UZYB 4RQQA 1JYXA 3WXWL 3QEQB 4NWTL 2EXYC 3W11C 3WD5H 3IS1X 1ZAGA 5E9DB 1LEKB 2GITA 3DO3A 1MCIA 3IDJB 3TO2A 4J12A 1F3JB 1MCDA 1FG2B 1NBZA 4X5WA 4TSCL 3V4VH 3V6BR 4UDTB 5KANI 3DSNA 1EBPA 2WBJB 2DBLL 4OGYL 4Y5XA 4DGVH 5FKPB 5IB3A 3JSSA 2VWEE 5IBUG 3MXWH 2CRYA 3MLYL 3ARPA 1AGFB 3IFLL 5IHZA 1VB9A 4FQJL 1LE9A 5J9PB 3BD3A 1SJVA 1TVBA 2DYPA 3IDGA 3ZO0A 4E0RB 4TSBL 1A6AB 4NBXB 4XNXL 4MQ7A 5GGTL 3WLWC 4MA1C 2GT9A 3LKOA 1BFOB 4JAMA 1NBQA 4X5XA 2BVYA 5C0RH 3X13A 5E1AB 5KVEH 1FYTE 5D71L 3BKCH 4Y16D 1HILB 43CAB 2WP3T 5FYKU 5K9KB 3MA7B 4JY4A 2VLJD 1CT8A 2EDNA 4PJ9B 5J6GB 1NFDE 4X7SL 5E99L 4QHUA 1UM5H 5CCKH 4KRLB 3MJ7A 4AL8H 3WLBB 3WNPA 1MREH 5D7LD 3ZHKA 2NTFA 4JN1H 1LK2B 3SDYH 1T7VA 4ELKB 4DVBB 4FQQB 3UROR 1U95B 5H94B 1AD9B 1GHFL 4PJDB 2F54D 1T7XA 2D7NA 1MCRA 2NY6D 2G2RA 3D2UA 4K7PH 1YN6B 2VXSH 1U6AL 3HNTL 3QBTB 4ZTPL 1ZA3A 4DK3A 2WIIA 4QRRE 1D9KB 2CPCA 2Y23A 1P4IH 2E8YA 1OTTC 3FB7B 4HIXH 5HYFA 4WTZG 3QUYC 5GJSL 5EU6D 1C7SA 4P23C 1AO7D 1PFCA 1YEJL 4PRBB 1AKJB 1OAYH 5AAMA 1KB9K 3UAJD 1RU9L 4XT1C 5FYLD 4Y4FC 5BRZB 5LVEA 4U6YA 5GGUA 1YEDB 4NNXA 2E6JA 5I6XC 2WIMA 5T1DH 4LSQH 4YHOL 5IB2A 3NGBC 3U4BL 3BYYA 5DD0H 4GQPH 3I9GH 1JRHI 1WFTA 1QFWL 3WMSA 1PZ5A 2LAGB 3ULVE 5I66A 5IKCB 4C56D 3STZB 2R9HC 4GKZB 5F6HI 1EEZA 1A0QH 4RGNC 2Z4QA 1F4AA 1DEDA 3SKNB 4XP4L 4UT7H 5KOMC