3ZHLA

The crystal structure of single domain antibody 8-14 scaffold
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEWVSLISGSGGSTWYDDSVKGRFTISRDNSKNLLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MG8-14 SCAFFOLD ANTIBODY
publication title Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zhlA00
1RZ8B 1CXLA 5C0BE 4WW2C 1NUDA 2PTTA 4A2MA 1FPTL 3BD3A 4F2MB 4HS8L 4YHIA 3KPPB 2GT9A 1KTLB 3B5HA 1NCAL 4LNRB 3SPVA 2FB4L 1NMAH 3NPSB 4BQ8A 2R2HA 3KJ6L 3RDTA 3RIFK 2MHAA 3S34H 3MV11 5HHMB 5C0GB 1QBLL 1I3GH 1SJEA 3DGGB 4G7VL 2APWA 5TQ2H 3TPUA 3C60D 3DOSA 3MREA 5D96C 1PG7X 1EFQA 4JG1H 5ENWA 5IKCB 4MD5B 4BKLB 4BFGA 3BKMH 3GSWB 1T7ZA 1RZGA 4QOKA 4YIQA 5ELIA 4FQCL 1E4XH 4PJBA 2XZCL 3DPBA 5HGDA 4YO0A 2D31B 3E8UH 4IMKA 5LGJB 1S5HB 3T3ME 5AWNH 3PWJB 1TITA 3BIAX 5EU4B 4EOWL 3Q0HA 5BJTA 3MJ7A 5HHOA 5IBUB 4IDLA 2APFA 1IT9H 2F54E 1MPAH 2AJXL 2FGWL 3CFJB 4NKQB 5FYKU 5B3JF 5JNYB 3NCBB 4XPFH 4P4KA 4A6YA 1LK2B 1MRDH 4WW2B 4R96B 3O8XC 4NKOB 3BKJH 4O58L 3REVA 3UTTE 3QDMD 1ZKAA 3HAEB 2VXQL 3ARUA 5BMFL 3VCLB 2AEQH 3DARA 4XPAL 3MLZL 5HGGS 4Y5YA 3MA9H 3BMWA 4OFDA 1K3IA 3SE8H 1NBVH 3MNVB 4NPYB 5EN2A 3MBXL 3UO1H 5D96B 2XG4A 1U8IB 1EAJA 3QCVL 2DQUH 1HHKA 5GGSY 4XCNB 3KPMB 4F7PA 4V1DE 3TO4C 3EW3B 4KK8C 4NSKB 4RBPK 1FORL 5B38G 5I15H 1F6AA 1A6UH 1YA5A 1MFCH 2GSIB 2BSRA 3FRUA 3MCG1 1FN4B 1JF5A 3OKEB 2V2XA 1IBGH 4G9FE 3LIZL 3EO9L 3PDGA 4TUJA 1O7SA 2YC1A 4PGCA 4DGVL 4BSVB 3JXAA 1KN4H 1WTLA 1WWWX 3QPXL 2VQ1B 2M2DA 3QEUA 3O8XB 5EOTB 5KAQG 2Z93B 4P99A 3L6FB 1QSEA 3JV0A 1ZS8A 5IWLC 1KJ3H 1CGXA 5HVHB 4KZEH 3UPRB 2W92A 4LCUA 3CVHL 3VWKB 3GJFA 2R9HC 3VFWB 5HD8D 2VL5B 4WTZA 3CDGB 3MLTB 1NSNH 1R5VB 4M93C 3S35L 2X42A 3TO4B 4BUGA 1RZ7L 3CCHA 2P8LB 3N85H 4PJ7E 1SEBA 4ZAKD 4CRPA 4NT6A 4KK5C 1GGUA 1M1SA 4BQ9A 2FX7H 2B7DT 4ELKB 2PXYD 1DQLH 3R8BB 2OR8A 1KJVA 1DLFH 1HHJA 3S97C 3QIWD 4R90H 4I3RH 3EDDA 1FIGH 5FYLH 3BGAA 3S4SA 4GT7A 4KC3B 2Z92A 3ZLQC 3T2NL 2FO4B 2VZ3A 3RX8A 3MLPA 2CXKA 4DK6A 1X4ZA 2DWEA 1TTUA 1T89C 3NVQA 1T1WA 3ZE2E 5DD1L 1FL5A 1PLGL 3V0WH 3HMXA 1FLRH 1AI1H 4LCCA 1TZIA 4ZPVA 4XCFH 4MQ7B 4XMKL 2VSCA 2DQJL 2VKXA 2YN5A 4M93B 4RGMC 5GJSH 2YEZA 4OZGB 4W81A 4TVSa 3T2OA 4R3SA 3T77A 2W9LA 4L4VA 1FPTH 1FZKA 2IJ0C 1TJGL 4NC0B 3TESA 3V5HA 5GZND 1Q9WB 1QFWH 1RZKL 1NCAH 4D2NA 3V5DA 2FB4H 2PO6A 3BDYL 3OKLA 3UAJC 2Y4SA 3CLEL 1I7ZB 3EHBD 2BNRB 4F33A 3DV6A 2MPAL 1JNLL 1OSPH 3SE9L 3X14B 4G7VH 5I8EB 2Z4QA 5K9KB 3I2CL 4F7CB 4TUOB 4NZRL 1HHIA 3CZJA 1R5IB 4J1UA 4LLUA 4KJYA 5D7IB 1AD9A 1I1YB 1IEBA 1RMFL 2J7LA 2YR3A 3WO3B 4JPVL 3OSKA 1KPVA 4RZCB 2I9LB 3C8KB 1F02I 4OGYL 5J4MA 1U3ZA 2J8HA 4LCIH 1QBML 1NFDF 4AIXA 2BSSB 1JYWA 3MRQA 5CSBA 3OHXA 2Z8VC 4RGMB 1XGYH 3GSNA 2E8YA 1BZ7B 3BPCA 5EORH 4QT5B 1RJCA 1OCWL 1MLCB 1B0GA 2NZ9C 1MJ8L 1WT5A 4PLNC 4QRPD 2OI9C 3ZDYE 5C0BB 3JV6B 5JUEL 1VENA 3VXRD 2Y6SD 1FZJA 1LP9E 3MXWL 3ECBA 4L8SA 5DEGB 4RFOL 2AEPH 1YMHA 5JW5B 3QHFH 1H3UA 1N59B 4XPAH 5SX5H 3VFMA 4YHPB 1W0VA 3VXSB 1KLGB 4XVUD 1CFNA 3KPRD 3N9GH 4BJLA 2YSSB 4QHMA 1V7NL 4I1NB 2VR9A 2VLRA 4NP4L 3QCVH 3Q48A 3S5LB 4L4JA 1OTSD 1UM6L 2AJVL 4HV8A 5IK3B 5CJOL 2DMBA 1LHZA 3W5MA 4DW2L 4D0BB 3GO1H 4APQA 4GKZA 4PRDB 1XGRA 4LOUD 1D9KA 4R8WH 4TYUA 1T0MA 1AC6A 4MGXA 2J1KA 3PE9A 1V3LA 1J8HE 2F54B 3AVEA 3IT8D 1E28B 3HAEH 5IB1A 1QSFA 2DI7A 2QQLL 5AAWA 1A14H 2OI9B 1WUNT 2I60H 5FOBB 1QKZL 2BVOB 3PHOA 4LVEA 1GOHA 2EYRA 3BE1L 4OZ4B 3BPLC 1BFTA 4YWGH 1AY1L 2OXGA 3QFJE 5IP4A 1KENL 2C4FU 1YEFL 1FYTA 3INUL 5KBNC 2UYLA 1CFQB 3OF6D 5KSAC 1BQLH 4ZUUA 3RP1A 1NC4B 1AQKL 1EEYA 3RWGB 4U1HA 5T1DH 4ZOAA 1I3RB 1G1CA 5BQ7A 5C6WH 2X4TA 1Y6KR 4V1DB 5DJYA 4YXHH 4IS6A 4P9ML 4LVHC 3PWNA 2HT3D 4HWEL 4Z0XA 3CLFH 1YEIH 3C6SA 4PJCF 1NCCL 2E3VA 3BEWA 4M02A 2YPKB 3W0WA 3BW9A 2ZSVA 4GG6F 5GHWH 3QPQD 3GIZH 2YA0A 5HGHA 4NN6C 1IGTB 4X7FC 1U3HD 5FHBH 5B22A 3WD5H 4Y16C 2HFGL 3BPOC 3VXME 4PG9A 1M7IA 3B8SA 1UB6A 2VZVA 1AIFA 4ZOEA 3UROR 4HFWA 2XWJB 5DD1H 1DLHB 1PZ5A 5TE4H 3SDXB 4XH2A 1PLGH 5EU6E 4DWHA 4LLWA 4X99B 4XMKH 5KSAB 1I1FB 1CLZL 3O0RL 5F1NB 3VW3H 4S2SB 4ENED 5T1KB 4P23C 2NX5A 4HPYH 4WW1A 5IMKB 2V2TA 1XF5B 3EJYD 2Y36L 2P5WD 4NNPL 3H7LA 4OCWL 4O51A 3NIFF 4HIIA 4LVHB 1I8LA 4PJ7B 3CIQA 3BDYH 2QEJA 1YYLL 4R26H 4DVBB 4OZFA 4XZUB 1DQQA 1HKLL 4OUUA 1NBQA 3WUWA 5JW4R 1ZT1B 4H88H 3SE9H 1KBGL 1YPZE 1WC7B 3ILPB 3X12B 4O02H 4NN6B 1CD1B 2BVTA 1EAPB 2V7HA 4YHLL 2CH8A 4H1LB 4LGPB 4EDXB 4LHUD 3QUMA 4KKBC 4PJFE 4MJIA 2APVA 1RMFH 4Y16B 4JPVH 3BPOB 3I02B 2V2WB 5JO5B 4LIQE 5JXEA 5T5FH 1FO0A 3V0VB 1S78C 1UM5L 4KDTC 2QJDA 4JY6B 4MS8D 3HE7D 4WTZG 1A7RH 5KSBE 1ETZB 1URLA 2EKJA 2GFBA 3GIVA 3U36A 3VWKD 1KCLA 2H6PA 4K7PX 3SDDD 3IDUA 3FAWA 1WBZA 2K7PA 4P23B 1FFPB 1LEGB 4KK8D 3MRPB 1XZ0A 1OSZA 3U79A 5F7LB 1HYRC 5DJ8B 2EDLA 5IG7A 4M1DH 3T65A 2JJSA 4JFEE 3S4SG 4PGEA 4UBDD 4DVRH 2XN9A 3VA6A 4NP4H 1YMMD 4P48A 4F9PC 5D5ME 3JSSA 5I9QC 2AJVH 2XY1A 1ZLWH 4N5ED 2YD3A 3MODL 2X6MA 3TFKC 4YHNA 4HIHB 2YD8A 1GC1C 1L7IL 3LKQB 1NC2D 1BFVL 4JY4B 5T33L 5DWUL 3L9RA 4AG4H 5IR1A 5I1CL 5AZEL 1S9VA 1BPVA 1WFTA 1RHHA 1W72L 3MROB 4KJPC 2VAJA 2EDOA 3G6AA 4KFZC 5E56A 3TBVB 1DQJB 5CSGA 3ZTJG 2YD7A 2MQ0A 3ULUE 2FZ3B 1BF8A 25C8L 2OQJA 3HR5A 4FFZL 4NQCA 5E8OA 4MJ4A 5CJXA 2HLFD 1BREA 4WGVB 1LP9B 3DJ9A 5LXGL 3WKNA 2EO1A 3NIDE 1WCBA 3LQMA 3GRWA 3X11A 4M1GH 2XTLA 3C2AH 4OGAD 4MHHG 3SDXF 2WINB 2ICEA 1LE9B 3GEWB 1MCKA 4MXWH 2E6JA 4LRNL 1DSFL 1OPGH 1QFPA 5I9QB 2HRPH 4YXLH 3KPLB 4OZIA 1MAML 3LKRA 3OR7A 5J11C 5C71A 4HWEH 3E6HA 1NCCH 4QHNB 3PHSA 1YYML 2NPLX 4DN4H 3D2UD 3WIFB 5FKAB 1U8JA 5B39A 1MCWM 3UYOD 2FX9L 1JNHB 5I1IL 4WIQA 2R1WA 3D18B 4PRNA 2DQHL 3S96A 5C2UB 3JWOL 3BEVA 1NDGB 1OF2A 3RJQB 4Q97A 1D3CA 3MLXH 1YEKH 2H32B 3UTPE 2R1YA 5DJAA 2ZCKL 5KVDH 5MP6H 3IGAA 4B50A 4NYLA 1JZ2A 4PJEF 5IFJB 3SO3C 4DCQB 1CDUA 4ZDHA 1H15A 4HXBL 3ARBA 4JN1L 5INCB 4C83B 2IBBA 4JREC 4IRZH 3QFJB 1A3LL 1TIUA 1F11A 2ADIA 4M6OL 2DLIA 5ESQA 4KKLC 2R2EB 4NBXB 4U3XA 4IEFB 1UH3A 4KQ4H 4WY7H 2Z8RA 1YEEL 5J11B 4PJAA 2FJGB 1S7TB 3L7EA 4PGBB 4F9LC 3DTXA 3QG7L 3VXNB 4QHUA 2AQ2A 4LF3A 3MLSL 1UZ6E 5DR5L 3QNZB 1WFNA 1CD8A 3MV7E 3HG1A 2VLKA 4PY8I 4WHYH 4WI3A 3IDXH 2JCCF 1I1RA 1VEOA 1LDSA 1TZGL 2OR9L 2AAVA 4YDKL 1F58L 4M62H 2AXGB 4PRHD 2XXMB 1EHAA 1RIVL 3SO3B 2HWZH 3VXMB 1E4KC 1P7HL 3H6JA 4R7DA 5SWQB 1UM5H 3FMGH 3ARZA 1J5OH 2BHUA 4JREB 4RMSA 5EU6B 1HDMB 2Q7YB 4PTTB 1P4BL 5GS2D 3HNTL 1OGTA 2P44B 4JZOA 4MXVE 4RQQA 3I50L 4KVNH 4PRPE 1CTNA 5F9OL 3RGVA 1I4FB 3VXUD 3O41B 1MAJA 4WV1C 1SBSH 3EUUA 1KPRA 1KN2L 4LDLB 1MCRA 3HLAA 3PJSA 5T3XL 2QKIA 4H1LH 5HGAA 3LQZA 3PF2A 1WAAE 4QGTA 3HI1A 5E95B 3SDCD 2AV7A 4V2BA 2WANA 1I85C 4JQIH 1CZ8L 4JFFD 1TTGA 3CDFA 5D7JD 4WUUD 3CMOH 1T2QH 3DSFL 2Z8WC 4KTEL 5C08B 4PREA 3K4ZA 3V4UL 1T04B 2H2PD 3MODH 1MFEL 4PJFB 1FFNA 3DX6A 5AG8A 1AKJA 3FT2B 3WJJC 2LAAA 2CLZB 1MNUH 2YK1L 4OZHB 3TYFB 5I1HL 2P8PA 1QYGL 2G5BB 2P49B 1NUNB 4OF6A 4EJ1C 3KNBA 3T1FA 1MEXL 5I66B 4CADA 5TDOB 4XC1L 2V17L 2HFEB 4EBQL 2H26A 2IGFL 1UZ8B 1N7ML 2GCYA 3CU7A 4NRXB 4PTUA 4ZNEE 4LAJH 5CZVL 5K93A 4WV1B 3ARQA 3GSOA 5GRZA 4PJGE 4OZFG 4XAKE 4JFDA 4Z7VA 1KJ2L 3WUWG 4U6XA 2Q6WB 1U8LB 1EUTA 3GJFK 2DIBA 5E4IA 3G6JF 5H35B 2QR0A 4D0CA 4NWTL 3CSYA 2IQAB 4KJWD 4XNYL 3D39D 4JFEB 5BZDB 2G5RA 4BQ6A 1P84J 3HCVA 5JW3L 4QRPE 3MLYH 3UYPA 4UZGA 3VXRE 3EJZD 3UC0H 5DRWA 2DLFL 1DUZB 3STLB 3PIQB 1HILB 4HKXA 4BSJA 4MX7A 5DGQA 1NL0H 1QVOB 4OCLC 1GL4B 2CKBB 3Q5YA 3T09A 5E94B 5BS0A 2YD2A 3UTQB 3MX0A 1Q9LB 5CKGA 3ZMRA 4MMXC 4G8EA 2FYYB 5DYOA 2FO1A 4N0FA 5I1IH 2BJML 1I8MB 5FCUL 2ZOKB 1U8HA 5ITBL 3IDMA 2H3NB 2WZPD 3W9DB 1P1ZA 5GS1C 3RZWA 5HI3D 5CS7A 2XXCB 4F15C 5DMKA 3ZHDA 1JZ3A 2EEAA 2VDRL 3T8XB 4HF5L 1GZPB 4OD2B 5D6DC 5IOPB 3IDYC 5DO2C 2N56A 5C0CD 4NZTH 3MRCA 1ZHNB 4M6OH 1GC1H 4HSQA 5ESAA 3V6OE 2ARWA 5D71H 1ZE3C 3CFDB 3SJVA 4CDGC 3OR6B 4UTAH 4TRPH 4Y2OA 5DSCA 2R56L 1UWGL 2MNUA 3MCLL 4JG0L 1DQDH 2DQGH 3GSUB 4YDIL 2F74A 3QG7H 4CW1A 3EO0A 4JZJA 5DR5H 4JO1L 3A6OA 4K7FA 2H32H 1HH9B 4OIAA 2GAZA 1ZLVH 2AJ3A 5ICXA 2HAZA 3WFBH 2EYTB 4M1CD 1I8IB 1KPUA 4QXWA 5F7MC 2OR9H 1JUFA 3F58H 2GEEA 4HBQA 2VR4A 3GM0A 4Q9QH 4OD1H 4BZYA 1S9XA 1HQRA 2IH3B 5GS1B 4UT7L 3M1BB 4F15B 1FHGA 4X8XA 3A6CL 5MEND 4LKCB 4QF1A 3TBYA 4G8GD 1TLKA 3U9PH 1L9MA 3IDYB 3CH8A 4WEBH 3HPLB 4JB9H 4OZHF 5F9WC 4LU5H 3I50H 3P4NB 3QISA 5KVEH 1N4XL 3AUVA 5F9OH 3QWRA 5E2UL 4FQXA 1MHCB 5CSZA 35C8H 1BVZA 3IDNA 1PBYA 3EYQD 1GJIA 1BF2A 5B39G 3V6ZA 2B4CC 3DUHA 4F7EA 5DLML 4HGKC 3MV7B 4XWGH 4HMCA 2AVGA 1OD7A 5D1XC 1CZ8H 2ZUWA 3IFOB 2AQ3A 2GJZB 5IB4B 2J88H 3CU1A 5DC9B 4HUUB 4MDJA 5DRNB 3AGVA 2P5WE 5EU5B 4P3CH 2DMKA 4OV6F 4MZ2A 3O81A 1MFEH 1U8KA 5MERA 3MUZ1 1A6VH 1A5FL 3IDGA 5DD6B 4XXCC 3VFRB 1A9BA 1IL1B 1XGTA 1XR8A 4CVUA 7FABL 4Y4HD 2IFFH 1ZT4B 5J3HC 2ADFH 4Z78A 4DAGL 5JOFB 3KXFD 1N6VA 3RRQA 1OW0A 4GBXC 5JPNB 5F9WB 5EUKB 3KAAA 1JIBA 2IGFH 1N7MH 5MHSE 4R4NC 4XI5C 1CS6A 3G5YB 2ZCHH 5EU3B 4PRPB 5EC2B 3MZTA 4PJ5E 4JY5H 4WFHD 4R4BB 4KPHL 4NNXA 1HSBB 2GK0B 5I76B 2DQDL 4UT6L 1YQ2A 1KIRB 1K2DB 2VXVL 4P0DA 5D1XB 4FQLL 2D7TL 5DHVB 1ZSDA 3F5WA 1IQDA 3W39B 3FQNB 3RL1A 5FM4A 5JW3H 2X9WA 1BVLA 5T3XD 4S1RL 2ADGA 3LDBC 1FG9C 4L9LA 1XT5A 3UYRH 1R3LA 3QXDA 1DR9A 4JE4B 1QACA 3S35X 3DNKA 3KPNA 4UQ3A 1LO4L 3I3EA 1X9QA 4PJXA 4D0DB 4KDWA 1VFBB 3RKDC 5GRJL 2E7BA 1DBJL 1LEKA 5I71C 3MYJB 4GBXB 2BJMH 4J4PD 3WSQL 1UXSB 3C60A 1S7XA 5FCUH 3B2VH 3MLUL 3O2WH 5TDNB 1GCFA 1JMXA 1DEEB 4MDIA 4MNQE 3BGMA 1H3TA 2AJUH 3E6FA 4QLRA 3ROOB 3TIEA 4NN5C 4PJGB 4AIZA 3QUZC 5C6TL 2FBJL 2X9XA 1DBBL 1MH5B 4U1NB 4RX4A 3VA2C 2VDRH 3NA9L 5HI4C 4HF5H 1UH2A 5EBGA 4WUKL 3RY6C 1HWHB 4ZTPH 2GIYA 2AJYL 2CKBH 4WO4D 4AYFA 4YDJB 2EDWA 3NZ8B 2VQUA 3V6OC 4RAVB 5C08D 3LDBB 4MAUL 1T7VA 2IPUG 1Y0LB 4YQXL 2JKXA 5IQ7L 1UWGH 3MCLH 4RIRB 4HPOL 1U8QB 3D9AL 1OM3L 3L3KA 3BH8A 4UINL 4YDIH 3TIDA 3GMPA 2MKLC 4MJ2A 1UWXH 5IVNA 1N8ZA 4JVUA 4JO1H 1BZQK 4HCRL 4OB5L 4ZYKA 1W0YT 5I71B 1KG0A 4NO3B 3CFEA 3LN5B 1VDGA 4NCDA 3BWUC 1EPFA 3Q3GB 3R06B 4WI9A 4D94A 1UXWA 3UJJL 1XF1A 1T5XB 2DRUA 4UT7H 4NN5B 1SYSB 5ACZA 1F4XL 3QUZB 4RAUB 2QSCL 4YX2L 1DL7L 3LMJL 3IAGC 4U1SB 4KHXH 5ICZB 4XVTH 1HHHB 2EDNA 5F1SA 3S88H 2RCSL 4ELMB 2ED9A 2XA8H 3FQXB 4I48B 5F1IB 5F8QC 2ZOLB 3RWCA 4C59B 4LLYB 1WEJH 5J6HB 4Z18A 1N4XH 5DJXA 3NCJH 5GISL 3JBG7 3SKOA 1C7SA 4NO5A 3MR9B 3V8OA 2QQNL 3RZCC 2B20A 1KIPA 3W81A 2ADJA 5KJRL 1MCDA 5C0IB 4N90E 1FZOA 1MI5A 1LO5B 4MB5A 1J1XL 3K4AA 1KNOA 1IGCL 1NLDL 3RVXD 3G04B 3SBWC 3WHXA 3QAZC 3TNMA 3BVNA 3NACH 3K2MC 3K8KA 4FMFA 1DVFC 1IILE 5T3ZL 1G0XA 3TBWB 3LEVL 1EFXB 3MRGB 1JF1A 3R0NA 1F3JA 1UH4A 5DJCA 1JFQH 4UAOC 5E70A 5GGVH 4ZAKA 5ICYA 7FABH 1BX2A 3RVUC 1UACH 2PXYA 3BP5A 4XTRD 5HY9B 3DX8A 3FOLA 5GGSB 3X3GL 3QIWA 3RTQA 4G9DB 5EO1B 3QIUD 5DD0H 2OTPA 2PW1B 4Z5RA 3T0ED 4PRHE 3OKKB 3VMNA 4JO2H 1JGLL 4OUOA 2BY0A 5C9JB 1FNEA 5EFIB 4WWID 3OXRB 5ADPL 4LSVL 2P42B 3PWUB 1T22B 3F7YB 3RZCB 2G2RA 1U2HA 3MRFA 5GGTH 2XRAL 3CFBA 3JTSB 1MWAL 1MF2H 1RJLB 2DQDH 4UT6H 2NW2B 1B88A 4JHAH 3VG0L 5IFHH 1G7PB 2EIZB 4FQLH 2D7TH 2CIIA 3VFUA 3QAZB 1E27B 2UWEF 2B1HH 1INQA 3BYYA 4IOIB 1Z9LA 4NN7C 3K46A 1NDMA 2XKSA 3VXUE 1DVFB 2YKLH 1B6DA 2HFTA 1TVBA 5A2IH 1RIHL 4QTHA 3KLAB 4OKVA 4UAOB 4KKAC 1FV1A 4G6FD 5EC1B 3BPNC 1I9RH 32C2B 2IEPA 5DRZA 1PY4A 1N2RB 1BJ8A 3BP6B 1LO4H 1J9CT 3RWDA 1YJDC 3O2DL 2XZZA 3V6BR 2GTWA 1A21A 4OCSL 5GRJH 4YAQA 1DBJH 2CDEB 4R9HA 2C1OB 2GW5A 2PYEE 1EHLH 4JPWL 3MUGA 3MLUH 1F5WA 1KC5L 3KYOB 3WL9B 1JWSB 1FNGA 5FA3B 3PWLB 2B4CH 3L3IA 3QSKB 2HH0H 2V5TA 5DHVH 4XMLL 5GGQL 1JHLL 4R4FH 2BCKB 2BOBA 4PJ5B 5C6TH 3KDMA 4NUJB 3TC9A 1U8OB 2VE6A 1NCUA 2DICA 1DBBH 1ADQH 4U1IA 4JANB 1UB5A 1AXTH 1I1AC 4WUKH 5HPMA 3GMNA 1JTPA 4FZ8H 4HLZH 1I3UA 4NN7B 1N3NA 5LGHL 5D8JL 4QHKI 3EOTL 4YQXH 3SGEI 3ARDA 4FTVD 3O3AA 1CGUA 5GS0D 3BPNB 2MWCA 3C5JA 4XPTL 3LKOB 1IKFL 3C08H 1HHGA 3O11A 4MD4B 5CEXB 1OWWA 5CLWA 4I18A 3D39E 4CMMA 4HCRH 3BJLA 1EO8H 4OB5H 3KPRA 2UV3A 1FGNH 2XNAB 3T4AA 5IT2L 4PP2A 3RWHA 1JV5A 3ZO0A 1HOCA 2C9AA 4XNMA 3AS1A 1ORSB 3CGTA 3T4YB 4G8FA 5C3LD 2VDKL 4OV5B 4AMKH 1E4JA 4MNQB 1LO0L 3L3OB 4OTXL 1T3FA 1TJHH 1CG9A 2JIXB 1GZQA 4M7KL 2VUOA 4QNPF 2BMKA 4YX2H 4O2EA 3CXDL 2GSGB 3PGCB 2SEBA 5FB8B 5L6YH 3VFNB 2XOTA 1I1AB 1NCBL 3LN9A 1BD2B 3MOBH 2WBWB 2EH8L 4GUPA 1BHGA 3VXOA 1T66D 4NQED 4WFFE 4C4KO 4D9RE 1UM4L 3B9EA 1KTDB 4AL8L 1YJDL 4ODUB 5T1LB 3O6FD 5GISH 3OKDB 4OIBA 2HT4D 1RHFA 2QQNH 4KH2A 2RQ8A 4AY0A 5BOZG 2JCCE 3GSQB 4UV7H 5E6ID 1U41A 4ODHL 4GRLC 1L0YA 5C0CE 1A3QA 3DIFA 5MEPB 3O4LD 1NLDH 2BHZA 3QEQD 3OF6A 4MNGA 4UOJA 2VXSH 5DQDL 3LVEA 4XPGL 5F7DB 3K1DA 4TSAL 4QY8B 4ODVL 4G6KL 4RMTA 5C0EA 4JDTH 4GW5B 4X4XB 4LSDA 1ULVA 3D48R 4PJIE 4TNWK 1QOKA 4UDUB 1KGCD 4YBHA 2D31A 3JVGC 5C8JA 2R0ZL 5KN5A 5JW4M 1ZT7B 2XG5A 2VZTA 1A0QL 1D5BB 3PWJA 2X4SB 4EUPB 4J3XA 1OTUD 5HDQL 5SWZD 2H8PB 4QHKJ 5D7SL 5EWIL 4J2XA 4XNXL 3DYMA 5JNYA 4M6AA 1JGLH 3IRZA 4GMSH 1U3HA 2VDML 4GRMB 5ADPH 4HXAL 4R96A 3UZEA 4F57H 5I1AA 3NFNB 3N50A 5EU7E 2Y5TB 8CGTA 4G8GE 3PGFL 1MRFL 5DJ0A 3PNWB 4MD0A 1Q0YL 1J05A 4JHWH 4JFZH 4GRLB 5FYJU 1B0WA 2UZXB 2X4UB 1NMCC 1EH9A 2VLME 1C5CH 4LDEB 3VG0H 3DYPA 4RNRA 1CK0H 1O7VA 4WFGE 3MNVA 5T5NG 2H41A 2MCPH 1WF5A 1FDLL 1U8IA 5HTSA 3CVHA 3KPMA 2ZJSL 2A2QT 1NFDA 4NSKA 5ERWB 4Z7NE 3BN9D 1CFSB 1MJ7L 4FHBD 2I26N 2W65B 2YMXL 4EZMA 4JGUA 2GSIA 5DVOA 4L8DB 2FHBA 4X6EB 3OKEA 1ES0B 5T3ZD 4OCSH 4Q0XH 1AP2B 1FFOA 5I18L 5ALBH 1S5IH 5D1QC 4EIZC 3L5IA 3K2UH 3MNWB 2CUMA 1K9TA 3QJFB 4OCYH 4GAYA 1TNMA 5HSFA 4Z76A 1S7RB 3QO1A 2MQCA 1ZLVK 4G8IB 4LHUA 1P5UA 4LPXA 5D2LE 5DMIL 2O5XL 1JHTB 3VG9C 5JIHA 4QRSB 2F8XC 3KXFE 2AJZB 3C6LC 4B53A 3RY4A 3HE7A 1A6ZB 3STZA 1NMCB 1FC1A 3B9DA 4BK4A 1AJ7L 3VWKA 2VLJE 4HUVB 3SDDA 5FYKE 1S8DB 1CL7H 4JR9L 5D8JH 3U7YH 4Y2DC 1QHPA 4PB9H 3K1KC 5DJZB 2NY6D 3EOTH 4WFHE 5IIEA 5A2LH 1EFXD 3CSBA 4UUJB 2F19H 1S3KL 3DURB 2RR3A 3VGDA 5IVZA 5F7YC 3DXAE 2WLZA 3U7WH 2VDPL 4JGMA 3HFMH 2E7HA 2R2CA 1EXUA 3QA3B 5D1QB 5KTEH 5LQBL 12E8L 1Z3GH 1ZVYA 5HYSA 2MCG1 3MFGB 1MFBH 1YMMA 4WI4A 1IC4L 3M07A 4LCWE 5JDSA 4KKCD 3RU8H 4TTDD 1HQ4B 3VG9B 4M61B 3MACL 5D7KD 2DBLL 3ZYZA 4WTXA 5IWLA 4M7KH 1H9VA 3VU2A 1NC2A 3GGWA 1SM3L 2D9CA 4KAQL 5C0AB 1IAIL 1DBMH 5TF0A 1U36A 4OD3H 5E2WL 5ID1A 2KQNA 3SDAD 2EH8H 1OAQL 3O3DA 43C9B 4OZGA 4UB0H 5CGYC 4Y2DB 4XRCB 1YJDH 3K0WA 4QRQB 4XBGB 4X80L 3OGCB 2ZNWA 4PJCA 4ZXBC 2JJTC 3AU1B 5DFVD 4LMQI 4MA3B 1LK3L 3BWAB 3FB7B 3WMSA 1H0DB 3AY4C 3ARSA 1BJ1J 1I7ZA 3ALPA 2DB8A 1RY7B 2DN7A 3SQOH 3X14A 5I8EA 3PQYB 5K9KA 1MCOL 4F7CA 5H2BB 2VB5A 1MVUB 1YDPB 1YNKL 3CUPB 4GAJH 1BLNA 4OQ1A 4YR6A 5D7IA 1I1YA 3FFCB 3HUJF 2P7TA 1XF4A 3NOIA 3C8KA 4OCRL 1N5YL 4YHML 4XVSL 4ZSOE 5F89B 5F3BA 5JLZB 3OAUL 3D2UA 3JV4B 4K3JH 4X8JB 3IVKA 5D93C 2BNUB 5HDQH 1ZANH 5D7SH 5EWIH 4KV5E 2Q87A 4YEFA 3WIHL 3WUZA 1NUGA 3GSVB 4PBWD 5J8OA 2IALB 2BXYA 3JV6A 4PRBB 2BC4B 4ZXBB 4AEEA 5CEZL 3DETC 5EU7C 1K6QH 5HPOA 4YHOH 2WUBL 4M6NH 5BRZD 4S1QH 4XNUL 3NH7L 3DROB 1G9NC 3L7FB 1K8DB 1X4YA 2NR6D 3VXSA 3MRRB 3PABB 4J3VA 2YSSA 4TNVF 3LHPH 3K81A 5CD5C 1QBAA 4WWKD 4JO3H 3S5LA 4Q9CA 2D0FA 2RFXB 3LKSB 4ZPTB 4EUPH 5J9PB 1X5KA 4M9OA 5IK3A 3SKJL 1MJ7H 4PJIB 1LDPH 1RULH 4G6JH 4P5TD 3W5NA 2VXTH 4FZEH 3AM8C 3MA7B 2RGSA 4PRDA 3VDAA 1H3GA 3L5XL 4FQPA 5D93B 3PWVA 3VFTA 3IDIB 4RGOH 5TPWH 2OP4H 3PDOA 5IVOA 4NKMA 5EOCL 2G75B 5IMOB 2IMNA 4QO1A 2B8OT 5H37G 2O5XH 2VDLL 3DV4B 4UNUA 3LV3A 1GAFL 3HRPA 5CKAA 1INDL 3QIBC 2B2XL 5DJ6A 1GPOL 4OZ4A 5CWSA 3WJLA 1LNUA 2B39A 5FGBA 5DZOA 4LPVA 1AJ7H 1UJ3C 1ROWA 4Y4KD 4X4ME 4JM4L 1M6OB 3V7AG 2EIEA 2LAGB 2VQTA 1AR1C 3TN0D 3PXJA 4JR9H 2GYSA 1SBBA 1FNSL 2B0SL 3VH8B 5HHQA 4HS3B 4R97C 1I3RA 1OVZA 4JRWA 3ARVA 1ZV5A 4HKJB 1YY8A 3O45B 2Q7NA 4PJ9D 2VIRB 2YPKA 1PD6A 3SDCA 5HDBE 3K7UA 2JLLA 3PWPB 4WUUA 1QLFA 5D7JA 3BO8B 1FL6A 1G7JB 4HC1L 2XTJE 3CFIC 1TCRB 4LMQE 5HHVL 3BYTA 2HG5B 4PLKD 1G9NL 1CCZA 5D2LB 3BT2H 2DBLH 2YPVH 1NJ9B 1HZHH 3WIIL 5FHAH 4WI5A 3ARYA 1CFVL 3QIBB 4Z95L 2R1XA 2GQHA 2XWJA 3OJMB 1DLHA 2HTKC 1X5AA 1KEGL 3SDXA 1OAZL 4MSWB 5E2WH 1UJ3B 1EEZB 4N0UA 5AD0B 4RSVA 1C16B 2VLJB 5KSAA 4OF3A 5F1NA 2X70A 5F96H 5E2TL 1KELL 4R97B 5IMKA 1UQSB 1XF5A 1IM3A 2IAMC 5GRYA 2WP3T 2X4PB 3I3DA 3P11H 1SY6L 4PJ7A 5IB3B 3MRKB 3B43A 3KYNA 4GLRI 2R29L 3DXAB 4MCYB 4CU7A 1CVRA 4P46C 5JQ6L 5J7CC 4LRIC 43CAB 4CVXA 3L3JA 5I19L 1WC7A 4LHUG 3K80A 4QRRE 4Y8AA 1U95B 3X12A 3QP3A 4OF0A 1YNKH 4UI2A 4PJEA 1EAPA 2OSLB 4H1LA 4YBLC 4LCWB 4EDXA 4PJ8D 4Y16A 15C8H 1RU9L 1YNLH 3I02A 2VL4A 1T20A 5TFSL 3V0VA 3RL2B 4Z77B 2FLBT 4X7CC 5L7XH 1KEML 4MQSB 2KH2B 5EZLA 4ETYA 1XMWA 1ODAA 3B9KD 5IGXL 2NY2C 1J11A 3RPKA 4YZFF 3WIHH 5BW7A 4LQFL 1AGFB 5E00B 2OZ4L 3QH3B 4GRWE 5C70A 3SO5A 3ILQD 4GKOA 4ZMAT 2EECA 3HE6D 3VI4E 3KGRA 2IAMB 3MRPA 1W72A 1XCQA 3RNQB 3VRJB 4Y5VA 3CFCL 2FEDC 3ZE0E 3FO2A 4PRID 4HMDA 3IB4A 3TJHD 1FVDB 4XNUH 1ED3B 2ESVD 5ISZD 3ARGD 5GJTL 4P46B 5HYSG 1LEIB 3HZMB 3KG5A 5CP7B 5GSVA 5C7XL 3L3GB 3O9WC 4U1MB 4KJQD 4GSDH 3QQ4A 4YBLB 5LVEA 4LSUH 4JKMA 4DOHE 4JRXB 3OXSB 4PP1D 4XP1H 4WGWB 5FM5O 3RWFB 4HIHA 1FNLA 1KTRL 4NBZB 4XNZC 1G7QB 4KDTA 4ZSOB 3LKQA 1JPST 3L5XH 4J8RA 3D25B 4MAYC 4XXDB 5CUSL 3BDXA 4I3SL 5ANME 4S0SD 2NY2B 5I2IB 3D69B 1U8NB 4OLUH 4QYOB 3MROA 1JK8A 4Q9RH 3N0PB 3PHQA 1DQJA 4ZS7L 1RJYB 3BOVA 4KK9D 4X0KA 1KGCE 4M5YL 2EC8A 5DDHA 1QQDA 3SCMC 4YHZH 1GAFH 4F7TB 3BP7B 1M05A 1W0WA 5MENA 2ICWB 3X3FH 5IB2B 3A67H 1GPOH 2P8MB 3FN9A 3OAYH 3TH2T 2PF6A 3P0GB 2NLJB 3CSPA 4N0CC 5FGRA 4JO4H 4JM4H 3O9WB 5CEZD 3N1QC 2XQBH 4Z7OF 1VCAA 2AABL 2Y1VA 4KXZH 3P9WB 3ZKQD 3CNKA 4XAWL 2AK4B 4QCIB 1QUNA 4ZTOL 4X6DB 4WTWA 5J89A 3QNYB 1EJ6A 1JHKL 4NQDD 1WK0A 2PW2B 2XZAL 2EDXA 4XNZB 4N9GB 5KVFL 4Q2ZB 4MAYB 2CXGA 2GTZA 2CD0A 3WIFA 1J87A 4OLYL 3IDJB 1YY9D 4NO0B 1JNHA 4WHTA 1Q72L 3QQ9C 2W9EH 1S7UA 3EGSB 3OKMA 4K71C 1Y18A 4DQOL 4KRLB 1NDGA 5D1ZC 1NAKL 1NCDL 5HHVH 3T0DA 1WWCA 2XTJC 1G9NH 3BIKA 3IXTB 3TCLA 5FECA 3SCMB 2A83B 3G6JA 1TVHA 4Y4HA 5I17A 4Z95H 2OX5A 1VESA 3DUUB 4EVNA 2J5LC 1ND0B 2CLVA 5AYUH 1OAZH 2BNQE 3O6LL 4YC2C 4OLZL 3QFJA 1XR9B 3ZT7A 1P84K 2BX5A 3S5LG 3BQUC 2BY1A 4MQXC 2J8OA 1Z2KA 1FNAA 1L6XA 3RVWC 3NIGE 5E2TH 2R2EA 1KELH 1QSED 2D7PA 3DX7A 4GMTL 1A6AB 3T0VA 3UPCA 3CC5B 4HWNA 1TJIL 2I24N 4OSUH 2FJGA 3EYSL 4KI5C 4PGBA 2GJ6E 1T0PB 1ZEAL 3QT2A 4J12A 4N8CL 3QNZA 3QUYD 3UJIH 5JOEA 1G7IB 1PJ9A 2YPLE 1FJ1A 2IPTL 5TF1L 1U9KA 2DQEL 5I19H 4P59H 4Y4FC 5C0ND 2VKWA 4K71B 3NN8B 3B8YA 5D1ZB 4NWUL 4QNPE 2XTJB 4ZQKA 1MJUH 5I16B 4EXPX 4HH9B 5TFSH 1PG7L 3RVVC 5SWQA 1HYSC 2J5LB 1D5XB 5FYKH 5A3ID 2EDRA 3AREC 1X5XA 4HS6A 1YEHL 4YC2B 1HDMA 2Q7YA 4HJJL 1F2QA 4J4PA 4MJ5A 1U8MA 3BQUB 4GW1B 2Q8AH 4ZUTA 3QDGE 1MCBA 2Z31D 3KLHD 3EO1B 1U6AH 2YA1A 3GI9H 5I30H 1UFUA 1PYWB 1RZJL 1INEH 3O41A 5GRUL 3CFCH 1DE4A 1C08B 1IZJA 4FXKB 5AG9A 2OJEB 2Q3AA 4LLMA 4OIIH 2H9GB 3V2AR 2AV1A 3A6BL 5C7XH 3LS4H 1G7HB 1JYXA 1KJ2A 4Y4FB 4WO4A 5CEYB 4QRRB 4WHYG 2A1WL 5C08A 4YHYC 2DIAA 5D70H 5KS9E 2YD6A 4NM4H 4CGTA 1JWMB 4X98B 2ZUSA 1DBKL 3ROLB 5CFHA 2VITA 2NYYC 2BVYA 2P48B 2BVPA 2CLZA 5HHPB 4X6DF 1KB5B 4OZHA 4UMGA 4X6CF 4PB0H 3AREB 1CVSC 1I7TB 2G5BA 4QRTA 3E0GA 4X4ZA 2XI9A 1IAOB 4NGHH 3U4EA 5TDOA 5I1EH 3WCYA 5JHDD 5K9OA 1UZ8A 4GRWB 4NRXA 4NFBA 4OGXL 4E41D 4U7KA 1KT2B 4WV1A 4DUWA 2EXYD 4M7LT 4WJ5A 4M43L 4LEOA 5IROC 1TZHA 1GGCL 1JRHH 2Q20A 3QXAA 4LAQL 5CIPB 2IQAA 3OQ3B 3VFGL 1YUHA 3TBSB 4JFEA 1AGCB 1P7KB 4H1LG 2ZUTA 4XB8A 3KLDA 2IQ9L 4YHYB 4D3CL 3RUGE 5JA8B 1KB5L 1ZWIB 5IMLA 4JFXB 5I1DA 1DUZA 4DKFH 5CGTA 4DOHB 5FA4A 3P4LA 1DN0A 4HGWA 4MLIA 5TE7L 2OJZL 1RUQL 3D3VD 1YEJL 3HPJB 3FN0L 2EEDA 2VXUH 3LSOB 3OJDB 4OQTH 4OLYH 2VLRD 5FUOH 5C09D 2HT2C 4MCZA 1KUMA 3HC4L 3BSZH 1EDQA 1E6OH 1NAKH 1A8JH 1UT9A 4ODWB 3W9DA 4X9BA 5L9DL 3EYFB 3T0WA 1BJ1H 1T03H 1IQWH 1H3PL 3EOAA 1BGXH 1RUPL 2FH8A 4XCYB 4X7SH 1D9KD 3O6MH 2A0LC 3MOAH 1EVTC 3QO0B 5IFAH 3O2VH 3Q5TA 5D6CB 4NQXA 5D9SA 3I75A 2QQKH 3DRTB 3GJEA 5IOPA 3O6LH 4TULH 5DA0B 3M17A 4BH7B 1F90L 2HMID 1EBAA 5JOPD 3RBSA 3T0EA 4ODXB 4ZS6C 1SJXA 1X5YA 4DZBB 4L3CB 4L4TD 3EJJX 3LEXA 3MRIB 4NM8H 2IANB 4JRXD 2BRQA 3GSUA 3EYSH 3VD9A 3IXAA 1ZEAH 5DMYA 2G60H 3TO2B 3RWJB 2VYRE 2EDYA 2CMRH 5IHLB 2AXJA 4X5XB 1D5MB 2Q86B 2NY2D 4HWBH 2EYTA 5FUZL 5I1LB 1TENA 2A6DB 4AEIH 1FZMB 3U0PB 1CGSH 3GHBH 4L8CB 4MXQC 4OI9A 1B90A 4L5FL 4LLVA 2IH3A 1JGDB 3C8DA 5F1KC 1XF2B 4G7YL 4M7ZC 2RIKA 1CE1H 4WDIA 1R3KA 4KTYA 2O61B 1AGDB 4HKZA 2BRRL 3D0LA 3VD4A 3EFDL 1I8KB 2FD6L 4XNQB 2QHRL 4FMKA 3B5GA 2Q8BH 5D6DA 1YEHH 4KVCH 4ZO8A 2BNQB 3LZFL 5ETUA 4JFYB 3RAJL 3VMPA 3QQNA 3IF1A 4QTIH 5E6YA 3LRGA 4XP6H 5GS3A 4QXUH 3M8OL 4JZNB 3UEZA 1MJJB 3CH1B 1AHWC 4HK3J 2F53D 4X6FB 1LGVA 4I2XE 1HIML 5JPMB 1RIUH 1WZ1L 3K8LA 2GJ6B 2GJJA 4DKEL 3DO7B 1FVCB 1HSAA 4Y19D 2ZCLH 5FF6B 3QEHB 3MRBB 4JFQA 2YPLB 3WE6B 1TQBC 5IB4A 4HIXH 3NZHL 3DX9A 3VGAC 1NMBH 3MRNB 1OQOA 1I9IH 5IM7B 3ZT6A 4NZUH 1MHPL 5CCKH 3MO1B 4FTVA 5EIVA 3ZKSD 4M7ZB 3HI5L 1WZMA 5DD6A 5F9AC 1FL3A 2BFVH 3DVNA 2ITDA 3PV6B 5JOFA 3TYGH 2CDGB 3IJYA 4OAWA 1W8NA 5F44A 3BRDA 3UTSD 3WLBA 1DQML 5DI8A 5IEKB 1TPXC 5KSUA 2FJHB 1S7SB 3MBED 3MV8E 2FRGP 4MJID 3KPSE 3QDGB 2VJXA 1QFUL 2FJFB 4R7NA 4PGDB 5E99H 3HHRB 2R2BB 4OGXH 5EU3A 3UPAA 1AHWB 1Q1JH 1ZHLA 4HHAA 5CBEB 3WN5A 5FKPB 1R3HA 3G6DL 2GK0A 1MHHB 3ZYIA 4NO2A 1OAXL 1NGXA 1GGBL 3I9GH 3H7BA 1UVQB 4O2CB 4YEEA 1K2DA 3CVIH 4R2GC 5K59E 4GS7C 3W2DH 3KR3L 1TQBB 1JTTA 2W38A 3W39A 4NQEA 3FQNA 2RHEA 3LPFA 2Q76B 2R23A 2DQIL 1M7DA 2I07B 4Y1AB 1ACYH 5GGRA 3VGAB 3VRLE 4D9LL 3QI9C 3KJ4C 1KB5H 3O6FA 4XMPH 5KS9B 3O3BB 2CLRA 5F70A 4PRIE 4U6VH 4XXCA 2A9MH 1JGEB 3DRQB 2ORBH 4AH2B 2EKSB 5TE7H 2Y7QA 3AFLA 1IGYB 1AD0B 5E6IA 4P9HC 4O5LL 4S1DD 1IEAA 2X89D 3ARPA 1VFBA 3K4DA 3O4LA 4GRWH 4RBPH 4I3GA 1QRND 2J8UB 3KS0H 1OAUL 1CR9L 1TPXB 1WBYA 3QEQA 4U3HA 1CIDA 3VI3E 4PJDF 1VB9A 2JB6B 5K9JL 3EDJA 1J0HA 1JJUA 1A4JB 1NGWA 5JZ7D 5IJKC 4HCRA 4JJ5B 1EMTH 5CIPH 2DJ4A 4M5ZH 4ONFL 4OFVA 1RUPH 2B5IC 3T0XA 2NTFB 2HJFA 3TT1L 1XIWD 2UWEA 1RK1B 4WU5A 2CO7B 2GITB 5EA0L 4R2GB 3EOBB 3UZVB 3TVMD 4GS7B 4NQUA 4QOKE 1M71B 4ZUSB 1V7ML 1OGAD 2ARJQ 4PJBE 4PV8B 3KPQB 4YDJA 3QI9B 3KJ4B 3MLWH 4L3ED 3RUGB 5B38B 2OXHA 4MQTB 3FO0L 4QKXB 1VADB 5HHOE 3VJ6B 4O4YL 1C5DB 2OK0H 1QBBA 3LB6C 2X4RB 3MGOB 1YQVH 1REIA 2XA3A 2C7UA 4PD4J 5E4EC 1XH3A 2AXFB 3ES6B 1IM9D 4NO3A 1MY7A 3CX2A 2ATPB 3LN5A 5EUOE 5C1MB 4P2QD 3GMOB 5DD3L 3TWCH 1DZBA 3FZUC 4XHJC 4E0RA 3TV3L 1EGJL 3RWIB 1D5IL 2NY1C 4LSQL 2WWKO 2B5IB 2F9BT 1EX0A 1SYSA 2V7NA 3AAZA 1A1OA 3QUZA 1Z9OA 1KSRA 4OJFL 4RAUA 2AI0L 3EFDH 1F3DH 3F7RA 4G43A 5LBSL 4P57B 4ZFOB 1A2YA 1F4AA 1BIIA 3B4NA 1MCEA 2W9DH 4ELMA 3QFDB 3NAAL 5DURB 3G5VA 1YZZA 4EDWH 4P2RD 5GRXG 4I48A 5F1IA 3LQAC 4LLYA 1VGKB 3NCEB 5AYQA 4ORZC 5J6HA 3M8OH 1MCQA 4P9HL 3S98A 1Z9SA 4K7PL 3BZEB 2EDKA 3MNZB 3TA3C 2R8SL 5C07B 3U4AA 3WBDA 3BGFC 1CT8B 1PQZA 3U46B 2FEEL 3B2UD 1SMAA 1DUYA 5E4EB 1WIPA 1J12A 1WZLA 1MELA 4MWFA 3WXWH 4AIOA 3NFPA 1KIQA 4YXKH 1W2KT 1L0XA 4ETQA 4HWZB 1F45A 3ARTA 4BSWB 1MWAA 2ATKA 5DJ2A 5MEQB 1VEMA 4TSBL 2JTDA 2HFFA 3W9EB 1RUKH 1J1OL 5FV2A 4K3DL 4ZOBA 2NY1B 3TBWA 1OP5K 1EFXA 1PY9A 5EZJB 4ZFOL 4KKNA 2CIKA 4JRYD 4YNYB 4YZFE 1YECL 1AXSB 3V7MA 4YBQC 3HG1D 4NDMB 4Z7UF 3BRGC 4BQCA 3HKFA 4LPYA 4GJTB 4DN3L 5EO1A 2XT1B 2P5ED 3SKNB 4XWOC 4TVPD 4K8RC 4LASL 3O2DA 3TH4T 4HUWA 2YHGA 5C9JA 4JQVC 1OT2A 1T22A 1NEZB 2IAND 3FONB 4IOSD 3GUTA 2WIIA 1IC5L 3TA3B 2EXWD 3BGFB 5I8KL 5FUCE 4ODTL 4GOSA 4KWUA 3G6DH 3SOBH 3JTSA 3MJ9L 4I2XB 1DCLA 3B9AA 5CHNB 1RJLA 3MV9D 3AS0A 1GGBH 4IRSD 5JXAH 4P5KB 4XP5H 1G7PA 4UIKL 3V4PH 3TBTA 3SDAA 5BV7L 4YLQT 4NQVA 3WHE0 1C5BL 2IPKB 1JI1A 4G3YL 1DVFA 3VFPB 4RGNE 4ZUVA 4YHKH 2OYPA 1AFVH 1UGNA 3PGDA 5CP3A 2J2ZA 3VXQA 3KLAA 4CBPA 4EN3D 4J23A 1UEMA 1KXQE 1RQ5A 1MHEB 1N2RA 1LD9A 3ZL4L 1HEZA 1FVEA 4JM2F 4HIEB 4UQ2B 4Z8FH 1XF3A 4L4VE 3U6RA 2XQYG 5K9JH 4Z7WF 3MV8B 4HJ0D 2DQCL 3WL9A 1MFDL 1JWSA 3KPSB 4LSTH 5HGBA 4BZ2H 2OTUB 1D6EA 3PWLA 1FP5A 3RDTC 1KULA 1KCVH 1F4WH 4K94C 4TPRH 5SX4H 2BCKA 1DJSA 4O2FB 1U8OA 1XFPA 3D87B 5HYIA 2R4SH 1CFBA 4JANA 2C1PA 4LL9A 3TZVD 2EZ0D 1V7MH 2D7QA 1CGWA 3H3KA 3FN3A 3MOQA 1FGVH 4IMKC 4WI2A 3JWNC 1QZ1A 1K4DA 4JFDD 2VISA 3FO0H 5IHZB 4B7LA 3LKOA 4MD4A 2I9TB 4E42B 1BFSA 1NGZB 4AEHL 3GBMH 3UP1A 5IBTH 4NUGL 3BKYL 3GKWH 4P4KC 1X6NA 5IUSA 4MJ6A 3ZKMC 4YHIB 4LARH 4WWKA 2GT9B 5DD5H 1EGJH 1D5IH 4OV5A 1JYNA 3SPVB 2R2HB 3RDTB 3L3OA 4XCEB 1FRGH 4Y5YC 2MHAB 4NQTA 2ZUXA 2JIXA 4U6TA 2C4XA 3FQTA 3HMWL 5D7LD 3S34L 1IAIM 3EFFB 2ICCA 2VLRE 3PGCA 3MREB 2I5YH 4PJHF 1I7RB 5ENWB 5LBSH 5CZXC 1PX3A 3QHZL 5T1MA 1BD2A 1RZGB 4QOKB 4YIQB 3NAAH 3BKML 4PJBB 5AAMA 3BZ4B 4AM0B 5IVXB 1E4XL 5HGDB 1KTDA 1Z0NA 4YO0B 4Y1AD 3BXNA 4P9HH 5E8PA 4D8PA 3E8UL 1BWMA 4DK3A 5AWNL 5BJTB 3MJ7B 2X4QA 5HHOB 4M7JL 3GSQA 4XP9L 3WNLA 4PJXF 1LILA 2MTPA 5HHXH 1QSFE 1MPAL 5MEPA 4Y4KA 4P4KB 4A6YB 4P3WA 1G0DA 1A7PH 4PV9B 3SJVD 2W91A 3ET9F 3TN0A 1MRDL 3REVB 5EUOB 5F7DA 3TLRA 3BKJL 2E5EA 1HI6A 1V05A 1BMGA 2HVKB 2X09A 3JUYA 2DYPD 4RRPA 2AEQL 4Y5YB 3WFCH 1FYTE 3MA9L 4IRJD 1ZT7A 5EN2B 2CUHA 5E1AB 3SE8L 1NBVL 2X4SA 3NTCH 4LLQA 2AKRA 3O6KH 1HHKB 1RZFH 4FQJL 4FFWC 2IBGA 4F7PB 2DQUL 1UKQA 1VFAA 4ODSL 2XWTA 5FGSA 1F6AB 3FB8A 5I15L 3WS3A 2BSRB 3FRUB 4N9OB 5TDPA 3W0WE 4G80B 2V2XB 2Y5TA 4TUJB 1IC5H 4JM2D 4P5MB 2AP2A 2YC1B 3MJ9H 3TJEL 4IM8A 4GRLA 5K33A 5HYJE 4UTBH 1X4XA 5KOMC 1MCLA 5FO8A 4LK4A 3GK8L 2HKFH 2DQFB 2HJLA 5JMRA 4G3YH 5L8JB 4X7TA 4RWHA 3QWRD 5T5NF 3U0TA 1H5BA 1P6FA 2KKQA 4RGNC 1FE8H 2X9YA 3OWEA 2NY4D 4LCUB 4IBLT 1CFSA 2W65A 1ZGLP 3GJFB 4LCCC 3KYMA 4I0PC 5A43C 3LQAH 4UDTA 4LEXH 4L8DA 4X6EA 3RVTD 1KLUB 1ES0A 1NSNL 1AP2A 3PP3H 4KROC 2ZPKL 3GMLA 2NX5E 3EAKA 1OTTC 3NCYP 2DQCH 1J1PL 2FCBA 1A1MB 1SEBB 2BSTA 2HLAB 3ARFD 4NT6B 3N85L 4YPJA 4P2OC 4PJ8A 2PO6C 2VRAA 1JHTA 1MOEA 2FX7L 5EBMA 1DQLL 3CDCA 2O93L 1BP3B 1HHJB 2AJZA 1ZLSH 1DLFL 1OARH 4HGMA 4FQQA 3VRIA 5I75C 2PETA 5I73B 3S4SB 1A6ZA 4I3RL 2HTLC 5EZIH 1FIGL 2Z92B 5FYLL 5F97E 5GIRB 3WKMH 4DZ8A 2ZZUT 2EDFA 4EI5D 4HUVA 4F58H 3IFNH 4QXGH 5GRWA 5HVWA 1F00I 1IC7H 1S8DA 5D72H 2DWEB 3MCKA 2WBJD 3W11D 5DJZA 3HE6A 4RGNB 4JFPA 5IBLC 3P30H 4LCCB 1TZIB 3P0VH 3P73A 4I0PB 5KZCD 2CRIA 1AI1L 4K8RH 5ISZA 4O9HH 5FYJE 1T4KA 2XPGB 3ARGA 2DL9A 3VGBA 2YEZB 1A7NL 2Z91B 3K74B 4KROB 4R3SB 1U58A 5GJSL 3QA3A 3T77B 4C56B 4L4VB 1WT5C 2X7LA 5H94A 3V5HB 2A6IB 4FA8A 1U93A 4P2OB 3IFPA 1QFWL 1DANT 3V5DB 2PO6B 3OKLB 4L8SC 3WFDH 4BK5A 4M61A 2LVEA 4UT9L 3FAXA 2FWOA 1GGTA 5BO1H 1N6QL 3JWDC 4KK6C 3HMWH 2XN9E 5I75B 1OSPL 2Z4QB 4KRPC 5C0AA 3KWWA 4LSRH 3QDJB 5C9KA 3L1OH 2YRPA 4J1UB 2DS4A 3QHZH 4KJYB 3CJJA 2XQYK 4HIJA 3MRJA 1IEBB 1KPVB 4BYHA 4KQ3L 2WIMA 2C3WA 3TGXA 4Y2DA 2AJSH 4APQC 5C0FA 5CILH 4LCIL 1T1YB 3HRZA 3WIHA 4RX4D 1E6JH 4M7JH 4XP9H 1IKNA 2Q3ZA 3OHXB 2VN4A 3BPCB 1XGYL 4OM1H 1QNZH 2VH5L 5EORL 3GBNH 2X1PA 1B0GB 4FXLA 3OG6B 1X7QA 4NQCE 3PQYA 5I8OL 4K94H 1Q9OA 3MUHL 1B4RA 4XWOD 4NRYB 1YDPA 3CUPA 1IAKA 4G6AD 4L8SB 4UILH 1YMHB 1YN6A 3FFCA 3VFMB 3WXVL 2AEPL 4NQDA 4ALAL 3QHFL 4KRNA 1CFNB 4ZODA 3QXVA 4KRPB 4QHMB 4ERSH 3N9GL 4PUBH 2FECL 1TCMA 4X5WA 3JV4A 2BNUA 5F6HI 4FQJH 4POZD 1V3JA 1C1EL 4HV8B 2V6HA 4BH8A 4IIQA 1H8NA 1K5NA 4OZIE 4ODSH 1BZ9A 1PGRB 2PCPA 3UBXI 4APQB 5CJ8A 4HW6A 5SWSD 4XBEH 4GKZB 2IALA 3GO1L 4PRBA 4KHTH 2QTEA 4A6YH 3ZDZE 1T0MB 3QBTB 4R8WL 2K1MA 4X83A 5DK2A 3TJEH 2X4NB 5IB1B 1QSFB 1Y6NR 2QADC 4PLJD 3MRRA 3GK8H 3FHQA 5DHYB 3LKNA 5CBAA 1CN4A 1A14L 3FT3A 1U91B 5GZOD 4QWWC 2I60L 3PHOB 4JFOA 5TH2A 4ZPTA 2EYRB 4G6MH 3C9NB 4GKNA 1FYTB 1MI5D 4YWGL 3VWJD 3QUYA 5L2KD 3I6GA 4ZUUB 1JPTL 2D4DA 1LE5A 4K07A 4H26A 1BQLL 2ZPKH 3IDIA 1EEYB 4POYA 1CFTA 5HI5C 2X4TB 1SMOA 4DFHA 3ESVF 1P4IH 5T1DL 4HG4K 3ZE1F 5DJYB 1J1PH 4PJAE 2G75A 4IS6B 3PWNB 5IMOA 4YXHL 2W0FA 1T1XA 3C6SB 4XCCH 5LCVL 3DVGA 1B4JL 3CLFL 1YEIL 3W0WB 5FGCE 1X5ZA 4OCXH 1NANI 3HG1E 2NY3D 2VLKE 1C12A 1X5HA 3ULVE 2ZSVB 4HC1A 4MVBC 2NY5C 3RTQD 1AO7D 5HYJB 5GHWL 1D6VH 5HGHB 2QADB 1G7LA 3GIZL 1T0NA 4TVPE 3C5ZD 5FHBL 2Z31A 3WD5L 3GJFH 5JXEC 1M7IB 4RRPG 2WLYA 4JKLA 1AIFB 1ZMYA 5E08H 4HFWB 5IEHA 4JFHE 1PZ5B 4XH2B 3D85B 4HKJA 5TE4L 5F6HJ 3TP4A 1KCSH 4LLWB 1KV3A 5K9QI 1K8IA 4GXVH 1A7NH 3L3DA 2HN7A 3VFSB 2CUIA 3VW3L 1MCIA 1SY6A 2E9JA 2NX5B 4WW1B 3PWPA 4HPYL 2WWMD 3BO8A 2Y72A 4O51B 5SV3A 2M8XA 2J12B 4WW2F 2FIKA 1DQQB 4OUUB 4UT9H 2DWDA 4R26L 3WUWB 2JJSC 1N6QH 1MREH 3QIBA 4PRAB 4H88L 3HB3C 3ZTNH 1VEPA 3LH2H 5F6IC 5E8NA 4MA1C 3OTTA 1UJ3A 2V7HB 1GGIH 4O02L 3EBAA 3N1FC 3QUMB 4FG6D 2Z9TA 2W0KA 4M3KB 3HMXH 4ONOA 5JHDA 4KQ3H 3PP4L 5I1JH 3KYKH 5T5FL 5ILTL 5TE6H 2FEEI 5FYLD 3WFEL 4E41A 2W59A 4P2CG 1SEQH 1NH6A 3BH9B 4CVWA 5IB3A 1A7RL 2OZ4A 3H9SB 3ZTJH 5GSRA 3T3PE 4EKXA 5E9DB 1F6FB 2H6PB 4Y8DC 3DXAA 3THMH 5CD3A 2NXZC 4MCYA 1A6TA 1EK3A 3WNPA 1WBZB 2VH5H 1VGEH 4OCMC 5BZWA 5LWYL 5I8OH 1MVFA 4J3OC 1OSZB 5B4MD 1U95A 4JFDE 1EJOH 1CXHA 4Z7VE 2FDBP 2E9BA 3ARDD 3AMKA 2VMFA 4OFYA 1BOGA 4WNQB 5IG7B 3WXVH 5C0DA 2NY0C 4Y5XA 4ALAH 4M1DL 3CPLA 5AEAA 1S9YA 4PGEB 1CDGA 4Z77A 2XACC 2YBRA 3D3VA 4NQSA 5F6IB 2XN9B 4MA1B 3E3QE 4DVRL 3D1MC 5B8CC 1MQKH 1C1EH 2D7NA 1CDYA 5C09A 1BQSA 1BEYH 2CRYA 4YHNB 1NFIB 3FT4A 4IOFC 5BS0E 1GHFH 5EO9A 3RPIB 1OP3K 2W1NA 5ACLA 1CICD 1MRCL 3L9RB 3RNQA 3VMOA 1JGUL 1S9VB 4AG4L 4BFIA 2W07A 5DFTA 4RCAA 5KANG 1SQ2N 2NXZB 5DF0A 1ED3A 1IFHH 4P46A 1LEIA 5KG9A 2OQJB 4C58B 3HR5B 3JWDH 4U1MA 4NQCB 2YD1A 4L4TA 3UTTB 4P2OD 4TOYH 3QQ3A 4MNHB 4JRXA 2NY0B 3OXSA 3J8F7 3ARBC 3GMQA 3T04D 3X11B 4GAGH 2ZSWA 4QGYA 3V4VL 4M1GL 1NBZA 5DXWA 2EC9T 3V5KA 1G7QA 3C2AL 3VGEA 3OKOB 2F5AL 5HHMD 1JPTH 4RISH 1MLBA 2IBZX 5B8CB 2BDNH 4MXWL 3D69A 4QYOA 1OPGL 4AENA 2M26A 1MCHA 4P2YA 4OZIB 3FQWA 4OZGF 2HRPL 4YXLL 3LKRB 1ZHBB 4P3DB 1P7QB 4GAFB 3E6HB 5LCVH 1B4JH 4WHCA 3WNNA 3S36H 2LE9A 3SKMA 5D4QA 4Q7DA 2ICWA 4DN4L 1A47A 2FHFA 1U8JB 2EDJA 4YGVB 3ULVC 4G9FB 1BAFH 3HNSH 4PYGA 2R1WB 1A4KA 3S96B 3B83A 2VSDA 4H25B 3S9DB 3MLXL 1YEKL 4NYLB 1WVZA 3QDAA 4Q6IA 1OY3B 5ESVB 5TQ0H 5KVDL 5MP6L 1OOAA 3WHE1 1Z5LA 4Q74A 4ZDHB 1H15B 4NC1E 5D7IF 4NBYB 2AK4A 4ZFGL 1QEWA 3ARBB 4X6DA 1CD9B 3QNYA 4X6CA 3BPLB 2F53A 3L5JA 3FB6A 4IRZL 5I0ZA 2ADIB 3IKKA 2NXYC 4Y19A 3ME0A 4K55A 5CINH 2J4WH 5IW1B 1L9NA 5SV4A 3U4BH 4K3GA 3F7QA 3RGVC 2JK5A 3EGSA 4KQ4L 2ZG3A 4WY7L 4PJAB 2Z8SA 3L7EB 2IADA 3GB7A 5JA9A 3GHEH 1HKFA 4LF3B 1KJMA 5DS8A 1VERA 4IDJH 3SGDH 4NCC2 2VLKB 2WUCH 3VXTA 3DUUA 3GNML 2BY2A 1E4XI 1H8OA 1ND0A 3IDXL 3UTSA 4FQ2H 2OMBA 3RNKA 3MBEA 4HK0A 1EVUA 4M62L 3O8XD 3PP4H 2BVEA 1RUMH 2VZOA 4R7DB 5IW6A 5ILTH 2HWZL 3FO9A 3WFEH 3HZKB 1ZA3A 1SJHA 2ARJB 3FMGL 2J6EL 1J5OL 1K4CA 3L5WB 4KTDH 2H2SC 4PS4L 1J8KA 1X5JA 1MUJB 4JKPH 3T3MF 4N1EA 2NXYB 4JZOB 2E27H 4JPKH 2VAAA 5LWYH 5L8KB 4KVNL 2G9HA 3IJHB 3RGVB 5DK0A 3TO4D 3NN8A 3ULVL 4PG2C 2NY5H 3WLWC 5ALCL 5BXFA 1KPRB 4HD9A 1SBSL 4I9WD 3ZHKA 2QKIB 1R3IH 3LQZB 3QUMH 3MJ6A 3HI1B 2H45A 4W68A 2AV7B 3SKUD 5DUPL 2X89A 4JQIL 1QRNA 4M48H 3CMOL 4PREB 2QADD 3P9LB 1T2QL 2BHYA 3ESUF 1WGOA 3BQUA 4NJ9L 1JP5A 3DX6B 3K3QA 4RMWA 2XZQH 5C6PB 4L29A 2D4FA 1AKJB 3PP3K 2A6JA 3EO1A 4PJXE 5FYJH 3C5SB 1PYWA 1A7OL 4DUXA 1MRCH 1JGUH 1MNUL 2P8PB 3KYAA 4UV4H 3KNBB 3QZWA 1C08A 3T1FB 1OB1A 4FXKA 3ULSB 2BZDA 1XIWA 2OJEA 2R9HD 2LU3A 4F8QA 2H9GA 3MJ8B 3TVMA 2H26B 2GCYB 1X6LA 1OGAA 4PTUB 5F93C 4FNLL 1G0YR 2ID5A 2YUVA 4M6MH 4GKSA 1MFNA 3MRLB 5CEYA 4U2ZA 4NNYB 4L3EA 3HS0A 4X9FA 3NCMA 4U6XB 3SDYH 4KK5D 4JJHA 1WISA 2EDTA 3SY0B 4RDQF 1AE6H 4D0CB 4XPBH 3CSYB 2XY2A 4UU9A 4X9GA 2VDNH 4W4OC 2BNRD 3REWA 3V4VH 5HHPA 4U6HA 1KB5A 2F5AH 2OTWA 3HCVB 3AREA 1I7TA 1IM9A 4JN2A 4MB4A 4U0QB 3MLYL 5DRWB 5DK3A 1TDQA 3QDME 4P2QA 3UC0L 4MX7B 3DMMC 2E8ZA 4EQ2A 5DMGC 5D2NE 5BS0B 1NL0L 1MIEH 1I7UB 2V9QA 1S9WB 4JGJA 1KT2A 1A64A 4JZJC 4G8EB 4JCMA 4TNVK 4PJ7F 1FC2D 5FO7B 3M45A 3ZKNC 1QLEL 5IB5B 2X4OB 1U8HB 4FXGA 1A6PA 1T1ZB 3H9HA 1J8HB 3IDMB 4WEMB 3V52H 4K9EC 1NBYA 3S37L 1CXIA 3GRWH 4P2RA 1P1ZB 3ARRA 3KPOA 1J0JA 5C0BD 5DMKB 1XCTA 1ZWIA 4JFXA 2BVUA 2EIBA 4NC1C 4ZFGH 3UAJD 3CX5K 5DTFA 4NC2B 3WDJA 3VXSD 5FO9A 3ZE2F 1AGBA 5ESAB 4AQ1B 4NZTL 2A77H 3ARWA 2FSEA 4LSPL 1GC1L 1JPFA 4RFEA 4M8VA 2WW8A 5D71L 1CE6A 4Z7QF 5DT1L 4HQQH 4UTAL 4TRPL 2MSPA 4U1KA 3DMMB 4FQXC 4MA7L 4R0LC 2YD5A 1DQDL 2DQGL 3RHWF 2E7LA 2NW3B 1DBAH 3EYFA 4CW1B 3EO0B 3CFKA 4JZJB 1MI5E 5IROA 4K7FB 5F88A 4JRYA 3UDWA 5EO0A 2GAZB 2C5DC 1CGTA 3GNMH 1KPUB 3WFBL 2V5YA 4AZ8A 2F54D 2UZYB 1FNFA 4IMLA 5JIPA 4FFVC 3F58L 2F58H 2UZIH 2P45B 4BH7A 3BZFB 2P5EA 1HQRB 1AH1A 4Q9QL 2NZ9D 3OL2A 4OD1L 2CGRH 1EZVY 1A7QH 4YGAB 1CDHA 5J1AB 3IU3A 5DQJA 2IANA 2J6EH 2XWBA 4Y89A 3U9PL 2LV4A 4PS4H 1P9MC 5DEFA 3RI5K 3MV9A 4WEBL 4PJDA 4JB9L 3RWJA 4IRSA 1KCRH 4LU5L 3DBXB 3G08A 2Q86A 2YD4A 1NC4D 5KVEL 4PPTA 4FQXB 5I1LA 2A6DA 5CSZB 1FZMA 4J6RH 3ULVH 4R0LB 1JPGA 4V1DD 2KL6A 5ALCH 1TETL 35C8L 4QXTA 1MFAL 3V6FA 1P7QD 2C3XA 1JGDA 4I4WA 4EN3A 3ZDYF 3V6ZB 4PGJA 4F7EB 4HK3N 1KB9K 5HDOA 2PYFA 3PL6C 1KYOK 1LP9F 3NCCB 3X13A 3Q6GH 5DUPH 4XWGL 1I8KA 2EYSA 4MDJB 1YPZB 1CF8H 2J88L 5M7QA 4I0CC 5MERB 1U8KB 4NJ9H 4DGIH 3DHJA 4L9LC 4P3CL 3IDGB 4HMEA 5I1GH 2PUQT 1XGTB 4OGZA 1A6VL 1N6UA 1XR8B 4K2UL 3TPKA 2N7BA 4Z78B 4JKWA 1A7OH 2IFFL 1MJJA 5L0QC 2ADFL 3VGFA 4Z6AT 3VD5A 3CH1A 5B3JE 1S7WA 1VKXA 2XICA 2DKUA 4YE4H 5KSBB 4XPHL 3C60C 4PD4K 5FM5M 3VGGA 5KSAD 3TZVA 3MRBA 5BVJA 5IESL 3UMTA 4FNLH 3WE6A 2VABB 3LY6A 4LQ1A 1U3JA 5T1KD 3ULUC 2ZCHL 3UBXA 4NOFA 3WV0A 1P4LB 3BX7C 1RJZB 4JY5L 1F4YH 4PY8J 5BVPH 1PSKH 3PL6B 4CN6A 3R4DA 3F5WB 1IQDB 1CDBA 4HBCH 1NPUA 3QNXB 3RL1B 1NCNA 4H8WC 3MQIA 2DAVA 3S3JA 4LIQL 1VA9A 3C09C 2ADGB 1Q9KA 5E7FA 4E9LA 4L9LB 4QHLB 1S7SA 1R3LB 3QXDB 4X5LA 5D5MB 2D2OA 1JZ7A 4Y16D 3UYRL 3KPNB 4UQ3B 4LGRB 5D2NC 5L0QB 2D0GA 3EYVA 3KPRE 3CZFA 1LEKB 5D7LA 5IF0B 5CBEA 3C60B 1QLEH 1MHHA 1S7XB 1FFRA 1V3KA 2DM2A 3B2VL 1ZHKA 3O2WL 3S37H 2RBLA 3DWTA 3BGMB 4P23D 2Q76A 2GUOA 3Q2CA 4Y1AA 2AJUL 3OKNA 4AIZB 5GQBA 3TT3H 2P1YA 3QCUH 3DRQA 4Z7UA 1WJ3A 2DI9A 1U8PB 3MFFB 4ZTPL 4LSPH 1Q0XH 2CKBL 2ZUVA 1RVFH 2J8UA 3C09B 2YA2A 4X4YB 5DT1H 3U1SH 3OX8A 4KKBD 4L8BA 3QDMB 4X6BA 4MA7H 3BH8B 3LRHA 3QUKA 3TIDB 2UY7A 1R3JB 1H3WM 4ZUWA 1S78D 5D2NB 2DYPA 2KUTA 3QZWG 1F6LL 1N8ZB 1J86A 1PEZA 4FP8L 1T7XA 4ZYKB 3QXUA 4MNGE 5L88H 2NTFA 4IRJA 5HD8C 3ULUL 3CFEB 1EGJA 4LCYB 3IJSA 2O5ZH 1QSZA 5F7EH 3V7AE 3ZSSA 3HZVA 4E5XB 1UXWB 1M71A 1F3RB 1G84A 1FSKC 1II4E 1YPZF 4JLRA 4LDOB 5ACZB 4ZAKC 3QEGH 4FRWA 2X05A 1BBDH 3H9ZA 1OHQA 4PJFF 2PXYC 3DUSA 1VADA 5IHBA 1LMKA 4JM2A 1I75A 3QIWC 1T80A 4KHXL 3OAZK 4XVTL 3S88L 1MCPL 5EBLA 3RWCB 2XA8L 4Z7WA 1MCNA 1HXYA 3EYUL 4F37F 1ZTXH 1WEJL 4XBPB 1PX4A 2DD8H 3SKOB 2ATPA 4NO5B 3GMOA 3NCJL 3TM6A 1I9EA 1X44A 3BD5A 5IJKA 1AQDA 3TFKD 1KIPB 1TETH 2HJKB 1MFAH 2ADJB 2B1AH 4K9EH 1HH6A 1JWUB 4FFYH 1QLRB 3WHXB 1S7QA 5EB9A 3JUZA 3O3EA 3TNMB 1XGPA 1FFQA 3BVNB 4KJPD 3WDHA 1K3ZA 4OT1H 3NACL 1A9EB 4ZFOA 1NFDE 6FABL 1FSKB 4OLXH 3QFDA 1JF1B 2X1WL 1F3JB 5DJCB 3OJ2C 5GZNC 3ARFA 4ZAKB 5ICYB 1JFQL 4K2UH 5GGVL 3GSXB 3FJTA 2YZ8A 2PXYB 3EHBC 5FEBA 1HINL 1UA6L 1UACL 1E4WH 3QIWB 5C07A 3DLQR 4XPHH 3QFJD 2Y5EA 3IYLW 3WEXA 5DD0L 1ZLUH 4EI5A 5IESH 1CWVA 4MLSA 4GH7B 1R0AL 4JO2L 5TGBB 5M94B 4BSWA 2Y06H 3MJ9A 5FAAA 3KPTA 1ITCA 3MRFB 1SJVA 2WBJA 3IKCB 2YRZA 3CFBB 3ULUF 5GGTL 5JR1H 3FCTA 2OBGA 1X5GA 1MF2L 3L95B 4WCYH 5DVLA 4PJHA 5F9JA 4YNYA 1RK0A 4JHAL 1RI8A 2CIIB 3VFUB 5IFHL 4YDVA 1AXSA 1INQB 2IH1B 4CVZB 4UIMA 1ORQB 2B1HL 3NIDF 2Y23A 1NDMB 4LIQH 3OV6A 2YKLL 1OAKH 5GGUB 1ZA6A 4OKVB 3SKNA 3U9UA 2Y6SC 4KZDH 1FV1B 3UTZA 4I9WE 4N8VA 1D5ZB 1GIGL 4HUXA 5ID0B 1BFOA 1NLBL 1I9RL 3RWDB 3VXMD 4I18C 4RMQA 1NEZA 2FR4A 4XVUC 1IGJB 3TA3A 3EIFA 4KMTH 5EU6D 1EHLL 3H0TA 1YMME 2F5BL 3BHBB 1L0QA 3MUGB 1HXMA 1B3JA 3T2PA 1FNGB 2CJUH 1OTSC 1XGUA 4KKLD 2Y25A 3PDDA 2WV3A 2B4CL 5GGRY 2HH0L 3KDMB 3T08A 1F2XK 2C3GA 2VE6B 4R4FL 4U1IB 1UB5B 1OAYL 1ADQL 1AXTL 1MHEA 4POUB 4N0YH 3GMMA 1QPXA 4FZ8L 4UQ2A 1CTOA 4U49A 3AXLA 2PN5A 4QRPB 2BOCB 4PJCE 5ADOH 3VXRB 5JQHC 3FOMB 1HHGB 3D6GA 5HHNB 4GG6E 3CDYA 4UOW0 3C08L 4I18B 4CMMB 4FP8H 3KPRB 4NHCH 2X5PA 1EO8L 3ULUH 4PP2B 1FGNL 2R0LH 3MGAA 2APBA 3RWHB 1JV5B 1HOCB 4W6XB 4WU7A 4G8FB 5D7IE 3UBXG 3I3BA 5DFWH 5DRXA 4IHOB 4AMKL 4H20L 1T3FB 3G9AB 3MRDA 4PFEA 1GZQB 1TJHL 2HT3C 1XGQA 3GFUA 4H8WH 4JPIB 2BMKB 5SWSA 4O2EB 4CNIA 2FGZA 2VDQH 5H8DA 5F3HA 5CAYB 5L6YL 4LP5A 4GQ9H 4WFED 3HI6L 3QPQC 3MOBL 2VR5A 1MCPH 4JFED 2V9TA 3NIFE 1C8PA 3EYUH 5DHXB 2ENYA 1U3HC 5EIIA 4HT1H 4I5BA 1G7MB 4S1SL 1LO3L 3G5ZB 3GDBA 5EULV 1A3RL 4FQIH 2DKMA 2QV2A 4XGZA 3U0WH 3EKCA 5I6XC 1QFWM 4MXVF 3ZYJA 3Q1SH 2DLGA 5I8CB 1RUAH 3NCYS 4H5SB 4WRLA 4JQXA 4UV7L 3DIFB 3VXSE 1VPOH 4NKDA 4XCEA 2LU7A 3VWJA 4MNGB 5L2KA 3R1GH 2R39A 3EFFA 3MTRA 2VXSL 1I7RA 1NCWH 3B3IA 3QCTH 4ENEC 4NZJA 2OR7A 3LPWA 5C0EB 1WAAF 2FATH 4HZLA 3RJDA 1HWGB 6FABH 4BA8A 1B2WH 4JDTL 3EJYC 4ORGA 3SE4A 3BZ4A 4AM0A 5IVXA 3ULUD 2A9NH 2D03H 5C8JB 3DYOA 5KN5B 3GZKA 2V5MA 4OM0L 1H8SA 2C3VB 5KW9H 4K3EH 5LAXA 3E2HC 1HINH 1UA6H 2APXA 2YXMA 2XFXA 4F7MA 5IQ9A 1DFBH 1AO7A 4AEFA 2JELH 1N0LA 3P40A 3DHMA 4B7IA 1JN6A 1U3HB 2GI7A 3C5ZA 1W8OA 3ELAT 5MEOA 1NAMB 1R0AH 4GMSL 1HCFX 1FLTX 4PV9A 5I1AB 4U31A 2CK0H 5EUOA 4F57L 5I6XB 3CD4A 5J6GA 5DJ0B 1T21A 4MD0B 1J05B 1E0OB 4PY7B 1ZOXA 2HVKA 5HVHC 4MS8C 3HE7C 5K9QG 4JHWL 1FBIH 4JFZL 3RA7H 2E7MA 1IVLA 3D0VB 2NNAA 4RNRB 4PJGF 1C5CL 3VWKC 1CK0L 4U7MA 5E1AA 5DMJB 3K8MA 3SDDC 2MCPL 1VFUA 2XKNA 3VFOA 5F7WC 3CVHB 2QSTA 5CLTA 3LRSA 1NFDB 1SYVB 2P5WB 4NRZB 3UTPD 1UCTA 4CKVX 1GIGH 4NFCA 1NLBH 1RURL 4OLEA 4XP4L 3E2HB 4G80A 1FFOB 2QL1A 1NAML 4Q0XL 4UBDC 4JFFE 2RAMA 4P5MA 4WUUE 1GVIA 2NY7H 5ALBL 4ONGH 1RZKC 1S5IL 1NGPH 1IMHC 3K2UL 5DO2D 4GAYB 5FFLA 2F5BH 4Z76B 3QO1B 4OCYL 2CDFA 4LHUB 2EICA 1BBJB 4N5EC 2DQFA 1IGMH 3MRMA 3MGTA 3ABZA 3LEYH 1BVKA 4M7LH 2PR4H 3SDXE 1X5FA 3HE7B 1L7TH 1OAYH 3STZB 1S7VB 1RZIB 4N0UE 1IGFL 2A74A 2ERJC 3MV7D 1P2CA 3SDDB 1KLUA 3AC0A 1IGIL 2WSKA 4OLWL 5A2FA 3FTGA 1CL7L 3U7YL 4ELMF 5JORA 4PB9L 5IIEB 1T83A 3ZZ1A 4ODBD 2HLFC 4JAMA 1A1MA 2HLAA 1N64H 2F19L 2W0LA 5IVZB 4C4KT 1WBXB 1WICA 4MZ3A 3QULB 2VC2H 4U1LA 3U7WL 1EXUB 1L6ZA 3HFML 4OGAC 4TQEH 5KTEL 5HYSB 1Z3GL 4PJEE 5LG1A 1YMMB 5GIRA 3LS5H 4LVOC 1MFBL 5JDSB 3QJHA 3FB5A 4RA0C 3RU8L 2ITCA 4H20H 1NUFA 3AS3A 4LBEB 4XC3H 4PRPD 5EOQL 5KOVC 2VZ1A 5JMOC 1NC2B 3GGWB 2HVJA 1CICA 4LHQB 5TJWK 5ID1B 1DBML 4JVWA 3HZYB 4Z7QE 3LN4B 4OD3L 4I0PA 5CMAA 2ERJB 1N0XH 3HI6H 5KVMC 2P24B 5D1XD 2XPGA 3O3DB 2Z91A 4J3SA 1CLOL 4UB0L 4C56A 1RZ8A 2KDGA 4N8VG 4S1SH 5E24E 4I0KA 4HS8H 1LO3H 4PJCB 1A3RH 4F2MA 3OB0K 2A6IA 1O5DT 4M03A 3KPPA 4P2OA 3HNVL 1NEZG 1KTLA 3F8UB 4GG6B 2OL3B 5B3NA 3P77B 5J3HD 4PBXA 3KJ6H 4LNRA 1CIUA 3NBNA 4O00A 1QBLH 3SQOL 5C0GA 3DGGA 4GBXD 4LVOB 4YPGB 3QDJA 1GRWA 1BLNB 4YR6B 5IKCA 4MD5A 3IAPA 4GAJL 1PKQE 4BKLA 2IPUK 4FQCH 3GSWA 4R4ND 4XI5D 2P7TB 1XF4B 2XZCH 3VFVB 4Z9KB 5E8EB 4OM0H 3I6KB 5F3BB 1R24B 3ZSTA 5LGJA 1S5HA 4XAKD 3D2UB 1RFDL 1T1YA 3IVKB 4EOWH 4K3JL 5EU4A 1ZANL 2RJMA 2AJXH 2DIJA 2FGWH 5H37H 3CFJA 2OL3L 4LVNC 4ONHB 3RWEB 4O58H 5MENE 1LK2A 4WW2A 1QD0A 4NKOA 3AB0C 3OGOE 4NRYA 2VXQH 1F97A 5BMFH 3HAEA 1K6QL 4M8QB 4Z0BL 4ZFFB 3WJLC 2EE3A 3MLZH 4YHOL 3VCLA 4M6NL 5FGBC 4S1QL 3U82B 2P46B 1KTKE 1JGVL 3RKDD 1JZ4A 3MBXH 4NPYA 4BUHA 3LHPL 2EDQA 4JO3L 1VACB 4XCNA 5J57B 3IAQA 1FORH 3NGBC 1I9JL 3C87A 1J88A 1J10A 2A73B 3G9VA 1RURH 4XP4H 1LDPL 1RULL 4G6JL 2NCMA 2VXTL 3QUZD 4F3FB 2C4FT 4FZEL 3PWVB 2LFGA 1FN4A 3LIZH 3EO9H 3VFTB 1NAMH 4OFPA 3SDCC 5HI4D 4DGVH 4RGOL 3PDOB 5D7JC 5TPWL 2OP4L 3BUYB 4NKMB 3T1WA 2X4NA 4BSVA 3QPXH 4LVNB 1Z9MA 5DHYA 1JF6A 2DLHA 2H2PC 2VQ1A 4L3AA 4PRHB 2X1OA 3O8XA 3G6JE 2GKIA 3AB0B 3LV3B 1U0QA 1U91A 5EOTA 2Z93A 1MCFA 3L6FA 3ZKXC 5DJ6B 4ZO7A 3S37X 5CWSB 2YD9A 1LNUB 3UPRA 3CVHH 3C9NA 1IGFH 4OFKA 2JJUA 3VFWA 2VL5A 3S35H 1IGIH 3CDGA 3MLTA 4OLWH 1R5VA 5HHQB 5KSVB 3VXUB 2J3SA 1RZ7H 3NGBB 4HDIB 1S9KC 3TO4A 3ORJA 1EEUA 1ZGLB 5DUBB 2P8LA 1YY8B 3EZ8A 1DN2A 4N1CA 4ELKA 4KJWC 1M7XA 3SDCB 2F8OA 5GRVL 3QG6B 4JFFB 3IU4L 4K23L 5D7JB 4WUUB 1QLFB 4KU1A 1VHPA 2PYEB 5T3XE 1FL6B 5HYJA 3SGJC 3EJZC 3T2NH 2CRZA 4GG8B 5HVFB 4HAFA 1WV7T 2FO4A 2P47B 3BT2L 5EOQH 5HXMA 2YPVL 3ZKXB 5EZOL 1QTYT 1HZHL 2R1XB 3RZCD 5FHAL 1YNTB 3C6LB 3D85A 2IC2A 4HJGB 4GW4B 4N0UB 2F15A 2DQJH 4MQ7A 4KDVA 5BW7C 1X5IA 1CLOH 2X70B 3VFSA 3P4OB 5F96L 1DVFD 5FK9B 3S3PA 1TJGH 1IM3B 5HI3C 1ZLUK 1DDHB 4NHUB 4Y5VC 1U2CA 1RZKH 3HNVH 1Q9WA 4LLDB 3P11L 4N5UA 3CLEH 3KYNB 3RVUD 2MPAH 1JNLH 2BNRA 4LPWA 3D39B 4CVXB 2YN3A 5J56B 3L3JB 4PRAA 3I2CH 4NZRH 5C08E 3RQ3A 1ZVSB 4PJEB 4TUOA 5FOJA 1R5IA 2PTUA 5C0JB 5MHSD 15C8L 2HP4A 1T20B 1YNLL 2W60B 4OGYH 2PNDA 4BELD 4RZCA 1T89A 2I9LA 1QBMH 1VFMA 4OZHE 5EZLB 4PJ5D 5I1KL 1RFDH 5L7XL 3H8NA 3BH9A 2BSSA 1CDIA 3H9SA 4M1CC 5E9DA 1Q8MA 5JTWA 3V95A 4U3CA 2ENSA 1OCWH 2W0PA 1BZ7A 2OL3H 4QT5A 1MJ8H 2I25N 1MLCA 4CU8A 5JUEH 1W72B 1XCQB 3L3HB 4Y5VB 5C0BA 1NQBA 4B41A 2HRLA 3FO2B 3MXWH 4KKAD 3JWOC 4RFOH 4WNQA 4Z0BH 5E5RB 3VD3A 5DEGA 2JCCB 5JW5A 1JZ8A 4WFEE 1N59A 5GSVB 4YHPA 1JGVH 5C0CB 4M3JA 4WI6A 1KLGA 1V7NH 3QQ4B 5CJQL 4GSDL 3NCFB 1NGYB 1UM6H 4J7RA 1PKQB 4LSUL 5CJOH 1I9JH 5AZ2L 4XP1L 4DW2H 1NFIA 4MNQD 1H3XA <