3ZHLA

The crystal structure of single domain antibody 8-14 scaffold
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEWVSLISGSGGSTWYDDSVKGRFTISRDNSKNLLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MG8-14 SCAFFOLD ANTIBODY
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zhlA00
4R90L 1U42A 2Q3AA 4PRDA 4PTUB 1BWWA 4Z95H 4L4VE 5F9WB 5LQBL 2QHRL 1QEWB 4J4PD 5CGYD 3CLEL 2OR9H 4TNVF 1YPZE 2CUHA 1MCNA 3TZVC 5DJZB 3DX6B 4JN1L 4YDJB 2XA8L 5HDBE 1AO7A 5E8NA 4V2BA 1WWWX 3RNQA 2XN9A 5FHAL 1TNMA 3PQYE 2BERA 3DECA 2JK5A 2X2YA 4OKVA 4XX1E 3SY0A 5GS0H 1QBMH 4IDJL 4JFXB 1J05B 4RQQA 5IK3B 1QKZL 2X9YA 1D9KD 4KI5C 4C56D 4WEUD 5MI0C 4JFOB 3TO4B 2Q76B 2AVGA 5IHUH 5D5MF 5I15L 3RUGF 1G7MA 4CDHA 2P43B 4KPHL 5HY9B 3HHRB 3CFKB 3U9UB 1J7VR 4NO0A 1X3DA 5EOCL 2MWCA 4Y19E 5DR5H 2IAMD 4PUBL 2I07B 4NO2B 1QHOA 4HIEB 5E03A 2PXYD 4LLVB 3RGHA 1MJJB 3B6SA 4PJGE 5DFVC 1I7UA 1JI2A 2WSKA 5I74B 1JHKL 3LKSA 3AXLA 1AGFB 2R9HD 1F11A 2VDPL 1CFSB 1T5WA 4QTIL 4K8RH 3KYAA 5KAQF 4G6KH 5BO1L 3KXFE 3NTCL 2GSIB 3EYOB 3V5HB 3B2VL 4NQTA 3F12B 2GK0A 4KJWD 5D9SB 2UWEF 3W2DL 4KKLD 1KCRL 1EBPA 1AR1D 4OCSH 4BQBA 3KYKH 1N6QL 1LO0L 4WWKA 5EBLA 1JGVL 2R15A 3HRZA 4GXVH 5ADPL 1H8OA 1LO3H 5F7HA 5ALCL 1Z3GH 4QRTB 1XF3A 2HT2D 5EU5A 3CK0L 1T2QH 3DX9A 1BFVH 2H9GA 1VSCA 5SV3A 2UZIL 4O2EA 1JPFB 2H1PL 4DGYH 3TO2B 1AIFA 3AREA 1HXMB 3KPPB 2YPVH 1VFBB 1P4IL 5C0AE 3O45B 2A6JB 3ECBB 1J88A 5CCKH 4OM0H 5AUMB 4Z8FL 1K5NB 4HUKB 3QDHA 3E8UL 2IBBA 5D2LA 2NY3C 5TDNB 4GW5A 2OZ4L 4HUMB 1MLCB 1AXTL 4MJ4A 1BAFL 2IGFL 3ZKMC 1IGIH 4GRWE 3BXNB 3QCVH 1R5VB 1KGCD 1WUNT 4Y0GA 3L3OA 4HHAB 1FZKA 4Q6IC 4XCFL 1U3HC 3QAZC 4GAFB 1KXVC 4ZODA 1P4BL 3QI9D 3ILQD 1QBLL 4HPYL 1T5WB 2W9LA 1HKLH 4MD5B 1D7FA 3CH1B 1J87A 4WGVB 4JM4L 1AC6A 1AFVL 1MCOL 5EH1A 5JR1L 2WK2A 4JREC 3BP7B 2X9WA 4K3JL 5DQJB 4DQOH 1KXTB 5B8CC 2Z8VC 4Z7WB 1EMTL 1FNEA 3BD3A 1DBKH 5F7FA 3HC0A 3PXJA 2XZAH 2H8PB 3E0GA 2JIXA 3MA7B 4JZNA 4QXUL 5DD6B 5L7XH 3S8WA 1L7IL 3IU3B 1XCTB 4WDIA 1OSZB 2DWEB 2VH5L 5GSRB 1MAJA 1IFHL 5HHOB 2JLLA 1H3XA 2W59A 3N1QC 4AEIL 1S7SA 2R9HC 1UZ8B 1MQKH 3ZL4L 5I1HL 2JIXB 1C08B 2X70B 4WHYH 4XMPL 3GM8A 1TZHA 1AC0A 3T8XB 1F45A 1ZAGA 4O58H 5KG9B 5IBUB 5ABDE 5I66B 4M7ZC 3WIIH 5CS7A 1LDPH 2B2XH 5B8CB 5J06A 3GJFB 3EYQD 1F58L 1HHGA 3IU4H 1MJUH 4WTWA 2DLFL 4IRSD 2HJLA 4P2QB 4JKPH 1DVFA 4LHJB 1BQLH 3ARDA 2IGFH 5H94A 3RZCA 4TPRH 3B9DA 2F58L 4WFHD 4LPYA 4YHOL 3RGVB 1I3VA 3CUPB 3B2VH 3BZFA 1MAKA 4PLKD 3DUUB 5INDA 2V5RA 4XXDB 5T3ZD 1WVZA 3H7LA 3ALWA 4RFOH 3KPNB 2VZTA 4WI4A 2GQHA 3O0RL 1JWUA 4OJFH 3GMMA 1UWXH 2IG2L 3R06A 3S7GA 2YKLL 4GLRI 4ZAKB 5E94A 4Q9QL 1NEZG 3KJ6H 4UT6L 5K9KA 2NMSA 2PXYC 5IB3B 1F2XK 1BFTA 1EO8L 4JO1L 5EU6E 1HXMA 1HHKB 4K2UL 4JY6B 5EA0H 4OLYH 4FFZL 1YN7A 2BVTA 4OCMC 1MIEH 5CBAA 3IDMA 1VFAA 4PJDE 4XVUC 3BN9D 4H0GA 1NMCC 3QCUH 2AABH 3UJIL 4Q2ZB 5T1MB 4R7NA 2BK8A 5EU7E 3FMGH 1QACA 4KVNH 1GGUA 1QSVA 4RIRB 4ZNCD 5C07D 3U36A 4HHAA 1A4KA 1X5XA 35C8H 3LN5A 1RK1A 1R5VA 1UACL 4YUEH 4F58L 3BGMA 1QFWI 3ABZA 3VI3F 3B43A 2PXYB 5ITFB 1CXKA 2GFBA 4GAGL 1FNSH 2Q8BL 1KENL 4X4YA 1UKQA 2LQRA 4F33A 3MYJB 1I9JH 3UTOA 2R0WL 5T1LB 5CIPH 3BGMB 5EO0A 2WNGA 1K8DB 3BP7A 3KWWB 4KRMB 1A14H 1NKOA 2AAVA 4LMQE 3DLQR 1DEEB 1EFXB 2VQTA 5FHBH 3QUMB 2ZCHH 4IRZL 3MFFA 3MRNA 4LCWD 5CZXD 4PJ9D 2CJUL 2Q8AH 1I8KA 1IL1B 1A6WL 1EEYB 2JJVA 2K7PA 4P5TA 2EEDA 4PLOB 1DEEA 3VI4E 1CFNB 2NYYC 4JHZA 1KF9B 5IBTH 3LPFA 5J1AB 4NZUL 2G60H 3T09A 4K9EC 4LLUB 5JXEA 3HNSL 4KRPD 4PJ5A 1KB5A 1ORSA 5F7DB 5I6XC 4U3XA 3UDWA 5I1AB 4OB5L 1G7LA 4O58L 3ZE2F 5DI8B 4TNVK 3VFSA 5D2LF 4NRXA 1G1CA 1VESA 1BQLL 2VSCA 3V9FA 3RJDA 2V2WB 3TYGH 4S1SL 3VGFA 1EXUA 4J1UA 1A22B 5TF1L 3BZFB 5A43C 3HG1A 4F7PB 4YPJA 4ZNEA 2FX8L 5BVPH 4P0DA 1ZK9A 5EWIL 3U0WH 4G7YL 3D18A 5E5UB 3FQUA 1T03L 2DDQL 1UJ3A 2C3XA 1Q0YL 1BOGA 1I7RA 1KLFA 5C0GA 4ZTPH 4XGZB 5IMKA 4JPKH 3ZTJH 1XFPA 5JXAH 3MRDB 4HKBB 1HXYB 2VDLH 5H37G 1UCBH 3VXUB 4X6DB 2XIDA 1H3PH 2E27H 1TJHH 3L3JA 2EYTB 4JFDA 1G6VK 3RWJA 1J0KA 4PTTA 3BO8B 1IGFH 4XCYB 3MREB 3TBWB 4ONGL 4MJ6A 3JUZA 4K94H 3VJ6A 3E2HB 2OR7A 3DSFH 3RZCD 2NY4C 3KPSB 3ARDD 2IALA 2VLME 4F2MB 7FABL 1YEIL 4Z7VB 3UPAA 1DQQA 3WNKA 1NGXB 3R4DA 3T1FB 3PXHA 5J13B 3MR9B 3DROB 5DWUL 3G08A 1K4DA 3PWJA 1CK0L 5TF1H 3GFUA 1U8PB 5DGQA 1CIDA 3E6FA 2P5WD 3X3FL 4RX4D 3S34H 3U46B 5C09D 1KELL 3D9AL 1DJSA 3IDJA 2I9LB 4PBXA 5FYJE 2CJUH 1KB9K 3GI8H 3QISA 4LKCB 2DYPB 4QRRB 3T08A 4NCDA 5IT2L 3MNVB 1EGJA 2HRPH 3MRQA 1FDLL 3QA3B 2XKNA 1RZIA 3WS6A 4WFHE 5F1KC 4AH2A 1M6OA 1WWBX 3O3UN 5J13C 4LKCA 3MJ9A 3MRDA 1BBJB 1T80A 4HKBA 5GISL 1CGXA 3MGTA 2H6PA 5D6CB 1QA9A 1RUMH 3ZHLA 4CBPA 4JO4L 3FRPG 2X40A 2MQCA 4XVUD 4F7MA 4E42B 2VDNH 3SDCB 3WXVH 2G5RA 2A38A 4YR6B 2A6IA 1IGMH 1QLFB 1AHWB 3DV6B 3HI6H 4KTDH 4UU9B 5CEZL 2VIRA 5E95B 4GFTB 1KPUB 3SPVB 4HFUL 1CFTA 4HIJB 4CN6A 6FABL 3PHOA 5FDWA 1JGDA 2VDPH 3D18B 3QPXH 2WBKA 4IRSB 1UQSB 5C6TL 1FZJB 3CIQA 1JK8A 2DWDA 1HHIA 3ZKSD 3S35X 1Z0MA 1AGDB 3RKDD 3GSNH 3EDJA 3SDAA 4G80A 1OAZL 5CWSB 3LSOB 3DX7A 1AE6L 1X5FA 4HK3J 4MZ3A 5DK3A 1H0DA 1TVBB 3UZEA 1A7NL 2E6QA 2ADJA 4XH2A 4YNYA 3VXQA 4WEMB 2IPUG 3LKQA 3N85H 3LB6C 3G5ZA 3QIBD 4LLQB 4PJ5E 4LVHB 3K4AA 1NGYB 3P0YL 3QHFL 1QBML 4PB9H 3VXMD 2UZYB 4WGWB 1LILA 2ED7A 2CIKB 5IVXA 3PWVB 3FQTA 4M1CC 4GMTH 1I1AA 4XPFL 4DFIA 2X42A 2ZSVA 4JFDE 3K46A 1G6RA 1HI6B 2YC1A 3T0VA 4YGVA 1NCUA 1L0YA 3PWLB 4PLKC 4L9DA 5FKPB 2IH1A 1UB6B 5BZDA 5CSZB 1HYSD 1G0DA 4KGJA 4DZ8A 1U92B 3OXSB 2W0FA 32C2A 5F9OH 3VE0A 5T1KD 2PTUA 4FABL 4P4KC 3U82B 3CFIC 5ESQB 1QFUL 5EUOF 2XKNB 1T5XA 2W91A 5D7SL 2D31B 2DQTL 3IAPA 5FYJL 2WMPA 6CGTA 5GGTH 3MGTB 2R2CA 5EU6D 2YD3A 3MV7B 3MA9H 5AYUL 2ARJQ 5IWLC 2JELH 3LKQB 3FB8B 4A6YH 4AIOA 4IMLB 1AQKL 1E4JA 4P4KB 2NX5B 1T2QL 3EUUA 5FF6B 4NKMA 5F8QC 4LVOC 3KLDA 4CU8A 1A2YA 3OZ9L 3Q3GA 2DQCH 4GKSA 4QOKE 5K9JH 3L5WB 5I74C 4P23A 1C5CH 1CE6B 1J1OH 2XZQH 1CFQA 4G9DA 1UM5L 3HPLA 2QSCL 1RZ7H 1LO4L 2IPKA 4ODHH 1NAMH 3U4BL 1AI1L 3T1WA 3L3HB 3MRLA 4PIRF 4C56E 4NZTL 3VRJA 5F89A 5F9OL 4ELKB 1AGDA 5I1HH 1YJDL 2BNRD 3O2WH 1U3JA 1DN2A 5J1TC 5DD0H 5FB8B 4GG6E 5K93A 1Y6KR 3KYMB 4G6FB 2GI7A 5A40E 43C9A 4ELKA 1W72H 3KLHD 4LVOB 4OLVL 4ODSL 2DL9A 1PVHA 5ALBH 1QRNB 1VEPA 1YMMB 1MCJA 4K7FA 2D7OA 2VR9A 3QIWD 3D6GA 4A6YB 4GBXA 1RIHH 2E9JA 4PFEA 4AQ1B 4U6VH 4GKZB 4G8GE 1IM9B 2BHUA 1RZJH 2B1AH 1BF8A 3CFBB 1SJEB 4M02A 3S9DB 2ILLA 1T7XA 3QT2A 1FO0B 3ESUF 1LO0H 1A3LH 5ESAA 3MLSL 2ENYA 1IKNC 4PJ8D 5E6IC 1T0MA 3H9ZA 4X6DE 1RZ7L 4UDUA 1XF4A 3MMEA 4F9LA 1JGEA 4OQTA 4KDWA 5IV2B 1Y6NR 2JTDA 5EUKB 1PY4A 3NMEA 3MRJB 4GG6F 3TBTB 1A6ZB 4HX1A 4M1CD 5DK2A 1AQKH 3QIBC 5AG8A 3FT2B 1LD9B 3QWRD 5F7KC 5SV4A 3ZO0A 2DQUH 3MLWH 3OKLA 3GRWH 5HPOA 4OTXL 4FXGA 5CGYC 4H25B 4WI6A 3UP1A 5E7FA 2DBLL 4ZUTB 2H2SD 4PYHA 2ZNXA 3LD8C 4LIQH 5HDQH 1QLRB 1HN1A 5BO1H 5ID1A 1G9EA 3GMNB 2Y07L 5DD5L 5EIVA 1WBXB 4EXKA 3ARBC 5I2IA 2B5IB 4P2OB 5MEQA 4TUOB 4M00A 1KCRH 5FF6A 1V3KA 4K23H 2EDQA 3E3QC 4J6RH 3C2AL 1QLEL 4AEEA 5I1KH 4R8WH 3G5VB 5SWSD 5CIPB 2C4XA 3NFSL 4PPTA 4JG1H 1SBBA 1XGQA 3TM6A 1MHPH 3HI5L 1LK2B 1UM5H 5D6DC 4KJWC 3NIFF 3ROLB 5K9OA 1K4DB 2DTMH 1KLUB 4W68A 5T5NG 4U1NA 4TTDD 1NLDL 4NM4L 1CT8A 1XF4B 5DT1L 2X7LA 1KTKE 1ZVSA 5FO8A 5CGMA 5HD8C 2FX9L 2GY7B 2B4CH 4MX7B 4OCYL 1K6QL 3WD5L 2XG5A 3IDNB 3L3IA 3LKRB 4JRYB 4DVRH 4ZPTB 5MERA 4ZQKB 1PAMA 2DYPA 4X4XB 1TZGL 4F9LC 1BX2A 4GRLB 2HYMA 4XP1L 3UBXG 1LNUA 3X14B 4NWTL 5IQ7L 3OF6D 3BZ4B 5LWYH 3S88H 2Y07H 3BMWA 3OKNB 5C0BA 2FIRT 4PGDA 4PJCE 4JKKA 4RQQB 5IK3A 4YHOH 1MCWW 1NUFA 2HLAB 2OS7A 2V9TA 3TT3H 4HDIA 2CMRL 1IKFH 4P2YA 2H32A 2OTPA 3LAFA 2Y9RT 1SEQH 4K7PY 3MLWL 2DQGL 3PV6B 3BP6A 3I84A 5KS9F 3F58H 5LXGH 2DLEA 3DETD 4TN9A 1YZZA 4JPVL 3K8MA 4JQIH 3SPVA 4LDOB 2EYSA 1IFHH 3EO0B 4RNRA 2B8OT 3Q6FB 5FM5M 2WLYA 4ONFL 2R4RL 1I1YA 5TH2B 2UWEE 4PRHA 1FNGB 5JOPD 4JM2F 2A83B 2GJ6A 4OD3L 5GJTH 1A7PH 3DYPA 2F53B 1WZ1L 3TV3H 3VFVA 5GS1A 1XH3B 3S3SA 5HYSA 1A7RL 1EEUA 4LLWA 4FXGB 1N5AB 4QGTA 2P1YA 4ODTL 4QHMA 4G8EB 3VFGH 4TUKH 3TBYA 4PJXE 2B39A 3QO1B 2FBJL 1BF2A 2DM3A 5EWIH 3U0WL 2H2PC 4AEHL 3IFLH 4DKEH 4Q9RH 2VYRE 2GTWB 4TOYH 2YR3A 1RHHB 1JN6A 1C7TA 4L8CB 2X05A 3D39E 4HUXA 4NC1C 3OPZL 2ORBH 1KJ2A 5AG9A 4HWZB 5EDXA 4NN7B 2EO1A 3QUZA 2NY5H 1RFDH 3CU7A 1WGOA 2HFEA 3VWJA 5KZCB 4LPTA 5D1XA 3I6GA 3VA6A 3O45A 4WV1A 4EI5C 3RWEA 1NQBA 4EEEA 3SKOA 1P84J 3RWFA 3SE8L 3OKKB 2AEIT 1SVZA 4UV4H 4N5UA 1XCQA 4M6NL 4PJEB 4OBSA 2B4CL 3I50L 1MF2L 3DWTA 3WKMH 3VGEA 1FLRH 1T1ZB 3D0VA 1M1SA 2Y5TA 1OCWH 4NN7C 5T3XH 3IKKA 3NOIA 3TH4T 3ZE1E 5FXCH 2JKXA 4MCYA 4YUEL 5IP4A 1R3LB 4LEXH 4TUKL 3S36L 1YA5A 1EFQA 3QNXB 1NCBH 5HDOA 4UINL 3LQMA 3SBWA 4PJAA 2P45B 5C0ND 1W72A 2J8HA 3BPOB 1UH4A 4LQFL 5I8EB 2BCKB 5GRVL 1JZ8A 4X80L 2AK1H 5E8PA 2OL3L 4M6OL 3NABH 4NO5A 4YAQA 1UCTA 4HIXL 4NQDA 4WEBH 4F7CA 4GUPA 3JTTB 4LLDB 1ACYH 2X4PA 2AI0H 1P9MA 1OP5K 1BP3B 3WLBA 1FL3B 3ILPA 3RTQA 4GG8A 3GJFA 2GSIA 4CN1A 5I9QC 4KVCL 4NQCA 1T3FB 3OG4B 1EEZA 3T0BA 4BQ6A 4RSVA 3QI9A 4XPAH 1N6UA 2JE8A 5KANG 5GS0L 3DETC 3OF6A 3PGCA 2JK5B 4OKVB 5D1QC 4QXGL 3FB5A 4MQSB 1IGTB 3P11H 1FNLA 2NY1B 4PJEA 4P46B 2WBJA 3U0TB 4OFKA 1IGJA 1AGBA 1F58H 4MAYD 5BOZG 1OARL 3QUXC 4RGNE 1DLHB 3TVMC 1JPGA 2F58H 2MHAB 3BIAX 2WBJB 3EFDH 3U0TA 3INUL 3LVEA 1RUPL 4JDZB 4LCYB 3QXUA 1OM3L 2QHLA 4ZS6D 1INDL 25C8L 4JQXC 4LSQH 4MB4A 5FYKE 4LGSB 3ZTNL 1W72B 3CU1A 2CDGB 2JJUA 4Z5RB 3OSKA 1BEYH 4LLVA 5D1QB 4PRBB 5SWSA 3DVFA 3M17B 4KKNA 2O5ZL 5EU3A 1WV7T 3OX8A 1AHWC 3KPSD 3BKCH 1U9KA 1UB5B 4P46C 5T3ZL 5IT2H 4UDUB 3DMMA 1UFUA 1MHHA 2KUTA 1D5IL 2Y4SA 3RVUD 3VMPA 3BXNA 4ZOBA 4JKLA 1FZKB 4F7CB 1V3LA 1U8NA 2WQ8A 4UV4L 2FLRT 5A2JH 1BQSA 1BZ7B 4Y89A 2MOVA 1EVUA 2V2XA 3MLRH 4R2GD 1JBJA 4WUUA 5D5MB 2EDJA 4ZXBB 2IPUK 5DQJA 3SQOL 4BQ8A 5GS1C 3V5DB 2JB5H 2AEQH 2JB6A 2FH6A 3JWDL 4X6BA 1RIVH 4B7IA 2R23B 1K8IA 1WBXA 5D72L 1YEEH 1RUPH 3ARSA 1YYMH 2A9NH 3MACL 3SKJL 3WO3B 3TZVB 1CDJA 4Z7UB 5E8PB 1B90A 3PABB 4S1RL 3LIZL 1T2XA 4MJ5A 2IADB 3FTGA 5J7CC 5JMOC 3P73B 1M05B 4QT5B 4P99A 4ZAKD 4U1JA 4KHXH 1MIML 5BQ7B 3C5ZD 1MY7A 3ES6A 3RA7H 1IQDA 5MI0B 3QDGB 3TO4C 3DO7B 5JPMA 1FL3A 1KTDA 1X7QA 3BHBB 1BPVA 3AS0A 5DLMH 1F3RB 4HIHB 3VXSE 4OSUL 3KYOA 5L0QC 3CUPA 5A2KH 4NKDB 4ZFGH 3QQ4A 1RZJL 2B1AL 3QJFB 3O6LL 1MVUA 3QRGH 1MWAH 1UM6L 2NTFB 5ADPH 4TQEH 3T3ME 2BXYA 3AUVA 5C0DA 1DLHA 2NW2A 3TNNA 5JOEA 1QRKA 3BEVB 1XIWD 4JZNB 4ZSOE 5EOTB 3VG0H 3O3BB 3MXVL 3WNMA 5L7XL 1JTTA 5C0GB 5CINH 4YDKL 1INDH 1LO2H 1UZ8A 2XT1B 1QPPA 2HTKD 1OM3H 3SJVA 1MLCA 3VGDA 2EDKA 5CZVL 4KK6C 4JGUA 5CCKL 1XIWA 4PJ9C 5SWSB 3HKFA 1NBVH 5F7WC 4E0RA 5D71L 3C2SA 3QIWC 1CD9B 3TYFB 1FN4B 3QRFM 4I1NB 5FKAA 3MNWA 2IQAB 4MJ6B 1J9CT 1MJJA 1VFOA 3I9GH 2FWOB 2UV3A 4Y4HD 1PG7W 1RD6A 5HYQA 4LNVA 5KVEL 2GJ6B 3KPQB 1MHCB 1T21A 4XNXH 3QZWB 2GITA 2X1XR 4JFYA 4WTXA 2XY1A 3L5IA 4MXQC 4NOFA 2MSPA 4J7RA 4PJXA 1IAIM 5ETUA 4QXTB 3NFSH 1TZGH 4FQ2H 1INQB 3VXSA 4G9FD 3KXFA 1QR1B 4D9RE 5KANI 5HYJA 3D85A 2HT4C 1TCRB 3LN4A 1MH5B 1CFNA 1NBQA 1LO2L 3WNPA 3HFMH 1DP0A 3IJHB 1YEDB 4OZHB 4EUPH 3QUKA 2W65B 2VXUL 1ZLUH 5HHPA 4NNYB 2M2DA 1UM6H 5IB5A 1XAUA 4MB3A 5HGBA 4LLAA 1U58B 2JCCB 3MRHA 5IG7B 4PRIB 2X4TB 1AGCB 4Y19A 1A5FL 1FZMB 3KNBB 4XC1H 5D71H 4KDTA 4Q9QH 1MCHA 2VKXA 2D9QB 5BV7C 2CSPA 4WU7B 3TCXA 1EHLL 1FNSL 5IEKA 2CDFA 1WAAF 4PJEF 4PRIA 2HJFA 3CGTA 1JPTH 3QG6A 4P3WA 3C60D 3VD4A 4GQ9L 1QVOB 3QR2A 4I0PA 5A2IH 4JFFE 4KVNL 4Y8DC 3CFCL 3WKNA 4FMFA 1UEMA 3DTXA 3RY6A 5C09E 4LSTL 1AO7E 1URLA 2VAAA 5FYLH 4Z7OF 4NC1E 1JPSL 4JJHA 4KROD 5IW3A 4HMCA 3T04D 1J8HB 3O4LD 1FYTB 4KUCF 3STZA 4OZFH 2HJKA 2BVQA 2M26A 2VLRB 1WBYA 3OPZH 3RDTD 1H3GA 1VADA 3U79A 1JL8A 5IKCB 5SX4I 1FN4A 1GGCL 3O4OB 4N1HB 3JVGC 5HHVL 3V4PH 2W92A 3TPKA 4ZAKC 2ADIB 1U8QA 3V4VL 1F42A 3OKYA 1OB1A 4Z18A 4G42B 4NRYA 5IMLA 4FNLH 2XRAL 2VMFA 4FN0A 2NXYD 4F7TA 3W9EB 5EU7C 4B41A 3SN6N 3GMOB 2EIBA 3EO9L 2VLMD 2C9AA 1YMME 2VOTA 5I17A 3GBLA 3T0EA 3O4OC 1PKQA 2GKIA 1JPSH 4NQCE 1ZHKA 2HVJA 3FAWA 4K3HA 3OAUH 1S7SB 4KK8C 5F7YC 3FN0L 3E6HA 1KB9J 5DQ9B 4Y2DB 3DGGB 5IVZB 3QA3A 2W65A 3KGRA 3QUYA 1A6AA 2AJSL 3GGWA 3T0WA 4V1DE 2DOCA 2VLJA 4YX2H 3BUTA 5J6GA 3SO3B 3O41A 4JZOA 4HUVB 2A6DA 1FJ1A 3S34L 4XCNA 2CK0H 3REWB 5IG7A 2GEEA 1HHGB 4TRPL 3WL9B 3GSOA 2GAZA 3NCBB 3U0PB 1CL7L 4LK4A 5DGRA 1II4E 5K59E 4ELMF 1JGUH 1FYTE 1CDUA 3CFJB 3PDGA 4DGIL 1ACYL 1D9KC 1UJ3B 4NQXB 5JOFB 3T0DA 1GOHA 2ESVA 5DMGD 2HVKB 2IANE 1OQXA 5DD3H 3EHBC 4R2GC 3T0EE 3W2DH 5CUSH 2H8PA 3MA7A 3OAZK 4K3DL 4RMUA 4U1GC 1VGKB 3IETB 3IFNH 4JO2L 4G80B 5CEYB 1P84K 2HVKA 3U6RA 5HYJD 4LSTH 2CR3A 1FFOA 3WMSA 3K1KC 1YNTA 3RP1A 4IM8A 4CUCA 2VDLL 3BVNB 3CDGA 2XZZA 1CGWA 2FLBT 4OI9A 2N56A 4HMDA 4GG6A 1FHGA 3HE6A 1J1XL 2VZVA 4NOBA 5C9KA 1FNAA 1YMHB 1U8OA 1UJ3C 1X5JA 3S4SB 4U7KA 1HZHH 2I24N 5HGHB 2XKUA 5JW4N 2PCPA 1QRNA 5JW4Q 3GSXB 1SBSH 2AABL 4MD4B 3UJIH 2B1HH 4OCLC 1QQDB 4X8JB 4QT5A 3SGJA 4WRLA 4E42A 3MQIA 1U8OB 2VLJB 1NGZA 4D94A 5EULV 4ETQA 5FFLA 4J23A 2EDOA 4Y4KD 3OB8A 3X12A 5JORA 4OT1L 5HHOE 3V7MA 4EI5B 3NAAL 3HCVB 5ENWB 4DVBB 3KPTA 3EFDL 2I5YL 1MVFA 1S9VA 4OLEA 5F97E 5JORB 5D8JL 43CAB 1LGVA 1ES0B 3VXUD 1UA6H 3RZWA 3GMLB 3GMOA 1NAKH 1CYGA 4D3CH 3VRLE 4I3GA 2C4FU 4HGWA 2NTFA 4K71C 4QRRD 3WDJA 1MCKA 1AKJA 3WV0A 4ZYKA 2FGWH 5DK2B 4UT9L 4XNUH 4BZ1H 4R90H 2EZ0D 3HLAB 3JSSA 4G9FE 3ISWA 2ADJB 2YUZA 2HFGL 2XFXB 1RUML 3ZYJA 3OB0K 1YNTB 4LF3B 1M7DB 4JFQA 5TDOB 3IKCB 2JCCE 4FS0A 4FZ8H 3VD9A 5I8KL 1OGAA 4YC2C 4KY1H 1S78C 3MLVH 3NPZB 5MENA 5DEFB 3FO1B 5HD8D 1NGPH 1CR9H 1UH3A 4ODTH 4WTZG 3VDBA 4ONOA 5GIRB 4QLRA 2DQIH 1I8LC 2AJVL 4F58H 3ZDXF 4ZFOL 3O4LE 5GHWL 4WWID 3GDBA 1N4XH 1YYML 3HUJA 5I1IL 3C8KB 5KW9L 2YXMA 4OZGE 5H2BA 5GGQH 1UWGL 3VRLF 3S5LG 3G6JA 4IHOA 5B3JE 2CLZB 1L6XA 2YPLE 3FHAA 4G5ZH 3G08B 2BNQA 1OAKH 3QBTB 2EIEA 3BRDA 2RCSH 3CD4A 1QHPA 3K8KA 5CP7B 2A77H 4PJHE 4PRAA 3F5WA 4XPBL 1N64L 2D31A 5CGTA 4R0LA 2ADFL 3GSRA 3OB0H 4NFDA 3MUHL 4JPWL 2DD8L 4A2LA 3QHFH 3MREA 4XC3L 4J3SA 2LV4A 2HTLC 1QO3B 4HEPG 3EDDA 2E7HA 4NQSB 3DURB 2V7NA 3FB7A 3FQXA 2CLRA 4GJTB 2VLRE 2FHBA 4OZFG 4KY1L 4HW6A 4N0UB 4DKAA 3MV8B 2X4TA 4Y19B 3TNMB 3MCLH 1P6AB 5TQ0L 1MI5E 4HIIA 4S1SH 5INCA 2HG5B 3L3OB 1IAIL 3PWJB 3TH2T 1DDHA 4HUNB 4U6TA 4RA0C 43CAA 5F9WC 3CNKA 1MCBA 4RMTA 5B3JF 3RX8A 3O8XA 2EICA 1W0VA 5F21B 2VL5A 4LSUL 4HWBA 3EJJX 5FUZH 1NUGA 3FQWA 3SEPA 3BEWA 2EE6A 1NC2A 2FEEI 1FG2A 5B39A 1B88A 1IC4L 4M7KH 3KLAB 3B9KB 2WZPD 4YHMH 3C6SA 1TZIB 3ULUL 4ZXBC 3L3JB 1F4WL 3SGKC 1OSZA 5GS1B 1KFAL 1UXWB 1CE1L 1H0DB 2EYRA 3MV01 4KRPB 3CXDL 5JUEH 2LVCA 3CSGA 3I2CL 5ERWA 5DFTA 2NR6C 1DBMH 3TN0D 3R1GH 4HPYH 3BP5B 3K7UA 3WFHA 5C7XL 2H45A 1MRFL 2BOBB 5L2KD 2DQFA 2J8UE 3DI2B 2C1OB 2YRLA 4OM1H 4JCLA 3SGJC 1NBZB 4NPYA 3RFZC 2CGRH 5CZKA 3MO1A 1DUYA 2Q7YA 5HGDB 4M9OA 3GMPB 1I1CA 3LKOB 3QI9C 1WCBB 1XGYL 5EU4A 3SQBA 4KRPC 5KJRH 4KRLB 1CLOH 5DC4B 5DSCA 5C71A 2GK2A 2LU4A 4MA1C 3RWFB 4FQ1L 4MVBC 3EKCA 5BZWA 4JPIA 2IPTL 4QRQA 5JOPE 4UBDC 1IC4H 5EFIA 4YFEA 3BWUC 2BNQE 4XNYH 5IB3A 2NY7H 4C58B 3ULVF 2LFGA 2YA0A 1GGBH 5HGAA 1RIHL 4YDLC 5LQBH 3SO5A 1CGYA 5JUEL 3OKDA 3V6ZB 5KVMC 4Z7VF 3FFCD 3CMOH 2PETA 4XAWL 4OIIH 5E8EA 1NPUA 3NFNA 3O2DA 4LKXB 5ACZA 1OD7A 4Q2ZA 5FM8A 1H3VA 4DW2L 3ZT6A 3T2NL 2BSRB 3A6CH 5H35B 1AY1L 3R1GL 5INCB 3U36B 3DVNB 2FHCA 1UG9A 1QG3A 5I1KL 1KCLA 3UCRA 3G5VA 5EO9B 1S8DA 1IT9H 3K1DA 5HHNA 2XZAL 4QXUH 3WLWD 4X8XA 5DRWB 3HG1B 4UNTA 2XXMB 3QAZB 3MXVH 1U3HB 3IJSB 1IAMA 1MCDA 2YWYA 5T1LA 4XBGA 5MEPB 3AY4A 1I1AC 4PV8B 5DRZB 1MIEL 1JF6A 5JLZA 1HH9A 3WFDH 1S5IH 5C08D 4QF1A 1RZFL 3PWNB 1PX4A 5DFVD 1OLZA 1JYVA 3WNNA 4HLJA 5MEPA 2DQUL 4JEGB 4JREB 2O5YL 5ID1B 4NZDA 3UAJD 2VABA 1Q9WA 4APQB 4HH8A 3CXHJ 1MRCL 1CGSL 1X5ZA 5E6IB 5EU5B 1KEGL 3V4UH 1PKOA 4YEFA 5FYJH 3W0WA 3OAUL 3QB7C 1L0XA 3FB5B 4ODWB 3MA9L 5AYUH 5LGHL 4ONFH 1KCKA 5GGVH 1JMZA 4U1LA 3MTRA 4AG4L 3OKDB 2AGJH 3T2NH 4J4PA 4LDLB 3EO9H 2BOBA 4Z7UE 5CJQH 3PP4L 1DEDA 4MS8D 3KPSA 3RAJL 2QQKL 2L4OA 4NQED 4F57H 3HE7B 3D39B 4RGMB 4B5EA 3I3DA 5CD3A 5LBSH 4NQVB 1BFVL 4APQC 4OUUA 5T3XE 2W9DL 4YBLB 5BV7B 1S7QB 1LEKA 1MCWM 4MNQD 4PY7B 2ZCKL 1ED3B 5HHNB 3ARBB 1SY6H 1FO0H 4JPIB 1FE8H 3EJZD 3QULB 3KG5A 4JFHE 4OI8A 1PEWA 1PG7L 5GSVB 2DIJA 1W0WB 2YSSB 4LHUG 4HZLA 1SEQL 4R3SB 5I73B 1WIUA 1BJ1H 3ZTNH 3A67L 1BZQK 2UYLA 3V0WH 5BW7A 2CRIA 3CXHK 1XGTB 4FOMA 1OT1A 3EOAB 5FIEA 2EDHA 2UWEB 2X6MA 2Z31B 2IANB 3V6BR 4ZXBD 1EHLH 4N5ED 4GXUN 3U2SA 4DN4L 5E2WL 4NJ9L 1T4KB 4PBVC 3IF1B 3NCFB 1KIQA 3P4OB 4NZUH 1LO5A 3KHQA 1J11A 2C3GA 1MCFA 2DS4A 5DK0A 3H7BA 5IM7B 4C83B 2IPKB 3MODL 1A0QL 1HILA 3UTTE 5HVHB 4XPFH 4FQJH 4PRPA 3ARGA 4DOHB 1KTLB 3FQRB 1FVDB 2A73B 4BZ1L 4PREA 3NCEB 3FT2A 4NC0B 4TSAH 4P9HC 5IB4A 1ZWIA 2FJGA 2X4SB 4UUJB 5E1HB 1F3DJ 2ADGB 1D6VH 4MWFB 1A8JH 2VDOH 3PGDB 4RMQA 1IRAY 2EC9T 2X1WL 4NQCB 2XOTA 4RRPG 1WITA 3MRCA 4D3CL 4OLUH 4KI1A 3O9WA 1SMOA 3FB6B 1MCIA 2FJGB 4MA3A 1K4CB 4R96B 3QEQD 1T1YB 2PF6A 3BD5A 3MRGA 4JVWA 4FZEL 2KH2B 5AAWA 4JFXA 3WDIA 2VWEC 5IHZB 1ADQA 3MRMB 4Y2DC 4IIQA 1QSFB 1QFWM 3OJMB 3QEGL 1G9ML 1T0NA 5J4MA 3SDAC 5TE4H 2OJEA 4AMKH 1XGUB 2FSEA 3DURA 2M8XA 5DUPL 1CVRA 1JPFA 1HCFX 3P9MA 4ORGB 2E8ZA 3GB7B 4JFZH 3KPPA 1AHWA 3PL6A 2DICA 2ICCA 3IF1A 1G7IA 2KDGA 4UTAL 2E7LC 4PR5A 4NO2A 3VXSD 3QUZD 3PHOB 2PTTA 2NZ9D 4JJ5A 2YZ1A 1WC7B 2F5AH 4TSAL 3MV9D 4UINH 5C0AB 2A0LC 1LO4H 4ODHL 3DX8A 1DQLH 2VXSH 4PR5B 4S11A 2EDNA 5GISH 3TVMA 1J10A 4R3SA 3DSFL 3QQ3A 4R2GB 1YUHB 2EC8A 2X44D 3ZKNC 4X6CF 3F12A 1OCWL 5EG6C 1RZGB 2GJZB 2X4NA 3B5GA 5FYLE 1FAIH 1LHZA 1CDHA 2X1PA 4JFYB 1OOAA 4ODSH 4RBPK 1YPZA 4L9LA 4LU5H 2NY2B 4FFWC 3CDCA 3P9LA 1BIIA 2JJTA 3R8BB 3LQAC 1F4XL 4ZO7A 4RFOL 5K33A 2RQ8A 4H88H 2CUIA 4R4FL 4YHZL 5JMRA 4YXHL 4CJ1A 4XBPB 5FUZL 4FG6C 4POZD 1ZEAH 4LIQE 3E2HC 2P42B 5ALCH 1C08A 3S5LB 4XPBH 4YBQD 3GB7A 4P23D 3FO2A 1NLBH 5DS8B 2AEQL 3JWDH 1MFCL 4GW5B 4DZ8B 5GS0D 1IQWL 5JDSB 4KI5F 1CF8H 4M43L 1S7WB 3MV8D 1MJ7H 5ISZD 4Z7NE 5DUBA 4JGMA 4H26A 1LEIA 1A7RH 1N0XH 1OAYH 4OZFA 4K71B 4XP1H 3DVGB 1LMKA 4MD5A 5GZOC 3MRGB 4CRPA 4AK1A 4EQ3A 4MXWL 1D5BB 2PYFA 3H0TA 4MGXA 4XC1L 1CG9B 3P30L 4A6YA 1U8IA 2GJZA 4CMMA 1G7MB 1NCWH 4X6DA 5C0RH 1A6PA 3PV6A 4Y16D 4GT7A 3VRIA 3K4DA 4AMKL 4ORGA 4LFHG 1IGCL 4UQ2A 3N50A 4S1RH 4YC2B 3F58L 1GH7A 4RZCA 2YA1A 4Z7QE 1SYSA 4L4VA 1CDIA 1KG0B 3C6LA 2NY1C 2IALB 4X99B 4PJDA 4ZUWB 2FGWL 2V5TA 1HWHB 5D7IA 3ZE2E 2F19L 2RJMA 4N0CC 4KZDL 2IQAA 1VHPA 2OM5A 3QUXB 3GSVA 2YOCA 3IDXH 3N85L 5L88L 5M94B 1I1FB 2AJYL 5HI4D 3TVMB 2J88L 4Z0XB 3BRGC 5D5MA 3EOYG 2VQUA 4HIHA 3UEZA 4MSWB 1RMFH 4OLWH 1E0OB 5EC1B 4ONHB 1P4LA 3SKMA 3RWGA 1MUJB 1MWAA 1YC7A 4IJ3C 2V9QA 4P3DB 4GKOA 1BFOB 2B20A 3B9AA 4K7FB 4NKOB 1LQSR 4P5MA 1BD2B 4X6CA 5CP3A 3W5NA 3VXSB 4MJ5B 4QOKB 2D7TL 4XBPA 1I9RL 3WEXA 3QWOB 2FHFA 4ZOCA 5KJRL 1KENH 1RVFL 2NX5E 2R4SH 4X7EC 4K94C 3WSQH 8FABA 5E00A 3E6HB 2R1WB 3K2MC 1BVKA 1YDPB 1EUTA 2JIXD 1QFWH 4KAQH 1GIGH 2QLVB 3RL2A 3HE7A 1Q9OB 3JV0A 4DKDC 1RJLA 4YHKL 5J12C 2PW1B 4ELME 5HHQA 1CN4A 4LRNH 1FZMA 4LLMB 1JHKH 4I8DA 3DARA 2L7JA 1F90H 1G9NC 1Q0XL 3KYOB 2EDWA 4NHCL 2W9EL 2VDQL 2VIRB 5C6WH 1S7WA 2RB8A 2NNAA 5CMAB 2XTJE 3GI9L 4R6UA 1MCSA 2X1QA 4MNGA 1T83C 3NCJH 3Q6GL 1CLYL 5KVEH 4Y4HA 3RY4A 2DQJH 4PJCA 4CU7A 3BH9B 1JK8B 2DWDB 3BEVA 4X7SH 4Y4KC 1ZLSL 4JHBA 4DEPC 1BZ9A 3X13A 1F02I 2EDBA 1RIUH 2Z91B 2QBWA 1U8IB 3FAXA 5J12B 2DM7A 1EZVX 4JANB 4WHTB 4HJGA 1CL7H 3LRSB 1NCBL 3IDMB 1D5ZB 1GZPA 4YDKH 4M8QB 1ZHLB 4LCCB 6FABH 2FD6H 1CK0H 5ICYA 4GAGH 3KPRE 2FDBP 2SEBA 4G8IA 1UWEL 3OTTA 3CSYA 1FORL 1ZT1B 4GRMB 5A1AA 4L4VB 3VXUA 5D2LE 4RX4A 4NQDB 2P5WA 4N9GB 1FFPB 1S3KL 4Y1AD 2UUDH 4YXKL 2F19H 3CAFA 4KK8D 4PJ5B 5E2UL 4M93B 3GSQA 5LBSL 2HN7A 3HAEG 1E4WH 2APWA 4KHTH 5ISZE 3NVQA 1RURH 4NJAL 3QI9B 5FYKH 5BQ7A 7CGTA 1Q9LA 5FV1L 1MQKL 1A3RH 4YXLH 3QDGA 3DO7A 3IDIB 3MRBA 4KQ4H 5D4QA 4WCYL 2P8LB 4CJ0A 4FQXA 3MRNB 3R0MA 4S0TD 1C12B 1ZGLP 4MNGB 4N8VA 4PJ9B 2AKRB 2X4QB 4LAJH 4HPOH 4LL9A 3AB0C 3MJ9H 4HWBH 2BSTB 4BKLA 1EMTH 3QIWB 2CKBH 3BSZH 1EFXD 2Q3ZA 4Y2DD 3NIGE 1ADQL 3DSNA 3FKUS 3BJLA 3TA3D 4NNYA 4O4YL 5T1KA 4HS8H 1QSFA 2CD0A 4KTEH 5ECJE 1T0NB 5ILTH 2JCCF 2H2SC 4OD1L 3H9SD 2G9HA 3S96B 4TPRL 3SKJH 1IBGH 3BDYH 3MRQB 4M3KB 5KVGH 4J3TA 2FB4L 2FL5A 3LV3B 4WFFE 1WICA 3LMJH 5D7LE 2B2XL 5GGSB 4JO3L 5E8DH 4BYHA 1ZGLM 4POUB 1MRCH 1M7DA 1IGYA 1ACZA 5JPMB 1GCFA 4OIBA 5B38B 4ZTOH 4JJ5B 4L1DA 2J4WH 1HKFA 3VJ6B 1NGQL 4KMTH 1UCBL 1TJIH 3VXMA 2P49B 3ULUF 3QHTC 1GC1C 1TQBB 4AEIH 3O9WD 1JGLH 3VCLA 4PJCB 3QIBA 3CVIL 3ARWA 1PKQE 5EN2A 3GSUA 3VFVB 1JI1A 1GVIA 2I26N 3V5KB 1VDGA 1KACB 5E24E 4F3FB 4O5LL 2ZOLB 3KPQA 2XI9A 3TJHC 1HXYA 3L9RA 1A0QH 5IJVB 3WCYA 2Y36L 3VFPB 3V0VA 1GC1L 1S9YB 4MJIA 4PRPD 4LCCA 3FO9B 4N8VB 5DJAB 3C5ZB 4ZUUA 4Z7OE 5JPNB 3MV9E 3S88L 4JFDB 2MTPA 4XWGH 1CXLA 2J8UB 3DI3B 3L9RB 5BRZD 5IQ7H 1OT2A 3VXPB 1INQA 1L4IA 1T83A 3AMLA 4H0IA 1BVZA 4P2OC 5TFSH 2VXSL 3PGFH 5KG9A 5D70L 4QHNA 1CU4L 5KOVC 1QQDA 1S7UB 3UBXB 2CIIA 1V7ML 2FL5B 4PY8J 4PJ7B 5DMKB 4DUXA 2I25N 3HE7C 4XXCA 5KS9A 4JM2D 3OKKA 3MBEC 3ZHKA 1BQHA 1IGYB 1T21B 4FFZH 4DK6A 4APQD 2CUMA 5DRXA 1A64A 4XCCH 4HC1A 4F7PA 2R69H 2QQNL 5FECA 5K9QI 4G3YL 5C07E 3RDTA 5FHBL 5CFHA 2F15A 3SDYH 5CKAA 2ATKA 1A14L 3PUCA 3VW3H 2QADD 3BDBA 1PDKA 2DKMA 3UTPD 2VDNL 3WXVL 1UT9A 3I6LE 2GCYA 4NQDD 5I73C 3D25B 3O4LA 1CXEA 3V5KA 4GRLC 1Z9OA 2F53E 4KGLA 4S1QL 4EVNB 3GKZA 3GO1H 4F15C 3LQZA 4D9RD 2CXGA 4KTEL 1G1YA 1P7HL 3WL9A 5BJTB 2ICWA 5L2KB 2F74B 4IBLT 1P7KB 3DXAB 1HIML 3C60A 4X80H 3MXWH 1LP9F 2V2TB 2C3WA 1FLRL 1N3NB 5DZLA 1E27B 4IRSA 3T4AA 4OT1H 2W60A 4ZS7L 2Z92A 4BSJA 4IRJC 4ALAL 1B3JA 2OQJB 1H5BA 4X0KA 1WLHA 3QWRA 2YBRA 5ACLA 3DRTB 1H3PL 2P44B 4OZ4A 4YBHA 4KDTC 3SKNB 3PGCB 4JFEB 1RU9H 1FNHA 4X7FC 3K2UH 5I8OH 1JNHA 4K3JH 3HC3H 4DQOL 1DUZB 5JXAL 1GPOH 2F54A 4HKXB 4JRYE 5DURB 3DRTA 2Y36H 3KXFD 4FMKA 2YUWA 4L8BA 4KH2A 3Q1SH 2CKBB 2E6JA 5AZEH 3RWCA 4Z7VE 1PY9A 2XA3A 4PRAB 3S36H 1M71A 3SE8H 1SY6L 4XWOC 4UOW0 2F54B 4HKXA 4JDZA 4LCYA 1AD0B 1D9KB 4C56B 1BBJA 3I75A 5DMYA 3S37H 2DF3A 5CJBA 3DGGA 3ZYOA 1MF2H 5FYJD 1DN0B 4U1GB 4U0RC 3U7AA 3L5XL 4Z8FH 1YQ2A 2XWTA 4Y5VB 3UYRH 3HA0A 2WIIB 4LASH 4WY7L 3HTLX 2GSGA 4IMKC 4K3GA 4PJ5D 4PGCA 3F7VA 4R4FH 4YHZH 4XP4L 3LH2H 3W9DB 1A6TB 4OF3A 5IGXH 3JZ7A 4Y1AB 1EX0A 3NIFE 1RU9L 1EBAA 2K9UA 2BMKA 1JNNH 5LVEA 1S9WB 3JVGA 3ARXA 5GXBB 1JGVH 1Z0NA 4U0RB 4MJID 5DRZA 5EZLB 1VFUA 3N0PB 3LQZB 2NPLX 1NCTA 2YMXH 4HGKC 3FOMA 3WFEH 3H42L 1OW0C 5KN5A 1LP9A 3EYVB 1QO3A 4K3EL 3QNYA 3BPOC 5DUML 5IWLA 3BW9A 1N3NA 1TMCB 4JRXA 4FXLA 15C8H 1WZ1H 3B6SB 3JTSB 2FO4B 3MXWL 2DQJL 1JWSB 2AJVH 2VKWA 3BAEH 3DNKA 4I77L 4ERSL 4BK5A 3HZKA 2J6EH 2HP4A 2R0KH 2KZWA 1NBZA 5J1SC 2F5BH 3E8UH 3VFUA 1FL5A 3WJLC 4MHHG 1KPVB 1DUYB 4ETQB 4F8TA 4NHCH 3O8XB 5C9JB 3HZKB 2PO6B 3OJVC 4HLZH 3SKNA 4UV7H 1TCMA 5AZ2L 4OGXH 5CLWA 5DJ2B 1W2KT 4MA7L 1MJ8H 4BH8B 1EJOH 2ZSWA 1AGEB 3TA3A 3G6DL 4Y2DA 3DX9B 4GRWH 5I0ZA 4I48A 4GG6B 4E5XB 1H8SA 3CX5J 3T4YA 4BH8A 3TO2A 4OFVA 1CD1A 2J8OA 3LKRA 2J88H 4PJHF 5MERB 5SWQA 1RHFA 5EZLA 4X4XA 4WUUD 1CLYH 5DJ8A 2PO6C 5DTFB 4OAWA 2EIZB 1AR2A 3V0AC 2FEDD 3VFOA 5M7QA 1IZKA 3WN5A 3MGOB 1DQML 3UTPE 4WFFD 4I3SH 4XAKD 3W39B 4RWHA 1CS6A 2AEPH 3QDMA 3MLTB 4OTXH 4LBEB 4M4RA 1JGEB 4G8GB 4HS3B 4ODXB 5CJ8A 1A6TA 2CDFB 4OV5B 1P1ZB 4LIQL 1DBJH 3QH3B 1IEAB 2AJ3A 3FT4B 3MCKB 5C09B 5JXEC 1MHCA 3RIAF 1FFNB 3FHQA 4OLZL 4CVWA 2HMID 3ZT7A 3RIAK 3C6SB 2BNQD 4MA7H 2X89A 5J0BA 2ZOLA 4H8WL 4ZNEE 1PQZB 3OKOA 4YK4B 4Z7WA 4BUGA 4OJFL 1FNGA 4YHML 2YD4A 4PJ8A 3G04A 3BYTA 3LEYH 5ITBH 4LVEA 3L5JA 5C2BH 3IDGA 4BFIA 4M48L 2Y06H 3M1BA 1KJVA 1NAML 3B8YA 4OQTL 4X8JA 2IH3B 2XA8H 1JCKA 3LQAL 3VFWB 4A6YL 1B2WH 4J3XA 2AJYH 2V7HB 3T8XA 4JG0H 2FYYA 1OWRM 5KS9E 1N0XL 1OAYL 1BGXH 3ULVD 3N9GH 4XNMB 1ZLUK 5C0NC 3P9WB 1RZFH 3RTQD 4LSPL 4U7SA 4YK4C 3T1FA 1QSEB 4TQEL 4KROC 4OLUL 4OV6F 2R2HB 3UX9B 1YJDH 3VXNA 1OTTC 1W72L 3GSWA 2VDRL 4WU7A 3BISA 1ULVA 3DUSA 3P0GB 3LKPB 1J86A 4HJJH 2BNRA 5DRWA 1DBBL 1CCZA 1NDMA 1GSMA 4X9BA 2ITDB 1KIPA 3GSWB 4XBGB 5A3IC 2XQYK 5CZVH 3L3IB 32C2B 1HH9B 5L0QB 1IEAA 2OJZL 3FT4A 5C09A 5DHYA 4EN3A 2ZJSL 5IIEB 3BZDA 4W6WB 4E5XA 3JBG7 4LPCA 4Y4KB 4FFVD 2OXHA 1T5XB 2NZ9C 3WIFB 4N1CA 5J6HA 4KROB 1J05A 4LLWB 2I60L 3C5JA 4Y4KA 2O5XL 4EDWL 1IC1A 1FGNL 3MLXL 4FTVA 2HWZH 2UZIH 4P2OA 4LHUD 3MCG1 4H5SA 3DVIA 4KJYA 2XPGA 4JRYD 4OBRA 1GYAA 5CP3H 4QHLB 1IGFL 4YZFF 4OF5A 4DW2H 1J0ZA 2C5DC 1F4YL 1CR9L 3ALPA 2NW3B 2EE9A 4ZFZA 4I3RH 1A7QL 1A2YB 4GKSB 3D39A 2VDMH 2PXYA 4ZSOB 1FFNA 4M93C 4L5FH 5F9JA 4YDLB 1PSKH 5IVXE 3JV4A 3RWIA 4WNQA 4NO0D 5FO9A 1TPXB 1U91B 2ARJB 3DGCR 3IFOB 5F7NC 1HHHA 4ISVA 4WWKC 3HB3D 3L7EB 3L3GA 4K7PH 5F9JB 1H3UA 3ARZA 3FZUC 5FO7A 4YHYC 3MOQA 1U91A 5KSBF 1G0XA 1XR9B 1KN2L 4LAQH 3AB0B 2KPNA 2L7UA 4JG1L 3ARGC 4IIQC 5IVZA 2IMMA 3T2OA 4QHKI 4OF6A 3TIEA 3GO1L 4EN3C 1CD8A 3IXTB 4JB9L 4PJGB 4XP9H 1Q9KB 5ISZA 3WFHB 2XTJD 3MZGB 3LZFH 3MV8A 4K23L 1NFKA 1TPXC 2XWBB 3CFKA 2VE6A 3DXAD 1I1AB 5I1CH 4L4JA 4NQVA 1RK0B 4E9LA 4FTVB 2NY6C 4BSVB 4H5SB 4XBEH 4Z7UF 4Z78A 4HV8B 3GSNB 2BNRB 1WCBA 3VI3E 4P5TD 1NEZB 1ZVYA 3QDJA 4KK5D 2DTML 5GRUL 5DHYB 4EN3B 4G9FB 3EYOA 4K7PL 3VXOB 1G9MH 1NEZA 1HSAA 3L6FB 2QEJA 5MHSE 3RWIB 3QUXA 3G5XB 3V6OE 1IM9D 3K80A 4HH9B 3QXDA 4HCRA 1CFBA 5JQHC 1NAMB 4H25A 3PDOB 4MVBD 5E6ZA 5FDYA 2Z4QB 3MGAA 2RFXA 4EUPB 1V3JA 2N7BA 1NGQH 3DBXA 4PJ8C 5KOMC 1EA9C 1NAMA 4IMLA 4P4KA 3KDMA 4EQ2A 5CD5D 2WWMD 5K9QG 4PJIF 4D0BA 4HWZA 1KLGA 4ZPVA 5C8JB 3MC0A 5HPMA 4FQJL 3QEUA 5T5FH 2A1WL 3DHJA 4KDVA 4O4YH 2Z31C 4FQLH 3E6FB 5TDPA 1Z9SA 4U1JB 5DA4A 2P8MA 5C0JA 1E4XL 4IHOB 2KQNA 1DE4B 1T66C 5FOBB 5TQ2L 3MUZ1 3WN5C 4FQIH 5JDSA 4LOUD 1I3RA 3U1SH 5L2JA 3L5XH 2VABB 1HYSC 3TLRA 2A9ML 1HSAB 2IQ9H 1F6FB 4MDIA 2ZP0T 1TJIL 5MEOA 3UYRL 3T4YB 5HVHC 3BKCL 5AD0A 4MXQD 1GL4B 2XFXA 1NC4B 4F15B 4OLXL 3MUGB 5JW3L 4JFQB 4PJIE 4ZO6A 5TDOA 3EOAA 2VWEE 4IOFD 4JFDD 2EECA 5DLML 5IR1B 4WHTA 2CDGA 1I75A 3QFJA 3WN5B 4HV8A 3SO3C 4U2YA 1GPOL 4PJAE 4EI6A 1QBAA 5I76B 3OX8B 3ARGD 1AR1C 1HQ4A 4JPVH 1MHHB 4YAQB 4ORZC 4JPKL 2W0PA 2IADA 4O00A 3WJLA 1L7IH 3HNVH 1NANH 2HT3C 3DYOA 4F37F 4ODVL 1D3CA 4WW2B 5IESL 5F1NA 5IBTL 5SWZB 4GRWF 5I0DA 3TYFA 1CFSA 1P2CB 1ZA3B 2FECL 3CC5A 1IEHA 5IW6B 1JNLH 1F11B 4KZEH 3MNWB 4P4KD 3SDAB 1T1XB 2X4RA 4LLYB 4PJEE 3WHXB 3MYJA 4QXWA 1IKNA 1LE9A 3M45A 1H3TA 2IQ9L 1EJ6A 1QD0A 1IGTA 3EDKA 1GOFA 3RWHB 2HFFB 2DQTH 1XF3B 3OBAA 4P5TB 1T0PB 5GGTL 5BMFL 1RUKL 2NW2B 4ZOEA 4KXZH 1IC7H 1G7JA 5HHMB 2VXTH 3O2VL 4PBWD 4M6OH 1HHJA 5DYOB 1CQKA 4ESKA 3O3BA 4OCRL 3CCHA 2BOCA 1LK3L 3H7BB 5CIPA 3C9NA 5EPMA 1YEJL 5IM7A 2VLLA 5FA3A 4JO4H 2A1WH 2H32H 1ORSB 4KKCC 4J3OC 1I8MA 1XGUA 2FSEB 4Y5VC 3RL2B 1DDHB 4UT6H 4WEBL 2P5EE 3DX6A 3AAZB 4S2SB 4I2XB 5C0CE 5FO8B 2APXA 5CILH 2WANA 4P5TC 2NY2C 4XVJH 3BP4B 4S0SD 3I3BA 3QFJE 1NUDA 1WZMA 1ZS8A 5HI5D 2UYLB 2CK2A 3QPQC 4M62H 2AK4A 2VDOL 5C6TH 4PRHE 1TTFA 3DX8B 3VXME 3NFPB 5EU6A 4KI5D 1B4JL 2OX5A 5C07A 4MCYB 2AK4B 1K85A 4QGYA 2JJSC 4R4ND 2OK0H 3QNZA 4U33A 4KZDH 4RAUB 4R7DB 1KIQB 2R23A 2J7LA 3EAKA 1UKTA 2A6JA 4ODUB 5JQ6H 4FXKB 4XXCC 1SY6A 1OGTA 1W0YT 3V0VB 4P2QE 2JJTC 1IC7L 4UBDD 3RWJB 2BNUA 3V95A 2PW2B 3OAZH 5EORH 2EYSB 1HCVA 4ODUA 1QSFE 2MKWA 3AS2A 3BI9X 4QRPB 3CCHB 4HXBL 2X41A 5D1XC 2W0KA 4OM1L 1IAKA 4PRNB 3B5TA 3IVKB 3B5HA 1VEMA 2A83A 4LARH 5JZ7D 4XC3H 2R56L 4O51A 1DQQB 1G7QB 4YWGH 4P46D 1UJTA 5HI3C 3U9PL 3D1MC 3Q5OA 5E2JA 4YX2L 1OAQL 2EXYC 1Q9LB 5GQBA 4PJHA 1EEZB 1G6RL 2HWZL 3IFPA 2PUQT 3FQUB 3U46A 3BP4A 3TBYB 4G42A 1FCCA 5F6IC 1JHLL 2IJ0C 4PD4J 1GGTA 4YHNA 1ORQB 3DMMC 1DQDH 2FJFB 2QHRH 3G6JE 3TFKD 1GJIA 4CVZB 3LRSA 3CMGA 4UMGA 4MQ7A 2XV6B 1DCLA 2X4OA 1F4AA 1NCCH 4GKZA 2MHAA 4IOSD 3INUH 5AUMA 1ZGLB 2EEBA 1XGRA 3C9NB 4YGAB 3W5MA 3GIZL 2HFEB 3AS3A 3CSYB 4GLRH 4OD2A 2BSRA 4KQ3H 2IFGA 1B6DA 1RQ5A 1X4XA 2DLTA 3DVNA 1BBDH 2AXFB 2EXYD 4HJ0D 1I8MB 2Z93B 5DVKA 2ZUQC 1BM3L 5DEFA 2UY6A 4IJ3B 5EZIL 4R7NB 4JFHD 4HJ0C 4HPOL 4NNXA 3ZKQD 1VB9A 3DMMB 3PDDA 4RGOH 1A6UL 4QRPA 1I3GL 1BMGA 1DBAL 2HN7B 2VAJA 2HFGH 3ZE0F 3TN0A 1AI1H 1T1ZA 3D0VB 4JFPA 4PGJA 3GKWL 4YDJA 5BRZE 1JZ2A 5HYFA 3LKSB 3ORJA 2EEAA 3OKMB 1I4FB 3WFDL 2EKJA 5BW7C 2V2XB 2YRPA 3ME0A 2OL3A 4Z76A 3SE9L 2YD6A 5I1EH 4J12A 3B9KC 1ZANL 5D93B 4YDIL 3MJGX 4ONHA 3SKMB 2BSTA 4FFWD 4HULB 5D2NC 2AEPL 4OF8A 4MXWH 4V1DD 4LU5L 2BCKA 1BJ1J 3N06B 1IC5H 5E7BA 1MFEL 2FR4A 3AM8C 4GS7C 1BAFH 1IL1A 1V7NH 1S7XA 5E1AB 4HAFA 1CICA 4DTGH 4OLZH 1WJ3A 5DR5L 2CKBA 4LSDA 2AV1B 1KBGL 4YXKH 2D7QA 3UZVB 4RAHA 1JZ7A 2BC4B 4ZPVB 2Z35B 4DEPB 5K59F 1X5HA 1L9NA 2ZUWA 4X6DF 2A6DB 4YEEA 4X7TA 3TNMA 2PR4H 1LO3L 3O2DH 4RISH 2Q8AL 5B38A 4MD4A 3QIUB 3IDUA 2DI9A 1FPTL 1YNLH 1E4WL 3BH8A 5IMOA 1OAQH 4KMLB 3VH8A 1U3ZA 4LCCC 3ARBA 3PWPE 3S98A 3V5HA 3U9PH 4HLZG 5IQ9A 3U7YH 1DE4A 3D3VE 4PJBA 1MPAH 5FECB 5JHDA 2BJMH 3QQ4B 3BH8B 4JG0L 1PKQB 4MA1B 1I7TA 1A7OL 1SBSL 2OMBA 4TVPD 4OB5H 3GBNL 3P11L 4YHNB 5LJYH 1EEYA 3C8HA 5D7IE 1CU4H 4J8RA 4KTDL 5CEZE 2IANA 1JV5A 1FAIL 2GJJA 4AT6A 3OHXB 3BZEB 5D1XD 2IAMA 5J6GB 4A2MA 2H3NB 1VENA 1Z5LB 3GIVB 5HSFA 3W11D 5CJ5A 5EOCJ 4RIRA 1I9RH 4HDIB 1DVFC 4HWNA 4Q9RL 2AXFA 4KAQL 4XWOD 1U95A 1XCTA 1R5IA 3VWKC 2PTVA 3SE9H 1DL7L 5HHMD 3BE1H 1S9XB 4LVNC 5CHNA 5AYQA 3FO0H 3S4SA 3IS1X 4I9WE 5D2NE 5IKCA 1E28A 1R3HB 5HGGS 1J1PH 1RZKL 3GEWB 4NBXB 5F44A 3SOBH 1W8NA 5DEGB 3RQ3A 4R8WL 2VXQL 1H5BC 3JUYA 5MENB 3FCTB 1U36A 4WJ5A 2DM4A 1QFPA 3EJZC 5DRXB 3T3PE 1Q72H 3PP3H 5IMLB 3AC0A 3PF2A 3HCVA 2BFVL 3H42H 5F3HA 1HNGA 1BZ9B 1DVFB 3CVIH 3ZDYE 4XMLL 5DSCB 4WWKB 5EBLB 2GJ6D 4C4KT 3C60C 3RJQB 4E41A 3VWKB 3L95B 4PRHD 2B0SH 4YHYB 1PG7H 3MJ8B 4F9PA 3SDXB 3G6JB 4EBQL 1GZPB 4S1QH 2W1NA 4XCFH 1G9NL 1PEZA 2ED8A 1TXKA 3O6FD 3Q0HA 3L95A 1JWUB 4NZRL 4BH7B 3MJ8A 1JYWA 3QCTH 4NQEB 1LVEA 3UO1L 4ACPA 1L0QA 3MBED 2FO1A 3IJYA 4XMPH 5C0IB 3ECBA 5CSGA 3BWAB 1TZHB 1KBGH 3MV7E 4RAVA 3HI1B 3PL6B 3C60B 2OYPA 4KJQD 1SJEA 2BVOA 3TPUA 1X6LA 4OI7A 1MIMH 1FO0A 1SYVB 3VH8B 3S35L 4RGMC 2ZUSA 4XNQB 4HC1L 4JKPL 2OLDA 5IMOB 4QEGA 4F9PC 4RA3A 5DZOA 3FN0H 4YBLC 5I19H 3C5ZC 4U0QB 5D7JA 1KPUA 1AXSA 4UU9A 1FNFA 2C3HA 1PD6A 1QRND 1ZS8B 3QQ3B 2W38A 4KK5C 1BOGB 5I30H 2ICWI 3H3BC 1V05A 3IGAB 4JFEA 5LCVH 3W11C 1I85A 3WE6B 1B4RA 3EGSB 3F7YB 2R8SL 2DN7A 1I8IA 2MCG1 4H20L 3OZ9H 3G9AB 3U6RB 4PJXF 4HK0A 3FOLB 3VFGL 2YD5A 3MBEB 5IEHA 4R7DA 5TPWL 4XT1C 4JY5H 3KJ4B 5DD1H 4PJ8B 5DRNA 3QFJD 4M7LT 1NDGA 4NRZB 4XH2B 4YNYB 3B9EA 5HDLA 1WBYB 4NO5B 1QSEE 2CQVA 3GSXA 4NUJA 1SYSB 5DRNB 2GIYA 1FIGH 1EHXA 5LXGL 1NGYA 5E70A 1NGZB 1CFTB 4HIJA 2V7HA 1CDGA 1I9EA 4ZUWA 4IRZH 2X4UB 3NZ8A 4XCEB 4U6HA 2V9RA 4EI5A 3BD4A 4RDQF 1Z2KA 2GITB 3VWJC 5IVNA 3MFGB 4MYWB 4H0HB 3KJ4C 2CRYA 1MFDL 2UZXB 4PJXB 2DIBA 4Q9CA 5D1ZA 1A3QA 1LEIB 3NCJL 3H9SB 4HGMA 1UB6A 3A6CL 1T66D 1QYGL 4O02H 3R06B 5F88A 1BFOA 4NBZB 2YEZA 4RCAA 5T33H 4AENA 2LU7A 3VXQB 1J5OL 3F7YA 5GGRA 5C0EA 3Q1SL 3BN3B 1K3IA 1C1EH 3QJHA 4IRJB 5D72H 4TUJA 5GRUH 5J1AA 5J6HB 3GMNA 5I2IB 4QRPE 4RAVB 1T20A 1PG7X 1DANT 5F6HI 3SHSA 4LCUB 4MCZA 2R1WA 4NYLA 3FQTB 4IOFC 1PGRB 2OCFD 2BDNH 3OR6B 5JW5B 4G7YH 1RZJC 3DV4A 4L3EE 4XNQA 1XR8B 3H9HA 2DAVA 3SJVE 4KWUA 4DK3A 3ULUH 4N8CH 3LEVH 5JNYB 1NL0L 3PHQA 2YD8A 3VFUB 1QNZH 2BY2A 2VL5B 4IS6B 1JJUA 1R24A 1KFAH 1N7ML 4PRPB 1RPQA 1F3JB 5CMAA 4G6KL 1IAOA 3Q3GB 2QSVA 5H2BB 4UV7L 3HPLB 3VMOA 1I7ZA 3FN3A 1KCSH 4PLJC 5I8CA 4JN1H 3AGVA 1MRDL 5KAQG 4MNQA 4MLSA 1UH2A 2PYEA 2NR6D 1R0AL 4HXBH 3ULVE 5GZND 3MODH 4TSCL 3V5DA 1EAPA 5T3XL 4KJQC 1JNHB 5KSAB 1V3MA 3T0AA 4ELMA 4R96A 7FABH 2WV3A 1KYOK 3KPSE 1OQOA 3TF7C 1VCAA 4I0PD 4L8BB 3MOBL 3QQ9C 2CIKA 3DXAA 5DTFA 3ARYA 1ITCA 5HXMA 4CVXB 1BWMA 4I4WB 3X3FH 4K8RD 4OLWL 1NBYA 3GBML 3HUJE 2CH8A 3D3VD 4QXGH 5EOQL 3STLB 1U93A 5KVFL 1RZ8B 3LRGA 3JXAA 2HA1A 1S7TB 1M4KA 1J0YA 4I5BA 4NDMB 5D1ZB 1AGEA 3TA3B 2R29H 4PRHB 4MD0B 3H9SA 1J8HE 1DQJB 3QJFA 1R24B 4CL7A 5E2TL 4MMXC 5GGUA 4M6MH 12E8L 3X13B 4TVSa 3VGBA 4HSQA 4G9FA 1YEIH 1KXQE 1VEOA 2GHWB 5LAXB 3LHPL 5EIIA 3FZUD 4LPUA 2MKLC 3R0NA 1IT9L 5J9PA 3BRFA 4MAUL 2ICWB 1JRHL 2D7MA 4CNIA 3QO1A 3QJHB 4ZFFB 1O7SA 4BJLA 1A6UH 3IDGB 4BFIB 4FQXD 4BZ2H 4ZG1A 2WQRA 5E8OB 1TVBA 3FFCE 4R4BB 1P4IH 4J3WA 5FCSH 1P4BH 1B6UA 3DV4B 1FFPA 4I13B 1JHLH 4R26L 3GBMH 1R5WB 4ZUSA 5J56B 1UVQB 5CHNB 2HMIC 4PB0H 4QWWD 4OV5A 5DHVB 4TUOA 4WY7H 4Q7DA 1A1MA 4L1HA 3CX5K 4LSPH 3P3YA 2OQJA 2PKDA 5D1XB 4O2FA 1RIUL 2ZG3A 1NCCL 2CXKA 3FCTA 3V6OC 1U3HA 1OAUL 3IJSA 1NSNL 5IB1B 4TVPH 2ERJC 3KPMA 4X6EA 5HDBF 4OQTH 4DN3L 1RZKC 5FYKL 1GAFH 2OP4L 2H2PD 5ID0A 12E8H 3PWLA 3ROLA 3MLRL 4ISVB 2A73A 4U1NB 3C2AH 3BPNB 5F6IB 1WISA 3VFPA 3QPQD 3B2UD 1JMXA 3OXSA 1VKXB 1W0WA 3RUGE 1JRHH 1VERA 4HKJA 4PS4H 3PNWA 5HGHA 4X5XA 5JPNA 3TCLA 4ZD3L 3LQAH 3TESA 4LARL 1KCUL 3MLYH 4OZIF 2C7UB 3S37X 1S7VB 4PJAB 4B7LA 4C55A 5E2TH 3MBXH 4JHWH 1DBML 4KKCD 4PJGF 1YEHH 5IVXB 4NM8H 5B3NA 3SGDI 4JFFD 1FVCA 3BPNC 1FL5B 4YQXL 2ZUQB 4MQXD 1QKZH 4U05A 4X5LA 1BQHB 4YPGB 3BP6B 3QDMB 5FGBC 5DVOA 1MELA 3QULA 3KPRB 5D7LA 3T65B 4AM0A 2ARJA 1B9ZA 2XWJB 3PIQB 4I0PB 2PTTB 1NAKL 3MUY1 4P9ML 2W07A 3IGAA 3PQYB 1T22B 5GS0C 4FQ1H 4KI5E 5EC1A 1ZWIB 2GCYB 3B4NA 1I3UA 5D93C 4Z7NF 3EJYC 5HVWA 1NFIB 1F8TH 4G6ML 4ZUUB 1J1PL 4GRWB 1RZKH 1UWXK 3RPIB 3SBWC 5KN5B 4WFED 3MLXH 2R0ZL 3D3VB 3HS0A 4WV1C 4L5FL 2O5XH 4EDWH 3CXDH 2VLRA 4OFIA 2YD1A 2EDTA 4N9OB 4GS7B 1ETZB 3DBXB 2DL2A 3GJEA 4TYUA 4XMKH 2GTWA 2CDEA 2Q8BH 5J3HC 1OF2B 5DD0L 3B83A 3RX5A 4NKIL 3REVB 4XBEL 4PRBA 1KJ2B 1A7QH 4P4RB 4QKXB 1ZT4B 5HI3D 1WK0A 1A1OA 1Q94A 3LS4H 4N0YH 4Z7QF 1WAAE 5A16B 1OWWA 5AWNL 2NY0C 4DGVL 1G7IB 2P5WE 1P6FA 1SJVA 4JHWL 5EUOA 4IRJD 5CLTA 1CDYA 5FYLD 3FRUA 3B9VA 3WSQL 3SDXE 5GSVA 3VD3A 2G2RB 1R6VA 1KB5L 4DAGL 4HWUA 1INEL 4HKJB 3S35H 4OLVH 4GOSA 5F96H 4NC2B 4X5XB 1IM3B 5IHZA 2FJHA 3NCYP 1O0VA 1BREA 2DI7A 3UAJC 5C2BL 2Q76A 2HLAA 1ZLWH 2FYYB 3WHE1 2NY0B 5MENE 4O2CB 4NQCD 1EDQA 3UZQA 1WBZB 3WXWH 5C0FA 5L6YH 5DJYA 3QDME 1L7TL 4FP8L 1A9BA 1YC8A 4O2CA 1VPOL 5J11C 1A3LL 3MRKA 4P2RE 1E27A 1XF5A 2WUCH 2APTA 2P48B 3QCVL 4M61B 5I75B 2AJUH 5LGJB 1CGSH 1Z9LA 1YEKL 3MRPB 2J3SA 1AKJD 3EFFA 3ARGB 1I8LA 1H5BB 3H6JA 4LCWA 3M8OL 4U6VL 1T2JA 2CO7B 2EE3A 3ARQA 3PQYA 1TQBC 3KPOA 3ZL4H 3QXAA 4JFED 3T77A 1XGPB 1JPTL 1O7VA 2E5EA 3UTQA 1DR9A 2OJZH 2EKSA 1S9WA 5TE7L 2V5MA 5D8JH 1NFIA 3G6AB 1T3FA 3LN9A 4ZTPL 1JWMB 3GRWA 2AXHA 4D9QD 4PJHB 3BT2L 1N8ZB 3GMRB 5HHXH 3RWGB 4HUXB 3P4NB 3PWPB 3KLHC 2F8OA 1N64H 5DJ0B 5DD5H 3BP5A 1OF2A 2WWKT 3PG2A 3TBSA 4XVSL 4HCRL 2HT4D 1T89A 5DURD 1ZTXH 4JR9H 1FVEB 4U49A 3FRPA 4M7JH 4DJMA 1HWGB 4FZ8L 4UOJA 4LCWE 3W0WE 1HQ4B 1K3ZA 2XYCA 1DTUA 2ITDA 4XHQA 1PX3A 4BSVA 2WUCL 1CWVA 1JF1B 4YGVB 3BKJH 1YEGH 5GHWH 1BVKB 1YDPA 3GK8H 2VRAA 5EUOB 1Q9OA 1FH5H 1UWEH 2CKNA 4XRCA 3MLUH 1HK6A 5D7IB 2AXGB 1SQ2N 5DD3L 5F71A 2APBA 1UC6A 3WD5H 1U8NB 1DL7H 4KXZI 2MJWA 4XNZC 1ZHNA 2HTKC 5F93C 1Y18B 1DQTA 1HOCA 4U1IB 5ETUB 4N1EA 1EHAA 1X5AA 1A6WH 1EV2E 3HLAA 3WUWA 2XTJB 3O6KH 3IU3A 4HKZA 1ND0A 1N5AA 1FL6A 1BIHA 2E9WA 3GJFK 4WDIB 3JWNC 5HHOA 1KJMA 1S5HA 4FXKA 2VZUA 3C87A 3QUYD 4OGAC 4U3CA 3P4OA 1ZHLA 4OCRH 2P5ED 3F8UB 4JO2H 4L8CA 3HI6L 4FFYL 3S4SG 4LP4A 5B8CA 1DSFH 1U2HA 3FO2B 2ADIA 3QEGH 3NACL 2C26A 3NZHL 3VWJB 3RGVA 3GK8L 3L3HA 3MRLB 1U41A 3G5XA 4NT6A 4NRYB 4F7EB 1LK3H 5C92A 2F54E 3LS5L 2GK0B 5D9SA 1XH3A 2OXGA 4TRPH 4HZAA 1AE6H 3CJJA 3MJ6A 5F3BA 4OZGB 3KYMA 1I3RB 2J2ZA 1Q9KA 4IDJH 5I1GH 1QSED 4JLRA 1TETH 4XNYL 2ESVE 3RWDA 4G8FA 2P47B 4N5EC 4LHUB 3SE4A 1C12A 1FFRA 4WUUE 2HVJB 5CBEA 5DJ8B 3VXRB 3KDMB 4RAUA 2H9GB 3GMQB 4WW2C 1CTOA 3D87B 4Z9KB 4U4BA 2BRRL 2I9TB 3MRFA 3SCMB 5ANMB 5HY9A 2CLRB 3HMXL 4LSRH 4NO0B 2EH8L 4G6JL 1TJGL 4OUOA 4HBQA 1ZSDB 4ONGH 4G8IB 3LHPH 4BSWB 1PZ5B 1MNUH 4UB0H 1P7QA 1A02N 3GSOB 1J8KA 2BY3A 4FFVC 3HAEH 4Q6IA 5D1QD 1KIUA 1WC7A 1BJMA 4QHUB 5B4MD 1OD9A 4OF0A 4TVPL 5IV2A 4JFFA 3BJ91 1KEML 4WWKD 3QFDB 3ZDYF 3RKDC 1CF8L 1N4XL 2BVYA 4G5ZL 5CEZD 2IMNA 2X4PB 1PQZA 3OKOB 5F1NB 1WTGT 1N59A 1F2QA 2J6EL 1HIMH 3W0WD 1GGCH 2FZ3A 3NIGF 4HJGB 4JO3H 4XZUB 1FRGL 2Q6WA 2O5YH 4QRTA 1UXWA 2AV7B 3KAAA 3U9UA 2DJSA 3LRHA 5ITBL 5A2LH 4XPTH 2R0LL 4E41E 3RIFF 2ICEA 4F80A 5JTWA 1AIFB 1RJYB 1AGBB 4LPXA 1TCRA 3OXRB 1GAFL 3D85B 4X98A 3TIDB 4YFDB 1YEDA 2DQFB 4OZHA 2K7QA 2J8UA 1BGXL 1HHJB 3GI8L 5DYOA 1WT5A 1MNUL 4UB0L 1RV6X 5IBUG 3O6FC 1DQMH 3H9YA 2OSLA 1N26A 4NHUB 2FWOA 1ZE3C 3MPCA 4YWGL 1LP9E 3MCLL 4RMVA 5BV7L 3HI1A 1EXUB 2MPAL 3OKEB 4J1UB 3SQOH 1PZ5A 2NY1D 1H9VA 3O8XC 2Z0BA 3TA3C 3QDGD 5JOFA 2H1PH 3PJSB 4XP5L 1X9QA 4DGYL 2ZKHH 3MSPA 5IIEA 4TULL 2CR6A 4DWHA 3FFCA 2Y1VA 4GBXD 2EDYA 4XXDA 1AP2A 4OZGA 3Q2CA 3QIWA 3VCLB 1QTYT 4OZFB 1TETL 2HFFA 3NA9H 5CEYA 4QRSA 4HG4K 3RI5K 4JANA 1YY9D 3SY0B 2A6KA 3QG7H 3ARDC 3DTXB 4PGZA 2IEPA 3G6JF 3MNZA 2LVEA 3MRFB 3SCMA 3VWKD 5JIIA 5J89A 3O2VH 2QQNH 5DJYB 3P0VL 3BKMH 4UQ2B 1VFAB 5T5NF 2KBGA 1BLNA 2J8UF 5JIPA 5L2KE 3UTZB 4PB9L 4Z78B 4NKIH 4G8GD 4ZSOA 5DMIL 2OI9C 5FGBA 4GMTL 4KV5F 1E6JL 4LCWB 3UTZA 3H3KA 5C0CD 4GMSL 3ARDB 3V79C 5CJXA 3KJ6L 3MBXL 1I1FA 1EPFA 1YY8B 3P0YH 4WU5A 3I2CH 3KYNA 1NMAL 3CFDB 4QF1B 25C8H 4LSQL 3VXTA 5C6PB 1QEWA 1RY7B 3T4AB 4JRXD 4QYOA 3DUUA 4M62L 5DVNA 5INDB 4N8VG 3GHBL 5CZXC 3MZTA 2YUXA 5TGBB 5E8NB 4NIKB 1VFMA 4JN2A 4XB7A 4J8RB 1N8ZA 2AXJA 4QYOB 5EZOH 3P9LB 1XZ0B 2DBJA 1NJ9A 3QUMA 5SWZE 3OR7B 4PGBA 3F7RA 4XPGL 4JN2B 2VE6B 4HQQH 2VN4A 4MNQE 1GHFL 1T6VN 1UA6L 2BHZA 3LIZH 5C0EB 3LZFL 2X4OB 5CJXC 1A6AB 3HPJA 2IWGA 2V6HA 4OAWB 4JKMA 3NH7L 3O8XD 4FQCL 4W70A 3NA9L 5H8DA 4KV5E 4BK4A 4ZOAA 2OSLB 1MRFH 2BVOB 2JB5L 1KUMA 2MFNA 3UPRB 4NNPL 2NLJB 2XTLA 3MX0A 5D2NB 1H3WM 3O3AA 4XPHL 5F7UA 2CGRL 5C70A 1FPTH 1YNLL 3PHSA 1KTDB 1X7QB 4XP5H 4HS3A 4ODXA 1MFBL 4E0RB 5E4EB 4F7TB 3CFJA 2HKHH 4OD1H 1UEYA 4NWUH 4I0PC 1G6RH 3VGAC 3D69A 1AP2B 5C07B 2BNQB 3TV3L 5C0BE 3BZEA 3EYFB 1NCAH 3QDJE 3RA7L 3SDXA 3FMGL 1N2RB 4EZMA 4NFBA 2XZQL 4MNGE 2QV2A 1K8IB 3QIUC 4PP2B 2FD6L 2OP4H 4R97C 3SDAD 4NCC1 5SX5H 4Y88A 3X3GL 1A3RL 4YXLL 3UO1H 1IE5A 2P5EA 3LMJL 2LTQC 4ZFOA 5D1ZD 5LGHH 4GXVL 2HFTA 2IC2A 4HAGA 3RX7A 4PTTB 5DDHA 5GJTL 3FOMB 5I1AA 3BIKB 3PWVA 5ITFA 4MLIA 1ZEAL 1Z6JT 4JKWA 3PWUB 3QSKB 3U7WH 1IQDB 4RWYL 1QRNE 2XICA 2E8YA 4JQVA 1G6RB 4LLDA 3TT1L 1I3GH 2X4UA 5F70A 1A4JB 5EO0B 3B8SA 4PG2A 3ZDXE 3LEXB 2XQYG 2A2QT 1MFCH 1AXSB 1D5XA 3T3PF 4OZGF 3QQNA 3BUYB 4NWUL 2ATKB 3NCYS 4LVNB 1A5FH 1C5DB 4QXTA 1BD2E 1U8KB 5AAMA 1T1YA 3ULUC 4C59B 2FR4B 1I7TB 4XPHH 5C0IA 1G9NH 5D5ME 4QRRA 4IIQB 4U3HA 2DQDH 3K3QA 2KL6A 5HYJB 4Z77A 1CZ8L 3X3GH 2ZOKA 3C5JB 2EYRB 4I48B 2QTEA 2VSDA 5F1SA 2VXUH 2BVPB 4P2RB 2FX8H 5BVPL 1GOGA 2GAZB 4FA8A 2E9BA 5I76A 2VLKB 1EGJH 2NY6B 4NUJB 1QA9B 2BRQA 5E99L 3F62A 5D70H 4K9EL 1NGWB 5JR1H 5H35A 4GW1A 2NLJA 2EIZA 4YJZL 4NPYB 3O6KL 4ZFZB 4HXAL 1TENA 5HDQL 5GRXG 2AW2A 3FONB 1OTUC 4G6AC 2E7CA 4DCQA 5I1LB 1I4FA 4ENED 5DEGA 3DIFB 2ATPB 3EHBD 1T04A 4MA8H 1JE6A 3BGFB 5I8KH 3DRQB 4F3FA 1P1ZA 1QLEH 3PGFL 5FGCB 5DT1H 1BZ7A 2FZ3B 4DKFH 4JQVC 3PL6C 4X4YB 3FFDA 4BZYA 5IJVA 2R39A 1J5OH 1N0LA 4H1LB 5FCUL 3QDGE 1MHPL 3PL6D 1OP3H 2YPLB 4OZIE 3TO4A 3Q48A 1G84A 5IUSA 5KVDL 4YLQT 5DC0A 3ZE1F 1JZ5A 2WM0A 1GGYA 1GGIH 1OPGL 5IBLC 1C1EL 3UJTH 1MFDH 4NQDE 5FEBA 3TZVA 4J6RL 3JWOC 2FX9H 3TIDA 4F2MA 5F7EH 5AZ2H 5SWQB 3BGFC 3HG1D 1RVFH 2UY7A 1TTGA 3L1OL 4Y4FD 2NCMA 1G7HA 1IILE 1Z9MA 4KU1A 4P57A 1UKSA 4BFBD 3SOBL 5IQ9B 1FDLH 3I85A 3TJHD 1CZ8H 1U8JA 4HIIB 5DI8A 5F3HB 4DN4H 2PYEE 4OGAD 1MEXL 5B38G 2ZSWB 3BPCB 3KS0H 2VXTL 4NKDA 2HAZA 1YYLH 2QKIA 5IF0A 4XNZB 3V8OA 1NC2B 2Q1EA 1PBYA 3EZJB 3ZT5A 3PIQA 1IARB 3K81A 3ARUA 5EIIB 1AXIB 1EFXA 1HHKA 1FGVH 3D39D 3PE9A 3OR6A 5JW5A 5KSBE 5CBAB 1C5BL 1YEGL 4MDJA 5FK9B 4F7MB 4LPWA 4NUGH 3CLEH 3G5ZB 2DQEH 4LSUH 1IKFL 3TC9A 1MI5B 4JQXA 4KZEL 1R3HA 4FQQB 5DHVH 3TEUA 3GUTA 5ERWB 3MACH 1RUQL 2P46B 3QO0B 5IHBA 1YMHA 2BHYA 4B0MM 4HC1H 1A4KB 1S3KH 2DRUA 4KMQA 5BVJA 5CEXA 2LAGB 2A77L 1BQUA 5DK0B 1JVKA 2NX5A 4P59L 1JGUL 1J8HD 2ATPA 1OL0A 4W4OA 3OJ2C 4NCC2 3TN0B 5CEXB 3BEWB 5D7SH 4JZJB 2R0LH 2BFVH 1G7PB 1CVSC 3IT8D 2C3VA 1WSST 5DQDL 5IB4B 3O9WC 3CH1A 5DJ2A 5CP7A 3ZSTA 1TZIA 4WCYH 4FQHA 3J7HA 3CH8A 1IJ9A 3B3IB 2YD2A 4LASL 5T5FL 4Y4FC 1FGVL 3ROOA 3MROA 3B9KD 1HH6A 2F5AL 4Q0XL 1MQ8A 5GGSY 5JQ6L 4QTIH 4K07A 5I15H 1P69B 2VC2L 5DEZA 3V6ZA 2WINB 1T7VA 2DQEL 2GYSA 3UBXA 1RZIB 3DPBA 5F7EL 3RBSA 3TIEB 5EOQH 3SGKA 1G7LB 3U1SL 2EIDA 1UVQA 2Z35A 4P57B 3MLPA 3CVHL 2YRZA 1BD2D 1FORH 1PLGL 4KJYB 5HGDA 4NDMA 1W0VB 3LKNA 1U8JB 5IVXF 1ZHBA 1MY5A 4Y19D 3G6DH 1E6OL 4BM7A 5KSAC 1XR8A 3H3PL 2DQCL 1MLBB 2F8XC 3FQWB 5GGUB 3HE7D 2WWKO 4L3EB 3IXAB 2ID5A 2OR9L 3EGSA 3KLAA 1OTUD 4R0LC 5EORL 2X89D 1KC5H 3D69B 3D25A 2EH7L 1QSZA 2GY5A 2E3VA 2FX7L 1R3IH 4HGWB 4UDTB 3O81A 1U6AH 4NN5C 5HYSB 1TDQA 1OTSD 2Q87A 4YHLL 3TFKC 1FNEB 1ONQB 2IAMC 3ARVA 3WFCH 2YXFA 2NXZB 4LDEB 2GW5A 5K9KB 4PG2C 1UACH 2QR0A 2E7LA 1YMMA 3BO8A 4HFUH 4PG9A 4ZUTA 1S7VA 3BPLC 3STBA 2OTUB 3ARFC 1JN6B 4MHHI 1OSPL 4FABH 1SMAA 2Z4QA 1G7JB 4R0LB 2X10A 3I3EA 2VZ3A 5I1DA 1B0WA 3QEHA 4U1LB 3OG6B 5EO9A