3ZHLA

The crystal structure of single domain antibody 8-14 scaffold
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEWVSLISGSGGSTWYDDSVKGRFTISRDNSKNLLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Human Heavy Chain Variable Domain (Vh) Using in Vivo Protein Fitness Filter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MG8-14 SCAFFOLD ANTIBODY
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zhlA00
2BNRD 4MYWB 4NBXB 3CU1A 1FG2A 43CAB 3SPVA 3FJTA 2EH7L 3H3PL 3HNSL 1NKRA 2C3VA 3NA4A 3WEXA 2HJLB 2HN7A 3QEUA 1M71A 4LPTA 3DYMA 4KZDL 3RFZC 5CEXA 3S9DB 3KS0J 3BKYL 1NMCC 3MBEA 5IVXF 3VD4A 2W0KA 1T5WA 4NQSA 1T1XB 2WBJD 2VDLL 4RMQA 4YE4L 2YPLE 4HUWB 1CXEA 5D7KE 2PO6D 2VN4A 3D0VA 3QFJB 4UOW0 1EMTL 2V2WA 1KTDA 4J3OC 4C54A 3KYOA 2FO4B 4ONFL 4ORGA 4BK4A 4HSQA 4OZGF 1CD1B 3KDMA 1YQVH 1ZANH 3IU4H 4GMSL 1B0GA 4MLIA 1DSFL 3V6FA 3I3EA 1VFMA 3PUCA 4I4WB 4WEBL 1QSFD 1MJJB 4NKIH 2DTSA 1KBGL 4RNRA 2Y7QB 3T09A 2NW2B 4OFVA 1KJ2L 3IDMA 3R0NA 5HHQB 3LKOA 4QNPF 2ADJA 4K94L 3O11A 2HJLA 4KWUA 1MRCL 1XGPB 1JZ6A 3DV6B 3QDHA 1AKJD 5HYJB 4UOJA 2W9DH 5C09A 3O6KH 4WW2B 3Q5OA 5F6IB 4MA8H 4L4TD 3V5KB 4JQXA 4HKZB 3RWIB 4FQLL 3FQWA 3MGTA 4OGXL 1CG9A 3SQOH 4YJZL 5DD6B 4GBXD 4CW1A 1BAFL 1FN4A 4DCQB 4X6DE 5D2LB 1TQCC 3STLB 4QWWC 3GIZH 2WBJC 2XRAH 1R3KB 3C5ZA 1G9MC 4QXTA 3ULUE 4P4KC 1P9MC 1MWAL 2L7UA 4GFTB 5EPMA 1QUNA 2EC9U 3VWJA 4HBQA 5F3BA 3EYFA 1GGUA 3JBG7 4PGCB 4JG1L 4MJ6B 3RUGF 1K4CB 4U6XA 3GJFA 2BVPB 4QLRA 1EV2E 4Q58C 2CK2A 1EUUA 5EU4B 1YYMH 1E4KA 3SKOA 5LAXA 4BSWA 5KW9L 1FL3B 3QDAA 5EU7E 2XQYG 3IDJB 4PJDE 4KKCC 5TPWH 4NHUA 3QB7C 4TTDD 3QEHB 4LSSL 4NRYA 2Y5TA 5E5MB 3ULUL 5ERWB 4MGXA 3DBXA 4UTBL 2SEBA 4I0PB 2CPCA 3B5GA 4X6CE 1OD7A 2VITB 3VI3F 4Z95L 2G75B 2NY3B 4RBPK 2E8YA 1T1YA 5DF0A 5FGBA 2IMMA 4OCWL 4GW4A 3MRPB 4YR6B 3BEWB 3X3FL 1CLYH 1R5VB 1DQJB 2B39A 1QSEB 5FM8A 2WUBH 1N59A 1U8QA 3U7AA 3RI5K 3BN9D 4Y4HD 3LSOB 7FABH 2P5WB 3BRGC 3QDGD 1RU9H 2DQEL 3CUPB 1VADA 5EZIL 2I26N 4Z0XA 3VFUB 1B0WA 1HYSC 2OLDA 3U0WL 5M7QA 1B9ZA 2VR9A 5I9QC 1RPQA 2HWZL 4OCXL 4JM2F 2C9AA 2X70B 2Z4QB 2A73A 4HJ0C 2Q6WB 3RNKB 2EDRA 2FRGP 5H35A 1CICC 2X40A 5D72L 2K7QA 3Q3GA 5I8EB 2BCKA 1X5FA 3MFGB 4JHAH 2DQUL 1TJIH 1E4WL 1DTUA 3P4NA 1DBKL 5D72H 4C56A 3MMEB 4OLXH 3GSWA 5EBGA 5LGJA 4GBXA 4JQVC 1HE7A 1EUTA 1RZKH 2V9QA 3QI9C 4LVNC 5HDOA 4S1QL 3ZTJG 3QPQC 1VGEL 4NC0B 5GS1A 4K71C 2WIIB 5HGHB 1XEDA 2ICES 5EZIH 1T89A 2HT3D 3QXWA 5L2JB 4ETQA 1UZ8B 3A6CL 3IGAB 4N68A 5B4MD 4IRJB 4K2UL 4O5LH 5E24E 4KGLA 4Y5XC 2X9WA 5F89B 4WO4D 1CDBA 4NRXB 3KLHC 4U2ZA 3CVHB 3MZGB 2O5XH 3MV11 5T3XD 2F8XC 4AQ1B 4X5WA 3O2WL 4KPHH 1WC7A 3ZZ1A 1NGQH 4MB4A 2BOBA 3W5MA 2ICWA 4MCYA 3O9WA 3IRZA 3FOLB 4ZTPL 4HJJL 1MCWM 5DYOB 4YXHL 2VXTH 3QUZA 4MA7L 4XNXL 4HX1B 4OQ1A 3CH1A 4RAVB 4RFEB 4MNHB 1VGKB 5SWSD 4ODUA 3VFOA 1ZT7A 2WUCL 2DBLL 4XX1E 2VWEC 2Z91A 1I75A 3CFDA 1NGZA 2P42B 5DRZB 4OIAA 3FAXA 4UV7H 2HTKD 3DXAD 3EGSA 2XA8L 2H1PH 5CP7B 3KS0H 2ZUQC 1FZKA 4Z18A 5EG6C 4HXBL 2YXFA 3QUYD 2OP4L 2BSSB 5IESH 4TNWK 4NQXB 3J7HA 4NO3B 4YGVA 4N0FB 2X89D 2V5TA 1BEYL 1CFSB 3RPIB 2WINA 3QUZD 4NZJA 5DVLA 1TCMA 1KEGL 4JJ5A 3T08A 5T33H 2OXGA 3WXVH 3DO7B 1KEML 4JFZH 1FVDA 4OFIA 4QHLB 4FQJL 5T1MA 3FB6A 1G9MH 3KPLA 4BZ1H 3ULVH 4Q2ZB 1WZMA 3WJJA 2DWDB 5JW3H 4GQPH 3ZYOA 4GRMB 4A6YB 1MF2H 1RIHH 5T3XH 1A0QH 4Q0XH 4U6HB 1YEEH 5GIRB 3FRPG 5J7CC 1ZSDA 5GZOC 3WBDA 3UPRA 1IC4H 1DQTA 5LQBH 1QLFB 5F71A 1KJ2H 2F54E 2CK0H 2V6HA 3G08B 1SBSH 1XR9A 1KBGH 1WLHA 4O58H 4NUGH 4U1MB 5I71C 3RX5A 2X1OA 2DAVA 1CF8H 4XPBH 4N5UA 4KQ3H 3LEVH 1AGEA 3D3VA 3K3QA 5I1JH 4G8IA 1IQDB 4PJBE 2DQFB 4PJAE 5JLZB 3PF2A 1HYRC 3ZKQD 1YEHH 1D3CA 4J2XA 5D1XC 4RGNB 1T7WA 1AD0B 2I9LB 1CDGA 3SKJL 5IMKB 3CFJA 3MBEC 4FZEL 3MNWB 4WI7A 1D9KA 3IDUA 2XWBB 3EHBC 1A5FL 4CADA 4FABH 3V5HA 2V7NB 4JR9H 4LQFL 3U9PL 2CDFA 4CVXA 3OR6A 2G9HB 2E7LC 2PO6B 3B2UC 4HIIA 4UBDD 3ECBB 2YEZB 1MHCB 1CXLA 4JCMA 4NRZB 4LSUL 4YBQC 3CXHJ 1Q9OB 3V95A 2IH1B 5BVPH 2FATH 3EAKA 5HVGB 3BDYH 3NGBC 5DJDA 1KULA 1KENH 3L3HB 1KOAA 4U1MA 3JWOL 5CJOH 4GAYB 1I85A 4MQTB 4F9LC 4D9RE 1FVCA 5ENWA 1A3LH 2VN7A 4XWGL 4M6MH 3FQXA 4G6MH 4PRHA 4P2OA 3RNQB 4DGYL 4JFHD 3SKMB 3BH9B 4GW1A 4YHYB 5HYQA 2XQYK 4GG6F 4U0RB 4X7TB 1S8DA 3MRIA 5I15H 3O4LB 3BD5A 4KTEL 5MEOA 3GEWB 3GMMA 4NO0A 5E99H 2ATPA 1CD0A 2VE6A 3JV6B 4EBQH 2LFGA 1J0YA 3N1PC 5ESAA 1U95A 1UXSB 1JTTA 3SCMD 4JPIA 3RVVC 4X6CA 3ZKXB 5F7HA 1BFOB 1JGVL 2OR9L 1FRGL 3U2SA 3HTLX 2ZCLH 2R56H 1HH6B 4HWZA 1IT9H 1A02N 1KJ3L 1S7QB 3RVUD 5B3JF 1IQWL 1YMMD 1BFVH 1XF4B 4ONHB 3CZJA 1BQLH 5BRZA 3TVMB 4KKCD 1EEZA 4WCYL 2BRQA 1QOKA 3HRZB 4AZ8A 5BV7C 5CEZD 5GGSA 3HE6A 4IRSD 3MV9B 1DBAH 1RK0B 1B88A 1Q94B 4MCYB 2YHGA 4ZFGL 3AB0B 5HHME 3X11B 4JKPH 3RWEA 3IDGB 5FCUH 3QIWC 3IU3A 2Q8BL 1KCSL 4JDTH 4JAMA 4ELME 4WI9A 4C4KT 4WWID 1X3DA 1KPUA 5FHAL 3MLWH 5GRXG 3V4UL 4OZIF 2ED7A 2PTTA 3OKLB 1BVKA 5F1NA 4IRJA 1OVZA 5ACZA 3HNVL 4KMTL 5C7XL 4WU7B 4P23C 5TQ0H 4I1NB 3RX7A 2QR0B 2YMXH 3KHQA 3DVIA 3NTCH 2FBOJ 2H32B 4PJDB 1B4JL 4M61B 2WNGA 4OI8A 3JSSA 4NP4L 2P46B 5LCVH 3GI9L 2YXMA 3EHBD 3WYRA 4MAYB 1RHHB 1TIUA 2BVUA 3S35X 1DQLH 3O8XB 2XT1B 4ELKB 2MCPH 3OAYK 3W39B 2J6EH 5ILTL 1MVUB 3L7FB 3TJHC 3MUGB 3P4NB 2FD6H 3T8XA 2HFEA 4NT6B 4ESKA 3NZHH 3HI5H 4HEME 1EHLH 1T1WA 1DANT 5AG8A 5E5UB 4YK4B 3WS3A 1Q72L 3HE7C 3NFNB 4Y2DB 2FJGA 4JM2C 2E9JA 3MLXH 1NBVL 3HC4L 3MRNA 3NIFF 4XCNB 1FO0H 4MQ7B 4HIEA 2VXVL 5E9DE 3QCUH 5F44A 3MV7B 1QYGH 3KVQA 3L7EA 3MFFA 1UKSA 3TBVA 1FO0A 1DQMH 4PJDA 5DJZA 1JMZA 3I3DA 2ZPKL 3LRSB 4TSCH 3TC9A 4ZOCA 2ZUXA 3MLPA 1ZVYA 3RGVB 2J12B 1T7VA 4UNUA 1LK2A 2EH8H 2PW1A 1J18A 1T1YB 4R4BB 5D70L 5DJZB 4XCCH 2DL9A 1SJHA 5MP6L 4GXVH 2QQQA 3SDDA 4IOSD 3WHXA 1MHPL 4JRYD 1BJ1J 3DBXB 5ERWA 4Q9RL 5JTWA 4G80B 4NRYB 3LKRA 1NL0L 1EEYA 4EDWL 3V7AE 4BA8A 2X1PA 4TULH 2GSIA 4LCYB 1J8HA 3SDXB 5I1EH 2BJML 2ZPKH 4QEGA 1O7SA 1CDJA 3QIUD 3LS5L 1UJ3B 4K8RH 3ZE0F 5JXAL 1ZLVK 1MCDA 4R7NA 2A6IB 3VFPA 1PG7X 4XP6L 4X5XB 1XF4A 4ONHA 1MJ7H 1ZHLA 3LN5A 5D8JL 1MQ8A 3SOBH 5CGMA 2H6PA 3H9SD 1G7QB 3EO0A 3H0TB 1IKFL 3U2SB 4HFWB 1QR4A 1FNLA 2FD6L 1IM9B 3HPLB 4RX4A 4TVPE 4JPIB 3OAYH 4N8CH 4G7YH 1MFCH 2WK2A 1WCBA 1VGEH 1KUMA 1RIUL 1RZFH 2APTA 4DGVL 5BS0A 1S5HA 4ONGH 4YBHA 5MEOB 2APWA 4HKZA 1P4LB 5FKAA 1I3RB 2EICA 5I8OL 4MA1C 2D7TL 3MLZH 1MFDL 4YHNB 1E28B 2A0LC 4PJIE 3W0WA 1K5NB 1W2KT 2Y9RT 4P5MB 1OWWA 1CWVA 3SKMA 2OCFD 4LSQH 3QWOB 2EDBA 1RUPL 2G2RB 1Z3GH 3IDMB 4ERSL 5JORA 4HMCA 1KCRH 1H3GA 1X6LA 4PJFA 1KLGA 1RMFL 3BKCL 4OZHB 1MJJA 5E8OB 3ARGB 4D9LL 3RZCA 1SMAA 7FABL 3S34L 2R0KH 1BZ9A 1R3LB 1T20B 1L7TL 3ARFD 5F7UA 5CJBA 3BGAA 2BZDA 1A7QL 2A6DB 4PTUA 1T04A 4JO1L 4JGJA 4NRZA 4ODHH 1BFOA 3TZVC 4D0CB 4WNQA 2EXYD 3VGEA 1XH3B 5ESAB 3EO9H 4HPYL 4GG8A 2VTFA 3X3GH 3IVKB 1I9JL 2V7NA 5CGYD 1GZPA 3MBEB 1C5BH 5C71A 4AT6A 5C0ND 3MLRL 4Z7NE 5CEXB 3G5VB 2EEBA 4CVUA 1Y0LA 3TO4C 1YQ2A 1FVEB 3BJLA 4ETYA 2E5EA 4KRLB 4YDJA 5C09D 5IB3A 3IFNH 5E4EB 1AD0A 3QZWG 4ZOAA 1ETZA 3ARBA 5I1HL 2VLLB 1KN4L 3SY0B 3TIDA 1AHWC 1J1PH 5E99L 1ODAA 1NGXB 3VMOA 1MCFA 5E6ZA 2VB5A 1NFDB 1W0YT 5IW6B 5HPMA 4FQXB 5EIVA 5BZDB 1I8KA 1YJDL 5GS0H 4HKJA 4M3KB 3RWDB 2YPKA 3VFRA 1IAII 3WIHA 4ZAKD 1JRHL 3G08A 1D5IL 3DUSA 4OI9A 5BS0D 4PRBA 3VXNA 5GS0D 4FQXC 4HIIB 4QRSB 1PZUB 1ZSDB 3FQTB 4OSUL 4PJGF 4ZXBA 3A6BL 1NC2B 3OAZK 4K8RC 4ZFZA 3KWWA 2NLJA 3QIBA 2L4OA 3D39A 1KENL 4LLUB 3DRQB 2JJSA 4TPRH 1BP3B 3TYFB 5E2UL 3D69A 1CGSL 1IILE 5DRNB 5IFJB 1FBIH 1J1OL 5GRZA 1FZOB 1NBYB 1SM3L 2KH2B 2CIKA 1OF2B 4GRWE 1JNLL 1T83C 5CZVL 4H26B 5CWSB 3C6SB 4M5YH 4HS6A 2WINB 4JLRB 2FX9L 2CLVA 4HGMA 4N0FA 3LQAL 2W60B 4YQXH 4I18C 4DFHA 4FQ2H 4DZ8B 1QRNB 3SKNA 1KCUL 2Z92A 3WXWH 5DHVA 1YNLL 3BYTA 4PJXE 5CP7A 4JVUA 1AGEB 4AH2A 3TBTB 1OAQH 2R23B 1HKFA 1D5ZB 3TESA 1MOEA 3CFDB 5D2NC 3CXDL 2CIIA 3VRLE 2JB5H 1FNHA 2MWCA 1F6AA 2XTJB 1FAIL 3BP4A 3IFLH 3KNBA 3P0YL 1EHXA 1IM3B 3I85A 5DYOA 4W6XB 4ZS6D 3PHQB 4XPBL 3O3AA 2VDOL 5MENE 3FFCA 4FQ2L 4P2OC 5MENA 3T04D 1IAOA 1EDQA 3GMLB 1J5OL 3RTQC 1KJMB 1PKOA 4R97C 3X17A 4H8WC 2EXWC 3O45A 1A7PL 4YO0B 4NYLB 3SDXF 5C6TH 2W59A 5J56B 5EWIL 3PJSA 1BD2B 4Q9CA 1QACA 3T2PA 1DBBH 3D9AL 3UTPE 5E56A 4QCIB 4PJHA 3V7MA 4XNZB 1YEGL 1LEIB 2XXMB 2WV3A 1U3HD 2QEJA 4J3VA 4OGYL 4R8WL 3GMPA 4G8FA 4UDTB 5ICYA 1U93B 4R4FH 1BJ8A 3LCYA 1FG9C 4PJEA 3AS3A 1D5IH 2Z91B 4P9ML 1PD6A 2GJZA 5DQDH 2V17H 1H3UA 4QY8B 4Y2DC 5IESL 2OL3B 4PJIF 5I8KH 1LVEA 4PRPB 4TSBH 5T3ZD 3KG5A 1AXTL 1KJMA 1MFAL 4OZFH 1XZ0B 2UZYB 2X70A 3AVEA 2A38A 1FLTX 3WDIA 5HDBF 2ICWB 4EIZC 3QDJB 5IFAH 3VI4F 3J8F7 2GYSA 1N3NB 4WHTB 3PHQA 5T3ZL 3HR5B 1YC8A 3B2VL 2XWJB 4MQXD 2D4FA 4Z0BH 2ICEB 3ARDD 2OL3A 3O0RL 3WFCL 4RIRA 1F6AB 3KLAA 4WUUE 3E6HA 4JFFD 3AY4A 2ILLA 1ZVSB 3H9ZA 1XGQA 1R5VA 4YEEA 1KLUB 3LH2L 3SEPA 4G9DA 3VXQA 4HV8B 3V6OE 4G8FB 4UDTA 4U7KA 2W65B 4LRNL 2G5RA 4KC3B 3P4LA 5DHVB 2WIIA 5HGHA 1T0MB 5SWQA 1QRNA 5AYUH 3ZHLA 4QXGH 3RL2B 1YNKH 4K7PL 1QYGL 5I8CB 4W68A 5FGBC 1MVFA 4HJ0D 2GJ6E 3C6SA 2BNQE 4CMMA 4PGJA 1IGMH 2BHUA 6FABH 4H26A 5F9WB 2PXYD 5I1LA 4P4RB 3WFDL 1CQKA 1PKQA 1MUJA 4WFGD 4HWBA 1A7RH 1E4JA 1MFEH 4XVJL 2XKUA 1KJ2B 4P5TD 2NY0D 3BD4A 4JFHE 2DMBA 5K9JL 1GPOL 3QIBB 1MCOH 1QEWB 4W6YB 2EDNA 2EKSB 4G8GE 5JOEA 2BVPA 3T2OA 3GJFB 2QLVB 2AV1A 1CLOH 2CXKA 3PP4L 3NFSL 3DYPA 3TT1H 4OBRA 1V3LA 3O2DL 1N59B 1DQJA 3STZB 4FFWC 3ILPA 5T3ZE 3DYOA 2R23A 4KGJA 1TMCB 1IEAB 4P5TA 5HPMB 1XAUA 1S9XB 1AE6H 1IAMA 4JN2B 4DOHB 4M6AA 5IBLD 1NGXA 3P0YH 5JHDB 4XAWL 4OD3H 4ZAKC 4LIQH 2SEBB 5AZ2L 1MY7A 4M00A 1MCCA 4IHOA 3V5KA 4PJ8C 4MD0A 1YJDC 1H3VA 3VDAA 2DM7A 4HS6B 5TFSH 4WI5A 4KKLD 1U8IB 4HZAA 5CWSA 1TETL 5ALBH 3R06B 3QI9D 3QXAB 1FL3A 1UM5L 2C1OA 2DBJA 3G5VA 2VXQL 3V4VH 3TNNA 2AJYH 2NY6D 1DJSA 4RWHA 4HHAB 5DJ2A 3SO5A 3VE0B 3S37L 3CCHA 5I1EL 4TULL 4U6XB 1A6WL 1IGTA 2AEQH 5CGYC 1BIIB 4PRBB 2APVA 2QQNH 3VWJB 4P9HC 3BKMH 4Z5RA 1Z2KA 4L8SC 4WI3A 4Y19E 1GGYA 3JTTB 5DO2D 1CXHA 5EC1B 1IT9L 5C0DB 5D5ME 3VFRB 1A7OH 2OR9H 1DE4A 2A6JB 1FN4B 4PJGE 4DCQA 1U8LA 1ZE3C 3UBXB 2XQBL 4PJFB 2DYPB 3BDBA 3F12A 1CICA 2YOCA 2A0LD 1I4FA 3FT2B 5HGAB 4N8VB 5JO5A 1M05B 3ZDXF 2EDDA 4P5MA 2IWGA 1CDYA 5C09B 1QQDA 4P2YA 3ZHKA 2Y1VA 2AJSH 2VMFA 1CIDA 4HS3A 2ZCHL 3SQOL 5KZCB 5DC4B 2VAAB 3V8CA 3C9NB 5D1ZC 2MCG1 3QJFB 3SBWA 1CXIA 2Y7QA 3H9HB 3F12B 3GNMH 5C3TA 4P23A 2C3XA 2CQVA 3U0TB 5JXED 4PS4H 5F88A 4DUWA 3Q6FB 1E6JL 4D3CH 1NCAH 3PXHA 5BW7A 2CGRL 2HLAB 1CBVL 2D0HA 4U7SA 5I71B 3JTSA 3QEGH 3D0LA 1BFTA 3N0PB 3P9LA 2JELH 1FFRA 1MI5A 3L3IA 3QRGH 3MA7A 5DC0A 5HHNB 4M7JL 4HUWA 1YYLL 4FTVB 4R7NB 4XXCC 1DSFH 2AXGA 1KLGB 5CJQL 5D7LA 4G3YH 4M48H 4WWKC 1K4DA 4LHUA 4JO1H 3I6KB 3NZ8B 4PREA 3VG9C 2R1WA 5C0BA 2V9TA 1F90H 4YPGA 3SPVB 2R4RL 3JV0A 3V4UH 1Z5LB 4X4XA 4XMPH 1IKNA 2VC2H 1E28A 4XI5D 4G80A 4APQA 4GAGL 4K3JL 2GUOA 2YRZA 1E4XI 2DLFL 1MRFH 5AZEH 2IBZY 1FDLH 4IDJH 1S5HB 4AEIH 3GRWH 3PDOB 1RSFA 1XF2B 1CFQB 4TUJB 2PW1B 3K4AA 1EHNA 1UYWH 2J2ZA 4I3SL 1VEPA 2V2XA 4UQ2B 5GZOD 2J4WL 3GKWH 4HIEB 1JCKA 3NCEB 2NW3A 4XCNA 5ECJE 5L7XL 5JOFA 5HGDA 5CSGA 1RZFL 4DGVH 3VFTB 1QEWA 1YEFH 3SGJC 3MO1B 2X9XA 3WFEL 1HWGB 3RX8A 1AO7B 2IPTH 5I74C 1MI5E 1S7XA 3GSNL 1GAFL 2YD6A 1T21A 3L7FA 4PR5B 5I15L 1N6UA 3L5XH 1FLRH 4F7EB 4BZ2L 4LEOB 4Z7UF 2D31B 4NHCL 1JHTB 3GUTB 3KPSB 2Y6SC 2Y07H 2W65A 3U9UA 1LGVA 4M6ML 1RK1B 2R0ZH 4U31A 3RDTC 3N06B 1LEGB 4OZIE 4PRIB 4M6OL 1A7NL 3RGVA 4NQEB 3JWOH 5I75B 5I6XC 2DF3A 3I75A 4LAJH 4TOYL 5DJYA 5CKAA 1QRNE 3ZKSD 1KFAH 1JV5A 5EO1B 1LK3L 1ROWA 1H0DA 2IJ0C 4NQEE 3HR5A 3NFNA 4OQTH 2EE9A 4FFVC 3VFGL 5IMMB 5E9DD 3QDJD 1KYOK 5JMRA 1ONQB 2D7QA 5C8JB 1QSEE 3W11D 1J0HA 1FYTA 4NT6A 2FJFB 4EQ2A 1WWBX 1U8OB 4QGTA 2YD9A 3SHSA 4OZGB 3LAFA 3HRZA 3ZHDA 2IBGA 3L5XL 4FQHA 5KSUB 5C92A 2H32H 2YKLL 5MHSD 1IEHA 2NY2D 1D9KD 1W72H 1DLHB 1PSKH 5SWZA 3HMXH 4WJ5A 4WFHE 4PJ5A 3F58H 4CVZA 5D7IB 4OLVL 1C5CH 3ZT6A 1NEZA 5KVEH 3MRLB 4KI5C 4NM8L 3BW9B 5JHDE 1JZ5A 4IJ3B 5F6HI 3B8YA 5IHZB 2VE6B 2NY4B 4YO0A 2Z8SA 1MY5A 1CU4H 3EDDA 4APQD 4U1LA 2P8LA 4F15C 1IAKA 2O5YH 2BSTA 4LRNH 4AIXA 3TT1L 3PP4H 3MLTB 2IG2L 4JM4L 5AWNL 2D2OA 1P7QA 1XF1A 5T5NF 3W0WE 4K7FA 2B20A 5DMGC 2IAMA 2LVEA 4LHUD 2FH6A 5EUOB 3BZDA 1K9TA 2M26A 2Z93B 3LQAC 4Y5VC 4PGDB 4XVJH 3ABZA 4FG6C 5IB5A 2ZUYA 5T3ZH 2W92A 4IOIB 5T33L 5IFAL 3VXRB 4DEPC 4KJQD 3MOAL 5DA4A 3HFMH 4AQOA 4YXLH 4K7PH 5IB4A 5DZLA 1A6AA 1LO5B 3LQMA 2NY4C 4RRPA 2B5IC 1JWSA 5EH1A 3VWKC 4OLWL 1YEIH 1QA9B 3UZEA 4KHTH 5E2TH 1J1XL 3JV6A 5CCKH 5FV1L 4N0RA 1CFNB 5IVXE 2I07A 2OTUB 5K59E 3ZLQC 1QZ1A 4PV8B 5TPWL 1MCPH 3EFFB 2CDGB 1AO7D 3IDIB 3W5NA 2WLYA 5EORH 2EIDA 3WIHL 2NLJB 4O2EB 1XGYL 1X5JA 3SDDC 5C08B 3DUUA 5T1DL 5C6TL 1YY9C 3RTQD 1KTKE 4WFHD 4JO2L 1IQDA 1T03L 5FB8B 5B38A 5J6GA 4UINL 4H20L 2NPLX 1NC4B 4K2UH 4O5LL 4XRCA 5B39A 5C0JB 1A6VH 5A3ID 1JZ7A 5FB8A 1NCWL 3LV3A 4UT9H 4EUPB 4G6ML 4R4FL 1QSED 3LZFL 4JRXD 1F4WH 1MCEA 5I75C 1FGVH 5I6XB 1Z9LA 4HKBB 4KKNA 5FCSH 3O3EB 5GGUA 5FM4A 1JVKA 2Q86A 5SX4I 1SY6H 3TFKC 4R7DA 4MNGA 2VH5H 2DWDA 1EJOH 4KK9C 1QHPA 2ARJB 4OF5A 2DN7A 2VKWA 4XP4H 3CFBB 3FB6B 3HHRB 3SDAC 3P9MA 4UB0H 4GKZA 4MNQD 1A6WH 4HS8L 2OTWA 5HD8C 1HK6A 2I9LA 4NM4L 4GKSB 4Z7NF 2LV4A 4K55A 1HHHB 3NCYP 5D1QA 4NM4H 3B43A 1KNOB 5FYJH 1A6AB 1LO5A 2X4NB 2DQFA 4M43H 1SM3H 4Z77B 4MHHG 5CHNA 3VXUA 2WMPA 2H45A 1N4XH 5ID0B 5ADPH 1EJOL 4P0DA 4KK8C 4RFNC 2IPUK 4FZ8H 1NGZB 2VWEE 1EMTH 1KCKA 1QSVA 4ODUB 3VFOB 4J6RL 4ZUWA 4HX1A 2A9NH 1CICD 3PWPA 5I18L 3KJ4C 4IMLB 1E4KC 1N0XL 3MV8B 3MV01 3G5YB 5FYKH 2UUDK 1UH2A 1YN7A 2BVOA 4HC1H 2NX5A 4KROD 3RJDA 1EERB 4X5WB 2YD2A 5K9OA 4OZHF 1AY1L 1MWAB 3FRUB 5FK9A 2PTVA 2UYLB 1I8LC 5BS0B 1FFNA 1AQDA 1DN2A 2NNAA 5EUKA 3S6CA 2BDNH 4P5KA 2XY1A 5I2IB 5EOQL 1P7HL 4XP9L 3C8KA 3SGEH 3QAZB 1AQDB 4L9DA 1YPZA 1FFNB 1D9KC 1MFEL 3TA3D 2D7OA 3OJDA 4O4YH 2F54D 2AEPH 2GTZB 1MWAA 1DLHA 5SWZB 4L4VE 5IV2A 1VFBB 3QHFH 4FFZH 4PP2A 4HT1H 3CH1B 4RFEA 1NMAH 3QUZB 4XVUC 5D7JB 3G5ZA 1WISA 5I16B 1YZZA 5C9JA 2ZSWA 2HKFL 3MJ6A 2H1PL 4MAYD 2V2TB 1WBXB 3GZKA 5IMMA 4WUUB 5DFTA 4GMTH 3VGAB 3WNLA 1A6UL 3S35L 1ZGLP 1TITA 2W0FA 3LKRB 1AIFA 1I85C 4UAOB 4ZO9A 4RMVA 1U3ZA 1WV7T 2ED8A 3UZQA 4YXHH 5E94B 5F89A 5ICXA 4HUVA 1U8QB 1MCPL 3L3KB 2ZSVA 5FUZH 3FQNA 2EYRB 3DX6B 4LVHB 4GO6B 3OKOB 5J12C 1ORSB 5JHLH 4FFVD 1KYOJ 3IGAA 4ELMA 2VDNH 2IG2H 4HLZH 3BQUC 4UZGA 3V6OA 2PYFA 4IDLA 2MQ3A 1EEUA 2HVJB 1FO0B 3SJVA 1WCQA 4IOFC 5HD8D 5D71L 2ZOKA 1GZQB 3WCYA 2FJGB 4PRPE 4NQTA 1LO3H 1YPZE 4R7DB 5AG9A 3MA9L 5J3HC 3FCTA 4QRQB 1OARL 1F45A 4PG2A 3S36H 5IQ7L 4PJEF 1T22A 4D9LH 5LAXB 3U79A 2A73B 2Q6WA 4BKLA 1QBLL 1X5YA 2YUVA 5EU4A 4NWTL 3AU1B 3W39A 4XNQB 3LB6D 5JW4M 3HI6H 4WWKA 1I3GH 2R0LH 5F3BB 1FZMA 3C5JB 2B0SL 3G6AA 1CU4L 1XCTA 4PRDA 4ZS6C 1JGLH 4CAGA 1CDCA 2ZZUT 1A6ZB 3EYOA 2QR0A 5C0AA 4PJAF 3MRPA 5K9KA 1DBMH 1DCLA 4JPWH 4TUJA 4U1IB 3ZYIA 1N6QL 1KPVB 4KTYA 2GW5A 3PGFL 3Q2CA 5HHVL 4XB8A 4Y5XA 4HWNA 1U8HB 1PLGL 1PX3A 1A7NH 5FXCH 2QTEA 5IHUH 2P8PB 3NPSC 5L9DL 2GJJA 5FA3B 5D1ZA 5KVDL 4UIKH 3O11B 1QFWL 1UM4H 2ICWI 4LHUB 2VDPL 2NYYD 4XAKD 2ID5A 1KCUH 5T5FH 2JIXA 3UPAA 3QIBD 4Y16D 2QQLL 5HHMD 5BMFL 5H37H 1CVRA 3MA7B 5HHNA 1TVBA 3CX5K 3AS2A 1JBJA 4X8JB 2BY1A 1K4CA 5F3HA 2DJ4A 3SDXE 3VMPA 1YEJH 4WO4C 3O6LL 5IB5B 5HI4D 5DURB 3ULVE 4E41E 4KY1H 2IPTL 2CRZA 4LIQL 5DRWA 2JE8A 1R3KA 4LVOC 4NDMA 1AR1C 4JPWL 5DJ0A 5F88B 4OGAD 4LF3B 3UTQA 1T5WB 3DJ9A 3H9HA 4AM0B 5I19H 2O61B 3GMMB 5J4MA 1D6EB 3RWIA 1YNTB 2IAMD 4HJGA 3MOBL 1ZHBA 3O4LA 3IJSA 2ESVB 3MRIB 4MA3A 5IFHH 5D7JD 1I3GL 1CS6A 2AW2A 1CZ8L 1RUKL 2EIBA 3PGDA 4XXDA 4KVNL 5CEYB 3DMMC 2J8UF 4L8BB 3PQYD 4Z8FH 4H25B 3RNQA 4M1CC 4HIXL 3T2NH 3NIGE 4PRHB 4FG6D 3MRLA 4JPVL 1ZHKA 4N8VA 5HHQA 5E2VH 1BVLB 1CVSC 1YY8B 5KG9B 1ZGLM 3I84A 4CRPA 3NABH 1QSFA 1BF8A 1BZQK 3UEZA 1OTUD 5ID1A 4Y5VA 1U8LB 4PJCE 5JPMB 4UDUB 3WFEH 1QBBA 4LSVH 5DFWH 2D03H 3PGCB 4P2QD 1RJYA 3NA9L 4NKOA 2IANA 4P3DB 3IJHB 1DN0B 1UKTA 2PN5A 1N7MH 2ERJC 1IGYA 1KT2B 3OX8A 3NAAH 4UQ3B 4X4YB 2PO6A 5E2TL 5HYEA 2R0WH 3EO9L 2EDLA 4HPYH 4XBPA 5E8EB 1ZLSH 3GMQB 2X42A 4I18A 1T1XA 4NQSB 2Z31D 1WWWX 1F6FB 3V6OC 1V05A 3KPQB 1YN6A 1J88A 2OL3L 4J8RA 2HN7B 3T3MF 4ZFOL 3O3BA 5BO1H 1XF3B 4EN3B 3PP3K 1MRFL 3W2DL 4G6JL 3EBAA 3OAUH 3HLAB 4M03A 4NQDD 3EW3B 2P7TA 4LLQB 3NVQA 3QYCA 4FN0A 4M5ZL 1D6VL 3JXAA 1CDHA 3LDBC 1F90L 3DX9A 4MAUL 3B5HA 4G8IB 4I8DA 3NCFB 1TENA 1TDQA 1W0WB 4LSQL 5CINH 3MLUH 4P46C 3T3PF 4EUPH 1NMAL 3QNZA 1P7KB 3VFMA 4DWHA 1BMGA 1YYLH 4F7EA 3GGWB 3EDEA 5DMIL 5CEZH 2ED9A 4QOKE 4QXUH 2NYYC 4QOKA 2F5AH 1QSZA 2N7BA 1CBVH 4GUPB 1RUML 3VXSD 2NX5E 3HE7A 3B3IA 1YMHB 4NPYA 1FNGA 3MO1A 4ACPA 3P0VL 5F1IA 5J1SC 3OV6A 4GUPA 4UBDC 4EBQL 2VLRA 1A3QA 5HGDB 4NWUH 2CLRB 3E3QC 1IL1A 1INEL 3QUMB 4JJ5B 1IGJB 3RZCD 2HT4D 2A9ML 2Q3ZA 4F7TB 1I7RA 1LE9A 2K1MA 3WNPA 1XGTB 4N0YH 3EYSL 1P7KA 4NQXA 1RUKH 2NXYC 1HNFA 5AUMA 1U6AH 1UM4L 3PDOA 2XNAB 5KVDH 2B2XL 2DMKA 1XMWA 3BOVA 1QPXA 2Y25A 2NXZC 4GQ9L 3X12B 4M1DL 2VOTA 1CXKA 4J6RH 1KN2L 4PJ7A 3UAJD 1XGQB 4B7LA 4OCYL 1H3XA 1MHPH 4G8EA 2J7LA 4TNWF 3UYPA 3VXUE 3I6KA 4J8RB 1ED3A 4IRSB 3TCLB 1F4XL 4G9FA 1NCNA 3UPCA 2VISA 4O02L 4UUJA 1I8MB 4X99A 2C26A 3HI1B 4O58L 4P9HH 4S0TD 3HUJF 3TNMA 3ET9F 4WV1B 4CNIA 3CVHA 2VXSL 3N85H 3C09C 3C08H 2J5LB 4PRPD 4Z7UA 4KDWA 3UTSE 2E9WA 4GAJH 1CK0L 3MNVB 5IF0A 2HLAA 2YS4A 4GJTB 2VUOA 4P3CL 4X0KA 4F37K 43C9A 1GGBL 1GYAA 3UO1H 2OK0H 3SJVE 4JFDD 3BPNB 4KXZH 4JFZL 1U3YA 3S3JA 3WIFA 5GS1B 4LCCC 2X9YA 4F2MB 4YFLI 3BJ91 3IXAB 1OB1B 1NFIB 2C3WA 5I76A 1WTLA 4PLOB 4DKAA 2HFTA 4KMQA 4Y8AA 3JV4A 2N1KA 4QRRD 3Q0HA 5JIHA 2C4FT 5LCVL 1X5KA 3GJFH 3RDTB 5HYFA 5DJCB 1IAIM 4LRIA 4NN6B 2R0LL 3RGVD 4Z7WE 4B53A 5AD0B 5EB9A 1GH7A 2HFFB 1C8PA 3BUYB 2I60H 4ZFFA 3DETD 1J1PL 3MJ8B 3U30B 3FFCB 4LF3A 3UTQB 4Q6IC 2DBLH 3VFUA 3ZT5A 3OG4B 3KNBB 5KJRH 3BRFA 5AZEL 1NBQA 1S9WB 4MVBC 2N4IA 1P7QD 1JFQH 5E7BA 2CRIA 3ULSA 3WFDH 4KDVA 1J8HE 2OJEA 1JUFB 2VLJB 5DHYB 2WBWB 4X8JA 3TVMD 1SMOA 1YDPB 3BEWA 5IWLA 3O2WH 3GMNB 2YA1A 3OB0H 4N0UE 3WE6B 3PE9A 3GSNA 4Y16B 3LKNB 5CJXC 4G3YL 4HIHA 3N1GC 1F3JA 4ODHL 5DUBA 3MV9D 5C0CA 1I7ZA 4L1DA 3UYRL 3DARA 3T0DA 1MIEL 4WCYH 3OWEA 1PVHA 1A1MA 3V52H 2MFNA 3B9KA 3R06A 3SDYH 2VNCA 2JELL 2P44B 1U8IA 3GBNH 2XKNB 3MBXL 1JFQL 2CR3A 2R56L 4NQCE 3O3DA 1FRGH 1FC1A 4L8SA 3SGDH 5DJAB 5HHOD 5JHDA 3QUXD 9CGTA 3LHPH 1KPVA 4D3CL 1AGDB 3LY6A 4OZFG 2VLRD 2A74A 3BZFA 5I1DB 3UJTL 1VFAB 1NFKA 4KDTC 5AWNH 3WN5C 1MEXL 3STZA 4PJAB 3PABA 3PWPE 3BWAB 3TLRA 3DSFH 4WWKB 5ANME 5DLML 4BSVA 4E41A 4NJ9H 1K85A 4NZUL 4P9MH 3TN0B 5KVGL 5I73B 3U7YH 3CFIC 4J3UA 4QRRE 4HG4K 4P57A 3I9GL 4M1GH 2DM2A 3ES6A 4O4YL 4YDLC 3WO4C 2VIRB 2GTWB 2Y4SA 3ZKMD 3FCTB 4QRQA 4EDXA 3UTSD 3V6ZB 3GI8H 4P4RA 3RVWD 2F5BL 5FAAA 4X9HA 5I1LB 4X6FA 3O6FD 5EOQH 5LBSL 1PSKL 4YDJB 4CN4A 5FDYA 4RQQA 1A1MB 1GZQA 2XFXA 5J11C 5I8CA 4NQCB 1U8KB 5TE6L 4P2RE 4NZDA 3GSNB 4Y16A 1ZKAA 4JFDE 5LGKA 4JFDA 4JFOA 3LQAH 4C59B 2FX9H 4Y88A 5T5NG 3U46B 4D0CA 3FQNB 1E0OB 1F4YH 1OL0A 1GSMA 2O5ZL 5D6CA 3KLAB 1UEYA 1RU9L 4PLJD 4LSDA 3TYGL 2E7BA 3MLVL 2EC8A 3MV8E 5DGQA 1GC1H 2XWJA 3VU2A 2IAMC 5MERA 3C60A 1I9IH 4NO5B 3QXDB 2FNBA 3CDCA 3PWNB 3G6DH 5L0QC 2MJWA 1G9NC 1G7PA 3KHOA 3I9GH 3PWVA 3QHZL 3ARGC 1YNLH 5DJCA 3WEXB 3RDTA 3G5ZB 2VXVH 1BOGA 3QR2A 5HDQH 3O9WC 2X4RB 4ZUSA 1BF2A 1UVQB 5CUSL 1I1AB 4S1DD 1TVHB 2F15A 3QNXA 4O2FB 4RFOL 3VFNA 1JGEB 2E7HA 3WUWG 3BIAX 3WIFB 2NY4D 3ETBF 4J3XA 1IC4L 4I0CC 1C1EH 1D5BA 1FBIL 3VRLF 5IMOA 3WJJC 3S7GA 1V7NL 4P4KD 3MCG1 2FJHA 43C9B 1GPOH 4G6FD 3IFNL 3A67L 3BPOC 1I1FA 2DI8A 3PJSB 4KVCL 3ULVL 3MRRA 5J89A 3OKEA 4MSWA 1C5BL 3WLWC 4G5ZL 3K2MC 1P6AB 4X5XA 3X3GL 2H3NB 3V52L 5JUEL 5F1IB 3NTCL 1N5AB 2E7LA 2FZ3B 2B1HL 4KDTA 1I8MA 2OP4H 3HE7B 4NUJB 4HXBH 1H8NA 2NX5B 3BIKB 4G9FB 2OMBA 1ZA6B 3S4SB 4FQLH 1A9EB 1LMKA 1WWAX 3ARGD 5IEKB 1TVDA 1Y18A 1YMME 4KK6C 3HE6D 1HHIA 3WIHH 3LKPA 2X4QA 3O6KL 4N9GA 4PRIE 4M93B 1J8KA 4X7EC 4ZFGH 3P30L 2A77H 3QUYC 1PDKA 4OCMC 1VFUA 4ZO7A 4KZDH 5EIIA 2OL3H 2P24A 3FO9A 2IQ9H 4R4BA 1EZVX 4ZNEA 4YHYC 2ZJSH 4LDLB 5DDHB 4IRZL 5HVFB 2I60L 2CLVB 4C83A 1QFPA 1S7TA 2X4OB 3MCLH 2R69H 1QNZH 1RJZA 4FQPA 3MV7A 3MTRA 3QUXB 3QH3B 4R2GD 3FT3B 3LEYH 2PF6A 3G04A 1G7MB 2QADD 2HG5A 3KYAA 3RZWA 2UVEA 1YN6B 3P4MA 5DO2C 2F5BH 3KPOB 1FNSL 4FXKB 3QQ4A 3QXVA 1O5DT 4LLUA 3NGBB 1L7TH 3ESUF 3K0WA 2R0KL 2Z31A 5E8DH 4D9QD 1WUNT 4XBPB 4TVPL 1VCAA 1KIQB 3UROR 5F96H 1FYTE 3TIEB 3REWB 5C07B 5D8JH 3GHBH 1OOAA 1F2QA 1DBBL 3QG6B 4DN3H 3LMJL 3CC5B 4LRIC 3RBGA 4Z78B 1H8SA 3TBYA 3WNMA 1MQKH 3H8NA 4EOWH 5IKCA 1M6OB 1BD2D 2FEDD 2VL4A 2XICA 4GAJL 5A1AA 4UDUA 2XTJE 1ZMYA 5GQBA 3OPZL 3QPXH 5J6GB 2JJVA 3P0GB 5IW6A 3P4OA 5BJTB 3NFPB 1QSFB 3CVHL 1A3LL 5DQ9A 4JY6A 2VLLA 3I50H 3MGAA 4L8BA 4XAKE 1T66D 1A14L 4FNLL 4XP5L 2FATL 2F53B 2NY6C 2CDGA 5T1KD 4I3RL 1NUDA 5GRUH 4G6KH 5D70H 5JNYB 2LAGB 4IIQA 5IVXA 4UU9A 3BPOB 5TF1L 3K1DA 4X7CC 3V8OA 1OAQL 4JKKA 5DJ0B 5DD0H 1MSPA 1XH3A 1EBAA 4Z95H 2FR4B 2DIBA 4LNRA 4AIOA 3IJHA 2OI9B 4YQXL 4HK0B 3VXRD 5D9SA 3GSRB 1EEZB 2AJUL 5F3HB 3PNWA 5GSRA 5IHUL 2HRPH 5BRZB 2FLBT 3N1FC 4G7VH 1BZ7B 5JPNB 4NWUL 1S9YB 4HK0A 3IRPX 1J1OH 4DK3A 1QFHA 3HAEG 1NDMA 5E2UH 2EZ0D 1YY8A 1BVLA 5JORB 1T89C 4PGEB 5CLTA 4XCCL 5MP6H 4E42A 4XCEB 5FA3A 2VDQH 1MNUL 1ZWIB 3GSXB 5T1LB 4LARL 3QI9A 4IIQB 3NH7H 5EN2B 4NIKB 4QXUL 4FTVD 1SBSL 3ESVF 4MA3B 4QTHA 4QRTB 2B7DT 5GS2D 4YHKH 4ALAH 3FONA 1P4LA 2OTPA 3AXLB 4G9FD 1C08A 2F53A 3BT2H 1CDUA 3S97C 5KSBA 1UB6A 5T3XL 3HNVH 1IMHC 5DQ9B 3ZDYF 4LMQI 3HPLA 2IALA 5BQ7B 5HI5C 3FHAA 2CJUH 5CIPH 1WAAE 4I2XB 1AI1L 2QADC 4GAYA 4TVPH 4QHMA 4Z7VE 2GCYB 5GGRA 5E1AA 5IKCB 4M7LL 5D9SB 5GS3A 1MRCH 3BZ4A 3AU1A 2Z8VC 3K74B 3GJFK 2P43B 4BFIA 2JIXB 3MLRH 1GC1C 2VLRE 3G6JA 3S96A 1U8OA 3WO4B 4YDLB 2G9HA 4KHXL 4DUVA 4LU5L 2E7MA 4QNPE 2X1QA 3QDMB 1HKLH 3L3OB 1G9NH 2DQTL 4WY7H 1A47A 5SX4H 5BXFB 3QULB 3QQ4B 1XCQA 3P77B 4CADB 1U8HA 1H0DB 1JL8A 3IDNB 4KJYA 1YECL 3JVGC 1I8LA 3AY4C 1JI1A 4Z7VB 4H8WL 5F93C 5DURD 3I75B 4X80H 2VLKE 4L5FH 1KN2H 2ATKA 1HWHB 3DVFA 4Z7WB 1Y6KR 1LDPL 1A6ZA 3EYOB 1HSBA 5C0AB 3OHXA 4KPHL 1NUFA 4GSDL 3LRSA 2DQJL 2ZSVB 5DJ8B 1CL7H 5GGTL 2V9RA 4TSBL 1DFBL 5E94A 4PBVC 3SDCD 3GUTA 1MCKA 2KDGA 3VJ6A 3T0EC 2PR4H 3QDGA 4HT1L 1S7WA 4JPKH 1NANI 1HHIB 5KAQG 4FFZL 4RZCA 2IBBA 3HNTL 4JHBA 4Y2DD 1I1YA 3C5ZC 4JO4L 4P2CG 3KPSE 4PY8I 4Y4KD 3TIEA 4OGYH 4Y16C 4RAUB 5C9KA 3AREC 4Y19B 3GK8L 2IFGA 4U1KB 4U3XA 3FT4A 4XVSH 4DK6A 1IKFH 4CGTA 2H3NA 5EWIH 1J87A 3RVXD 1J0IA 1G7MA 5T1MB 3ARFA 1DBKH 4OUUA 3D48R 2D0FA 3FT3A 2NW3B 2XY2A 3SDAA 5LJYH 1LO0H 4J4PC 4XC3L 5CBAA 1I1FB 4R96A 4C83B 1HINL 2P5ED 5DDHA 5I2IA 4K8RL 3VH8B 1HILA 1NJ9A 4P5KB 5DK0B 4GSDH 4IOFD 5EBLB 5C0BE 4KK5D 1P84K 1MFBH 1N64H 1RIVH 2P24B 5GZNC 3K2UL 2R1XA 2PTTB 4K8RD 2ITCA 2A83A 3MREB 1KPUB 4L4TB 2EECA 4JAMB 3W2DH 4MNQE 4NQDB 1ORQA 4LASL 1A9EA 3HZYB 3TYGH 3DOSA 5GS1C 1CE1L 1YN7B 3NACH 1RK0A 2ZSWB 4NKDA 5I16A 5CIPA 3MV8A 5FYJL 3FMGL 1WZKA 4LAQH 2DQHH 3HZYA 4PJ9A 2BOBB 4R4NC 2VLKB 1ORQB 3TP4A 1QFOA 2NY2C 5TGBB 5IJVB 2FZ3A 1N6VA 4FTVA 5E5RB 1KJVB 5TF0A 2AI0H 4WFGE 1VFBA 2EE2A 4L4TA 4L4TE 5CZVH 1CD8A 1IAIL 5ID0A 1R3IL 1UJ3C 3WL9A 4P49A 1HHJB 3F5WB 1HH6A 4JB9L 1BM3H 2AK1L 3FFDB 4F7CB 2VAJA 1FQ9C 4TPRL 3QIUA 3Q6FA 3S5LG 1DZBA 2FJHB 4M02A 4ETQB 5IWLC 15C8L 3HC3H 4JFOB 1TTUA 4GKSA 3HUJB 5J6HB 3SO3B 5FK9B 3BPCA 4Z8FL 4NQCA 2XYCA 4MD5B 2XFXB 1WWCA 1MLBA 1QQDB 4YHKL 4ALAL 1KB9K 4X6FB 2XRAL 4WFFE 2RFXA 2CLZB 2BCKB 2BVOB 2C1PA 4LQ1A 3UTPD 2VSCA 3G5YA 2CO6B 4HFUL 4WW1A 4FHBD 2VIRA 1NFDE 5FFLA 1LILA 5CS7A 5JHLL 2DYPA 3CK0H 2VZ1A 4PG2C 4EUPA 4Q0XL 4JDZA 2W0PA 4RZCB 4OTXL 3UTOA 3QDGB 1X5IA 4ODBD 3GKZA 3REVB 4B7IA 5KN5A 5LGHL 5HDLA 1CD9B 3W0WD 3DURA 2ZNWA 5D6CB 4FQJH 3QDMD 1J86A 5DJ8A 2LTQC 1OAUL 4UILH 4S1RL 4KAQL 5IIEA 2QSQA 1F5WA 2JLLA 1MLCB 4KRMB 5HSFA 5C0AE 2VYRE 3AM8C 3BZFB 1HIMH 2QSTA 4V1DA 5A43C 5KAQF 4JFQB 2O5XL 2OTWB 5FUOH 3NPSB 3UJIL 5TQ2L 1R3HA 1V3MA 5CILH 3CFBA 5DQDL 4V2BA 4LGRB 2O93L 3EFFA 4Y4KB 4PV8A 3IAPA 1HHKB 4RGOH 4UIMB 4K94C 1O7VA 4GLRH 2FH8A 2DLGA 2AEPL 4QRPB 1G1YA 5CEZE 1NEZG 5KS9F 32C2A 4BK5A 5MHSE 3ES6B 4LOUD 5HVHC 4ZS7H 1GL4B 5H2BA 3GMNA 1NC2D 5IUSA 8FABB 2N7AA 5E1AB 3W81A 3ZTNL 3OXRB 1XR9B 1AXTH 1MFAH 4LSTL 2XZQH 4QHMB 5I73C 5MEPB 4OFYD 1S3KH 4LLDA 4I2XA 5MI0B 5F9JA 3ZL4L 5I1CL 5EPMB 4PGDA 5JXEA 4RMWA 1CFTB 3WV0A 3LMJH 1IFHL 5D5MA 4WGWB 5GIRA 4DN3L 4G8GA 2PW2A 1A21A 3VMNA 3QA3A 4WFED 5EIQA 4LFHD 4CW1B 3MNZA 4K7FB 1DANU 1NMBL 1WITA 2AS5M 2G5BA 4LDEB 3AM8A 3O3DB 1Q0XH 3CSYB 1EXUB 2I9TB 4UT7H 3OKMA 3MJ9H 3WLWD 5CJXA 3M17A 4LNVA 4WENB 4OCNC 3UAJC 3DV6A 3W9EB 5I76B 4E42B 4BFBD 4ZUVB 2ADJB 4PB0H 3RU8H 5I1CH 4PGEA 5DUBB 3OJ2C 2BSSA 3WXWL 5D7IA 4KKAC 4HMDA 4R0LB 3OJVC 4D2NA 5L0QB 1F3RB 2XTJC 3QUML 3U0PA 3V6FB 4HAFA 4H88L 2HWZH 4OCXH 3QCVH 3CDYA 5E2JA 1HNGA 2KPNA 2A77L 5LGHH 3ULSB 3D85A 3EJJX 3MNVA 5IF0B 1MCWW 4C55A 4Q9RH 1C16B 3B9KD 4RIRB 4N8VG 1KTDB 3IFLL 1KPRA 2Y5EA 4YHOL 4K3GA 3SKJH 4WV1A 4DKEH 2FR4A 4QHKJ 1BBJA 2ZG2A 2F54B 5C8JA 4WHTA 3ARDA 4OM0L 3NCMA 5E9DB 2HKFH 1OAKH 1F58L 4YFEA 3EZ8A 4HQQL 4BFGA 4CN1A 3V9FA 4OIIH 5SX5K 4MJIA 2CUIA 1J12A 2BSTB 4JZJB 1GHFL 2HT2C 4U1LB 4LCIH 2Y07L 5L2KA 4ZG1A 3LDBB 4WIQA 1ZXQA 4U3HA 3EZJB 1NDGB 4APQC 3FAWA 3BSZH 4M5YL 3BXNA 3IJYA 4JY6B 3RY6A 4R26L 1LEGA 5KVMC 5LKNA 3RAJL 3T4AA 4AG4H 1NH6A 1Q38A 3NFPA 5FF6B 5J12B 3P0VH 4WHDA 1JHTA 3DVNB 4CMHB 1NC4D 3VGHA 1X5XA 4LDOB 1YEFL 5KSUA 4GBXB 1X9QA 3GSWB 3U4BH 1F4AA 2ADIB 3L1OL 4C56B 1T21B 1IC5L 5I1GH 1I9RL 3BSZL 5C07A 4NKIL 1M7DB 5CCKL 4NQCD 2GY7B 3PWUA 1CT8A 3DHJA 3QG7H 3WNNA 4WUKH 5TQ0L 3B3IB 5KANI 3P11L 4OF7A 2YRLA 1VADB 1CE6B 2P5WA 3BP6B 1RZKC 3QUXA 5L88H 4IRJC 3QQ9C 1X5ZA 5DWUH 3TV3H 4MA8L 3E0GA 3QUYA 4MMZC 3DV4B 4YHOH 5DSCB 5BOPA 3X12A 4MJIE 3ZE2E 1R3IH 4DQOH 3QAZC 1CFQA 1H3PH 2WQ8A 5L2KE 4ODTL 3D6GA 4KK8D 3NMEA 1HINH 3SE3C 3BN3B 3QUMH 3FN0L 3L3JB 2FSEB 2NY0B 4NC2B 4DZ8A 3CLFL 4N9GB 4F7TA 2DQHL 2KKQA 1RVFL 3U48A 3DV4A 3FMGH 5FYJU 2PXYC 1T2JA 3A6OA 4PR5A 4X4XB 3WDHA 2BVTA 4KRPB 5D5MF 2CLRA 2AVGA 1V7ML 1L0YA 1KJ3H 4OM1L 3ULVC 3D69B 3SGKC 5C3LD 1MPAH 3WO3B 3U7WL 3WIIH 2APBA 1PJ9A 1KXVC 1NMBH 5DGRA 3FQTA 5FGSA 1UFUA 4QOKB 3FO1B 4MJ6A 3VDCA 2MQ0A 1UACL 1AC0A 1JF1A 3WJLA 5SWSA 1Q9WB 2IANB 4NNYA 4K7PY 2EH7H 4QXTB 4KVNH 5E8PA 2H26B 5HYSG 4MMXC 2VUYA 3DVNA 3VFMB 1I8KB 4R3SA 4M1CD 1MFDH 1ZLVH 1MCJA 5IMOB 5F97E 5ESVB 4CVWA 3UJTH 4R90H 2QSCH 4ODSL 5DZOA 5EOCL 4P59H 2HJFA 5EORL 2NQCA 3WHE0 2YWZA 1PEWA 1MFCL 3F7YB 4OLYH 2DQEH 2OR8A 2X4RA 3MBXH 3AREA 1XF3A 4CBPA 3ULUC 5IBUG 5JW4N 4DKFL 1ZT4A 4JZJA 3P40A 1RUQL 4MZ3A 1H8OA 3QISA 3HE6C 4PRAA 4P99A 4RGOL 1HH9B 1L0QA 3S88L 3OR7A 1HCFX 3GMQA 4GG8B 2WWMC 1UEMA 2CKBA 4E9LA 4LHQB 5D1QD 5C0DA 2RCSH 1KPRB 4NCC2 3D0LB 1VSCA 2E9IA 5FO7B 1OAZH 2FIKB 3SE4A 4HGWA 1RJYB 2YPLA 1MHEA 4FTVE 3RIFK 1AC6A 3P73B 1R3LA 1AI1H 1FNAA 1FV1B 3DECA 2Q87A 5HYSB 3ISWA 5JPMA 2A1WL 3HG1D 4F57L 4N8PA 5IB2A 1T4KA 4LL9A 1TNMA 5ID1B 1L4IA 1YECH 4R0LA 4XAWH 2X4SA 4YHLL 5BV7L 1W0VB 3O8XD 1N6QH 4KQ3L 1N8ZB 1XGUA 3QXAA 1OPGL 1K5NA 1Q1JH 2BY0A 4RFNB 1H3WM 4JG1H 4UT6L 2HMID 1RZJL 4QTIH 3O4LE 1B4JH 2NY3C 3N9GL 2BOCB 3FTGB 1I1AD 4I3SH 4J1UB 5DZNA 2QSVA 5ISZA 3MNZB 3WMSA 3UBXA 4YFDB 3TN0A 1DE4B 1RZGA 3HA0A 4DN4H 1CFTA 5EC1A 3JTTA 5F7DA 5ACMA 4LPXA 2EXWD 1QSFE 4FXGA 1ZHLB 3L5JA 3VH8G 2GT9A 3O4LD 1OM3H 2OYPA 4PUBH 3FZUD 3BEVB 2DM3A 1DQLL 3VE0A 3ZYZA 1KGCE 1P69B 3JWDC 2FGWH 3SN6N 4JRYE 4LGSB 5KS9B 2RAMA 3FQRA 1MUJB 1ZT1B 1NCTA 2C3GA 2WSKA 4QRPA 3U6RB 2WIMA 3OG6B 1FE8L 5JIPA 3MC0A 3L95A 5FYLL 1C7TA 3B9KB 5C7XH 1TQCB 2BY2A 4OLEA 1NEUA 1QKZH 4MD0B 4NC1E 4ZODA 1I7ZB 5C0CE 1JHLL 4RBPH 4JANB 1JGVH 4LGPB 3CFCH 3OKKB 4LFHG 3ZE2F 4JFFE 4DAGH 1IGIL 1S9XA 2VDLH 4ELMB 3GNML 5D6DA 1T66C 3RVTC 4X6EB 3V0VB 4HIJA 2PNDA 3G6AB 1Z9OA 1U58A 1FZMB 2XTLA 5KN5B 3REVA 5IEHB 4WTXA 3BZEA 1IM9D 2FB4H 4XNYL 2W0FB 3ZKXC 4XNQA 2WM0A 1NUGA 1Q9KA 2FEDC 1KB5H 1UWGL 3S8WA 2K7PA 2YPLD 4KUCD 4HPOL 4ZFFB 4XVSL 4FNLH 5C9JB 1A14H 2NTFB 1UWXK 1K2DA 3HZKA 4I5BB 1JJUA 2FX7H 3ORJA 2IFFH 2YUWA 1FH5H 1NCBH 3TJEL 4RAHA 1ACZA 4FP8H 3UBXI 1FSKB 1U92B 3KR3H 1J9CT 5CAYB 5M94B 3HUJA 3WFHB 2ZJSL 2XXCB 3OSKA 4W4NA 1JWUA 3KPSD 4G9DB 1P4IH 4RRPG 5FKPB 1L0XA 1IE5A 4MD4A 5DQJA 1H3PL 4K23L 1U8MA 3GHBL 1ZVSA 1RAMA 5C0FA 4K3HA 4X9BA 3MRGA 5I18H 1G7JB 1CGUA 2Z8WC 3V6BR 3TO4D 4XMPL 1W8OA 1NUNB 5D93C 1AIFB 1WAAF 3EOBA 3VG9B 4TQEL 2JCCA 3RWEB 3IXTA 5DRXA 2C4XA 2V2TA 1NGYB 5CIPB 2H8PB 2XPGB 4P2RD 3HE6B 4JZOA 4PJXF 1ZLSL 3ZO0A 2CRYA 2R0WL 2R2EB 3LPFA 4O00A 4Q9QL 1YEKL 2Y36L 4GRWF 2GJZB 4N1EA 4L3AA 2HLFD 4LSSH 3RWJA 4PJEB 5IV2B 1XF5B 5D7JC 1TJGL 4HS8H 1U93A 2DQIL 3O2DA 1CLOL 3CIQA 4AH2B 5CHNB 4PJ8A 4MXWL 5DHXB 2OJZH 2EDTA 2AGJH 2DQCL 2I27N 5AUMB 3SKNB 4QCIA 3U36B 1AJ7H 4OLZH 2Q3AA 4GBXC 3T4YA 4I48B 3UJJL 2EKJA 3V4PL 1JIBA 4LMQE 1PEZA 3WDJA 2CIKB 5A2JH 1CQYA 4HWBL 1G7HA 1MH5B 2IADB 3ROLA 4BQCA 3LEVL 2E27H 5CZXC 1IAOB 4PGBB 2Q7YA 4MNGB 1FCGA 1RQ5A 3WS6A 1TJHL 4OZ4B 4BH8B 2LTQB 1I9RH 1R24A 1IC5H 3LS4H 4MCZA 5EBWA 5TE7H 4ZXBB 1QBAA 1GRWA 2NZIA 2X44D 4OGXH 4ZYKA 4JFYA 1MNUH 4KVCH 4BUGA 4Z7QF 4JZJC 1RULH 5HHOB 3LKQB 5C0JA 3D18B 2EYTB 3BKML 2YPKB 5JW3L 2EO1A 1IC1A 4V1DD 3QWRA 5IK3A 4X8XA 3HS0A 4LCWE 4F8QA 2AEQL 1W0WA 3QIUC 5I74B 2EDHA 4JN1L 5FHBH 1RHFA 1ACYH 2EDFA 4ZOBA 2BVQA 1JI2A 1X44A 1J1XH 3WUWA 2DI9A 2W60A 4Z76A 2ZWLT 1YEIL 1LD9B 1I8IB 2ATKB 3C60D 1LE5A 1B0RB 4DVRH 3GSUB 3O3BB 5T1KA 5E70A 1DEEB 3KPMB 3WJLC 3C5SA 4XBGA 3G5XB 4DZBB 4U6YA 3P77A 1MREH 2F74A 4I3RH 2D9CA 4HAGA 4UT7L 3L3OA 4GLRI 5HHVH 1TZGL 3PGFH 1AE6L 3HC0B 1G9EA 1KT2A 5L2KD 2XG4A 5KVGH 5CP3H 4BFIB 4AL8L 3THML 4BZYA 1A4JA 1JGLL 3NPZB 4OKDA 3S3PA 2QSCL 3MUHL 4ODSH 5EZLA 1KB9J 1ZVHA 2CMRH 1E4WH 3OPZH 3QPXL 3H42L 5GS0C 5F7FA 3CDGA 2O5YL 1FL5B 1MFNA 1QLFA 3HZMA 4XH2A 5HYIA 1RI8A 3I2CL 4O2CB 5BQ7A 4ZS7L 3DUUB 2WP3O 4X7SL 4EI6A 3BPLC 1AFVH 2IANE 4Y5YA 1NAKH 3ARBB 4PJGA 2YC1B 1JRHI 4GRMA 4LVNB 5EU6A 1TLKA 2BXYA 4NGHL 3CSPA 2AJ3B 1ULVA 2N56A 1Y6MR 4M7ZB 1HXMB 2D7PA 3IDIA 4YHNA 3KPPA 1LO3L 1WSST 4NGHH 5ICZB 4K9EH 4HJGB 4MDIA 4OD1H 2F58L 2X4TA 2O61A 1UCTA 3RKDD 1RZKL 3VD7A 3GSXA 1CFBA 5TQ2H 1CFSA 4MJ5B 3RPIA 1WCBB 4JCLA 3BW9A 3FZUC 5HI3D 5I9QB 1IM9A 3RIFF 4LSTH 3TPKA 4Q6IA 1OGAE 1T1ZA 2XOTA 3U4AA 3MRQB 3OF6D 5J0BA 3RHWK 1FZKB 4UTBH 4F37F 5CMAB 5IT2H 1ADQA 1S9YA 3KYMA 1NCCL 4KZEH 1IGIH 4PTTA 4Y0GA 1Z0NA 1LO4L 4JKLA 3BAEH 5IHBA 1FNEA 1VGKA 2XZZA 4BELD 4YDVA 4IRSC 3MCKA 2D3VA 4FFYH 5DJ6B 4M4RA 4NZRL 2EYSA 2E9BA 1J8HB 3SDXA 4NOBA 3K1KC 2AQ3A 2VZOA 4PJBB 5TE7L 3RY6C 1JYVA 1J0JA 1JNJA 3MRJA 2IPUG 4X9FA 1I3RA 4GOSA 5J9PB 3QCUL 5D7KD 3QG7L 1TZHB 2NX5D 3TO2A 3VXSE 3MYZA 3QHFL 3ARFC 4JEGB 1XR8B 2DM4A 5EZOH 3IF1B 1QFWI 2IPKA 3B9DA 4Z9KB 4F9LA 1A1NA 2EDJA 2X1XR 5IROA 4HFWA 3QQ3A 3OF6A 4XMLL 1AJ7L 1U3HB 3R8BB 4ZXBC 3D9AH 1G0DA 4OTXH 1XFPA 3BGMB 2GQHA 3LN5B 5MI0C 1SJVA 5EBMA 4JY4B 2ZUTA 5ILTH 5H94B 1E4XL 2DQDL 1DUZB 2VZTA 4OB5H 4HW6A 2ENSA 4ODWB 3CC5A 4Z78A 1CFVL 3QG6A 2E3VA 3TM6A 5L7XH 1UJ3A 4L8DA 1J5OH 1FL6A 1PFCA 1ZLUK 2FJFA 1UB5B 4L4VA 2BNUB 3FO2B 1T22B 1XIWD 1I7TB 4WU5B 3QWRD 3L3DB 2HFEB 4LAQL 1SEBA 2Z4QA 4QYOA 1JPTL 2GSIB 5FYKL 3JUYA 5IBTL 2BXZA 3O6FB 3QP3A 4TNVF 3GSQB 5FM5M 4FXKA 2OS7A 3P4MB 1HQRA 3VFTA 3UTZB 3VW3L 3T1FA 2LU4A 1QO3B 4ZUUA 1J7VR 1T7YA 4DW2L 1H5BB 5FHAH 3JVGA 2FBJL 1SJHB 4M3JA 4YPJA 2GITA 4YHML 2B2XH 1F13A 4PRIA 3HR6A 1CR9L 4WU7A 3WLBB 1FAKT 4EVNB 3T77B 5EULV 4EN3C 2G75A 2VXSH 3N85L 2JCCF 4NQDE 3U9UB 5JW4R 3CPLA 4HUVB 4H88H 1P4IL 4PYGA 3BPLB 4E5XA 3BMWA 4ZPTA 5CJQH 3MRNB 3RA7H 4Y2OA 5CFHA 4APQB 4LBEB 4UB0L 3QXTA 3MLZL 3MRMB 1RURL 4TRPH 3X11A 1DLFL 3WS3B 5EFIB 1PYWA 3D87B 4ZQKA 5GRWA 5D2NE 3IDJA 4LSRL 1VACB 1SEBB 3Q1SL 1QG3A 1K4DB 1UH4A 4G6FB 2BNUA 3FO2A 4XI5C 3GDBA 4NUJA 2XTJD 3MJ9L 1A3RL 3LRGA 3QNYA 3H9SA 3GSVB 5TE4H 4PP2B 1J05B 1VDGA 5H94A 4FQ1L 1UWGH 3BVNB 3VD3A 5EBMB 1U6AL 3M8OH 3EYFB 3OKEB 1AGFB 1UC6A 1U42A 3GBLA 4KQ4L 4OFPA 1NAMH 5JQHC 5GPRA 3C6LB 4XC3H 3C8KB 3V5DB 3STLA 4MAUH 2IPKB 2DB8A 3MPCA 4PJCB 3WSQH 4FP8L 4YNYB 1FH5L 3OMZA 5EU3A 4XNUH 4OQTA 4XZUB 1WGOA 4KKAD 4YBLB 2VAAA 3RUGA 4F3FA 2R2BB 3HZVA 3LHPL 1OWRM 3KLHD 3CFCL 4YGAB 1WFUA 4XVUD 4X7TA 3IDGA 1JHKL 4WW2A 2AXHA 4XX1G 4PJBA 3NBNA 3BDYL 5DHVH 4IS6B 4HLJA 5DVMA 3LQZB 5HHXL 4Z7QE 4DTGH 3I6LD 2COQA 3SDYL 3MV9A 5C0CD 4ZXBD 2JB6A 2QBWA 1BIHA 2NW2A 2DQGL 5EO9A 3QXDA 1ITCA 2EDYA 1T80A 4Y4FC 4ZUWB 4I4WA 1OCWH 5JQ6L 4TN9A 1VENA 2VDRL 3QPQD 2DRUA 1N7ML 2BY3A 1YUHA 1UA6H 1FO0L 1S7QA 2J8UE 3RBSA 2X4NA 5FA4A 3MRQA 4PY8J 1KNOA 1UZ6E 4X80L 3BP5A 4U1NB 3ZE1F 1FIGL 2DYPD 4S2SA 1RUPH 2PCPA 4N0UA 2ATPB 2RHEA 1T0NA 3R4DA 3V5HB 1C5DB 4HS3B 1MI5D 3WS6C 5ICZA 3KPRE 4LCWD 2DMCA 4P46D 1CZ8H 1QTYT 3SE9H 43CAA 4NUGL 1F11A 3S4SG 3VXMA 3IS0X 5ALCH 5KZCD 3TT3L 5JLZA 2FL5A 1I4FB 1S7RB 3PP3H 3D2UA 2ZOLB 3CDGB 2GY5A 4Y1AD 3EDKA 4Y4FD 4HD9A 4PP1C 5DJDB 1PZ5B 1MAKA 3SOBL 1VHPA 2CJUL 1Q9OA 3DXAE 2EDXA 4JDTL 1A7RL 5D93B 3KPRB 4NFBA 3DHMA 2L7JA 3HC0A 2YN5A 4JFPB 1DQQB 1VFAA 2HJKA 4CL7A 3RWHA 1QVOB 3PV6A 1DVFD 3C2AH 3BT2L 4A6YA 4L4JA 1AGDA 2DIJA 3B2UD 4HKXA 4QHKI 2ZG3A 2VDPH 1YNKL 3T3PE 3HPJA 3LEXB 3EYUH 3CFEB 1LP9E 3TNNB 3G5XA 5BRZE 3KPLB 4J4PA 4KRPC 2AV7B 4QHLA 4WHYH 4OD2A 3GB7A 2OTUA 3CFJB 1KSRA 1NGWB 4DKEL 2V5MA 4LLWA 1UH3A 4TUOA 4XP5H 4LASH 2ADGA 3EJZC 3WKML 2BVQB 4I77L 5GJTH 5IJKA 1ZK9A 4PFEA 5DUPH 4I13B 1GOHA 5KSAC 3QCVL 4U7MA 3TFKD 1I1AC 5F72S 3VXQB 4NFCA 1OAZL 3B83A 4LLVB 3IETA 2VL5A 5DHYA 5DRZA 3FB5A 3SDAD 3HC4H 3MLXL 5J57B 1Z6JT 3VRIA 2X4UA 4ZYKB 4X6BB 5T3XE 4P2OD 3DETC 2J1KA 2D0GA 2IAMB 4MCZB 5EBWB 1UWEL 1ZEAL 3QDJA 4PGBA 5C07E 4U0QB 4Q74A 1EGJL 2VRAA 4L4VD 1P2CA 1A6TA 1U0QA 1FNSH 2E7CA 4NRXA 1ZTXL 3KLSA 4QY8A 3DUHA 5D71H 1A8JH 5CBEA 5IHZA 4N0CD 1KACB 3QCTH 2AK4D 3GI9H 4OBSA 1BD2E 2BC4A 5B8CB 1NEZB 1DL7H 4G8GD 5I1KL 3SE8H 5ICYB 5I66B 1P5UA 3OGCA 1URLA 2CMRL 1OTSC 1EFQA 1LEIA 1BQSA 3CLFH 1GGIH 3O81A 1MQKL 5CINL 4HV8A 4EXPX 1OGTA 2Q1EA 1CL7L 5GGTH 1XF5A 4IDJL 1CDIA 1CR9H 1PY9A 1YEDA 1EO8L 3MMEA 1LDPH 2XACC 4KTDH 4ZNEE 1RFDH 3O45B 5TE4L 4ZFOB 1KIUA 3MUZ1 2CD0A 3TNMB 4HXAL 3H6JA 3RQ3A 3FOLA 5IG7A 5KSVB 3X3FH 4OGZA 1G7LB 1CGXA 4EN3D 1PQZA 4D0DB 4CU8A 4DVRL 3GSOA 5HI5D 3VWKD 1PX4A 1JMXA 4OZFA 5BVJA 1T7ZA 1ZS8B 1KC5L 3AS1A 4PRPA 1C12A 1X4XA 3BP4B 4LU5H 4AY0A 1CGTA 5DVNA 5DJYB 5E1HB 3GJEA 3RA7L 5FUCE 1QSEA 3FKUS 3VI4E 5I1GL 3E6FB 1G6RH 4OF3A 4U49A 4N1CA 1V3JA 4ODTH 1OGTB 4GW4B 4POUB 3SDCC 3O4OB 1E4XH 1NPUA 3TH2T 4YEFA 1NCAL 2J6EA 4RWYL 5I66A 4I0PA 4YHPB 5DI8B 4JREB 1U36A 3MXWL 5FYJD 1WBYA 1BD2A 5KSAB 3AMLA 1JN6A 3RTQA 4NHUB 5CBEB 4MX7B 1IZKA 2NY1D 4BQ8A 2YPVL 4I5BA 1A6TB 5FYKD 2NTFA 5DRNA 5IFJA 1RZJC 1JZ3A 1BWWA 5DVOA 3OKDB 2AERT 4CMHC 3D39B 2I24N 3H7LA 3VGFA 2X4UB 3F7VA 2XA8H 5CJOL 4WRLA 3MRDA 1AR2A 4UV7L 2R29H 1FJ1A 3TVMC 4NNPH 3GGWA 4HIJB 4UQ2A 4XBEH 1G6RB 2VL5B 3SE4C 3IETB 4LSUH 4YR6A 3QNZB 1NGPH 4LP4A 4MA7H 4PJ7F 4MS8D 1IKNC 4MZ2A 4X6DB 4O9HL 1UQSB 1XF2A 5JIKA 4KZEL 2VITA 1GGCH 4HUXB 1TNNA 1WFNA 1KELL 1EAJA 2GUOB 2Y06H 4NQVB 5L6YH 1SJXA 1DVFA 4QT5A 1KC5H 2PYED 3HLAA 1GHFH 3WNKA 2P8MB 4GMSH 1VFOA 3U6RA 1ZT1A 1HN1A 1YQVL 1ZANL 4L3CA 1OF2A 4YPGB 2RJMA 5IVZA 2YK1L 5C0BB 4P3WA 1FZOA 1NBYA 1H5BC 5IQ9A 1T0PB 4GH7B 3TYFA 3VXOA 1GZPB 3DRQA 3AROA 3E2HB 4MQXC 3A6CH 2OZ4L 1N4XL 2WAHA 2F19H 1A64A 3JV5A 2QJDA 3L3IB 2DKSA 4QRSA 3BGFC 1MI5B 3P9LB 4U1JB 1VPOH 3CAFA 2R8SH 2X89A 5JHDD 5KTEL 1DN0A 4MB3A 3JTSB 4PTUB 3DI3B 5INDA 3DUSB 5DLMH 2A6DA 35C8L 1EBPA 2AJZB 2VZ3A 4PJ9C 4URTB 1WAAA 4JG0L 2RIKA 5C0RH 2VLME 5TE6H 1NFDA 2EO9A 4BH7A 3U0TA 1S7VB 4OZHA 5E8OA 2QHLA 1JYXA 4I2XE 4HZLA 2BNRE 1ZHNA 3MODL 1MCOL 3VWKA 3FTGA 3KJ6L 3L6FA 4OT1H 2G2RA 3ZYJA 3TIDB 4C4KO 1DR9A 3VXMB 1CCZA 1F11B 1BQUA 2HVKA 1ETZB 5DD1H 2NXZB 3PGDB 1OARH 4PJFE 4XXDB 1Q0XL 5IB3B 1E6OH 3EOTH 1FVEA 5IR1B 1HEZA 2W1NA 1TZGH 3T0WA 3VDBA 3EOAB 3KYNA 2ESVA 2NY7L 3FOMB 4XPHL 3B9VA 3LKOB 4GKNA 3FT2A 5DT1H 4AT6B 1AFVL 4RGNC 3MUJA 4OLWH 3IVKA 4JPKL 4S2SB 1MCIA 4XHQA 1AKJB 5D7SH 4D9RD 3EJYD 1FV1A 2ORBL 3H42H 3MOAH 1BECA 3LS5H 2NR6D 1P5VA 2H6PB 2VERN 2XIDA 4MWFA 5JDSA 1G1CA 4P2RB 4JN1H 2C5DC 2W07A 3D0VB 3QFJA 4HCRA 5D2NB 1QRKA 2V5YA 3KXFE 4U6VH 2X7LB 3EYQD 1WK0A 4PYHA 2EDEA 5EO9B 1S5IH 4OUOA 3TBSB 1FGNL 3TJHD 1FE8H 1M71B 3R0MA 1ZT4B 3EOAA 3KYNB 4K7PX 1F97A 1LP9B 5CSZA 2H9GB 1WFOA 2P8PA 3QDJE 1FG2B 4HMEA 3LB6C 5M95B 1KB5A 1NLBH 2CR6A 3WNOA 4LOUC 1JTPA 1MIML 4AEEA 3D85D 4GXUM 1ZHNB 5LXGH 2PO6C 4L1HA 5KVEL 4YNYA 5CD3A 1OAUH 1RV6X 3FO0H 3ULVF 2ZKHL 1LK2B 3V5DA 7CGTA 4X9GA 1OAXL 4YIQA 3H7BB 3TA3B 3MFFB 3TBVB 5C6WH 3D39E 4MQ7A 5F7YC 1U3JA 3SKUD 4U1JA 3MGOB 1HXYB 1A1OA 2EIZA 3DX8B 2OXHA 3GSVA 4OCRH 5F7WC 35C8H 5MEQB 4H1LB 1KJ2A 3NH7L 1H3TA 4JHZA 1PGRB 2VDOH 2XWTB 4LHJB 4M7KL 4LCYA 4NZTH 3IB4A 4JREC 4F7MA 4WV1C 4ZOEA 1LK3H 2KZ1B 2JTDA 4ZPVA 1EFXA 1OP3K 2ZOKB 4NQVA 5SWZD 5E8NB 2C3HA 4OV6F 3O8XA 3RL2A 5DI8A 3WHXB 1FIGH 4ZPTB 1T0MA 4HUXA 4AMKL 2EZ0C 3CPLB 1GC1L 2ZCKH 4M6OH 1T5XA 2Q8BH 5JA9A 3O3UN 4U0RC 1TFHA 5E7FA 1ORSA 5F1SA 5IMLA 2EYRA 3DX6A 1G6RA 4I0PC 2W0LA 1F4YL 5DSCA 1KCVH 3PHOA 4KI5D 1FJ1B 3FFCE 1AQKL 3IT8D 4L3EB 3MRDB 4P9HL 4MS8C 5C07D 3BE1L 4Y8DC 4X6DF 3VFGH 1REIA 4Y2DA 3HN3A 3OB0K 3GSQA 3TJEH 1RUQH 2DD8L 2HT2D 5F8QC 2IQAA 2VABA 5HI3C 1T1WB 1QPPA 3L3DA 4QYOB 1XZ0A 3UMTA 4JM2B 1FFOA 4PJHF 1DEDA 2BNQA 5D7JA 3I50L 5GGSB 5FV2A 3W9DB 4XGZB 1MVUA 4XMKL 4F33B 4GQ9H 4OI7A 2W91A 1JN6B 4U1GC 1A6PA 4ELKA 1FORH 1ZOXA 1NAMB 2VZSA 4AEHH 1MJ8L 4MAYA 5A16A 2NZ9D 1NLDH 4YFLF 2NY1C 5SWSE 5E08H 4NHCH 1JWMA 1LWRA 4CJ1A 2H32A 2XN9E 2D7NA 1M7IA 3TPUB 3OGCB 3ZDYE 4PJHB 1A4KB 3ZKND 3N1MC 2XZAL 1XIWB 3DVGA 4FMFA 4RISH 1WEJH 3IJYB 1GVIA 4P46A 2IGFH 3IFPB 3P3YA 5ACZB 2IF7A 2JJWA 4XNMB 3OKLA 4M5ZH 4WEUD 5J1AB 5DFVD 5I1HH 1HYSD 5FGRA 1P2CB 1TCRB 1OLLA 3EO1B 5FO8A 2J5LC 3GSOB 5C0NC 3AS0A 4LLMA 4PJ5D 1P4BL 1BHGA 3T0EB 1CTNA 1RD6A 1QKZL 4PLNC 5E9DA 3O3AB 1Q94A 1OSPL 1BBJB 4JFEB 3L5IA 5ENWB 3HMXA 1FVCB 4POYA 2Y23A 4IRZH 5HHMB 2PR4L 3GO1H 2FGWL 4OCSL 3D85B 2CIIB 3S5LB 4RMTA 2MPAL 1D5ZA 3TA3C 3QEGL 4LQFH 1BQHG 3HFML 1OT2A 4FABL 4G9FE 4HH9B 1ZGLB 2FECI 1VEOA 3ARED 1T1ZB 4GRWB 1FPTH 3OKNB 4DAGL 1AH1A 4FQQA 2M8XA 2NR6C 4ZUVA 1U95B 1UXSA 4AENA 3BKYH 3DGGB 4TUOB 5HTSA 4LLWB 4JPVH 4HUMB 2ADFL 4PB9H 4TYUA 5DUML 3GB7B 4DGIH 3GO1L 4OCSH 1BX2B 4NZTL 1A9BA 3CFEA 3DMMA 1ZLWK 1LEKB 1MHHA 1SJEA 4HUUB 4Z7WF 5HYQB 4GW1B 4G5ZH 3KWWB 3PV6B 4TTGA 2QQKL 1OSPH 2P47B 3B4NA 2PW2B 4UTAH 4HC1A 4BUHA 4PRHE 1AXSA 4OCRL 2FO1A 4YDKH 1ZTXH 3UDWC 5LQBL 4PUBL 2DQDH 4HEPG 3IAGC 3A67H 5FIEA 2RQ8A 1OLZA 1JK8B 2M2DA 1F3DJ 4PS4L 1PZ5A 5E2WH 4RMUA 2OQJA 3UO1L 4YDIL 1NC4A 5EZLB 1IEBB 2WWKT 3RAJH 3V7AG 4AG4L 2HMIC 4F7PA 1NQBA 1JK8A 2A6KA 3GMOB 5CD5C 5IGXL 4PJIA 4RFOH 1MHCA 4ODXB 4M62L 5BMFH 1WFTA 1FYTD 3QQNA 4QGYA 4JVWA 5C08A 4H1LH 2AKRB 3SY0A 1R0AH 4U6HA 4KFZC 1WVZA 4ZAKA 4FQIH 4O2EA 4JO3H 4LCUB 4HUUA 3EJYC 1PG7H 2BNRB 1MHHB 1SJEB 2YUZA 3KYKH 4GRLB 4KKLC 4Q2ZA 1LEKA 3UYOD 2HRLA 1Y0LB 2FECL 3G6DL 4XBGB 5IW3A 4LARH 1OAKL 4XMKH 3S88H 1R3HB 1R5WA 3MNWA 4JQIL 4GRLA 5GRUL 5IMKA 3WKMH 4N0UB 4YHLH 5BV7H 4YWGL 1I8IA 1T6VN 1UM6L 2GJ6B 1P84J 5ACLA 2AKRA 4WNQB 4GXVL 2DD8H 4FXLA 3O6LH 5GJSH 4OCYH 2P5WD 1OGAA 1J0ZA 3KPRA 4HBCL 4AEFA 3DURB 5IVOA 4ZTPH 3RVWC 5BV7B 5EOTB 1PG7L 3QZWB 3DROA 5FYJE 1CXFA 3S37H 3WN5B 2RCSL 5I1AB 3ARGA 1S7RA 1Q0YL 1UWXH 2PKDA 4M62H 3BWUC 2HTKC 1U2HA 2X41A 1KLFA 4JFYB 3E2HC 3ZE1E 1INEH 4JFEA 1TETH 5ALBL 1WJ3A 5LWYH 3TO4B 3MR9A 1EZVY 1EHLL 3UTTA 3K7UA 3MRBA 1MCQA 5TH2B 3HKFA 5F96L 1MAMH 1WC7B 1P7QB 1T7XA 4OAWA 5FYKE 1BJ1H 4OD3L 3BHBA 5E6YA 3EO1A 2LU3A 1IAKB 4HF5L 5GGQH 4YZFE 2B1AL 1MPAL 5JOPE 5BCAA 1DBML 1T0NB 4P2QE 1SBBA 4KRPD 1UG9A 4X9IA 3PIQB 4I48A 4WGVB 3WUZA 1X7QA 3IFPA 4AENB 4P5TC 12E8H 4YGVB 1OT1A 4LIQE 1SEQL 2DJSA 5GZND 3GM0A 4OV5B 3C6LA 3GRWA 3K46A 4JG0H 5C0RL 3RI5F 3SE3A 2VR4A 3EYVB 1M7IB 4ZD3L 4CVZB 3FFDA 4F7CA 1G7QA 3EO0B 4OF6A 4XPFH 4XCYB 3ZTNH 2XKSA 1OW0A 4HH9A 1F4HA 4PJ5B 3EGSB 5C1MB 2IQ9L 4LPCA 4WJ5B 1YUHB 2HA1A 1OP3H 4UV4H 3N1QC 2A6IA 1FSKC 3VFPB 2DDQH 2VZVA 3ALXA 2VLKA 3QNYB 3K8LA 4FFWD 3QUXC 3B2VH 4IMKA 2W9EH 2BNQB 3U30C 1FFOB 3GMRA 4PRID 5EOCJ 1JGDB 2XA3A 5BO1L 3LKSB 2WBJB 1F8TL 2IQAB 4OM1H 1R3JA 1DBAL 5CJ5A 5CILL 1MIMH 3LOWA 3NN8B 3MRMA 2DWEB 2VDRH 3EOBB 4D8PA 1V3KA 1TCRA 5CD5D 1DUYA 2ITCB 3RP1A 3MBED 1YPZF 2VLJE 2FIRT 5CSBA 3SDDB 1IARB 3LPWA 4GW5B 4YHZL 4XNMA 2HYMA 3FN0H 5HHXH 5DTFB 4MJ2A 1L7IL 4P46B 4R8WH 2B4CH 1XIWA 3OXSB 4IIQC 1FYHB 3SDCB 5EU5B 3P30H 2X4PA 4LSVL 1T5XB 3DTXB 4XP9H 3L7EB 3FN3A 4W4OA 5KS9E 1HZHH 1OTSD 2D31A 3QFJD 1BLNB 3QEHA 4XVTH 3VGBA 1TPXC 1UZ6F 2IGFL 1J05A 3O6FA 5B3NA 3W9DA 2ITDA 2W38A 1GJIA 2DKUA 3Q3GB 3DX7A 5CUSH 5I8EA 3C8HA 5H35B 4M6NH 1AO7A 4HCRH 3T8XB 4H1LA 2LQRA 3MUGA 4FRWA 3DWTA 1VEMA 1BAFH 4LBEA 3D25A 3M07A 1BLNA 1HXYA 2CO7B 2XQBH 2QHRH 3I02B 5BRZD 1RHHA 4PJEE 4PGCA 3VXPB 4U4BA 5DJXA 2H2SC 3DPBA 4QRRB 4M61A 2F9BT 3KJ6H 4OT1L 1II4E 1T2XA 3ARQA 4LSRH 1KTRL 4JB9H 3QIWA 5DTFA 4QRPD 1X5HA 2JJSC 4PBXA 1U8NB 4U6TA 1TJGH 4MXQD 2AJXL 4RDQF 3NIGF 4ZUUB 4OGAC 1QO3A 4EXKA 1LO2L 2IEPA 5KSAD 3RUGE 2R1YB