3ZHMA

N-terminal domain of the ci repressor from bacteriophage tp901-1 in complex with the ol2 operator half-site
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGRSHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the N-Terminal Domain of the Lactococcal Bacteriophage Tp901-1 Ci Repressor to its Target DNA: A Crystallography, Small Angle Scattering, and Nuclear Magnetic Resonance Study.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Transcription
molecule keywords CI
total genus 26
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3zhmA00
3JXBC 4PU4C 1QP7A 3RZZA 2GRMA 2PUAA 2PUDA 2MQKA 1R69A 1DWKA 1UXCA 2LYRA 3GBFA 4IVZA 2H8RA 3ZHMA 2O4AA 3BD1A 1LQCA 3ZHIA 4IWRA 3KXAA 1NEQA 2XSDC 3CROL 3B7HA 2ICPA 4PU8A 4YARA 2JCGA 3BS3A 3QQ6A 3DNVB 4IA8A 4MCTA 2A6CA 2JVLA 5K98B 4PU3C 4GQMA 4YG4A 2CROA 3O9XA 4NDWA 2PPXA 3L1PA 1RZRA 2O38A 2KEIA 4JCXA 3KJXA 4X4HA 3IVPA 4Z5HA 3OQNA 1CQTA 1QQAA 3MLFA 3QF3A 1X2LA 2KPJA 4OB4A 2L8NA 2XI8A 4O8BA 2R63A 4GHJA 4Z5DA 1ZZ8A 4X4CA 3S8QA 3TRBA 1RIOA 3QWGA 2XJ3A 1WH6A 3BDNA 3LISA 4YG1A 3UFDA 2AWIA 4I6TA 2WIUB 4FN3A 2PUFA 2EF8A 1WIZA 1PNRA 1BDHA 2D5VA 2KEKA 1LLIA 2FJRA 1WETA 4JQDA 4PU7A 3GN5B 2GZUA 1ZPQA 2BNMA 2BNNA 3QYXA 1L1MA 1RZSA 4Z59A 4X4BA 2AXVA 3G5GA 2BNOA 3F52A 1ZVVA 3LFPA 2OFYA 3D1NI 1PRUA 2LYPA 4Z58A 3SCGA 3OP9A 2IVGA 2PUCA 3GN5A 2MEZA 1ZZ7A 4MCXA 2L49A 1OCTC 1JH9A 3OQMA 1POUA 2ICTA 1LCCA 3FYAA 4FBIA 2IUOA 1S7EA 1PRVA 1XWRA 2GRLA 3H5TA 1UTXA 2PUGA 2IVQA 3FYMA 2LYJA 2LYQA 4J1XA 4I6RA 1OSLA 1ZZBA 4X4EA 1ZZ6A 2IV1A 3CLCA 1AU7A 3EUSA 4X4IA 1GT0C 2PUBA 3JXCL 1YSEA 2KEJA 1EFAA 2EWTA 1RZRD 4J1WA 1UXDA 1PRAA 1Y7YA 3VK0A 3F51A 4F8DA 3U3WA 2LYSA 4Y42A 2LYKA 2LYLA 1JWLA 4I8TA 1ZAYA 2O49A 3PXPA 2AXUA 3OQOA 1NERA 4Z5CA 2LCVA 2XCJA 4I6UA 2WUSR 3CECA 1LCDA 2HINA 2BJCA 1QPZA 2B5AA 3JXDL 2HSGA 2PIJA 1LMB3 2AXZA 1ZS4A 1ZZ9A 5A7LA 1QP4A 1R63A 2R1JL 4YG7B 3HZIB 1X57A 4X4GA 2EBYA 3F6WA 2PE5A 1SQ8A 1E3OC 3ZKCA 1B0NA 1O4XA 2OR1L 2XIUA 2AW6A 1CJGA 2IVBA 1WH8A 1JFSA 1RPEL 1DW9A 1QP0A 1ZUGA 2PUEA 3SCHA 1VPWA 4JCYA 1ZZCA 2KZ8A 1JFTA 3OMTA 3FMYA 3R1FA 2IU7A 1IC8A 1HF0A 1PERL 4X4FA 2CSFA 3G7DA 2AUWA 4YBAA 3SCFA 1BDIA 4X4DA 3KZ3A 1Y9QA 1QQBA 1ADRA
chains in the Genus database with same CATH superfamily
3RZZA 2PUDA 2O4AA 3ZHMA 2HCNA 3CROL 2ICPA 3MEJA 2JCGA 3QQ6A 4IA8A 4YG4A 3NZLA 4NDWA 2PPXA 4ER3A 3UWPA 4JCXA 2XI8A 4O8BA 3BDNA 4YG1A 2GZUA 2BNNA 1RZSA 3G5GA 1ZVVA 3D1NI 3OP9A 3GN5A 5DT2A 5DTMA 2GRLA 3H5TA 2PUGA 2M4HA 2LYJA 4X4EA 5DSXA 2PXFA 4X4IA 2PXUA 1RZRD 2PXVA 4J1WA 3QOXA 2J7WA 2LYSA 2XXPA 3OKZA 3NXHA 1NERA 1LCDA 2BJCA 2PIJA 5DTRA 1QP4A 1R63A 2R1JL 3HZIB 1X57A 2PE5A 3LQXA 1HQ1A 1RPEL 1QP0A 4JCYA 1VPWA 3OMTA 3FMYA 3QFIA 1IC8A 1HF0A 4X4FA 3G7DA 1ADRA 3JXBC 4PU4C 1U2ZA 2GRMA 2MXDA 2PUAA 1QB2A 2MQKA 1DWKA 3GBFA 5DTQA 5JUWA 3ZHIA 3KXAA 2XSDC 4PU3C 2JVLA 2A6CA 2PXTA 4GQMA 3O9XA 2O38A 1QQAA 3IVPA 3OQNA 3MLFA 3QF3A 1X2LA 2PXQA 2R63A 4Z5DA 1ZZ8A 4X4CA 2LNMA 1RIOA 3QWGA 1WH6A 2WIUB 2PUFA 2EF8A 1WIZA 2FJRA 4PU7A 3GN5B 2BNMA 2FFHA 1L1MA 4Z59A 3LFPA 2OFYA 5DRTA 2LYPA 4Z58A 2LLVA 3SCGA 2PUCA 1ZZ7A 1JH9A 3OQMA 1POUA 3FYAA 4FBIA 1XWRA 1UTXA 2LYQA 3KL4A 4I6RA 1OSLA 1ZZBA 1AU7A 4EKGA 1GT0C 2PUBA 1YSEA 1QZXA 4ER6A 3GZCA 3G0TA 4Y42A 1ZAYA 3QOWA 3DM5A 4Z5CA 2LCVA 4I6UA 2B5AA 4X4GA 2EBYA 5GAGi 3NROA 1B0NA 2AW6A 3GUUA 1DW9A 1ZZCA 2KZ8A 3R1FA 2LYRA 4IWRA 1NEQA 4YARA 2PXPA 3A9ZA 4EZIA 3DNVB 2ODRD 5K98B 2HCSA 2CROA 1RZRA 3KJXA 4X4HA 4Z5HA 3SX0A 2L8NA 3TELA 2XXAA 4DE8A 4EQZA 4I6TA 1PNRA 3ME5A 2KEKA 1LLIA 4JQDA 3OWQA 3ZPXA 3QYXA 3F52A 1PRUA 4ER7A 2V3CC 4MCXA 2L49A 1OCTC 2ICTA 1LCCA 2IUOA 1S7EA 3TEPA 2IVQA 2IV1A 3JXCL 1UXDA 1PRAA 3TFLA 2L1PA 3F51A 3GZDC 3VK0A 4F8DA 2PXLA 1JWLA 4I8TA 2O49A 3OQOA 3R09A 2XCJA 3CECA 1QPZA 3JXDL 1LMB3 3GZDA 1ZS4A 1ZZ9A 5A7LA 4YG7B 2J7UA 3ZKCA 1O4XA 2PXKA 2IVBA 1WH8A 3VWSA 2PUEA 1ZUGA 3NDBB 3SCHA 4OBMA 2YBDA 4EKIA 1PERL 2CSFA 2AUWA 2PXBA 1Y9QA 3A9XA 1DULA 1QP7A 1R69A 1UXCA 4IVZA 2H8RA 3BD1A 1LQCA 3A9YA 3B7HA 4PU8A 3BS3A 4Q2JA 4MCTA 2PXDA 3L1PA 2KEIA 4ER5A 1CQTA 5GAHi 2KPJA 4OB4A 4GHJA 3S8QA 3TRBA 1MFQC 2XJ3A 3LISA 3UFDA 2AWIA 4FN3A 1BDHA 2D5VA 1WETA 1ZPQA 4X4BA 2AXVA 2BNOA 2IVGA 2MEZA 3SR4A 1PRVA 1NW3A 2JQEA 2VEOA 3FYMA 4WVLA 4J1XA 1ZZ6A 3M9LA 3CLCA 3EUSA 4EK9A 2KEJA 1EFAA 2XXQA 2EWTA 1Y7YA 3U3WA 2LLWA 2LYKA 2LYLA 4ER0A 3PXPA 2AXUA 2WUSR 2HINA 4DE9A 4HRAA 2HSGA 2AXZA 3F6WA 1E3OC 1SQ8A 2HFZA 2OR1L 2XIUA 1CJGA 1JFSA 3PE5A 1JFTA 2IU7A 3SCFA 2PXEA 4YBAA 1BDIA 4X4DA 3KZ3A 5DRYA 1QQBA
chains in the Genus database with same CATH topology
3JXBC 4PU4C 1QP7A 3RZZA 2GRMA 2PUAA 2PUDA 2MQKA 1R69A 1DWKA 1UXCA 2LYRA 3GBFA 4IVZA 2H8RA 3ZHMA 2O4AA 3BD1A 1LQCA 3ZHIA 4IWRA 3KXAA 1NEQA 2XSDC 3CROL 3B7HA 2ICPA 4PU8A 4YARA 2JCGA 3BS3A 3QQ6A 3DNVB 4IA8A 4MCTA 2A6CA 2JVLA 5K98B 4PU3C 4GQMA 4YG4A 2CROA 3O9XA 4NDWA 2PPXA 3L1PA 1RZRA 2O38A 2KEIA 4JCXA 3KJXA 4X4HA 3IVPA 4Z5HA 3OQNA 1CQTA 1QQAA 3MLFA 3QF3A 1X2LA 2KPJA 4OB4A 2L8NA 2XI8A 4O8BA 2R63A 4GHJA 4Z5DA 1ZZ8A 4X4CA 3S8QA 3TRBA 1RIOA 3QWGA 2XJ3A 1WH6A 3BDNA 3LISA 4YG1A 3UFDA 2AWIA 4I6TA 2WIUB 4FN3A 2PUFA 2EF8A 1WIZA 1PNRA 1BDHA 2D5VA 2KEKA 1LLIA 2FJRA 1WETA 4JQDA 4PU7A 3GN5B 2GZUA 1ZPQA 2BNMA 2BNNA 3QYXA 1L1MA 1RZSA 4Z59A 4X4BA 2AXVA 3G5GA 2BNOA 3F52A 1ZVVA 3LFPA 2OFYA 3D1NI 1PRUA 2LYPA 4Z58A 3SCGA 3OP9A 2IVGA 2PUCA 3GN5A 2MEZA 1ZZ7A 4MCXA 2L49A 1OCTC 1JH9A 3OQMA 1POUA 2ICTA 1LCCA 3FYAA 4FBIA 2IUOA 1S7EA 1PRVA 1XWRA 2GRLA 3H5TA 1UTXA 2PUGA 2IVQA 3FYMA 2LYJA 2LYQA 4J1XA 4I6RA 1OSLA 1ZZBA 4X4EA 1ZZ6A 2IV1A 3CLCA 1AU7A 3EUSA 4X4IA 1GT0C 2PUBA 3JXCL 1YSEA 2KEJA 1EFAA 2EWTA 1RZRD 4J1WA 1UXDA 1PRAA 1Y7YA 3VK0A 3F51A 4F8DA 3U3WA 2LYSA 4Y42A 2LYKA 2LYLA 1JWLA 4I8TA 1ZAYA 2O49A 3PXPA 2AXUA 3OQOA 1NERA 4Z5CA 2LCVA 2XCJA 4I6UA 2WUSR 3CECA 1LCDA 2HINA 2BJCA 1QPZA 2B5AA 3JXDL 2HSGA 2PIJA 1LMB3 2AXZA 1ZS4A 1ZZ9A 5A7LA 1QP4A 1R63A 2R1JL 4YG7B 3HZIB 1X57A 4X4GA 2EBYA 3F6WA 2PE5A 1SQ8A 1E3OC 3ZKCA 1B0NA 1O4XA 2OR1L 2XIUA 2AW6A 1CJGA 2IVBA 1WH8A 1JFSA 1RPEL 1DW9A 1QP0A 1ZUGA 2PUEA 3SCHA 1VPWA 4JCYA 1ZZCA 2KZ8A 1JFTA 3OMTA 3FMYA 3R1FA 2IU7A 1IC8A 1HF0A 1PERL 4X4FA 2CSFA 3G7DA 2AUWA 4YBAA 3SCFA 1BDIA 4X4DA 3KZ3A 1Y9QA 1QQBA 1ADRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXB C;  4PU4 C;  1QP7 A;  3RZZ A;  2GRM A;  2PUA A;  2PUD A;  2MQK A;  1R69 A;  1DWK A;  1UXC A;  2LYR A;  3GBF A;  4IVZ A;  2H8R A;  3ZHM A;  2O4A A;  3BD1 A;  1LQC A;  3ZHI A;  4IWR A;  3KXA A;  1NEQ A;  2XSD C;  3CRO L;  3B7H A;  2ICP A;  4PU8 A;  4YAR A;  2JCG A;  3BS3 A;  3QQ6 A;  3DNV B;  4IA8 A;  4MCT A;  2A6C A;  2JVL A;  5K98 B;  4PU3 C;  4GQM A;  4YG4 A;  2CRO A;  3O9X A;  4NDW A;  2PPX A;  3L1P A;  1RZR A;  2O38 A;  2KEI A;  4JCX A;  3KJX A;  4X4H A;  3IVP A;  4Z5H A;  3OQN A;  1CQT A;  1QQA A;  3MLF A;  3QF3 A;  1X2L A;  2KPJ A;  4OB4 A;  2L8N A;  2XI8 A;  4O8B A;  2R63 A;  4GHJ A;  4Z5D A;  1ZZ8 A;  4X4C A;  3S8Q A;  3TRB A;  1RIO A;  3QWG A;  2XJ3 A;  1WH6 A;  3BDN A;  3LIS A;  4YG1 A;  3UFD A;  2AWI A;  4I6T A;  2WIU B;  4FN3 A;  2PUF A;  2EF8 A;  1WIZ A;  1PNR A;  1BDH A;  2D5V A;  2KEK A;  1LLI A;  2FJR A;  1WET A;  4JQD A;  4PU7 A;  3GN5 B;  2GZU A;  1ZPQ A;  2BNM A;  2BNN A;  3QYX A;  1L1M A;  1RZS A;  4Z59 A;  4X4B A;  2AXV A;  3G5G A;  2BNO A;  3F52 A;  1ZVV A;  3LFP A;  2OFY A;  3D1N I;  1PRU A;  2LYP A;  4Z58 A;  3SCG A;  3OP9 A;  2IVG A;  2PUC A;  3GN5 A;  2MEZ A;  1ZZ7 A;  4MCX A;  2L49 A;  1OCT C;  1JH9 A;  3OQM A;  1POU A;  2ICT A;  1LCC A;  3FYA A;  4FBI A;  2IUO A;  1S7E A;  1PRV A;  1XWR A;  2GRL A;  3H5T A;  1UTX A;  2PUG A;  2IVQ A;  3FYM A;  2LYJ A;  2LYQ A;  4J1X A;  4I6R A;  1OSL A;  1ZZB A;  4X4E A;  1ZZ6 A;  2IV1 A;  3CLC A;  1AU7 A;  3EUS A;  4X4I A;  1GT0 C;  2PUB A;  3JXC L;  1YSE A;  2KEJ A;  1EFA A;  2EWT A;  1RZR D;  4J1W A;  1UXD A;  1PRA A;  1Y7Y A;  3VK0 A;  3F51 A;  4F8D A;  3U3W A;  2LYS A;  4Y42 A;  2LYK A;  2LYL A;  1JWL A;  4I8T A;  1ZAY A;  2O49 A;  3PXP A;  2AXU A;  3OQO A;  1NER A;  4Z5C A;  2LCV A;  2XCJ A;  4I6U A;  2WUS R;  3CEC A;  1LCD A;  2HIN A;  2BJC A;  1QPZ A;  2B5A A;  3JXD L;  2HSG A;  2PIJ A;  1LMB 3;  2AXZ A;  1ZS4 A;  1ZZ9 A;  5A7L A;  1QP4 A;  1R63 A;  2R1J L;  4YG7 B;  3HZI B;  1X57 A;  4X4G A;  2EBY A;  3F6W A;  2PE5 A;  1SQ8 A;  1E3O C;  3ZKC A;  1B0N A;  1O4X A;  2OR1 L;  2XIU A;  2AW6 A;  1CJG A;  2IVB A;  1WH8 A;  1JFS A;  1RPE L;  1DW9 A;  1QP0 A;  1ZUG A;  2PUE A;  3SCH A;  1VPW A;  4JCY A;  1ZZC A;  2KZ8 A;  1JFT A;  3OMT A;  3FMY A;  3R1F A;  2IU7 A;  1IC8 A;  1HF0 A;  1PER L;  4X4F A;  2CSF A;  3G7D A;  2AUW A;  4YBA A;  3SCF A;  1BDI A;  4X4D A;  3KZ3 A;  1Y9Q A;  1QQB A;  1ADR A; 
#chains in the Genus database with same CATH topology
 3RZZ A;  2PUD A;  2O4A A;  3ZHM A;  2HCN A;  3CRO L;  2ICP A;  3MEJ A;  2JCG A;  3QQ6 A;  4IA8 A;  4YG4 A;  3NZL A;  4NDW A;  2PPX A;  4ER3 A;  3UWP A;  4JCX A;  2XI8 A;  4O8B A;  3BDN A;  4YG1 A;  2GZU A;  2BNN A;  1RZS A;  3G5G A;  1ZVV A;  3D1N I;  3OP9 A;  3GN5 A;  5DT2 A;  5DTM A;  2GRL A;  3H5T A;  2PUG A;  2M4H A;  2LYJ A;  4X4E A;  5DSX A;  2PXF A;  4X4I A;  2PXU A;  1RZR D;  2PXV A;  4J1W A;  3QOX A;  2J7W A;  2LYS A;  2XXP A;  3OKZ A;  3NXH A;  1NER A;  1LCD A;  2BJC A;  2PIJ A;  5DTR A;  1QP4 A;  1R63 A;  2R1J L;  3HZI B;  1X57 A;  2PE5 A;  3LQX A;  1HQ1 A;  1RPE L;  1QP0 A;  4JCY A;  1VPW A;  3OMT A;  3FMY A;  3QFI A;  1IC8 A;  1HF0 A;  4X4F A;  3G7D A;  1ADR A;  3JXB C;  4PU4 C;  1U2Z A;  2GRM A;  2MXD A;  2PUA A;  1QB2 A;  2MQK A;  1DWK A;  3GBF A;  5DTQ A;  5JUW A;  3ZHI A;  3KXA A;  2XSD C;  4PU3 C;  2JVL A;  2A6C A;  2PXT A;  4GQM A;  3O9X A;  2O38 A;  1QQA A;  3IVP A;  3OQN A;  3MLF A;  3QF3 A;  1X2L A;  2PXQ A;  2R63 A;  4Z5D A;  1ZZ8 A;  4X4C A;  2LNM A;  1RIO A;  3QWG A;  1WH6 A;  2WIU B;  2PUF A;  2EF8 A;  1WIZ A;  2FJR A;  4PU7 A;  3GN5 B;  2BNM A;  2FFH A;  1L1M A;  4Z59 A;  3LFP A;  2OFY A;  5DRT A;  2LYP A;  4Z58 A;  2LLV A;  3SCG A;  2PUC A;  1ZZ7 A;  1JH9 A;  3OQM A;  1POU A;  3FYA A;  4FBI A;  1XWR A;  1UTX A;  2LYQ A;  3KL4 A;  4I6R A;  1OSL A;  1ZZB A;  1AU7 A;  4EKG A;  1GT0 C;  2PUB A;  1YSE A;  1QZX A;  4ER6 A;  3GZC A;  3G0T A;  4Y42 A;  1ZAY A;  3QOW A;  3DM5 A;  4Z5C A;  2LCV A;  4I6U A;  2B5A A;  4X4G A;  2EBY A;  5GAG i;  3NRO A;  1B0N A;  2AW6 A;  3GUU A;  1DW9 A;  1ZZC A;  2KZ8 A;  3R1F A;  2LYR A;  4IWR A;  1NEQ A;  4YAR A;  2PXP A;  3A9Z A;  4EZI A;  3DNV B;  2ODR D;  5K98 B;  2HCS A;  2CRO A;  1RZR A;  3KJX A;  4X4H A;  4Z5H A;  3SX0 A;  2L8N A;  3TEL A;  2XXA A;  4DE8 A;  4EQZ A;  4I6T A;  1PNR A;  3ME5 A;  2KEK A;  1LLI A;  4JQD A;  3OWQ A;  3ZPX A;  3QYX A;  3F52 A;  1PRU A;  4ER7 A;  2V3C C;  4MCX A;  2L49 A;  1OCT C;  2ICT A;  1LCC A;  2IUO A;  1S7E A;  3TEP A;  2IVQ A;  2IV1 A;  3JXC L;  1UXD A;  1PRA A;  3TFL A;  2L1P A;  3F51 A;  3GZD C;  3VK0 A;  4F8D A;  2PXL A;  1JWL A;  4I8T A;  2O49 A;  3OQO A;  3R09 A;  2XCJ A;  3CEC A;  1QPZ A;  3JXD L;  1LMB 3;  3GZD A;  1ZS4 A;  1ZZ9 A;  5A7L A;  4YG7 B;  2J7U A;  3ZKC A;  1O4X A;  2PXK A;  2IVB A;  1WH8 A;  3VWS A;  2PUE A;  1ZUG A;  3NDB B;  3SCH A;  4OBM A;  2YBD A;  4EKI A;  1PER L;  2CSF A;  2AUW A;  2PXB A;  1Y9Q A;  3A9X A;  1DUL A;  1QP7 A;  1R69 A;  1UXC A;  4IVZ A;  2H8R A;  3BD1 A;  1LQC A;  3A9Y A;  3B7H A;  4PU8 A;  3BS3 A;  4Q2J A;  4MCT A;  2PXD A;  3L1P A;  2KEI A;  4ER5 A;  1CQT A;  5GAH i;  2KPJ A;  4OB4 A;  4GHJ A;  3S8Q A;  3TRB A;  1MFQ C;  2XJ3 A;  3LIS A;  3UFD A;  2AWI A;  4FN3 A;  1BDH A;  2D5V A;  1WET A;  1ZPQ A;  4X4B A;  2AXV A;  2BNO A;  2IVG A;  2MEZ A;  3SR4 A;  1PRV A;  1NW3 A;  2JQE A;  2VEO A;  3FYM A;  4WVL A;  4J1X A;  1ZZ6 A;  3M9L A;  3CLC A;  3EUS A;  4EK9 A;  2KEJ A;  1EFA A;  2XXQ A;  2EWT A;  1Y7Y A;  3U3W A;  2LLW A;  2LYK A;  2LYL A;  4ER0 A;  3PXP A;  2AXU A;  2WUS R;  2HIN A;  4DE9 A;  4HRA A;  2HSG A;  2AXZ A;  3F6W A;  1E3O C;  1SQ8 A;  2HFZ A;  2OR1 L;  2XIU A;  1CJG A;  1JFS A;  3PE5 A;  1JFT A;  2IU7 A;  3SCF A;  2PXE A;  4YBA A;  1BDI A;  4X4D A;  3KZ3 A;  5DRY A;  1QQB A; 
#chains in the Genus database with same CATH homology
 3JXB C;  4PU4 C;  1QP7 A;  3RZZ A;  2GRM A;  2PUA A;  2PUD A;  2MQK A;  1R69 A;  1DWK A;  1UXC A;  2LYR A;  3GBF A;  4IVZ A;  2H8R A;  3ZHM A;  2O4A A;  3BD1 A;  1LQC A;  3ZHI A;  4IWR A;  3KXA A;  1NEQ A;  2XSD C;  3CRO L;  3B7H A;  2ICP A;  4PU8 A;  4YAR A;  2JCG A;  3BS3 A;  3QQ6 A;  3DNV B;  4IA8 A;  4MCT A;  2A6C A;  2JVL A;  5K98 B;  4PU3 C;  4GQM A;  4YG4 A;  2CRO A;  3O9X A;  4NDW A;  2PPX A;  3L1P A;  1RZR A;  2O38 A;  2KEI A;  4JCX A;  3KJX A;  4X4H A;  3IVP A;  4Z5H A;  3OQN A;  1CQT A;  1QQA A;  3MLF A;  3QF3 A;  1X2L A;  2KPJ A;  4OB4 A;  2L8N A;  2XI8 A;  4O8B A;  2R63 A;  4GHJ A;  4Z5D A;  1ZZ8 A;  4X4C A;  3S8Q A;  3TRB A;  1RIO A;  3QWG A;  2XJ3 A;  1WH6 A;  3BDN A;  3LIS A;  4YG1 A;  3UFD A;  2AWI A;  4I6T A;  2WIU B;  4FN3 A;  2PUF A;  2EF8 A;  1WIZ A;  1PNR A;  1BDH A;  2D5V A;  2KEK A;  1LLI A;  2FJR A;  1WET A;  4JQD A;  4PU7 A;  3GN5 B;  2GZU A;  1ZPQ A;  2BNM A;  2BNN A;  3QYX A;  1L1M A;  1RZS A;  4Z59 A;  4X4B A;  2AXV A;  3G5G A;  2BNO A;  3F52 A;  1ZVV A;  3LFP A;  2OFY A;  3D1N I;  1PRU A;  2LYP A;  4Z58 A;  3SCG A;  3OP9 A;  2IVG A;  2PUC A;  3GN5 A;  2MEZ A;  1ZZ7 A;  4MCX A;  2L49 A;  1OCT C;  1JH9 A;  3OQM A;  1POU A;  2ICT A;  1LCC A;  3FYA A;  4FBI A;  2IUO A;  1S7E A;  1PRV A;  1XWR A;  2GRL A;  3H5T A;  1UTX A;  2PUG A;  2IVQ A;  3FYM A;  2LYJ A;  2LYQ A;  4J1X A;  4I6R A;  1OSL A;  1ZZB A;  4X4E A;  1ZZ6 A;  2IV1 A;  3CLC A;  1AU7 A;  3EUS A;  4X4I A;  1GT0 C;  2PUB A;  3JXC L;  1YSE A;  2KEJ A;  1EFA A;  2EWT A;  1RZR D;  4J1W A;  1UXD A;  1PRA A;  1Y7Y A;  3VK0 A;  3F51 A;  4F8D A;  3U3W A;  2LYS A;  4Y42 A;  2LYK A;  2LYL A;  1JWL A;  4I8T A;  1ZAY A;  2O49 A;  3PXP A;  2AXU A;  3OQO A;  1NER A;  4Z5C A;  2LCV A;  2XCJ A;  4I6U A;  2WUS R;  3CEC A;  1LCD A;  2HIN A;  2BJC A;  1QPZ A;  2B5A A;  3JXD L;  2HSG A;  2PIJ A;  1LMB 3;  2AXZ A;  1ZS4 A;  1ZZ9 A;  5A7L A;  1QP4 A;  1R63 A;  2R1J L;  4YG7 B;  3HZI B;  1X57 A;  4X4G A;  2EBY A;  3F6W A;  2PE5 A;  1SQ8 A;  1E3O C;  3ZKC A;  1B0N A;  1O4X A;  2OR1 L;  2XIU A;  2AW6 A;  1CJG A;  2IVB A;  1WH8 A;  1JFS A;  1RPE L;  1DW9 A;  1QP0 A;  1ZUG A;  2PUE A;  3SCH A;  1VPW A;  4JCY A;  1ZZC A;  2KZ8 A;  1JFT A;  3OMT A;  3FMY A;  3R1F A;  2IU7 A;  1IC8 A;  1HF0 A;  1PER L;  4X4F A;  2CSF A;  3G7D A;  2AUW A;  4YBA A;  3SCF A;  1BDI A;  4X4D A;  3KZ3 A;  1Y9Q A;  1QQB A;  1ADR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...