3ZJKA

Crystal structure of ttb-gly f401s mutant
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
424
Chain Sequence
EKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLHHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRSGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Semi-Rational Approach for Converting a Gh1 Beta-Glycosidase Into a Beta-Transglycosidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords BETA GLYCOSIDASE
total genus 155
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zjkA00
1A3HA 2XWEA 3BAKA 5A69A 3RJXA 4V2XA 1HVXA 1W3JA 3A4AA 1KXQA 4W7VA 1AQMA 2WSKA 2PWGA 1RD6A 4PEEA 4PCTA 2CCRA 2YJQA 4UFKA 3CTTA 3L4VA 5CSYA 1DWHM 1C93A 4GZJA 4PMZA 1UH4A 2X0HA 4M56A 4ATLA 1ZJBA 3PZNA 3WDJA 1BAGA 2WVTA 1BHGA 2XIIA 3IJ7A 4ZXOA 1PJ9A 3EDEA 4K68A 4J3SA 3QGVA 3GBDA 1V6VA 1HKKA 1WCGA 2XGIA 3ZR5A 1PZ2A 2VURA 2DT0A 2ZWZA 3AXXA 4TXEA 1EOMA 3VMOA 1XHGA 4W5ZA 2JIWA 3T0BA 4TVDA 4AIEA 1VEOA 3ARPA 1BTCA 5M17A 1RP8A 2Q8XA 2D20A 4MB1A 1KXTA 2DH3A 2A3CA 2UY2A 5CPSA 1EQCA 4AD4A 3HN3A 1GCYA 5FKYA 4IUGA 3W53A 1VIWA 5HDRA 3O2LA 1EIBA 3PHAA 2XWDA 3VD3A 1KCKA 5EFFA 3DHUA 3PZIA 1DWAM 1QNSA 2WMGA 4PMOA 1TA3A 5A6AA 1PX4A 3M46A 3N18A 1E55A 1JAEA 3VGEA 1V0KA 4OJYA 2W67A 1SR0A 1BPLB 2CBJA 3WL0A 3VMNA 3WQ6A 3LPFA 1J01A 3WQ4A 3RM4A 1LG1A 4FLRA 3VIMA 5JIWA 1JL8A 3GTNA 2J7EA 2AMGA 3AHXA 3SUSA 3HMCA 4CVUA 2JALA 2J4GA 3VINA 4EAMA 5DF0A 5KEZA 1E40A 5AC4A 1WZLA 1IZJA 1X1NA 1UG6A 1V6YA 1QBAA 5DEZA 3WUBA 3DECA 4W7WA 3TTSA 1UZ1A 4F79A 5ABFA 1L8NA 2D3NA 1UKQA 4BQ3A 4W5UA 1DTUA 1UQYA 1J12A 3SUWA 2DEPA 1Q6CA 1C8XA 2VCAA 4ACZB 4PMDA 1KBKA 5HPCA 3VX1A 3KL5A 4UZUA 4WKAA 1OIFA 2PBGA 4J3WA 2G3MA 1UWQA 4AD0A 2ZX8A 4TX8A 3AS1A 4BQ2A 2J75A 3ZT7A 2BY0A 1UWIA 3AFBA 3LPOA 7CGTA 1R87A 3AIRA 2C0HA 3W38A 1NH6A 1E5JA 3W81A 4RE3A 3RCNA 1EO7A 2E3ZA 2FH8A 3SEPA 5IFPA 1W9PA 3SCRA 3QOMA 4WSKA 4LYPA 1GQKA 3K4AA 4PUEA 3VU2A 4H8UA 4YHEA 3RILA 3CBWA 1NWTA 3ARVA 3IANA 2DSKA 3MUIA 3IJ8A 4GKLA 4D6CA 3K1DA 1E6QM 2V5DA 1UD6A 1HT6A 2OYKA 4KGLA 1S46A 3AHTA 1LLOA 1FH9A 2D0HA 3SCQA 3WIJA 1G94A 1V3IA 1W3KA 5E0FA 1V02A 1AVAA 1D3CA 5I78A 4JAWA 1ITCA 1MQPA 1B30A 3PTMA 1CLVA 4IPLA 2BY1A 2WVVB 4CCCA 4JFUA 1AQ0A 4JKLA 1P6WA 5E6YA 3NUKA 3L2MA 2DSVA 3AHVA 2BY3A 4FMVA 2G3IA 3CHDA 2BY2A 4CCEA 4X0VA 2GK1B 4AZ5A 1WAWA 3SIMA 1E1EA 5F7UA 4MB4A 4N42A 2W63A 3GZAA 4ZE5A 4HU0A 3ZR6A 3SCNA 3VGGA 1ITXA 3AI0A 3FHQA 4V28A 4F9JA 1UKPA 1H2JA 1VBRA 3VGBA 2ZUUA 4AC1X 3ARXA 3A47A 2GSJA 2Y5EA 5IXEA 1CENA 4IPNB 3W6MA 1L0PA 1FHLA 2EPLX 4IISA 2YOCA 2FGLA 4JCLA 3GH7A 2J7GA 2V3FA 2WLZA 3WDIA 2ZUWA 2DSUA 2ZX7A 4LGXA 2E9MA 2DH2A 3MANA 2PWDA 1LL6A 1CGUA 1A47A 1H41A 2GJXB 4PMYA 3T2PA 5LA1A 1LWJA 2ZX5A 4KRTA 1G5AA 3MV11 3DC0A 1GUVA 4AZCA 2JFEX 3KWXA 1VBUA 3ZM8A 4AZBA 4W8LA 4E8DA 1PX3A 1FOBA 1QNPA 1UA3A 3AYSA 2XM1A 1UWUA 1TVPA 3QR3A 3GXIA 4LYQA 3WDPP 4W7UA 2WM0A 4TX6A 3ZJKA 4HPHA 2WSPA 3EDFA 4CVWA 1NP0A 4J3XA 3W82A 5D8ZA 2XUCA 1OM0A 1E4LA 1MW0A 4E2OA 1XD1A 1KXVA 1NP2A 2XVPA 4JFVA 2OSYA 1GNXA 3T09A 1EDTA 1EQPA 3OLGA 3MUAA 2UY4A 2CIPA 4TUFA 4OZOA 3ARRA 1GOQA 3UCQA 3VD7A 5AY7A 1NM9A 2WBKA 3ARWA 3W28A 5CG0A 3QOKA 5I79A 3NSNA 4F9DA 3OB8A 4OIFA 1XD0A 5A8NA 1EOKA 4D72A 3TP4A 2CBVA 3K4DA 2WBGA 1CBGA 1ESWA 3VDCA 1ODZA 2JE8A 3BXWA 5I77A 3ZJ6A 3GNPA 5CZKA 1E1FA 2BNJA 2YLLA 3AIVA 3WD1A 1FH7A 5CLTA 2Y2WA 5GQBA 2BS9A 1UYQA 3L4TA 3WD4A 3OZPA 2CITA 1HKMA 1OGGA 3NJ3A 1JI1A 3IK2A 3WH9A 1FP8A 2W5FA 1BLIA 1GQLA 4URIA 1WB0A 3TOPA 4CN1A 1W9DM 1UH2A 1LL7A 1W9BM 1HVQA 4ACZA 1WDSA 4MJ2A 4UFHA 1JDCA 1HL9A 1MYRA 3AIWA 4HOXA 1OB0A 2XVLA 3UG3A 3WUFA 4D6FA 2WMIA 3SURA 1C7SA 4OOUA 3WMCA 4P8WA 1VJZA 1W9UA 5M5DA 1PBGA 4KWUA 4MJ4A 2JEQA 4L4OA 4S3KA 5DT5A 3VIKA 4JCMA 3BCDA 4UQAA 5GNYA 3CZEA 4AIUA 3GNRA 1LG2A 1R85A 3AQUA 1E5NA 3SUUA 4QP0A 1F4AA 1KBBA 4DWSB 4ZE4A 2C7FA 1GQIA 1W9VA 3AYRA 3FN9A 4CKQA 2EEXA 1UZ4A 4BCEA 3AOFA 3ZT6A 1QHOA 2WHJA 4U33A 1DHKA 3PZUA 1NOFA 2EXOA 2J7CA 2XVNA 4KRUA 4QCFA 4XX6A 4DUXA 3WQ8A 1E72M 5HPOA 4DUVA 4U5IA 4UQBA 1CECA 4AD1A 3POCA 1PX8A 2YBUA 3OGSA 5HXMA 1KXHA 1GOIA 1EDGA 1OGBA 4Z2HA 2AOSA 3AHYA 3ZMRA 5AC5A 1KWKA 2QPUA 9CGTA 1E43A 2QMKA 1JNDA 2PWFA 2VX7A 1VB9A 2WWCA 3WFZA 3W37A 3N9KA 4UFIA 3L4XA 2IXVA 4BS0A 2XFFA 1SMDA 4P7QA 2IUZA 3GNOA 1WPCA 4PTXA 3AIBA 1WP6A 1BG4A 3AIQA 5KZ6A 4MAZA 1CXHA 1E70M 2J7BA 2WMJA 4EKJA 3KZSA 3F5LA 3FAXA 2XVGA 1CXIA 4OBSA 1CXEA 3OLDA 5ABGA 1K9EA 2WZEA 4V27A 3CHFA 1C90A 4M82A 4TVUA 4UCFA 4P8VA 2OWCA 1CGWA 1CTNA 1UA7A 2VZTA 3VM5A 4W87A 4D6IA 4YN5A 2BHZA 3E1F1 1E4IA 1ISXA 4ZENA 5JIPA 2NSXA 2B31A 4M24A 4MDPA 4W89A 3SUVA 3GH4A 1ECEA 1D7FA 3SCVA 1QI2A 3WENA 5E70A 1TZ7A 1XC6A 2CPUA 4QLJA 3WMBA 5CPQA 4AYSA 3OLIA 1VJSA 3PZ9A 4BF7A 5HNNA 4UOZA 3WKZA 3M07A 1G1YA 4M80A 3QHNA 2V3GA 5ABFB 3CO4A 3DHPA 2BV9A 1E73M 1JZ6A 3RIKA 3VGHA 5A1AA 2NW0A 2AAAA 4GQRA 4AD3A 3SCSA 1E6RA 3WEOA 4AISA 2ZXBA 3HU7A 1QW8A 3AJ7A 4GO8A 4E4PA 1GQJA 4JZ5A 4KMQA 3WD0A 1OINA 5C71A 1QI5A 4P8XA 1GPFA 3O6AA 2GK1A 3N1AA 3MS8A 3UETA 4M81A 1RP9A 3ZJ8A 1IZKA 2Y8KA 1E6XM 3DYMA 5TD4A 2XGBA 2X09A 1EDQA 1R7OA 2XTKA 1B3WA 2BVYA 4PMXA 4FK9A 1H5VA 1Q6DA 4C7FA 5A2AA 2J7HA 1UD4A 3QHOA 2DSZA 4QDMA 2WB5A 3L4YA 1W91A 1V3KA 4U2YA 2VCCA 3THDA 1JFXA 3N15A 1X6LA 4EK7A 2J77A 3VGFA 1VFUA 2WZHA 1FHDA 4D6JA 3BAWA 3AS2A 4XB3A 3SCWA 1H49A 4LPCA 1EHNA 2YBTA 3WNNA 1RH9A 2O9OA 3WN6A 5I6SA 4AW7A 4D71A 2XVKA 1PIGA 2VTFA 2PWHA 5I5RA 1M01A 1HL8A 3B8SA 1XSJA 2QMJA 3LPPA 3T2QA 3VDHA 1TG7A 4W8AA 3VGDA 6TAAA 3N11A 4BQ5A 2GDVA 1OD0A 1E6SM 4Z2KA 3ZOAA 3VVGA 1QHZA 4NSBA 1V0LA 2D1ZA 2Y24A 5A8QA 1NWRA 4Z2LA 1DWGM 1E0VA 1JD7A 2ZE0A 2O92A 1O6IA 1E3XA 2YA2A 2WK2A 5JBDA 3GBEA 5BXSA 1XGZA 1WKYA 2Y8VA 1BVZA 1K9DA 5JUVA 1BSIA 1LL4A 1NARA 4CD6A 4RL3A 1E4NA 5A2BA 1H0IA 3VTRA 1UR0A 4ATWA 1QW9A 1NOUA 1KR1A 2ZXQA 2XIBA 2XPKA 4OBRA 1CYGA 4UFLA 3N17A 3CH9A 1MQRA 3GH5A 2YL6A 5D9NA 5A3HA 3CUJA 1UR1A 3HJEA 2YL5A 3T0AA 3S6TA 1B3VA 2E9BA 2YA1A 4D6HA 3ARTA 1J10A 1ZS2A 4W93A 3G6MA 3VIPA 2O9TA 1DEDA 3TTYA 1H0GA 5IHRA 2DIJA 1GHRA 3FNDA 8A3HA 5HBFA 3UG5A 2J8FA 3TTQA 1CGYA 4PMQA 3OGRA 1C7TA 3B9EA 5A6JA 1KWGA 1CLXA 4UR9A 3VPLA 3M6DA 3UR7A 3UR8A 1HJVA 3UEQA 4JL2A 1XH1A 3NDZA 2D2OA 6A3HA 4CU8A 4HMCA 3AS3A 3OA5A 1HIZA 2JF6A 1GORA 3NIYA 2VCBA 4FLSA 1Y7VA 2WZIA 1JFHA 1MQQA 5ABEA 1H4PA 3ZSSA 2VI0A 2VZSA 1GW1A 4NRRA 3OIHA 1KGUA 3LMYA 1VFFA 3WBEA 1JYVA 4U31A 2VZOA 3WH7A 5CSUA 3NDYA 1VAHA 1BG9A 4WLCA 2FGZA 1GJUA 2E40A 4B9ZA 3AROA 2JF7A 2RGLA 1JZ8A 3MMUA 1GVYA 2D3LA 2W4XA 3VDAA 3WDQA 3PTKA 3BAYA 2ZUTA 5D4YA 1V6WA 4UQ9A 4XZWA 4UZSA 4J27A 3K8KA 5I23A 4TVCA 3FXYA 1E56A 2YDQA 4CD7A 2Z1SA 4ZFMA 4D1IA 1UD2A 2NT1A 2BVTA 3DYPA 4PMVA 4MADA 4B3LA 4AWEA 2W91A 2HVMA 5E09A 3WQWA 4PCSA 5FL1A 2CBUA 3WF0A 4PUDA 1ZL1A 1WDQA 2OLHA 3OZOA 3AZTA 4JFWA 4QLLA 3RO8A 1C92A 3AXIA 3CUIA 4MNMA 2X2YA 4MB5A 4BZYA 2DT2A 1QNRA 2CETA 3PZTA 1KQYA 2XSAA 2ZUVA 3II1A 1KR0A 3AXHA 5BRQA 1QNQA 5HOSA 1XV8A 4F8XA 1D2KA 4UFMA 2VX5A 1UD3A 2WVVA 1CZ1A 4J3VA 2J62A 1K9TA 5FL0A 1EA9C 1ISWA 5LYRA 1PPIA 1E4MM 1ZU8A 2D22A 2EPOA 1HJWA 1TR1A 3U57A 3AICA 2WVUA 1FFRA 1H1NA 5IFTA 4KGJA 3GM8A 4WJXA 1JYNA 2GJXA 4MDOA 4KH2A 3BMWA 3PZMA 4J3UA 2WXDM 2VRQA 2WWDA 1JYXA 2RGMA 3RM8A 1W2VA 1MFVA 1CXLA 2ZX6A 3G6LA 4QLKA 3D5HA 3WF3A 3WNMA 3MV01 4CGTA 2TAAA 1UUQA 4MTVA 3SCTA 1GVIA 2V3DA 2E4TA 2D0GA 5E6ZA 2VZUA 2WCAA 2EPMX 3WQ5A 1JXJA 4PTWA 3KE0A 1ISVA 3GDBA 4RE4A 3VD9A 2ZX9A 3CGTA 1UWRA 3CPUA 4N0RA 3RM9A 1HP4A 1PIFA 1LJYA 4HP5A 1EGZA 2EPNA 1UR9A 1HP5A 2DIEA 3WNKA 1Q6EA 1ZBVA 2CHOA 3AHZA 1TA3B 1C3FA 4E8CA 3WH5A 4X0NA 4H2CA 3GYCA 2CHNA 4U2ZA 4HZ6A 5BRPA 1C8YA 1V03A 2CKSA 4Q7NA 1SYTA 1JZ4A 3WEMA 1JZ5A 1MVYA 4AZHA 4BQ4A 4WSJA 1KGXA 1W2PA 2BXYA 1QBBA 4PMNA 3L4WA 3B9AA 2WHKA 1OD8A 4GXPA 1ZB5A 2BHUA 3ARZA 1JXKA 3VUPA 2V38A 3L2LA 2J79A 2EBNA 2F61A 1CGTA 3I3DA 3N12A 1CPUA 5CGMA 1J0KA 5A6MA 2GFTA 2OSWA 1UKTA 4NF7A 1MWOA 2VRKA 4PBGA 1H3GA 3EMCA 5E9AA 2J7FA 2JEPA 3SCUA 2QPSA 3U5UA 1BYBA 4YHGA 3S2CA 4MAVA 3WQVA 3WD3A 1JYWA 2V5CA 3ZIZA 3VIIA 4ZXLA 2C8NA 4DWSD 4S3JA 3CMJA 1WNOA 3SUTA 2EPKX 4GZIA 3EYPA 1VEPA 5A95A 1HKJA 1IT0A 4JIEA 3GXDA 4H8VA 2QHAA 3CZ8A 3OBAA 3VIFA 4AXNA 4XV0A 4JFTA 1J0ZA 4HOWA 1E6ZA 1JNEA 4GIAA 3ARQA 3MMDA 5A6LA 2GUYA 4JFSA 2WCGA 3WD2A 4AZ7A 3CLWA 5IHSA 1XSIA 3NYDA 3QHMA 1PEZA 4LQ1A 5GNXA 3PZQA 4NZCA 5C8BB 3AMLA 1F4HA 1CXKA 1WO2A 2G3JA 2DQXA 4CUCA 1E71M 1XCWA 1IV8A 1UH3A 2FHCA 2ZOXA 5FOOA 3GXFA 3AMDA 4MNLA 3EBVA 7A3HA 1KQZA 2XSBA 1YQ2A 4PMRA 2ZXAA 1CGXA 5BXRA 3I3BA 3CMGA 5LA2A 1UD5A 1M03A 8CGTA 3UESA 4X9YA 2DDXA 2ZUNA 1UWTA 4QAWA 2MANA 4ML4A 7TAAA 1TUXA 1B3XA 1VENA 2BVDA 3VO0A 2FHBA 1TE1A 4UOJA 2VR5A 1VFMA 1B9ZA 2VR4A 1MFUA 3MU7A 2ZICA 4W85A 2CYGA 4CN4A 1G0CA 2G4FA 4DM2A 3CHEA 3KEHA 3VDBA 3BAJA 4ATDA 2JIEA 4WIWA 3PBGA 4AEFA 1W1VA 4W86A 5BROA 3ALFA 3WUGA 1UKSA 1E6NA 2G8ZA 5EMYA 3VX0A 1WZMA 5CXPA 2PI6A 1OCQA 3W27A 3K8MA 3WMSA 3D3AA 2WHLA 2WCSA 5M03A 4UQCA 3PZGA 1CWYA 4MNKA 3WFLA 1JI2A 3I3EA 3SCOA 3F5JA 3WSUA 3JUGA 4H41A 4AY1A 3SCPA 2WNWA 4F66A 1I1WA 3AMCA 4PSPA 5AYIA 1XSKA 5IDIA 2PC8A 1FFQA 3WEZA 3VD4A 4HA1A 2OYLA 3F5KA 4GINA 3W25A 1BFNA 2PBOA 1XYFA 5BYWA 4Z2GA 1QHPA 4Z2IA 2YDRA 4PTVA 4QFUA 2A3HA 4CCDA 1QI4A 2J74A 3BAIA 1QPKA 3WNOA 2YIHA 1J11A 4PN2A 2D0FA 4U3CA 5D8WA 1B0IA 4FLQA 2D24A 4H04A 4PYSA 1V6XA 2CESA 1J18A 3TA9A 1Q6GA 1MW2A 4B16A 4Q22A 2VT0A 1V02E 5LA0A 1WZKA 3ARYA 5JBFA 1OT1A 1KGWA 3ZO9A 2XM2A 2NT0A 1SMAA 4B9YA 3RDKA 4UOQA 3AISA 4AZGA 1KFWA 4MB3A 1XCXA 1BF2A 2WMFA 3VIHA 2VNCA 2WPGA 3WH8A 5ECUA 1V3HA 1SFSA 2OYMA 3ZSTA 3EDDA 3U7BA 4MPKA 4EE9A 1TFVA 1HJSA 4HZ8A 4UQDA 5EB8A 1OIMA 5DFAA 4UQEA 1KB3A 2CXGA 3B9DA 1K6AA 4J7RA 1BGGA 3RMEA 1N82A 3CZKA 5AYBA 1M53A 2VVSA 1JZ2A 3VKKA 1UR8A 4HTYA 3RPMA 3OG2A 2QV4A 3AMGA 2WKGA 3U7VA 1B2YA 5FCZA 1WZAA 2DSWA 2PWEA 1QVBA 2FH6A 2G41A 1JDDA 1GOKA 1U33A 1PZ3A 2VUYA 2Y4SA 3A3HA 3ARSA 1OWQA 4CU7A 5A6BA 3O9NA 1J0HA 1TCMA 1BGAA 1E9LA 4AIOA 1UHVA 1ZJAA 4GPNA 5CJ5A 2EO7A 2CNCA 1MXGA 2VRJA 2VO5A 2WC3A 3KL0A 4DWSA 1ZBKA 2J7DA 1H09A 5BXTA 2FHFA 4D6GA 3BH4A 4CU6A 2W66A 3UERA 2XHYA 4AEEA 4P7RA 4W84A 4W88A 3VIGA 5I24A 3WBAA 3AS0A 3FAWA 1VEMA 2WKLA 4B15A 1UQZA 4GQQA 4D1JA 4CD8A 1E0XA 5BWFA 1E15A 1O7AA 1W3LA 4R27A 2DPEA 3DYOA 1DWIM 3FW6A 1TVNA 2GDUA 4UNIA 5EBAA 3CHCA 2OSXA 1X6NA 4H7VA 1WDPA 1HKIA 3WY1A 4LX4A 4R5EA 1NOWA 2VQTA 4CD4A 2W92A 4PRWA 3VOCA 2YLAA 5DO8A 4DM1A 1MW1A 1ODUA 3WELA 1HJQA 1J0IA 1FH8A 1FA2A 3CIVA 5A8PA 3L4ZA 5BCAA 4AMCA 1W1PA 1DP0A 1UKOA 3AZRA 3K8LA 5FIPA 4FLOA 3TTOA 1ISYA 4QCEA 1UR2A 3W24A 4U5KA 1OSEA 3BLKA 1MXDA 2EJ1A 4P7NA 1G9HA 4OKDA 1TMQA 2WANA 2WHMA 1HJUA 2W62A 2ZIDA 2QF8A 5EFDA 3M7SA 3PN8A 5E0CA 5A8MA 2UWFA 4Y7EA 4GZEA 3NSMA 1CIUA 3EDJA 3OGVA 1JAKA 2YL9A 1HXJA 1GZJA 1V08A 4JHZA 2ZUSA 4GI9A 2VOTA 1CGVA 1EO5A 3K46A 3T0DA 1W1YA 2A3AA 2ESCA 3BSHA 1BYDA 1MW3A 4U3AA 3BLPX 2Z1KA 2YDSA 3MSGA 1R86A 1LF1A 2FDMA 1UD8A 4P7OA 1OGSA 4XUYA 2QLYA 3T08A 4Z2JA 3VNZA 1OBAA 5A6SA 3W29A 3A4XA 3EDKA 3CZLA 1G01A 1EH9A 5I2UA 4A4AA 1QI3A 3RJYA 3THCA 2DT1A 2PB1A 2A3BA 3BMVA 5JBEA 4GI8A 5A2CA 4HA3A 2WAGA 3ALGA 2GVYA 4LXFA 3CZJA 3MUY1 4CN6A 4AZ6A 3WF1A 4HMEA 4GO9A 4J3TA 3WDHA 4NI3A 3CUHA 2J78A 4UFJA 2E0PA 2F8QA 1B1YA 1QI0A 2VVNA 4MNJA 1V6UA 4HMDA 3BC9A 4JKMA 3POHA 2J47A 4PMUA 4TTGA 2WMIB 4OOZA 1W9XA 2XG9A 2PF0A 3BCFA 3UG4A 1J0JA 1R8LA 1J9YA 2VZVA 4WF7A 2W61A 2O9PA 2O9RA 2BFGA 5I0DA 1B31A 3PTQA 4HA4A 2E9LA 4D6DA 3WNLA 3CZGA 3A6OA 1AMYA 2ZWYA 3W6LA 4HPGA 4TOQA 2VMFA 2J8GA 1UR4A 1XH0A 1M7XA 3IJ9A 1GOMA 4ACYA 3MKKA 1EHAA 2X05A 4C7GA 1GOOA 1DWJM 1RPKA 1CXFA 1VF8A 3NCOA 2VX4A 3ARUA 2VX6A 1VRXA 4OUEA 2XYLA 1ZBCA 1AQHA 5FD0A 1GOWA 2UY5A 4IM4A 2WW5A 3AIEA 3LPGA 1V0MA 1BYCA 1XYZA 2XFRA 3WL1A 4AD2A 1KCLA 1VFOA 2UY3A 1V0NA 2WVSA 1CEOA 1NWUA 2WYSA 2XJ7A 4HZ7A 3MSDA 3BAXA 2VL4A 2CBIA 4H8HA 4NRSA 3BGAA 1US2A 2D23A 1HJXA 4P8UA 1W32A 1XRVA 5CGTA 2VJXA 3N04A 2V3EA 1HNYA 3T2OA 4EANA 2X8RA 1JF5A 3APGA 3VIJA 1E6PA 3FHAA 4L4PA 3N13A 4WKHA 4UTFA 2E8YA 3EMZA 1C91A 2CERA 2X0YA 3ECQA 1WE5A 2EQDA 1I75A 3A4WA 3PZOA 1HN1A 4AD5A 4JL1A 2DGAA 4AZCB 1ISZA 2ZUMA 1V3JA 2F2HA 3AMKA 1JZ7A 1EXPA 3NSXA 2WMKA 1W3HA 1U2YA 1JGIA 3AIUA 5DMYA 5GPRA 4LYRA 5D9OA 4WKFA 3VILA 1Z32X 1M04A 3WDRA 2VC9A 1GONA 4M29A 1XH2A 1ZBWA 4AZIA 4B3KA 4XZBA 1BYAA 3W26A 2WMHA 3WH6A 3ZQ9A 1LQ0A 4RE2A 4C7DA 2GJRA 2OWWA 3PZVA 1UWSA 3ZT5A 2CEQA 1NQ6A 3GXMA 2E8ZA 4PTMA 1NWSA 1US3A 2DT3A 4FF5A 1JZ3A 5A8OA 4WK9A 3VNYA 1CDGA 3VM7A 3ZJ7A 3CUGA 1JIBA 1J0YA 5A94A 5C70A 3TONA 1Q6FA 2YKKA 2A3EA 1JF6A 4BA0A 3OLEA 1HX0A 5A6KA 1V3LA 5DT7A 6CGTA 1JG9A 1W1TA 3AZSA 3BSGA 4CD5A 5CLWA 4W8BA 5D9PA 5GNZA 1B3YA 1B90A 2YL8A 3IAQA 1YHTA 1GJWA 5CPTA 5M3WA 2BHYA 1BQCA 4TTUA 5CQ1A 1K9FA 3EMQA 2YA0A 1QOXA 3MUZ1 2GJPA 4GI6A 3MMWA 3W4RA 3VMPA 4M8UA 5A6BD 4A3HA 1DWFM 4D6EA 1E3ZA 1HF6A 4JHOA 2BXZA 1I1XA 1Q4NX 1BVNP 2WC7A 3W0KA 1OT2A 4M1RA 1H11A 3J7HA 3MO4A 2ZXDA 1C8QA 2WC4A 2IXUA 5BXPA 3KL3A 4PSRA 3WF2A 1CNVA 1JD9A 3CUFA 4JKKA 3U5YA 1PAMA 1GHSA 2WLYA 4A3YA 1JDAA 1WDRA 3VD5A 1QNOA 2VQUA 3WUEA 5ABHA 3WF4A 5D9MA 2J25A 2OWXA 1R7AA 3WNPA 1UOKA 3L4UA 2XFYA 1U30A 1B3ZA 4ZEPA 1FP9A 2CKRA 4DUWA 1LWHA 3IAPA 2X1IA 4P7LA 1E0WA 2G3NA 4DWSC 4HU8A 3F4VA 3FY1A 4YPJA 3VIOA 1V3MA 4J28A 4HOZA 2HISA 5I3DA
chains in the Genus database with same CATH superfamily
3G1SA 4XSMA 1LOSA 1OFOA 1A3HA 2NQHA 3HBLA 3RJXA 3DG7A 4V2XA 3A4AA 3UW6A 3PANA 1RD6A 2A3LA 2OO0A 4PMZA 4TMBA 3HM7A 2PDBA 4XZIA 3TC3A 4LSBA 5FJRA 4ZXOA 4GACA 2DZSA 4AB4A 4WOQA 1TE6A 4NU7A 2DT0A 1EOMA 4RJEA 2CZDA 3HA1A 3WYZA 3C52A 2FZ9A 2XN1A 3UZWA 4BK9A 1KXTA 2O55A 4XK2A 4DJEA 5HWJA 2A3CA 2UY2A 2FVLA 2KAUC 3BLLA 4UTWC 2FTPA 1GCYA 1VIWA 2C16A 3NXLA 5HDRA 1EIBA 1TSIA 4XAPA 3WLRA 3CEUA 3TUUA 3BO9A 5FACA 5K9DA 1N8IA 1QNSA 1DE6A 5G1MA 2NXIA 4LS2A 3WZ0E 3UZZA 1A0CA 1E55A 2YR1A 1DQXA 2Y7EA 2C18A 4N6EA 4ZOBA 2F6UA 1I2NA 1XLHA 2HS8A 1SUXA 2BZNA 1YNPA 4CNSA 3B8VA 3LPFA 4NAEA 3RM4A 3ZS4A 1I8JA 3A3WA 1IEIA 3JW7A 1Z8AA 4FLRA 2Z26A 2JGQA 2AMGA 4A21A 2JALA 1NQKA 2QJIA 5LXEA 4EAMA 5FF3A 1EX1A 3IV8A 1WZLA 1EYEA 2Y5JA 1V6YA 3FSUA 5A6TC 1R2RA 3G1XA 1W5OA 4US6A 5H2ZA 2OQHA 3V1PA 3LHVA 3UPWA 3U0HA 2D3NA 1UKQA 4UXDA 1NU5A 4W5UA 2VXNA 3CT2A 3LTPA 4H83A 1WYIA 1B4EA 2OELA 5FJJA 4I7WA 1N2VA 4UZUA 1WDWA 1EC7A 2G3MA 1AL8A 1UWQA 1KFCA 4OHQA 4BQ2A 4GGBA 3SSJA 3QEZA 5AHEA 3UJEA 3UGVA 3ZT7A 3LPOA 1UWIA 2YCLB 3EA1A 2VEMA 1VCFA 3AIRA 1LOQA 2AKZA 1E5JA 3W81A 1QMLA 3UWWA 1KM0A 2E3ZA 2FH8A 3IGSA 3QPZA 5IFPA 3E38A 4YCOA 1R9XA 3LSCA 2CWXA 3VU2A 1W8GA 4ERIA 4LCQA 3TQ0A 1I0DA 3CQKA 1A5AA 3A9BA 3VKBA 4NZ1A 3IANA 5DRCA 3MUIA 3QM3A 4D6CA 3K1DA 4JTEA 3H24A 1E6QM 2V5DA 3UJSA 5DXXA 4KGLA 3AYVA 5FF2A 4GJJA 3V7PA 1LYXA 2D0HA 3SCQA 3I7SA 1G94A 1V3IA 5E0FA 1V02A 4FNTA 5I78A 2O7QA 3MZNA 1CLVA 2FDSA 2F2KA 5LNRA 4IPLA 2BY1A 4JFUA 4MY1A 1V7AA 2HVOA 1P6WA 4LBSA 5E6YA 1RY0A 1SO6A 3SDOA 3EX6A 3NUKA 3AHVA 2BY3A 4FMVA 1VLWA 4CCEA 4X0VA 4NY2A 2XN2A 1SO4A 3OU8A 1YE6A 3TOYA 3GNXA 4K7YA 3RX3A 4N42A 2W63A 2WZMA 4ZE5A 1OF8A 3UPMA 3ZR6A 3SCNA 3VGGA 1QR7A 3FHQA 4V28A 4F9JA 5CCZA 1VBRA 6XIAA 1Z89A 4U10A 3LD5A 4NNBA 1YTDA 4GYJA 2GSJA 2C71A 5IXEA 3T4WA 1FHLA 3LLXA 4DXKA 4IISA 1IEVA 2YOCA 4MIMA 4FALA 3CQJA 1B4KA 5DQPA 1UASA 5BU6A 2WJDA 1JVNA 4F4RA 2E9MA 2DH2A 3W7NA 2AGTA 2NUWA 1LL6A 3UVAA 4IFKA 3T6CA 1H41A 1ZTVA 1LWJA 4QSFA 1L6SA 3ZM8A 2HTMA 4ASTA 4AZBA 1PYMA 1PX3A 1AH0A 4DX3A 3AYSA 4ZB5A 2XM1A 4H9MA 4B5VA 1TVPA 3NNTA 3UA3A 1DE5A 2ZZ2A 3CMFA 3GXIA 3WDPP 4NZ4A 3S5ZA 4CEUC 4CQ8A 4J3XA 2BTMA 2VGIA 1V6TA 4I6VA 3TU9A 1K7FA 3UWYA 4TQTA 2QUVA 1ZUAX 3A4JA 3CAVA 4PUJA 3EA3A 2PA6A 3MCNA 4B5UA 5TNVA 3QTPA 4JQAA 1RQHA 3T09A 3CPRA 3C0QA 1XLCA 2PU0A 3MUAA 3ARRA 3V1HA 1LLZA 3SFKA 1TWSA 3VD7A 1DYSA 3N34A 4LY8A 1EKOA 3MDWA 3HTWA 1E51A 5A8NA 3CUXA 1FDZA 4DO6A 3LLDA 4TMCA 2E6FA 1EOKA 3U6WA 2EG7A 1F2JA 2P3EA 2WBGA 1NDWA 3VDCA 4LNYA 1VCGA 4RV8A 3G1HA 5H6HA 2AL1A 3K1GA 2BNJA 4B5SA 3AIVA 1R3VA 2Y2WA 3FJ6A 2Z2BA 2BS9A 1DXFA 5M2FX 4NX0A 2CITA 1EJUC 3PPGA 3A12A 1OZMA 2DZXA 4KEVA 4WGHA 1NTHA 4JQ4A 1IIGA 5JXQA 1GQLA 3LHTA 2R1MA 3PWIA 3EX3A 3TOPA 3A64A 1ZQ5A 1WDSA 2D2JA 4MJ2A 4UFHA 3UJRA 4XVDA 4XTDA 3DCPA 3VNMA 3GG0A 1GEQA 1S3HA 1S38A 2HE8A 1QPNA 1W54A 4P8WA 1K4HA 5M5DA 4B5NA 2Z2AA 3EB4A 2JEQA 5DT5A 3S5OA 3IARA 3TXZA 2DUAA 4JCMA 3CZEA 3LHUA 4DPPA 3K4WA 1E5NA 1EJTC 4L4MA 4DWSB 3AYRA 3FN9A 3P93A 3MP4A 1TJ0A 1UZ4A 3AOFA 3T8QA 4U33A 2PDYA 4XX6A 1XRTA 3PSVA 4GE8A 4HHMA 4O4WA 3EOOA 4EXQA 1E72M 5HPOA 4DUVA 4U5IA 3V3WA 2YXXA 4AD1A 3NURA 4RR4A 4UNLA 5HXMA 1KXHA 1GOIA 4UTIA 1X1ZA 1AW2A 4QITA 1GYNA 3AHYA 2FVMA 1HL2A 5BOOA 4RZBA 2PWFA 3WFZA 2ZA1A 2H3BA 4AWSA 3L4XA 2IXVA 4GY0A 2QCNA 5TQLA 5C2GA 4GY7A 1BG4A 5HMEA 4IMEA 5KZ6A 4KCWA 4MAZA 4DO5A 1CXHA 4O0QA 2J7BA 1GPWA 4EKJA 3KZSA 3F5LA 3FAXA 3QLDA 2XVGA 1CXIA 4OBSA 3V0TA 5BOEA 3W2NA 1K9EA 2WZEA 1M9HA 1C90A 5CSSA 4M82A 3UA4A 2OWCA 2VZTA 3NR0A 3E1F1 3PP7A 4JYEA 1H5YA 3STGA 2B31A 1EEPA 3SUVA 3GH4A 1TWDA 3B0UX 1ICPA 3ATYA 3E0IA 1AD1A 1IWBA 1O68A 2CPUA 4AYSA 4WXYA 3BG3A 1WA3A 4J3ZA 2P0IA 4MUZA 3CO4A 4ADUA 1XIGA 4O12A 2OT1A 1E73M 2VC6A 3RIKA 1XQKA 4I9JA 4L6HA 4AD3A 2HBVA 3WEOA 4AISA 3HU7A 3IIOA 3AJ7A 1R9YA 3NQCA 3PWAA 4PA8A 1QI5A 4J9JA 2ZFAA 2DZTA 4PH6A 2GK1A 3N1AA 5HANA 3KCLA 4S3DA 2HRWA 3ZJ8A 5TD4A 1TIMA 4O1FA 2X09A 3GU1A 1EPXA 5TBOA 2XTKA 2BVYA 1Q6DA 4C6PA 1XUZA 4UTKA 4C6IA 1EYWA 1W1B1 1XIEA 2DSZA 4A8LA 3WLQA 1N55A 3ONCA 4Z17A 6REQB 3QKZA 2VR2A 5I3JA 3BV7A 3THDA 1X6LA 3MI2A 4OFCA 1VFUA 3IJLA 4OU1A 2WZHA 4LVFA 3U2EA 3DN5A 4GYPC 1FHDA 4HJFA 2Z25A 3BAWA 3APYA 3GLCA 1DJIA 2A0NA 1IXPA 3LBCA 1DIOA 4LPCA 3EPNA 1OZQA 3M0LA 3BJSA 1Y5XA 2R91A 4CQAA 4UUIA 5EMLA 3DDMA 2NQ9A 2VTFA 4RZ6A 1M01A 1QK2A 1HL8A 1U5VA 3TW9A 3VDHA 4W8AA 3VGDA 4PB3A 5CKSA 4BQ5A 4Y6GA 1TZZA 3N6HA 4NSBA 3CIWA 2Y24A 1Q65A 5LNVA 2Y61A 3KWSA 4AXKA 4Z2LA 1DWGM 1E0VA 5REQB 5JBDA 3GBEA 5BXSA 3R0DA 4DWDA 3HGSA 3RPDA 2G95A 2QYGA 2Q09A 4ILSA 3V75A 4YIWA 2ISFA 1H0IA 2CZEA 1UR0A 4JGDA 2X7WA 1GVOA 1DIEA 3F4WA 2Z4GA 1NDVA 1NOUA 3PBYA 2OGYA 3G3DA 4OBRA 1CYGA 1MQRA 3GH5A 3QW3A 1G4TA 5D9NA 1ONXA 2PDJA 4GZ7A 1KA9F 4JIHA 3FYOA 3G6MA 3OYXA 1VQTA 1BKSA 5CZ0A 3QFEA 2QJMA 3FNDA 5AC6A 5HBFA 1HKWA 1CX9A 3R25A 4GOAA 2ZDRA 3OGRA 1DBTA 2V6AA 5A6JA 1CLXA 5F2LA 2SFPA 4Z42C 2FZ8A 3M6DA 4Q8VA 3UR8A 1VS1A 3UEQA 1XH1A 1AD4A 3WLKX 3L5LA 4CU8A 3AS3A 3TW7A 3S5SA 3NIYA 2VCBA 4FLSA 3C5QA 3M0VA 3NA8A 3GNDA 3PBVA 2ZKMX 4JTUA 3ZSSA 2VI0A 3OIHA 1KGUA 3LMYA 1VFFA 3PULA 3PPHA 3MYOA 3E5PA 5GVJA 2OCZA 1SZFA 3WH7A 2J24A 3I65A 2QIIA 4O8AA 4JN8A 2GUUA 1VAHA 2GL5A 3L68A 1BG9A 3C2YA 4WLCA 1D8WA 1YDNA 2E40A 3P61A 3W85A 5LIWX 1Z48A 1JZ8A 2OTDA 5JMUA 1YBQA 5D38A 1L6WA 2HNHA 1RSCA 1FWHC 3TLQA 1GTEA 4AQLA 1SSDA 3KP1A 4ZO7A 5DLCA 2HK0A 4XZWA 1MEWA 1Q6QA 3W1QA 3ABRA 1REQB 1E56A 4WVXA 4CD7A 3H2NA 1XKYA 2PAJA 1QOQA 1A5MC 1V5XA 1ML1A 4B3LA 4JS3A 5E09A 1EL3A 3L65A 1R3YA 2FLIA 2E1DA 3UZYA 4H9XA 1VJIA 3C2EA 1JDFA 2AQWA 1C92A 2DJLA 1P43A 4MNMA 4HBKA 2DT2A 1QNRA 3MHFA 3UBPC 1KQYA 4JY8A 2XSAA 3F4CA 3AXHA 1QNQA 5E93A 1OY0A 2VX5A 2NQJA 4PUMA 4GBUA 2J62A 1K9TA 1EA9C 2XN0A 3G0SA 4GIEA 3TDFA 4NQ1A 1PPIA 1ZU8A 2EPOA 3NZQA 4LC8A 1HJWA 1TR1A 2CZ5A 3M5YA 1I2QA 4UTLA 3GM8A 2I9UA 4IIDA 4Q4OA 1JYNA 3B4YA 4MDOA 4KH2A 4J3UA 2WXDM 4JYFA 1JYXA 4X61A 1MFVA 1OYBA 2ZX6A 3AALA 3G6LA 5AYZA 4NJKA 1ZHAA 4MLJA 2Z1WA 2TAAA 4NNAA 3AJXA 4MTVA 3KVMA 5E6ZA 4FP1A 1XYAA 3WQ5A 3FJNA 3KE0A 1HUVA 3LQLA 3MDUA 4MYXA 1D9EA 1ZENA 1PUDA 2ZX9A 1UWRA 4XAZA 1DJHA 3CUZA 3S5YA 1UR9A 2CU0A 1ICQA 1Q6EA 2CHOA 4EIVA 3BCJA 3WH5A 4GNKB 4H2CA 3GQYA 4HA0A 3PG9A 1XIJA 2CHNA 5EMKA 1C8YA 3TIMA 4MZ1A 3RPTA 4L6DA 1YDVA 4XZNX 3CL7A 1QBBA 4PMNA 2C91A 2CC0A 4OUIA 1TJRA 4IIFA 3KUMA 5I3IA 3ARZA 1VRDA 2PTWA 3UY7A 3NL5A 3N12A 1TIWA 1O5XA 1CPUA 1J0KA 3VOFA 1I60A 3BK0A 1Q3NA 2VRKA 3EPOA 4PBGA 4Y8FA 1H3GA 1TQXA 3E9AA 2J7FA 1VBHA 4C1NA 2JEPA 3QKEA 3SCUA 4YHGA 1EUNA 2V5CA 5LNWA 3VIIA 2C8NA 4DNHA 3L23A 1MDRA 4JOMA 4S3JA 3SUTA 2EPKX 3LA4A 1KD0A 1XINA 1OFPA 3CZ8A 3OBAA 3VIFA 4Q7IA 3QLLA 4JFTA 1J0ZA 3QYQA 4DO7A 4DIAA 1EP3A 3ARQA 2QT3A 3MMDA 4DUOA 4Q4MA 3NXFA 4L9YA 4EACA 2WCGA 1LCOA 1R3QA 5IHSA 3VNLA 1F9CA 3KM8A 3NYDA 2AKMA 2PDWA 2Y7FA 3PZQA 2H6RA 3LHZA 3FK4A 1WO2A 2G3JA 2DQXA 2O56A 3VYLA 1GVSA 1K7XA 2PRLA 1X96A 4OV9A 1AZ1A 4EXAA 3CTLA 4F3HA 1M7PA 3EBVA 2CLKA 2X1UA 1KQZA 4S3EA 4FZIA 4JQ1A 1YQ2A 3BW3A 2VGBA 4EX4A 5AKQA 3S2JA 3I3BA 3GS6A 3U4AA 1SZRA 4KRZA 1EJRC 4WY0F 1BD0A 5C9RA 4ZQMA 1K1DA 3RCYA 2ZUNA 3UCDA 2E6YA 1XL9A 1B3XA 3C86A 2X2GA 3C0SA 3P5YA 1OABA 1XX1A 3LHWA 1VFMA 4JNZA 3FOKA 2IPFA 1PE1A 1MUCA 2X30A 5EYWA 2CYGA 2IMRA 4DM2A 1SGJA 3NL3A 1GZGA 3QFWA 1JEZA 4IFKB 3VDBA 4EP8C 2VD9A 2JIEA 3OYZA 3ABXA 4AEFA 4S23A 3SQLA 5EMYA 4Q4QA 3VA8A 1K6WA 3DFPA 2PI6A 1OCQA 3WLJA 1KFLA 5LGZA 4UQCA 1VYPX 3N4FA 1A5BA 2TSYA 3I3EA 2ODOA 3F5JA 4WDTA 5G2WA 5G2HA 3T05A 4Y96A 5AVHA 3AMCA 4PSPA 2JQXA 5IDIA 4E2BA 3NM3A 3F5KA 4GINA 4H01A 3W25A 2VGFA 1BSLA 3LRMA 4Z2GA 4US5A 4JNYA 1IR2A 3N2XA 3O15A 4NIRA 5DY3A 3W88A 3JZEA 2PUZA 4CCDA 3E0VA 3VFLA 3BAIA 3WNOA 4Y9PA 3TJXA 3FYPA 5D8WA 1B0IA 4FLQA 2FQIA 1LT7A 2CESA 4H19A 3S0CA 1A49A 4Z1YA 2WSRA 3IIVA 3SW6A 4Q22A 1RLCL 2EG6A 5LA0A 1WZKA 5JBFA 4C6KA 3JS3A 4B9YA 3DAQA 3TYZA 4O15A 2VNCA 3KBSA 3WH8A 2P5NA 4JHMA 1SFSA 3OVRA 1O95A 2OYMA 4Z1BA 3TJIA 3R94A 2XINA 1TFVA 1HJSA 4HCHA 4UQDA 3PJTA 5EB8A 4DB7A 4DBUA 2CXGA 5DMLA 2E28A 3SECA 1N82A 4JYDA 2V81A 2EGZA 4HTYA 3AMGA 3DG6A 4L56A 4Q6XA 3T7VA 4V15A 3SBFA 4MF4A 4XZMX 1QDSA 1OWQA 1PKMA 3AU6A 2V68A 1UJQA 1IIHA 1TCMA 3G24A 4ADTA 4DWSA 4PZVA 2NXHA 4Q4SA 4HN4A 4PULA 4KW2A 5ECVA 1Q6OA 3IJQA 3BH4A 1QWKA 4WUIA 2PDCA 2Y6ZA 1TWIA 3FA3A 5I24A 3AS0A 3URBA 3GXTA 2WKLA 4EPDC 4QQUA 1UQZA 4ZB2A 4MWAA 1W3LA 5D2TA 3INPA 3DYOA 1DWIM 1TVNA 3FW6A 3CHCA 3WY1A 1IT7A 4LX4A 2P10A 4ICNA 4FR1A 1TRIA 1Y5VA 4NJHA 3D0CA 1J79A 2HWGA 1ODUA 1J0IA 5K4ZA 3NPXA 4QQ3A 3L4ZA 3KCJA 3TR2A 1W1PA 1DP0A 4K8GA 4GLEA 3AZRA 3K8LA 5HMFA 5FIPA 3E96A 4FLOA 4QCEA 3TQPA 3W24A 1L6GA 2J8TA 2X42A 2EJ1A 4LUSA 2WO5A 3GR8A 4OKDA 3I7QA 3F03K 3PN8A 5E0CA 1TCDA 4Y7EA 3NSMA 5K9CA 1Z7AA 2C6QA 3ITOA 2PFHA 2ZUSA 2E09A 3N2TA 3RLUA 4GNJA 3BSHA 4DJDD 1SFJA 1BYDA 1MW3A 2F6KA 5E0KA 2VFGA 5DELA 1R86A 4HYVA 1LF1A 1UD8A 3BZGA 2DORA 2Y5SA 4XUYA 4OVXA 4Z2JA 3VNZA 3BMXA 2PDXA 4DRSA 2CZVA 2OX1A 2F38A 5H8UA 1EH9A 1MRQA 1QI3A 2XZ7A 3DFYA 2A3BA 2E77A 5A2CA 1QCWA 5KZEA 3P62A 2GZXA 4TO8A 4BJHA 3HB9A 3NQMA 1VHNA 4CN6A 3WF1A 1BWVA 4GO9A 4UWMA 1F61A 4YNGA 1TV3A 2YX0A 4MNJA 1T6MA 3BC9A 2Z6JA 3GSMA 3BCFA 1Z42A 4QJ4B 3SRFA 4CNPA 1M3UA 5I0DA 3RGTA 1B31A 4JTTA 3WQGA 4DELA 2E9LA 3B8DA 3A6OA 1Q6RA 1AMYA 3HJZA 3W6LA 3LTSA 2ACSA 4TOQA 1KNWA 2VM8A 5HR6A 1TX0A 3BANA 3CC1A 3LEPA 3R79A 3IJ9A 1GOMA 3MKKA 4C7GA 3EX2A 1RJRA 1PTDA 1DWJM 1RPKA 2GJLA 4J1OA 2VX4A 1YMYA 4ORIA 8XIAA 2VX6A 4LBUA 5AYYA 3R12A 1FWCC 3QH2A 1ZBCA 3B03A 2ZZ7A 1BYCA 1O66A 3S1WA 1K8CA 3DX5A 3U3HA 4AD2A 2UY3A 4XD4A 3PBMA 1K3UA 3PPCA 1IGSA 4B2DA 5A5WA 3V5CA 2PCEA 4NRSA 1VD6A 2YCKX 1HJXA 2VJXA 2V3EA 2PWUA 3NGJA 1GVQA 1E6PA 3EWUA 3BTNA 1F05A 3C61A 4GUJA 4L64A 3PZOA 2H9AB 1T5AA 3BGGA 1ISZA 3HQNA 1V3JA 3NQEA 4XO7A 4WDXA 1U2YA 4F0LA 4MGGA 5BMXA 4LTSA 3AIUA 3BWWA 2F84A 4FX8A 5DMYA 3N29A 2QCDA 4WKFA 1WBHA 3NZ1A 1R47A 3UY8A 2UZ9A 4IHCA 1M04A 3WDRA 2VC9A 3MT1A 1GGOA 1QASA 1SPQA 4JR5A 3WH6A 2OJPA 1LQ0A 1UWSA 1GVEA 1LRQA 1X38A 4ZR8A 4M51A 3PFMA 2XH7A 3V0SA 5A8OA 3VNYA 1E0UA 4NXKA 1JIBA 1Y0EA 2B81A 3IVTA 1ZAHA 3MBFA 1U22A 4NNCA 3W22A 3UWQA 4QE1A 3YPIA 1HX0A 3W7MA 6CGTA 5DT7A 2A5HA 4WDUA 2NUYA 4GC3A 4Z1AA 1B3YA 1B90A 2NWSA 2C1GA 4TV5A 2Z1XA 5CPTA 5M3WA 1WV2A 4Q8NA 2BHYA 2V2CA 5I00A 2VYOA 2X16A 3CAQA 4FI4A 2ASHA 5A6BD 4M6UA 1TTPA 4CLMA 4UMCA 3C3NA 2IQTA 3H8AA 3J7HA 1EBGA 3MO4A 1LQAA 3UXDA 4GYPA 3NVDA 4MMWA 1OEPA 1FVPA 3BURA 1PAMA 1FWIC 2I56A 3DXIA 2VFEA 5HR7A 3H4XA 5F4SA 1SO5A 2CFFA 2VQUA 1TV2A 3G77A 2L5HA 3P81A 1JCNA 3UWVA 1UOKA 2JBMA 4LALA 2CKRA 4DUWA 1LWHA 3KTXA 4S2BA 3IGHX 2G3NA 3FY1A 4OWGA 1V3MA 1XLKA 2KZHA 1AJ2A 3NO5A 4Y90A 3BAKA 3CB3A 3DKJA 4IXXA 1KXQA 4W7VA 2PWGA 1NFBA 1REQA 4PEEA 3L4VA 1W0MA 5CSYA 3MCMA 1C93A 1S5WA 4HSHA 5HINA 5HQLA 4ATLA 2PDHA 4G7EB 3UR5A 3WDJA 3IJ7A 4Q3MA 1ZJIA 2QCDB 3LB0A 4EVZA 2E5BA 3QGVA 4HNCA 2GVLA 1SFLA 1PZ2A 2VURA 3H54A 4JX5A 2DVTA 4HHHA 1A50A 5CBIA 1YX1A 3VMOA 2JIWA 3T0BA 3GHSA 1WXZA 2DFAA 1GG0A 2Y88A 3ARPA 4DF0A 4PB4A 3HIJA 2DH3A 1HQTA 4AD4A 3W1AA 4Y9AA 4EPKA 2QR6A 5JVLA 4JTAA 2XWDA 2FMNA 1H7WA 4A3QA 4AAJA 1DWAM 4Q8QA 2QGYA 2WMGA 4RNIA 3TVAA 3OHMB 4PBFA 3SFWA 2W9MA 3GTIA 2W67A 2C15A 1M1BA 3OVQA 1BPLB 1TPEA 3VMNA 2QCFA 2WV8A 5JIWA 3GTNA 3AHXA 1YBQB 2ATMA 4X60A 1OX4B 1ZCCA 3EB3A 1RCXB 3VINA 5DF0A 1P0EA 1X1NA 1R46A 2YYTA 1UG6A 2R94A 1W1ZA 5DEZA 4LWWA 1EP2A 3IIPA 1M5WA 1OFQA 3IUIA 1S5NA 3EEGA 3WUBA 3DECA 3TTSA 1JUKA 4L7ZA 1L8NA 4AEOA 3MP5A 3HPZA 1IT8A 1R3SA 2DEPA 3UJ2A 4Q8TA 1Z41A 4ACZB 3DFOA 4JIPA 3MZ2A 1KBKA 1ADDA 5CEWA 3VX1A 4DZAA 4F48A 1OIFA 2PBGA 4J3WA 2ZVRA 2B7OA 4AD0A 1JR1A 4TX8A 3O6DA 3DU0A 9RUBA 2GQ9A 3AFBA 1R87A 1TTIA 5MF5A 3G1VA 2G4JA 1XFBA 5BWAA 1H63A 4AIBA 4PUEA 3K4AA 4IL2A 4M19A 4JTHA 4YHEA 3RILA 4DF1A 3VNIA 1JRBA 1DTNA 5U7SA 1WKFA 4GXMA 1DXEA 3ARVA 2CLPA 4IJCA 2G37A 3W87A 3UWZA 1ZSXA 3U8GA 3HURA 3M43A 1HT6A 2OYKA 3CQIA 5CGQA 3AHTA 1KM2A 1LLOA 4C5YA 1FH9A 3F2BA 3P84A 3WIJA 1MRAA 2VDHA 4IX0A 1AVAA 1D3CA 1YPIA 4GIRA 2PF8A 4JAWA 3NM1A 1B30A 3PTMA 3S2NA 1AK5A 1FWGC 2NLIA 2WVVB 3NZPA 4JD4A 3FLUA 1GT8A 1AQ0A 3E6EA 3G0UA 4XBSA 5H8PA 4C6NA 1DXIA 2DSVA 2VEIA 2ONEA 3E0LA 4GVFA 4ZVJA 2HJPA 5KMYA 3W7JA 1AJ0A 2ABAA 2BY2A 4MOZA 5HULA 4LVGA 2GK1B 4AZ5A 4ZL1A 2PCQA 1E1EA 2FMOA 4JDBA 3VOIA 3ANUA 3QPEA 1EJSC 4QS5A 4LVBA 3AI0A 5T9CE 4EPEC 1H2JA 5LHFA 3VGBA 2ZUUA 3R10A 3ARXA 1CENA 4MKVA 1BRLB 3VI2A 4M7SA 2QDGA 3ITLA 4GQ0A 2J7GA 4GBDA 3UT0A 2GGHA 4DAIA 2ZUWA 2IKHA 3WK2A 2G5WA 1XBXA 4GX8A 4H9VA 1SO3A 2PLKA 1R2SA 4A8RA 3CV1A 4WJ8A 1V4YA 1A47A 1P0DA 3QSTA 4H2HA 2NVAA 5JH2A 2I57A 2GJXB 3CPGA 3T2PA 3KDNA 2R24A 2ZX5A 4KRTA 2Q02A 3MV11 5AN7A 3TNOA 1GUVA 3G0XA 1G6CA 3THQA 2JFEX 1VBUA 4E8DA 4BF9A 3W76A 5CPOA 1UWUA 3B3DA 2OZ8A 4EF9A 2WM0A 4TX6A 3TN4A 2PDFA 1FCVA 3EDFA 4CVWA 1KKRA 3MO7A 4AG0A 1R5YA 2XUCA 1E4LA 3FXGA 3QY6A 4AVFA 1KXVA 1W5QA 3NQAA 2XVPA 4G7EA 1A5SA 1S2UA 2FTWA 1EDTA 3OLGA 4LAUA 4TUFA 2WSQA 3TYCA 1WOBA 2PTXA 4GYKA 5AY7A 3NL2A 3KXQA 3ARWA 3W28A 4JTKA 5I79A 3OB8A 4OIFA 1KM3A 4I90A 1Z44A 1J6PA 4JPGA 3PFRA 4FNSA 3F4NA 1Q8JA 1ESWA 1G4SA 1ODZA 3BXWA 1DPMA 1QPOA 4MM1A 3E2SA 5CPNA 4LJ3A 3WD1A 2HCVA 5CLTA 1UYQA 4MWAD 4C1NB 3NJ3A 2GSEA 4R9OA 1YDOA 4GJ1A 1FP8A 2W5FA 1LORA 3SGUA 1WB0A 1W9DM 1LL7A 5HJYA 1TMLA 2PD5A 5LGXA 1JDCA 1HL9A 2NX3A 4DLMA 3ABSA 1XICA 3HO8A 4YCPA 1OB0A 5HMSA 2NSOA 2XVLA 3KVKA 3WUFA 3H7VA 3WMCA 2E68A 1VJZA 4HGXA 5D37A 4ES4A 3W72A 3OQ8A 2QJNA 3A5VA 1JPMA 3V0UA 1S2VA 4UQAA 4DZIA 5FEPA 5GNYA 4JX6A 4AIUA 3HF3A 4FSAA 4RPQA 1R85A 4F40A 4QP0A 3ZVIA 1KBBA 4ZE4A 3H7UA 3B8TA 3V35A 1W9VA 1HKVA 2EEXA 4QRNA 5KZDA 3G22A 1RJQA 3NFUA 3GVGA 3ZT6A 3ZWSA 4HSNA 4E3VA 3ZLHA 1NOFA 2XVNA 4QCFA 1AG1O 3WQ8A 1DJXA 4UQBA 4ZGYA 1IQ8A 1XUUA 3BZJA 3RLHA 3PAJA 3OGSA 2ACRA 2Q3RA 3RG6A 1LQ2A 3TQVA 1EDGA 3AWNA 6ENLA 1KTNA 1KWKA 2QIWA 3GTHA 2FZNA 2QPUA 3B8IA 4IL0A 4LC6A 2QMKA 1JNDA 4D9PA 3CAWA 2WWCA 3N9SA 4DI9A 2J27A 2NLYA 3DFQA 4P7QA 3WLHA 3AIBA 3AIQA 3CS2A 5HNTA 3QQ0A 2GLKA 2PRMA 1WKEA 1AW5A 3IJ6A 5CZJA 1TKKA 1CXEA 4UCFA 1CGWA 2Z7KA 1HG3A 3KHDA 4JBRA 1V8EA 4CNNA 2BHZA 4KERA 1OCJA 4GFIA 4H9ZA 1UROA 2NSXA 3MQTA 4ZQPA 4QAIA 1UMLA 4DBSA 5E1QA 3LBMA 3NOYA 3LMZA 3GY1A 3UD6A 3I4KA 1VZWA 1QPRA 2QXWA 1QI2A 3WQEA 1MEHA 5LNUA 5CPQA 3AU2A 2DUXA 4GRSA 3OLIA 4M6VA 2D69A 1G1YA 2PEVA 3LOTA 3Q4DA 5ABFB 1FWSA 3VGHA 4S39A 2NW0A 4AY7A 1V51A 5AVNA 2QJGA 3SCSA 2E1WA 5XINA 2ZXBA 3ENLA 3NQVA 1QW8A 3UPBA 1XDLA 4UNKA 1PIIA 1E9YB 5F1VA 3KHJA 1TJ2A 4KEMA 4P8XA 5LIYX 2X7VA 4FNPA 4Q4PA 5I07A 3HG4A 5HA7A 2Y8KA 1E6XM 1F07A 2XGBA 3UU0A 3LU2A 3UXAA 3TLLA 4WOZA 3AAMA 3DOPA 3ZR4A 1R7OA 2NVCA 4H8NA 5D2XA 4PMXA 2WNNA 4FK9A 3EGJA 4C7FA 5A2AA 1DJZA 5HK4A 2WB5A 3NG3A 2OMAA 4B92A 2VC5A 3D46A 3STEA 1JFXA 3N15A 1YLVA 5K3VA 3VGFA 4C6EA 3M0JA 2RUSA 2C1HA 2ZYFA 3UJFA 2OT0A 4N9EA 1W6TA 2A85A 3H2EA 1FWNA 5I6SA 2HBXA 2XVKA 2VFDA 1PIGA 2ZZ3A 1DKWA 5DRIA 1N8FA 3MVTA 4I9MA 4TU1A 3BW4A 3S5NA 2IQDA 1TG7A 3EXTA 5FF0A 2QCLA 3VVGA 5D02A 1W3TA 1K70A 4NZ5A 1JD7A 2ZE0A 1O6IA 1J96A 1E3XA 2FPTA 2WK2A 3KS5A 3QV7A 1XGZA 2Y8VA 3PC0A 3LM7A 1BSIA 1NARA 4DJDC 3KVJA 4ATWA 3VKCA 2I5GA 4X3ZA 3W00A 2ZXQA 3S46A 3N17A 3KVLA 5EMJA 3T4CA 1J6OA 1RV8A 3GW3A 5A3HA 5LZLA 3KZPA 2QGHA 1EFZA 4LS0A 1R38A 4E38A 3S6TA 2E9BA 2YA1A 3ARTA 3GHTA 4GQGA 4BFAA 4XKYB 3NYZA 1VFHA 3N3MA 2H3DA 4I7VA 4F0RA 4KWVA 5IHRA 4R88A 3S9IA 3TTQA 4H9UA 1U1JA 3B9EA 4ZMGA 4OT7A 4UR9A 3VPLA 1OF6A 3S3GA 2D2OA 1OG6A 1HIZA 2I16A 3O06A 1I2RA 4FIRA 5LIUX 5ABEA 1H4PA 4RNHA 1KRBC 3BLIA 3GDKA 5FJPA 3PM6A 1OC5A 1FWBC 4U31A 2W79A 3TV8A 4HHPA 2X40A 2FVKA 4WY0B 1R3RA 3LUTA 2FGZA 1GJUA 3FVMA 4MZYA 2Y63A 4Q8MA 1QO2A 2JF7A 3AROA 3PNZA 3MMUA 2NXGA 4J5NA 4LB4A 5XIAA 1XISA 2W4XA 4O54A 5LIKX 5ABTA 3CB8A 4QJ5B 1XBZA 3ME3A 4O8RA 3A9IA 4UZSA 2HPIA 3Q65A 3QV9A 4L9XA 3K8KA 5I23A 4TVCA 1G67A 3TKFA 2Z1SA 4ZFMA 2I17A 2BVTA 4ERGA 4AWEA 2W91A 2HVMA 3QZ6A 2J9YA 1V77A 3UWUA 3L9CA 4QG9A 5E5CA 2CBUA 3C8NA 4PUDA 1ZL1A 1WDQA 2ZC1A 3OZOA 3T1GA 3AZTA 4K3ZA 3DGBA 1RXOB 2OB3A 3M1ZA 2X2YA 4MB5A 4DAFA 1JQXA 2ON3A 3PZTA 2ZUVA 2A79A 2PP1A 2DY3A 3QC0A 4BKNA 3PUOA 1ECQA 1PCKA 2DVUA 4RW5A 3QY8A 3LV6A 4QXIA 2WVVA 3WLOA 5FL0A 1PKYA 1TPWA 4O10A 3GNNA 1E4MM 1GWJA 1R3TA 3QR0A 5EKYA 3U57A 3FIGA 4E5TA 1F8MA 2WVUA 3LNMA 1H1NA 2ZTKA 4KGJA 3NTYA 1MXSA 1XDJA 1T0OA 4IICA 3JU2A 2JKPA 4UMBA 2GJXA 3PZMA 2VRQA 2WWDA 1EC8A 2RGMA 4G56A 3WNMA 1TPDA 4L61A 1IR1A 4CNOA 3SCTA 4CQBA 4H3DA 2PP3A 1DV7A 1GVIA 2V3DA 2E4TA 1N7KA 2VZUA 4L9ZA 2WCAA 3UNTA 4PTWA 1UP2A 1ONRA 1ZAJA 3WJZA 3VD9A 1XIDA 1PDZA 4PR4A 3RM9A 3SGZA 2DZPA 2EPNA 4S3BA 4Q33A 2POZA 3IVSA 3WO8A 3WNKA 3PBWA 1TA3B 4FNRA 4IG2A 2VFHA 3EA2A 4M3PA 2W6RA 1V03A 3T8LA 1JZ4A 2YGYA 3WEMA 3GYEA 2QZRA 3SRDA 4LYKA 2WQPA 3H4WA 3BQ5A 3R1ZA 1LOLA 4Q4KA 2HQAA 2Z24A 3NVTA 3S2LA 1JXKA 3VUPA 3L2LA 2EBNA 1TELA 4F0SA 2F61A 4MYAA 1A0EA 3CAKA 3LXBA 3GR7A 2FPVA 3TCEA 4C6OA 4HNTA 1MWOA 2BOGX 4UTMA 2QDDA 4O1EA 2X1TA 3SRHA 1LBFA 2FB3A 2QPSA 2PDKA 3GG7A 3N4EA 1H51A 1ZPTA 2Z1VA 5CJNA 3A13A 3SQSA 4DWSD 1IEQA 5A95A 1HKJA 4JTFA 1A5UA 3CIXA 1EF3A 3RX2A 2IKGA 2QHAA 2I1OA 4JQ2A 4XV0A 3BPWA 4I5UA 2ZVIA 4QROA 1E9ZB 3F2CA 4RKAA 5AHIA 1L9WA 2R6OA 1KCXA 1B9BA 5A6LA 4GD0A 1JPKA 2C1IA 3WD2A 1UJPA 2P3ZA 2W0UA 1XSIA 3QHMA 1GEHA 4XD3A 4NZCA 1W3NA 5C8BB 4DJFD 3AMLA 3BE7A 3E49A 4I8DA 1F6YA 4RE0A 1O5KA 4GUFA 2RDUA 1EGMA 1T96A 3NEHA 1KM5A 2J9ZA 2FB2A 2FHCA 3MBDA 5FOOA 3STCA 4GCXA 4PL2A 2PD9A 1YNQA 2V63A 4MNLA 4UMAA 4QEEA 7A3HA 1UPPA 2XSBA 4PMRA 1CGXA 5KITA 3SSZA 1L8PA 3H2AA 3A3XA 2RH9A 3VOJA 3UESA 4X9YA 1TRDA 4JNMA 1UWTA 2Y7DA 7TAAA 3LSBA 3WBYA 1L2UA 2BVDA 3O3RA 4PRTA 2FHBA 1TE1A 4N9BA 5DMNA 4DI8A 2NX1A 3U48A 3M0XA 1Y8BA 1DJYA 4MY9A 3MYPA 3DERA 2GQAA 2R9RA 1K77A 3TN3A 3KEHA 3UXKA 1PL9A 4ATDA 3S1XA 3PBGA 1W1VA 4W86A 4GY1A 3WUGA 5HQMA 2IPGA 5B80A 1AQFA 2G8ZA 3VX0A 2ACUA 4RDYA 1FWDC 2P88A 3W27A 1VPXA 1JDEA 1OC7A 2VP8A 1FWEC 2WHLA 3D3AA 3HFTA 3VCRA 3PZGA 1CWYA 1C9WA 4MNKA 1LP6A 3WSUA 4H41A 3RU6A 4F66A 2Z0IA 4PE8A 1WXYA 4B2DD 1XSKA 1FFQA 4KWWA 3VD4A 2OYLA 2PBOA 4RLIA 2I14A 5C9ZA 3DFSA 3PJUA 4HD5A 3EZ4A 1QHPA 3GKFA 4Z2IA 4PTVA 3SJNA 3CJPA 1XS2A 3W7RA 3RLVA 1H50A 2YIHA 1J11A 4PN2A 3GG8A 1MUWA 4QEHA 2D24A 3L66A 4LRTA 4PYSA 2YSWA 1V6XA 4KEUA 1J18A 1SM9A 1MW2A 3DG3A 1XJBA 5AZ1A 2VT0A 2CLMA 1YE4A 3ARYA 4IQJA 1QK0A 3EWDA 3NDOA 3ZO9A 1LRNA 2NT0A 1D3HA 3RDKA 3EX1A 4MB3A 1RVGA 1XCXA 1BF2A 3VIHA 3IV3A 4HK6A 1XLDA 5ECUA 1V3HA 1R0MA 3FSTA 4O17A 3EDDA 3U7BA 1TB3A 2GGGA 2TODA 3PS7A 5M1TA 1JQVA 5DFAA 1H1YA 3LCFA 1YYAA 3SN4A 1K8ZA 3FV9A 4GISA 4RK8A 5AYBA 3G8RA 3HGRA 1JZ2A 3VKKA 1UR8A 1WOAA 3MPGA 3RPMA 1XKJA 1Q5MA 5GJNA 3U7VA 4DLFA 2DSWA 7REQA 2FH6A 3PAOA 1JDDA 4Y9MA 2QULA 4B90A 1U33A 1KTBA 1PZ3A 4XD6A 2VUYA 3GDRA 4IPPA 3A3HA 3ARSA 1XM3A 4WHBA 3O9NA 1J0HA 5C5YA 2J66A 3EKZA 4AIOA 4GPNA 1OJXA 5PTDA 1MXGA 3QZEA 5C9UA 3G2GA 2VRJA 3R13A 2VO5A 2PE4A 2WC3A 2E5DA 4BF5A 2J6VA 3KBWA 1H09A 2DQWA 3M41A 2EG8A 3QVQA 4I9AA 1UB3A 5J04A 3W70A 4OBTA 1NVMA 2ZA2A 3U4FA 4IGSA 1ME9A 3LY0A 5BXTA 2FHFA 1EUAA 4LVDA 3UERA 2XHYA 4EWND 4P7RA 4W84A 4JTDA 4LCSA 4YVXA 3UXLA 3G18A 1OADA 1FX6A 4CD8A 5F4XA 5BWFA 1E15A 3W23A 3JZUA 4ZODA 2GDUA 4YYFA 2POTA 3SZ8A 1HKIA 1CB2A 1QO5A 3I4EA 3SAZA 2VQTA 5G5IA 4PRWA 2VDGA 4PCNA 4QE4A 1TTQA 5FEWA 3WELA 1HJQA 3M5XA 2Y89A 4MFEA 1FA2A 3KOFA 5CZTA 1KRMA 1MSSA 3CASA 5EY5A 1Q6LA 5KSWA 1PZ1A 4FHAA 1XBVA 3RAOA 3GDMA 2Z29A 1SW7A 3ZXWA 1ISYA 4N02A 2OKOA 3N6JA 3BLKA 4L1GA 4PCPA 3W7CA 4P7NA 5XIMA 1G9HA 2WANA 2WHMA 2XH0A 1HJUA 4KS0A 2ZIDA 2I7GA 4RZ4A 4LF1A 4DNMA 1PCWA 3FEQA 3AXMA 4DJFC 4GZEA 2Q8LA 1TV4A 3OIXA 3OGVA 1HXJA 3QRHA 2V82A 3NO1A 1V08A 4XIMA 2IPWA 2PTZA 1Q8AA 1H7NA 2PLJA 4GI9A 2VOTA 1CGVA 4GYFA 1KW1A 3REQA 1W1YA 5J8LA 2A3AA 2V5JA 5EBUA 1QTWA 2YDSA 4LH8A 2C13A 1W1IE 2FDMA 1AH4A 5FSEC 4P7OA 2NUXA 4GH1A 2FFIA 2VWSA 1M7OA 1OGSA 2VGGA 5CPMA 5A6SA 3EDKA 1EB3A 4FX6M 3WJYA 3RJYA 3THCA 3ZVHB 2PB1A 3BMVA 4XO6A 1BVWA 4Z1DA 3H2OA 2GVYA 4LUTA 3CZJA 3KBMA 5GJMA 4AZ6A 2PDMA 3W1PA 1V7YA 3C4UA 3KRBA 4BR1A 3CUHA 3MI3A 4UFJA 1IEXA 1X39A 3TC7A 1Q7ZA 4LNCA 3N2BA 2DZWA 3O07A 4O28A 4LY4A 2Y70A 4FR6A 1V6UA 4HMDA 2INEA 3N73A 3POHA 2J47A 4TTGA 2WMIB 4OOZA 2XG9A 3UG4A 3O63A 2YB4A 2NQ5A 4WF7A 1XGEA 2W61A 1T7LA 5K9XA 2O9RA 1RR2A 2BFGA 2V2DA 1F3XA 2P53A 2V5KA 2ZWYA 4X2RA 2J8GA 1M7XA 4ACYA 2CW6A 2X05A 4ICMA 5FEXA 2JKEA 3TR9A 3NCOA 3C2VA 4IZGA 3IGUA 4H6QA 3S9YA 1X8CA 2UY5A 4IM4A 2WW5A 3GAYA 1G7UA 3WK3A 3G8EA 1SW0A 1XYZA 3VCCA 5JH1A 4KPLA 1V0NA 1CEOA 4HZ7A 3T81A 7REQB 3MSDA 3BAXA 2MNRA 3MJMA 3BGAA 2D23A 4JIRA 3T2OA 2X8RA 1M68A 1E0TA 3APGA 2GOUA 1ZP4A 4C6CA 2W3ZA 3N13A 4WKHA 2HEJA 2CERA 1YPXA 5D33A 2OO6A 3A4WA 2NZLA 1KV5A 1HN1A 2ZRVA 3AMKA 3TZFA 3IJDA 1EXPA 1W3HA 3O6CA 3BG5A 4Z0JA 3CO8A 5ENLA 2OEJA 1TQJA 5D9OA 2TMDA 1PHQA 5REQA 3RRXA 3UQNA 1GONA 4M29A 1XH2A 3L5AA 2REQA 1TZ9A 1ITUA 4R53A 4B3KA 4D2JA 5L9FA 2XDFA 3ZQ9A 5C54A 4RPPA 1YXYA 3ZT5A 2CEQA 1NQ6A 2CLEA 3BV4A 3GWQA 2E8ZA 1US3A 1B54A 3N9RA 4CCZA 1CDGA 3VM7A 5A94A 1D3GA 3TONA 2YKKA 3S4TA 3T40A 1JF6A 3LI0A 4WRHA 4BA0A 3ITYA 2BDQA 1U1UA 2WKJA 2YL8A 3IAQA 2VC7A 4KCTA 1GJWA 4PCFA 1TWWA 4TTUA 3ATZA 3T55A 5CQ1A 3F7JA 1DORA 1S39A 3MMWA 1P6BA 3LGDA 1WQ5A 1W56A 4R9XA 5G1TA 3KBNA 1E3ZA 4FPSA 1HF6A 4JHOA 1OT2A 1H11A 1DJQA 1S5MA 1J4EA 4KQNA 4TIMA 1C8QA 3SADA 2R1PA 4BEQA 5G4EA 4L65A 1NJJA 3STPA 3WF2A 3KRUA 1FWAC 3PK7A 3NGFA 4JKKA 1KFEA 3CXOA 4V1YA 1GHSA 1XRSA 2WLYA 4JEJA 4KWOA 2XIQA 3LRLA 4D8LA 5D2YA 2BBFA 4IT1A 2A7PA 2FJKA 3MA8A 2XIMA 2OWXA 1R7AA 3WNPA 2DZVA 2XFYA 1U30A 1FP9A 1UUOA 2NVDA 3IAPA 9XIAA 2X1IA 2HK1A 4P7LA 1KRCC 2CLLA 2GVJA 3H23A 4MY8A 1PWLA 2GDQA 3LI1A 4YPJA 3QGKC 1XFCA 3BLDA 5I3DA 1JPHA 3OJGA 4PTDA 1LUCA 3WJWA 3CWHA 1THFD 2R1NA 2WSKA 2Y85A 5CC6A 2ZZ4A 4PCTA 4UFKA 1EF2A 3CTTA 4GNVA 2IKIA 3PB2A 3PZNA 5MKGA 4WCJA 1BHGA 1PJ9A 3VKDA 4K68A 4HN8A 1V6VA 1HKKA 2XGIA 4C60A 4O1BA 4V1XA 3ZR5A 1RVKA 1KLZA 2ZWZA 3D47A 3L12A 4W5ZA 3LX9A 4AIEA 1BTCA 1RP8A 2Q8XA 2D20A 2RJGA 3FJ4A 4MB1A 1IXOA 4ZSUA 1M7JA 3W53A 1EZWA 1RBOB 5EL1A 3L21A 3PHAA 4IIHA 2BGNE 4NAFA 3VD3A 1KCKA 2BX7A 4QG6A 3DHUA 3PZIA 3KTCA 4YJ5A 1A5CA 2DW6A 1TA3A 4IG2B 2KX9A 1V93A 1EJXC 1HW6A 4OGZA 5A6AA 1PX4A 4FB7A 1KFKA 4IMCA 2WOQA 2ANUA 2PDGA 1JAEA 2BWGA 4S2CA 1V0KA 4ZZ9A 4UTUA 3GB6A 1SR0A 4HK5A 3QGAC 1KV8A 1ZJHA 3WQ6A 4JTJA 1J01A 1LG1A 4GVIA 1JL8A 2J7EA 5HAOA 4ZQNA 4CVUA 4E3TA 1LT8A 1E40A 3GX9A 1IZJA 1XYCA 1VPQA 3ABZA 4MHBA 4M6QA 3WQPA 1QBAA 4FEZA 3HPAA 3B40A 4Y9NA 3ZVHA 4W7WA 5ABFA 3M5ZA 1W5PA 5HWMA 3Q58A 4BQ3A 4DJFA 4WGXA 3W2JA 1DTUA 1J12A 3SUWA 5HUPA 3ITCA 2VCAA 1W8SA 4IX2A 5HPCA 3TSDA 1PWMA 4ORMA 3CU2A 2ISWA 3ES7A 3R8HA 1JCMP 1TX2A 3CLMA 3WLPA 4CQCA 4O1CA 3AS1A 1P7TA 3NZRA 4XQ6A 5AYXA 2J75A 5BOFA 1YKWA 3GKAA 2BY0A 2DIKA 3QV8A 4M5PA 1LUCB 2C0HA 3W38A 3TYEA 1NH6A 4BI7A 1EO7A 3SEPA 2RDWA 1W9PA 4WSKA 5KETA 3VNKA 3RO6A 1GQKA 4AFYA 3T07A 1NWTA 5TAOA 3RK8A 3THAA 4GKLA 4S3CA 4NILA 3WMLA 3HQOA 3ZZ1A 1UD6A 2BVWA 4HPNA 1S46A 2Z00A 5AHNA 4GI4A 5I3GA 4XZLX 1W3KA 1VPYA 1EX5A 4REQA 3EEZA 1PV8A 3U2CA 1X8FA 4KT2A 1DL3A 5D03A 4RXFA 4CCCA 4DQWA 3JRKA 4MWAB 4JKLA 4KBXA 1YTKA 3P5ZA 3L2MA 5TF0A 4YWSA 4ZQOA 3CHDA 4XUGA 1KBIA 1NSJA 4XBJA 4C5ZA 4YVPA 3SIMA 4YU1A 4HB7A 3OODA 5F7UA 4MB4A 4RDZA 3O05A 3UF9A 1YPFA 3C3UA 2VWTA 2EHHA 4ICCX 4AC1X 4K2SA 1YDYA 2OOGA 3TW6A 3VC6A 5IBXC 3W6MA 1L0PA 4ZA0A 2CWNA 2FGLA 3GE7A 2LLEA 4WY0A 3BARA 2C0AA 2V3FA 1W31A 3C8FA 3VXGA 3WDIA 1DIKA 3R4IA 1KFBA 2P8BA 1JGMA 1J8VA 3MANA 2PU1A 1TPC1 3RUBL 3LN3A 5LA1A 5KZMA 1S2AA 1W3IA 1XLLA 3M0YA 3DC0A 3FCPA 1JCJA 4AZCA 1G7VA 5LIXX 3F2DA 3H2CA 3SR7A 4ROQA 1FOBA 3COTA 3B0XA 3LCGA 1XYMA 3JVAA 3W1LA 1I2PA 3TMQA 3ZJKA 4HPHA 2WSPA 2F7FA 4S1FA 3SI9A 5AC8A 2GWNA 4MWAE 2DW7A 3W82A 1AODA 5D8ZA 1OM0A 4NI8A 4E2OA 4ZO8A 2OXNA 1NP2A 3MHGA 1GNXA 2GSHA 1EQPA 4QX4A 4LT9A 2UY4A 1VP5A 3B9OA 3SY8A 3UCQA 3EWCA 1G4EA 5CG0A 5LKYA 4F9DA 1S3TC 4IPIA 1QUMA 2ICSA 5KTLA 4IWWA 4D72A 1MZHA 2QUNA 2CBVA 4TR9A 3K4DA 1CBGA 1XQLA 2DZAA 1Q13A 5I77A 3GNPA 5CZKA 1E1FA 2AL2A 3TMLA 1XPGA 5GQBA 2QV5A 3L4TA 1XXXA 1Z69A 3OZPA 3WD4A 3K30A 1OGGA 3IK2A 3FKKA 4PODA 1BLIA 4URIA 4AC7C 1UH2A 4NUWA 1KBJA 4C6FA 1KLYA 4YTUA 4ACZA 3BGJA 4PRRA 3T42A 5F4WA 3G1RA 1KM1A 3B06A 1MYRA 4MJZA 4HOXA 3V5OA 3HV8A 2BB0A 4D6FA 2PDNA 1L6FA 3UWEA 4IQLA 3KRZA 5IDZA 4OOUA 3HPXA 3D3FA 1W9UA 2XGZA 3W2MA 3W1XA 4KWUA 3H53A 5DMMA 1XIBA 1BXNA 1Q85A 2V8ZA 4XBKA 1OQFA 3GC5A 1RCOB 1LG2A 1O5RA 1Q66A 3QMRA 3VK5A 4YVVA 4O1AA 4POCA 3QXBA 2G3FA 4MLRA 4BCEA 1A3WA 1BKHA 2WHJA 5DN1A 1WXJA 1FDYA 3PZUA 1BEUA 5I3FA 2J7CA 3NEVA 4HVXA 4DUXA 4DY1A 1CECA 4RCXA 2BSLA 1HFBA 5I7GA 3DESA 4IQDA 3POCA 2GUBA 1PX8A 2YBUA 3W2KA 1FCQA 3MUXA 4IJBA 2QPXA 3W1RA 2YCEA 2BASA 1OGBA 3CT7A 1A5OC 4QBXA 1AL7A 2AOSA 4L1XA 9CGTA 2B4GA 2VX7A 3W37A 1KFJA 3N9KA 4QJ1A 4UFIA 4US5D 4BS0A 2XFFA 1XGDA 1IYXA 4PTXA 1WPCA 1T99A 5D2VA 4FA3A 1A5NC 5FEZA 4J40A 4BI6A 4XSLA 4Q8UA 4FOKA 3TEVA 1IEWA 4C6LA 3XIMA 1RA5A 3MSYA 3CHFA 4P8VA 3MSRA 1ENUA 4W87A 3BLOA 4GUGA 1VGAA 4ZENA 3GFZA 2RJHA 3DI0A 3O7UA 1RQBA 4QDPA 1FXQA 3AUJA 5MKGB 3DH7A 1ECEA 2QAPA 1D7FA 1P4CA 1R3WA 2EKCA 3WENA 5E70A 2A1YA 3REQB 4QLJA 5FI8A 2OX4A 1J2BA 4PMJA 3MMTA 4BF7A 3O8AA 1UIPA 4UOZA 4I8YA 3WKZA 3GC2A 1ZRQA 4A8NA 3ISIX 3OZMA 1GQNA 2R1KA 3UGRA 5HNRA 3MKCA 2BV9A 3E3HA 1JZ6A 4F0KA 5A1AA 3QF0A 4GG9A 2PTDA 3QMTA 1PSCA 2QDEA 2A7RA 3TYUA 3IACA 1FWRA 1P0KA 4GO8A 1GQJA 4JZ5A 1IXNA 4KMQA 1J5TA 5C71A 4FIQA 3I6RA 3VZYA 3UETA 1E9IA 1RP9A 1IZKA 4AHQA 4PB5A 3TFXA 1XIMA 2V69A 3R0UA 4IH3A 1B3WA 1H5VA 4QDMA 4NHVA 3TQKA 4C1LA 3IPWA 1A53A 4FOJA 2HXUA 5FJOA 3N6QA 2VDIA 1HGWA 2HSAA 1H61A 3PUEA 3EPMA 2BG5A 4IMGA 1Y5WA 1XG3A 2J77A 1X7FA 4ZCWA 5TIMA 4EK7A 4ML9A 4D6JA 1IZCA 2VKZG 1AZ2A 4ZQCA 1H49A 4NL1A 1EHNA 3WNNA 4H9YA 5DANA 1F8IA 1RH9A 3M4HA 5D2WA 3OOQA 3PUGA 3KP0A 4AW7A 4D71A 2H9AA 5G2IA 2ACQA 3B0YA 1XSJA 2QMJA 3G1DA 3W7DA 3LPPA 1TVLA 3T2QA 4HPXA 2ZBTA 3N11A 2A7NA 1OD0A 1E6SM 4Z2KA 4CNUA 4C90A 2O7SA 2D1ZA 5A8QA 2GVEA 3O0KA 1EBHA 4E2VA 2O92A 2CLOA 2YA2A 3MB9A 3PUDA 2OOFA 1WKYA 3TC6A 1BVZA 3O0FA 1LL4A 1R30A 4CD6A 4RL3A 1E4NA 1EEXA 3ZLGA 3VTRA 4H6EA 3PF3A 1QW9A 3Q67A 1KR1A 1LM1A 2BLEA 4ZO9A 3CH9A 3P80A 3GW0A 5CH9A 5AZ0A 2C19A 4A6GA 3E2VA 3T0AA 2HXTA 3ABQA 1B3VA 4D6HA 1J10A 1ZS2A 3EB2A 4NVTA 4W93A 1RA0A 1NFPA 2O9TA 2ZRZA 5J5RA 1JCYA 1UW9A 2GPTA 3TTYA 1DHPA 2DIJA 1S5VA 3R8GA 1GHRA 4AVOA 3GFYA 2OFJA 1CI1A 4O0ZA 5MHBA 3UG5A 1YTEA 2OZTA 4OV4A 3TE9A 2J8FA 2BGSA 4PMQA 4PL1A 1C7TA 3EAUA 4R7OA 4GK8A 1KWGA 3VCNA 4GUIA 3UFYA 1HJVA 5LHEA 1XLIA 4ZTYA 3CYJA 4HMCA 2JF6A 1GORA 2Z1BA 3B05A 4ADSA 4PC8A 1H60A 4NRRA 3W7OA 2VD8A 3WBEA 3ID7A 3ELFA 3WBXA 2VZOA 6XIMA 5BZAA 1NY1A 1GKRA 2YB1A 5CSUA 3NDYA 3GRIA 4FXSA 4G9PA 2G96A 2J88A 4IP4A 3R58A 4LRSA 4B9ZA 2Z6IA 1BQGA 4IQEA 1DQWA 1FTXA 3OBKA 1GVYA 4F2BA 1BXBA 1YXDA 4O11A 4LAMA 2G0WA 3HOJA 3VDAA 3NZGA 3BAYA 3NWRA 1JCLA 2ZUTA 1Q2SA 1UMYA 5D4YA 1V6WA 4Q6JA 4UQ9A 1RALA 4ZB0A 3EOUA 4J27A 4DBDA 4UTTA 3FXYA 2YDQA 3S6OA 2PGWA 4D1IA 2OQYA 1UD2A 2NT1A 3SJ3A 3DYPA 4PMVA 3A22A 1XLGA 4IJRA 1OFAA 4AX6A 4PCSA 3OO2A 5FL1A 4RDVA 2OLHA 4DXXA 3W7GA 3CUIA 4QR6A 3EWYA 4LF2A 4BZYA 4XAFA 1RUSA 3AUOA 1KR0A 1I45A 1NF7A 5BRQA 2WQDA 3KS6A 1XV8A 4HPJA 3IRSA 1EWDA 4K36A 1TPFA 1ISWA 3GVRA 3W07A 4WDWA 3W7EA 2D22A 1A4LA 4MKSA 4Y8EA 3AICA 3PNUA 4EF8A 4I7UA 2FPYA 3W7KA 5IFTA 1A5LC 5EGRA 2EKGA 4WJXA 3WLSA 1XIIA 4UC5A 3VE9A 4DO4A 5F2MA 3PTDA 1W2VA 4QLKA 1ELSA 3WF3A 3GD6A 3R0KA 4AY8A 3NL6A 3MTWA 3MV01 3NQDA 4CGTA 3RFAA 4YXGA 4IIBA 1OX4A 2D0GA 3IUDA 2UV8G 1AFSA 1T40A 2EPMX 4GFSA 1JXJA 1KTCA 1FBAA 3AC0A 3GIPA 3W86A 3GDBA 4OTKA 3IIZA 2J9XA 1Z6KA 4Q7BA 3CGTA 4N0RA 1PIFA 4HP5A 1SJAA 2WSYA 5K4XA 1ZBVA 4INFA 1DOSA 1C3FA 3ITXA 1C29A 4E8CA 4X0NA 2ZZ6A 3BLFA 4UCGA 4EXBA 3GYCA 1GTHA 1IHIA 3M7WA 3QQ1A 1VFTA 1EA0A 4IPJA 4HZMA 1MVYA 2GGJA 2VOMA 4AZHA 1P0BA 1KGXA 3U2OA 3GVQA 3L4WA