3ZJKA

Crystal structure of ttb-gly f401s mutant
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
424
Chain Sequence
EKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLHHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRSGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Semi-Rational Approach for Converting a Gh1 Beta-Glycosidase Into a Beta-Transglycosidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords BETA GLYCOSIDASE
total genus 155
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zjkA00
4UOQA 1JZ6A 3BAIA 4D1JA 1QW8A 2ZX9A 4L4OA 1CXKA 1M53A 1JYNA 1XH2A 5E9AA 2G8ZA 1KB3A 2J79A 3VIKA 1B3XA 1GOMA 3K8MA 3WNOA 4V2XA 3NSMA 3LPOA 4W7UA 3WDIA 2O9RA 1VFMA 4F66A 4GQQA 4OKDA 1EHNA 5DFAA 1J12A 2DSVA 2W91A 3CHEA 1WE5A 3NIYA 4IPLA 4GI8A 2EPOA 3SCVA 2EBNA 5LA1A 3VIGA 1WP6A 4Y7EA 3EDJA 3UG5A 3AZSA 4AZ5A 5M17A 1HL9A 1NOUA 2DH2A 1HJVA 3VDCA 3PBGA 1TUXA 2JF6A 3VD7A 3VO0A 2VX6A 3CIVA 2A3EA 2VZTA 1XHGA 4W88A 4CD6A 4H04A 3RJXA 3GNRA 3AIRA 1RPKA 2JF7A 4DWSD 2E0PA 1MXGA 1LJYA 1EO7A 3MV11 3W6LA 2VX5A 2UY3A 2WVVA 1UD5A 1CXIA 1WDQA 1KQYA 4CU8A 2X1IA 4BZYA 3VX0A 2WANA 4GPNA 4YHEA 1QI3A 3TP4A 3SCRA 1NQ6A 4OBSA 2EEXA 1GJUA 1U2YA 1CGTA 2D3LA 3T0DA 3RDKA 2ESCA 1H3GA 2PBGA 2WLYA 3AHXA 1XYFA 1HJSA 1UD6A 1TVPA 3CZGA 3AQUA 3WQWA 1C8XA 3N15A 1JZ4A 1KXTA 5E6YA 5HBFA 1HF6A 2JEQA 2JALA 2ZUNA 3PHAA 2D23A 3SCQA 2J62A 2V3FA 2ZWYA 3SURA 5D9NA 3OIHA 1J18A 1JNDA 3NUKA 2XUCA 4WKAA 2CNCA 2Y5EA 3SCTA 1R7AA 2WZEA 3N04A 3ZJ7A 1QNQA 2B31A 4Z2IA 4PTVA 2WKLA 1GZJA 3J7HA 3L2LA 4GKLA 3VM5A 4CU6A 2BY3A 2CBJA 3NJ3A 3MUY1 3CHCA 2BY2A 3UEQA 3GXDA 1OT1A 1ZBWA 1UKOA 1QNOA 4CN1A 4JFTA 4FF5A 4V28A 3ARYA 3W37A 1UZ1A 1X1NA 2NT0A 3M6DA 4W87A 3WBEA 2OYLA 3OLEA 1TZ7A 3BAXA 2C7FA 3U7BA 1H0IA 2XVGA 2BHUA 5I5RA 2CETA 4GZEA 3OLGA 1CNVA 2O9PA 3WDJA 1ISYA 4RE3A 2VNCA 4QP0A 1J0HA 4OUEA 2OLHA 3TONA 3QR3A 3E1F1 3VIHA 2DT3A 2XWDA 2YKKA 5DEZA 2GK1B 4DWSC 2W5FA 2A3CA 2JE8A 5EB8A 4EKJA 5GQBA 2ZUUA 1ISWA 1KFWA 4E8CA 4LYPA 3OGRA 4AZGA 3TTYA 1G01A 3ZT5A 4JFVA 3SCOA 1AQMA 1VF8A 5A8PA 3ZJ8A 1MWOA 1Q6FA 4UQDA 5CGTA 2EO7A 4JKMA 2WMIB 5KEZA 4A3YA 1VEPA 5D9PA 4CVUA 1UR9A 5DO8A 4D6HA 4PMDA 3G6MA 3FHQA 4CU7A 4BQ2A 4DM2A 3WF0A 1FA2A 1E1EA 1Q4NX 4QAWA 3ZT7A 4IM4A 1US2A 3KZSA 4W85A 5E09A 2FH6A 2W67A 4AEEA 1NM9A 3W82A 1XC6A 3AS0A 1F4AA 2VCAA 2JIWA 2YA0A 3UG4A 2O9OA 2V5CA 2J7BA 2X8RA 2BVTA 1TR1A 1MQRA 1RP9A 1V6WA 1W9XA 3F5LA 5EFDA 3II1A 1NOWA 5I23A 2FGLA 1DWIM 3WH6A 4UNIA 4AZCA 5CPTA 4C7DA 4M29A 3CH9A 3WIJA 3ARSA 1TMQA 3IANA 3IJ9A 1OSEA 3QHOA 4KGJA 5E70A 1LLOA 3SCUA 5D9MA 3AMDA 2QPSA 4J3TA 2BS9A 3ARWA 3WNPA 2ZIDA 3BSHA 2VZVA 2YL6A 3VGBA 2OSWA 1BGGA 5M03A 2AOSA 2Y8VA 1TFVA 1QNSA 4RE4A 3VIMA 4FLSA 1JDCA 3AIVA 2NSXA 1C93A 3VGFA 1FH7A 1E6SM 3MSGA 5A8QA 3DYOA 4PEEA 1XGZA 1R87A 3N11A 1ZBVA 4XZBA 1AVAA 4BQ4A 5BCAA 4CN4A 3W24A 4P7NA 1JYWA 2VTFA 4OOUA 4QCEA 3AYSA 4UCFA 3EMZA 4CD5A 1BHGA 2WMIA 1H11A 3VGHA 5I77A 3WY1A 7TAAA 1NWTA 2WM0A 5BXPA 3RM8A 1XSKA 2XVNA 2WSKA 2YBTA 3THCA 2QF8A 4HMEA 2OSYA 3VMOA 1UWIA 1FFRA 2WMHA 2BNJA 4AZBA 3TTSA 2VVNA 2DPEA 3A6OA 2CBIA 3WF4A 3W81A 1UH3A 2E8YA 5BXRA 2EXOA 2VR5A 3ARQA 4GQRA 1E71M 1J0ZA 3AIBA 1V0LA 4J27A 3WD0A 4W5ZA 1HP5A 4XV0A 3WF3A 5CGMA 3GNOA 3CZKA 1LF1A 3AHZA 5EMYA 3OZOA 2VRJA 2J7HA 3OG2A 2VJXA 4UFIA 4P7OA 5A8NA 1E0VA 4CGTA 2PWHA 1C7SA 1UA7A 1M7XA 1ECEA 3CMGA 1K9FA 4J3SA 1BAGA 3QHMA 5I6SA 1GQJA 5FD0A 4HOXA 2CHOA 2WHMA 2J25A 2XIBA 3GDBA 3BLPX 1QPKA 2G41A 4B3KA 1JGIA 1CXEA 4KH2A 1IZJA 3PZVA 2VCCA 1LG1A 1DWFM 3AZTA 3ZR5A 2YA1A 3VGEA 5C71A 2PWGA 4CCEA 4Z2JA 5BRQA 9CGTA 3WENA 4UFLA 5BYWA 1KGUA 1W1YA 2HVMA 3L4UA 4PSRA 3T0AA 2GSJA 3VD5A 2WC7A 4KGLA 1XCXA 4U31A 2DT2A 5HNNA 1GPFA 2QMKA 2WMKA 2WMFA 1TVNA 4F9JA 3SEPA 1GQLA 1CLVA 1R85A 2D1ZA 1Q6CA 2X09A 3IJ7A 4EANA 3VIIA 1WAWA 1PIFA 3BAKA 2D0FA 1KBKA 4YPJA 8CGTA 2PBOA 1HVQA 2IUZA 4ACZB 3SCSA 4JCMA 3VNZA 4BF7A 1X6NA 4MAVA 2V38A 3W25A 1UD4A 1HKMA 4UFMA 3ECQA 5A8MA 4RL3A 4Q22A 2YLLA 1E56A 2XGIA 3KL0A 2DGAA 2WSPA 2VURA 1P6WA 3QHNA 1ODUA 4UZUA 2XFYA 2VRQA 2WVTA 4AMCA 2YA2A 1W9PA 2D20A 3FY1A 4P8WA 4PMRA 1CGXA 5CLWA 3L4VA 5HXMA 1BG9A 3HJEA 1B0IA 3VD9A 2YLAA 4J7RA 4PMXA 1WCGA 5ABFB 2UY4A 3EYPA 3UR8A 1W2PA 3MKKA 5EBAA 1XCWA 2JIEA 3KL3A 1US3A 4P8XA 4M8UA 5CXPA 3WKZA 4HZ6A 3U57A 6TAAA 3UERA 1QI0A 4P7RA 3M46A 2VQTA 1OCQA 1HN1A 4MB3A 3JUGA 4H8UA 1ISZA 4TVUA 1W3KA 2PWFA 4IPNB 2AAAA 1KCKA 4LXFA 5IHSA 4JCLA 3BH4A 4MPKA 3WD3A 2ZUSA 5DT7A 3BAJA 4LGXA 1JI1A 3W6MA 1E4LA 1NWUA 2WCAA 3WEOA 4UQAA 1EQCA 4PBGA 2X0HA 4NRRA 1XRVA 1DTUA 4JFUA 1CGWA 1HJWA 1QBBA 4TUFA 1JZ7A 1BVZA 1RP8A 3NYDA 5LA0A 2Z1SA 5LA2A 3SCNA 1XD1A 1KXHA 5BXSA 2ZX7A 1H09A 2VI0A 4GZJA 1GOIA 2YL5A 5TD4A 3B9EA 2DIEA 1GW1A 3VPLA 1ZS2A 1J10A 3W26A 3ZM8A 4E4PA 2HISA 2WCGA 4ZE5A 3BCFA 2GUYA 4J3XA 4W89A 4AZHA 1GORA 1N82A 1PZ3A 1UUQA 2YJQA 1TCMA 2YDRA 1NOFA 4JZ5A 1BSIA 5ABEA 3OLDA 2V5DA 1BYCA 2VZOA 3RILA 4H8HA 4UOJA 4EE9A 3GXIA 3LPGA 3ZOAA 1C8YA 4UQEA 1O6IA 3W28A 3HN3A 3MMWA 1K9TA 1EOMA 1E5JA 2A3HA 3K1DA 3A47A 3IAPA 4FLOA 2J8FA 1BTCA 3W27A 4UFJA 4C7GA 4UQCA 4M24A 4FLRA 3SUWA 3KE0A 1VENA 4PMUA 2XPKA 3VU2A 3I3EA 4CD7A 1GOWA 1M01A 4PUDA 2YOCA 3GH4A 5A6KA 1GOKA 5AC4A 1UD3A 3K4AA 1UKSA 1V3HA 2ZUMA 4D1IA 2D22A 3K8LA 2J74A 1V03A 2J7CA 1WZAA 1B3YA 4JIEA 2WC3A 3DHUA 4U5IA 4AD5A 5A2BA 4ML4A 1JG9A 4CVWA 5A3HA 5A2CA 2DEPA 4NSBA 4UQ9A 1G94A 1CYGA 1EHAA 4TX8A 5BWFA 1XSIA 1BYAA 1J0IA 5FKYA 1DHKA 3CUFA 1WDRA 1TA3B 3WEZA 4J3UA 2J75A 2QV4A 1QNPA 4TTUA 2RGLA 3GM8A 2WCSA 3W4RA 1OGBA 3WFLA 3VIOA 3VM7A 1MYRA 1A3HA 1ESWA 2EPLX 2JEPA 5AY7A 3KWXA 4D6JA 4DWSB 2XJ7A 2GFTA 2PF0A 6CGTA 1VEOA 4MNLA 1V0NA 1J0KA 1UR1A 1OGSA 4QCFA 4HU0A 2GJRA 4DUVA 2PB1A 3DC0A 2A3AA 1JYVA 4UQBA 1HT6A 3WDPP 2ZE0A 1UKTA 3EMCA 1W32A 1MW2A 3T2QA 2OSXA 1BGAA 3WD4A 5FCZA 1ISVA 4XUYA 2WB5A 1H5VA 1W1VA 2MANA 2WVVB 4AC1X 1TG7A 1UD8A 1UR0A 1LL7A 4FMVA 1M03A 3MO4A 4KWUA 3VX1A 1MW0A 1JZ5A 1J9YA 5A69A 4AYSA 2VOTA 1JXKA 5CLTA 3AYRA 1H4PA 1XYZA 4AD3A 2WNWA 2G3MA 3DYPA 2WYSA 4D72A 2Z1KA 4PCSA 5A2AA 1WKYA 3WUFA 1HXJA 1E6RA 4GI9A 4N42A 3GXFA 1E73M 5DF0A 1XSJA 3NCOA 2DSZA 1GOOA 3AS3A 4J28A 3WQ8A 1YQ2A 2WBGA 1GOQA 1TE1A 3FAXA 2YDQA 3WL1A 5F7UA 2J4GA 5HDRA 4L4PA 4XX6A 3WNKA 1R86A 3VINA 2V3GA 2GDUA 2GJXA 3GZAA 2CERA 2CKSA 4PSPA 2X0YA 4D6FA 3N18A 2WMJA 5GNYA 1O7AA 1SR0A 1KQZA 1PEZA 5AC5A 2QHAA 1UHVA 5A6SA 2XIIA 1V6XA 1W9DM 2IXVA 3A3HA 3AOFA 3OGSA 5A6BD 2WWDA 1KGWA 4U3AA 3AIWA 3GBDA 1ITXA 3AIQA 4JL1A 2PI6A 3D3AA 2CEQA 1MVYA 3MSDA 2WHKA 2E40A 2E9LA 3N17A 1ZBCA 5IFPA 3I3BA 4URIA 1B9ZA 1JAKA 1VFFA 5A6JA 1V02A 3POCA 3B9AA 4UZSA 3IJ8A 4AWEA 2CXGA 3U5YA 1DEDA 3VIJA 1KCLA 3FN9A 2YL9A 1KXQA 4HMDA 1OM0A 2O92A 2WK2A 2FDMA 3PZMA 3VIFA 4PMNA 3A4AA 3EMQA 3LPPA 1KWKA 3KEHA 3AHYA 4QLJA 5A6LA 3CGTA 1D7FA 4U2YA 4F9DA 1GVYA 3WSUA 3NDZA 2EJ1A 3ARUA 3QOMA 3CZEA 1BQCA 2DQXA 4D6EA 3RCNA 1V3IA 3MMUA 2C0HA 1EXPA 2X2YA 3VMNA 4UR9A 3S6TA 4CD8A 5M5DA 4MB1A 3WH9A 4HOWA 1CGVA 4F79A 1W3JA 3PN8A 1ZJBA 4AXNA 1U30A 2CIPA 1WB0A 5D9OA 2ZXAA 1V0KA 4EK7A 2BY0A 3WH7A 1XD0A 1JFHA 2BXYA 3WD2A 3N9KA 1K9EA 4ATLA 1UWQA 4HOZA 1I75A 1NP2A 4PYSA 2DSWA 5CSYA 5CZKA 4P8VA 4X0VA 3ZQ9A 2DSKA 1E4MM 1UQYA 1B3VA 1DWHM 1GNXA 1EA9C 2FHBA 3KL5A 1E4IA 1BFNA 1OIMA 1WO2A 2XHYA 3LMYA 3ZSTA 1I1WA 1GVIA 4C7FA 3CO4A 2O9TA 4U5KA 1EQPA 1E6XM 1L8NA 2QPUA 5CQ1A 1FP8A 1FP9A 1W2VA 2YL8A 3ALGA 3WQ5A 1JXJA 1G0CA 1OD0A 2UY2A 7A3HA 4R5EA 4S3JA 5HPOA 4JKKA 2J7DA 1B30A 2NT1A 4BQ5A 2BHYA 4JFWA 2VRKA 1VRXA 4NF7A 1QHZA 4LQ1A 1HJQA 1IZKA 3PZ9A 1H41A 3WDHA 1CEOA 4JHZA 3NSNA 3PZOA 1CXFA 1BF2A 2J7GA 4P7QA 2XTKA 3ZIZA 4D6DA 5A1AA 5DT5A 2XM1A 1EIBA 1JZ8A 1W1TA 5D4YA 1GJWA 3RMEA 5A6AA 2CYGA 4ZENA 2J8GA 1Q6DA 1QBAA 1V6UA 1V3KA 4W84A 1J0YA 1M04A 5I0DA 5BROA 2VX7A 1C90A 4HMCA 5I24A 3OLIA 1V3JA 1JDAA 4ZFMA 4HA4A 1B31A 5C70A 2W4XA 4AISA 4OIFA 4XZWA 3L2MA 2GK1A 4HP5A 3WELA 4D6GA 1LWHA 2D24A 1E4NA 1OD8A 1MFUA 4PUEA 4B9YA 1U33A 2CKRA 2G4FA 4AZCB 2J7EA 3L4ZA 4M82A 3CHDA 3AIUA 4AZ6A 4DM1A 1GONA 2WZHA 2EQDA 4UFKA 3PZUA 1UKQA 4HU8A 1V6VA 3WH8A 5CSUA 4W8BA 4AD4A 1CWYA 1JFXA 2GVYA 4NI3A 4PMOA 5I78A 1E0XA 4U3CA 3A4XA 1C91A 5BXTA 4HPHA 3VGGA 1UR4A 2J78A 4W93A 1HVXA 1E55A 4WF7A 4J3WA 3FAWA 4MNJA 2UY5A 3B9DA 1NWRA 3WDRA 3T08A 1B3ZA 3FNDA 1SFSA 4P7LA 3PTQA 2Y2WA 5FL0A 5BRPA 3GNPA 1CGUA 1JL8A 1G5AA 3I3DA 3MS8A 2AMGA 1BLIA 1ZU8A 1KBBA 3N1AA 4CKQA 5LYRA 3WL0A 1UR8A 3CBWA 4W8AA 1GQIA 5HPCA 3PTMA 3UG3A 5JBEA 4DUXA 4H7VA 5D8WA 3EDDA 1DWGM 3RPMA 4NZCA 3FHAA 8A3HA 1FH9A 5AYIA 3VTRA 3CHFA 3AXIA 4AY1A 3ZSSA 1WDSA 3MANA 5IFTA 4MTVA 1CXHA 3ARXA 3WUEA 4NRSA 2D2OA 3T2OA 3M7SA 4MDOA 3VD3A 3EDEA 3HU7A 1KXVA 2FHFA 2NW0A 4AD2A 1C92A 3BMWA 3WQ6A 2Y8KA 4A3HA 4M56A 1CZ1A 1W91A 3PZQA 4UFHA 1J01A 2EPNA 2X05A 2FHCA 2W66A 2BV9A 3SUUA 3ARTA 1GHSA 2WWCA 3AMGA 3UESA 1GQKA 6A3HA 3PTKA 4WK9A 4JHOA 1K9DA 4R27A 2XVLA 1DWJM 4Z2GA 2G3IA 5JBDA 3VDHA 3BAWA 3AMLA 2W92A 3EBVA 1EDQA 1OINA 4D6IA 2F61A 4CUCA 1PIGA 5GNZA 2CCRA 3SIMA 1KWGA 4D6CA 3PZIA 1FHDA 1WPCA 3G6LA 4AZ7A 3CZ8A 2VO5A 4GINA 1UWSA 4BS0A 3BC9A 1G9HA 3MUIA 1UG6A 1WZKA 2WZIA 1KR1A 4HA1A 4N0RA 2WMGA 2BVYA 3WQVA 1Q6GA 4X9YA 2GJPA 5FOOA 1UH4A 4QLKA 4F8XA 5I79A 4ZEPA 5I2UA 1E43A 4TTGA 1V0MA 2BXZA 4AIUA 4EAMA 4CCCA 1LG2A 4BCEA 1WNOA 1IT0A 3WDQA 3CUGA 2D0GA 2ZOXA 1E6NA 2XWEA 1RD6A 2WVSA 2ZUVA 3EDFA 3MMDA 1ZL1A 1JF5A 1YHTA 5A8OA 1QNRA 1XH1A 2ZXDA 4HTYA 4ZXLA 4GO8A 2CITA 1JZ2A 4U2ZA 3BXWA 1W3LA 4RE2A 4KRUA 1E40A 2ZUTA 2F2HA 3UR7A 1H1NA 1HIZA 4OOZA 3AISA 5E0FA 3T09A 4WJXA 2WBKA 4TXEA 3ZJKA 1QW9A 4OJYA 5ABGA 1CTNA 1SMAA 1CXLA 4AW7A 2BVDA 3RO8A 1GHRA 1BPLB 4LYQA 2WHLA 2VUYA 1B3WA 1VIWA 2VCBA 5CPSA 1FHLA 1R7OA 3TTOA 1HJXA 4PMZA 4P8UA 3VOCA 4TVDA 1R8LA 1CENA 5GPRA 3T0BA 1MW1A 5ABFA 1CLXA 1VFUA 4Q7NA 4PN2A 1JNEA 1MQPA 1V3MA 2W62A 3FXYA 4B16A 2PWDA 1DWAM 4S3KA 1UR2A 1E1FA 1VAHA 1E6QM 3BMVA 1JD9A 4FK9A 2WC4A 4W5UA 4GZIA 1W9UA 2VC9A 4MDPA 2XFRA 4WSJA 2CHNA 3OGVA 3AFBA 3IAQA 3VVGA 1SYTA 3RJYA 3CMJA 4J3VA 1BVNP 1OB0A 2WW5A 7CGTA 1L0PA 1B1YA 1HP4A 3ZR6A 3ARVA 4XB3A 3CLWA 3SUSA 2D3NA 1LWJA 1A47A 3SUVA 1HX0A 1UQZA 4U33A 2OYMA 2ZWZA 3VUPA 1FFQA 3WMBA 4GXPA 3A4WA 5ECUA 4BQ3A 2XGBA 1TA3A 3ARPA 3GXMA 4JAWA 5E6ZA 2BFGA 3WNNA 2VQUA 1IV8A 3AIEA 3EDKA 4B9ZA 2CBVA 3DYMA 3GBEA 2XFFA 3DHPA 1W3HA 1XH0A 3F4VA 1Z32X 1HNYA 2GJXB 2IXUA 1AQHA 3CZJA 3PZNA 1VB9A 1ZB5A 2WLZA 2CPUA 5JBFA 1OBAA 4AZIA 4OZOA 3W0KA 2BHZA 4K68A 3GTNA 4ACYA 2WVUA 3ZT6A 1JD7A 4H41A 3IK2A 1VBRA 4WSKA 1HJUA 3VDBA 1PX3A 1PJ9A 1QOXA 2DSUA 4W8LA 1QVBA 5JIPA 3VMPA 5A95A 2E4TA 4DUWA 3AZRA 2Y4SA 1ISXA 5C8BB 2E8ZA 2FGZA 1VFOA 3PZGA 1LQ0A 4GO9A 5JIWA 1Q6EA 4E8DA 4PTWA 1EOKA 1K6AA 3L4YA 1CIUA 2E9BA 1KGXA 2QLYA 4LPCA 3MU7A 2YDSA 3RIKA 4TVCA 3ARRA 3OB8A 4PMQA 5CG0A 4JL2A 5A94A 2ZX5A 1DP0A 3VGDA 3O9NA 1UWTA 5GNXA 3L4WA 3WF1A 2WPGA 2DT1A 3GH7A 3W38A 4HA3A 2JFEX 3AHVA 1PX4A 3QOKA 2XVKA 1JDDA 1EH9A 3BSGA 3WFZA 1GUVA 1UWRA 2YIHA 4JFSA 3QGVA 3F5KA 1HKJA 4ATDA 3PZTA 1OGGA 1E9LA 1BYBA 4HPGA 1C7TA 3WQ4A 3CUHA 3O2LA 1V02E 1V3LA 1MQQA 3OA5A 2QMJA 1ZJAA 2J47A 2C8NA 1E3ZA 4JKLA 1NWSA 2UWFA 4W7VA 4YN5A 3WN6A 3CZLA 2W63A 2ZICA 1JF6A 3U7VA 4AIEA 4UOZA 1EDTA 2E3ZA 1OT2A 4B15A 3MUAA 3HMCA 1W9VA 2FH8A 4W86A 4B3LA 2CESA 1OIFA 2VVSA 3OZPA 2ZUWA 4HZ8A 1QHOA 1VJSA 3RM4A 1QI4A 2ZXQA 3VILA 3VKKA 2DH3A 2WHJA 3UCQA 1JZ3A 1EO5A 2XVPA 1E72M 2V3EA 3DECA 1Y7VA 1MXDA 2VZSA 5FIPA 2F8QA 2DIJA 3CUJA 3K4DA 4W7WA 1BYDA 2WAGA 4ATWA 3AMKA 2G3NA 3WMCA 4Z2KA 1JYXA 4H2CA 1KR0A 3CPUA 1LL6A 1FH8A 3WH5A 3WNLA 2E9MA 2Y24A 3OBAA 1HKKA 4E2OA 1PBGA 5AYBA 1E3XA 1WZLA 3TTQA 2V3DA 3AI0A 1C3FA 2OYKA 5E0CA 3SUTA 2VT0A 3AMCA 3SCPA 1D3CA 3BGAA 3TOPA 1H2JA 3POHA 4PTXA 4PRWA 3WEMA 4UTFA 4TOQA 4MB5A 3TA9A 1CGYA 4Z2HA 2RGMA 2YBUA 4PTMA 1S46A 1E0WA 1FOBA 3ZO9A 1LL4A 3O6AA 1V08A 1E6ZA 5IDIA 2A3BA 1UWUA 3AXXA 4A4AA 5DMYA 1JAEA 1UKPA 2GDVA 1F4HA 4LX4A 1CBGA 4IISA 2W61A 3K46A 4ACZA 4WKHA 2VR4A 1QI2A 3VNYA 3BAYA 3T2PA 3ZJ6A 1W1PA 3WMSA 1UA3A 2D0HA 5FL1A 1I1XA 4WLCA 1AQ0A 3F5JA 3MUZ1 4H8VA 1QHPA 5A6MA 2EPKX 5EFFA 4PCTA 2VX4A 4WKFA 1E5NA 1VBUA 4MJ4A 1J11A 4AD0A 1C8QA 4MB4A 4AIOA 3APGA 1PAMA 4M1RA 1BG4A 4FLQA 1HL8A 1PPIA 3MV01 1J0JA 4PMVA 3S2CA 3GH5A 1OWQA 2EPMX 1SMDA 1B90A 3WUGA 5IXEA 1HKIA 3SCWA 1ITCA 2VZUA 4Z2LA 3K8KA 4V27A 4MNMA 1AMYA 3FW6A 2Q8XA 4MADA 3AROA 1NH6A 4ZE4A 4D71A 4CCDA 5M3WA 2BY1A 3UETA 3BLKA 2PWEA 2OWCA 3AS2A 3WBAA 3VIPA 3AJ7A 4BA0A 4WIWA 5CJ5A 2WXDM 1UZ4A 2WKGA 4KMQA 2XM2A 4KRTA 1RH9A 4M81A 2VMFA 3N12A 4IUGA 1CDGA 1W9BM 4ZXOA 1WZMA 4MAZA 4MNKA 1E70M 2OWWA 3VDAA 2ZX8A 1E15A 1ZBKA 2DT0A 5JUVA 3CTTA 1MW3A 2DDXA 3D5HA 3GYCA 1WDPA 1CPUA 4GIAA 1EDGA 1X6LA 3WF2A 4GI6A 5CPQA 4M80A 2XSBA 4OBRA 3NDYA 2J77A 3B8SA 3L4TA 1GCYA 4LYRA 1MFVA 1D2KA 2TAAA 5HOSA 1NARA 3W29A 1XV8A 3RM9A 2XG9A 1JIBA 4QFUA 1UH2A 1UD2A 1V6YA 1ODZA 1H49A 3NSXA 1QI5A 1H0GA 2VL4A 4X0NA 1NP0A 4QLLA 3ARZA 2OWXA 1CECA 3U5UA 3N13A 3M07A 1EGZA 4DWSA 1E6PA 3LPFA 1JI2A 1PZ2A 1B2YA 5IHRA 2ZXBA 3WD1A 3CUIA 1VJZA 4CN6A 4PMYA 1UYQA 3WUBA 3W53A 5I3DA 4YHGA 3AXHA 5KZ6A 3VD4A 3AHTA 5ABHA 3WNMA 2ZX6A 2CBUA 4MJ2A 2XSAA 4AD1A 5D8ZA 5A6BA 4HZ7A 2PC8A 1VEMA 2J7FA 3THDA 2G3JA 2XYLA 3AICA 1PX8A 1UOKA 3ALFA 4CD4A 4TX6A 4AEFA 3L4XA 4QDMA 3BCDA 3AS1A 1G1YA 3ZMRA
chains in the Genus database with same CATH superfamily
1TX2A 1QW8A 1XUZA 1XIMA 3E49A 4JTCA 1FWJC 3T0TA 4YCPA 5HMFA 5TBOA 4EOUA 4KCVA 2J79A 5DMMA 4IJCA 3WNOA 3ZLGA 3NSMA 2IQ0A 3WK3A 1EHNA 1TV8A 3O1NA 4C6MA 2XFWA 1M65A 1QUMA 2W91A 5LA1A 2QDEA 3VIGA 1X39A 4PE8A 3H2EA 4O19A 3TYUA 4LV9A 1ZPTA 3AZSA 4AZ5A 5M17A 2A21A 5CPOA 2DH2A 3VDCA 1EXBA 3GVGA 2V5BA 2OKOA 5G2WA 3VD7A 3V0TA 2VX6A 4LF1A 4H9ZA 4W88A 3P5ZA 3T44A 2XH4A 3PJTA 3AIRA 3DKLA 2E0PA 3GRIA 5FJTA 3IVTA 3BURA 1LJYA 3THUA 3TC7A 3UGVA 3W6LA 2VX5A 2UY3A 3MHGA 4KBXA 1XKJA 1HO4A 4IXHA 1E0TA 4R33A 3WLNA 4Q3MA 3TP4A 3M43A 3SCRA 1PL9A 3GIPA 1YX1A 4FX6M 1CGTA 4PEKA 2EPHA 2ESCA 4LAUA 4WEVX 2C16A 3KS5A 4LANA 2PMQA 1UD6A 4DJDD 1TVPA 3CZGA 3ABRA 2SFPA 5E6YA 1X97A 2JEQA 2JALA 2ZUNA 3FVMA 3OBEA 3PHAA 4QQUA 2J62A 2ZWYA 4WXYA 4EXQA 3OIHA 1J18A 4ZODA 4H2HA 5I03A 3MHUA 3NUKA 2CNCA 3N2CA 3ZFHA 1PO9A 3N04A 4J35A 1SM9A 3ZJ7A 2CLPA 4Z2IA 2REQB 5CPNA 3OVPA 5CC6A 3L2LA 3B0UX 3C56A 4GKLA 2DQWA 4Q8QA 2PGFA 4CU6A 3RFAA 2CBJA 1NF7A 2BY2A 2FDSA 4HCLA 4NX0A 3C2EA 1UKOA 4QX4A 3W7CA 4H01A 1IEXA 1TRDA 4LVBA 3QRHA 1L6YA 4W87A 3WBEA 2C71A 3OLEA 3WLQA 4H6QA 3U7BA 2POTA 4JXCA 3RN6A 4GZEA 3OLGA 2VEGA 1VBHA 2O9PA 1ISYA 4RE3A 4MJMA 3IARA 4R9XA 3LHYA 3TONA 3UPBA 5IM51 3E1F1 5TIMA 3HQ1A 1QASA 3TKFA 3VIHA 2YKKA 2GK1B 2Y7FA 3V18A 3O6CA 4Q8TA 3OGRA 3W2KA 4UTKA 1YBQA 3ZLFA 2VENA 1G01A 3F1QA 3ZT5A 1VF8A 5A8PA 1FKWA 3B97A 4JKMA 5FEPA 4PUWA 1UR9A 3M0VA 1M3UA 4TMBA 1RPXA 3I65A 4PMDA 1YYAA 3A21A 3FHQA 3KRBA 1TTPA 1FA2A 4KERA 4NT0A 9XIMA 1AQFA 1US2A 4LH8A 3V5CA 3KZSA 4F0HA 5E09A 4CEXC 2FH6A 1Z42A 4GY1A 1XC6A 2PFHA 3ZZ1A 3AS0A 1DJHA 2X2GA 2C18A 3IS4A 2V5CA 1OFAA 4IX0A 3PF3A 3QXBA 3II1A 1XIBA 1NOWA 3NZRA 2PLMA 2G3FA 4M6UA 2FGLA 3XIMA 4EAYA 4Q8WA 4M29A 1J6OA 4S2CA 3IANA 1UJQA 3SCUA 5D9MA 2XIJA 3NG3A 2PDFA 1PUDA 1TPH1 4KQNA 3W70A 2ZIDA 2VZVA 1R5YA 1G69A 4F0LA 2AQVA 3VGBA 5BU9A 4F0SA 3P14A 7REQB 1RJRA 2AOSA 3HIJA 4F40A 3DENA 3WBWA 3MSGA 3DYOA 1D9EA 3TROA 3N2BA 4PEEA 3WK1A 3N11A 3F2BA 1AVAA 4GX8A 4PRRA 1W5MA 3R0DA 4HCHA 3W24A 3AYSA 4MGGA 4UCFA 3EMZA 4RDVA 4CD5A 2QV5A 1FXQA 1SPQA 4IFKB 3WY1A 1XBYA 1YDOA 3RM8A 5CSRA 1EP1A 1JPMA 2WSKA 4C1NB 5F2MA 3THCA 4HMEA 2KAUC 3QF0A 3VMOA 3TSBA 3UCCA 4C5YA 1FFRA 5LSMA 2QCNA 2VVNA 2DPEA 4JX5A 3TTSA 3SM0A 4XWUA 2A7PA 1TE6A 2OZ3A 3ARQA 4IMCA 3G24A 3W07A 5HULA 3BG9A 1HP5A 4XV0A 5CGMA 1NDYA 3USZA 4N6FA 1LF1A 4X60A 1N55A 3VE7A 4CGTA 2HNEA 1C7SA 1VHNA 1ECEA 1NF0A 3CMGA 1EGMA 1MEHA 1S3HA 5I6SA 3CXOA 2R9RA 4X3ZA 2CHOA 4HOXA 4JYEA 5B7ZA 2I5GA 4XKMA 3GDBA 4L7ZA 3DU0A 4MF4A 4LRTA 2BTMA 3BLPX 3ZR4A 1ZCOA 2R91A 2DORA 3CQJA 4EPKA 4KH2A 1QPRA 1IZJA 2ZA1A 2VCCA 3GG8A 1JPDX 1TTIA 3VGEA 4MMWA 3QMTA 1KD0A 1WDDA 4IIFA 3PUGA 5HQEA 3KOFA 3W2MA 4U31A 5HNNA 1ZP4A 3OODA 2GVGA 4PUJA 1I60A 1TVNA 1DIEA 2QGYA 2IS7A 1GQLA 1CLVA 4MIMA 1ONRA 1OEPA 3WQGA 2X09A 3GG1A 1WAWA 4MVAA 4DPQA 3STPA 3B05A 1KBKA 4PA8A 4I7UA 1F2JA 8CGTA 3SCSA 4M19A 5D38A 1X6NA 2PF8A 3N19B 1UD4A 2C3ZA 5CJNA 1HKMA 4IQJA 4DBUA 2YLLA 1FWIC 1E56A 4XKYB 1KTNA 3MY9A 2VURA 1P6WA 5HWNA 3KBNA 4AMCA 5HAOA 3C3NA 1ZGDA 4GUFA 5LXEA 1NAL1 4H19A 1UP3A 3W86A 4HNOA 2HEJA 4S3GA 1T40A 4X22A 4CQBA 2OT0A 1BG9A 1A80A 2A5HA 1ME8A 2YLAA 5ABFB 2FZ8A 1TPB1 4PUKA 1W2PA 1XCWA 1XIFA 1OHLA 3GIQA 2OXNA 3UR2A 5G4HC 1LT8A 3WKZA 2J9ZA 3MVTA 5FJJA 4FA3A 1ZALA 3LK6A 2VQTA 3DIPA 1BVWA 4DNHA 5K9DA 4H1ZA 5CSSA 4K37A 2PWFA 2AAAA 1P0DA 4WX2A 4JCLA 4KIRA 3BV4A 3P8IA 4LGXA 1DQUA 4G6CA 3LERA 4S3DA 4LUSB 2VEFA 2YXOA 2EF9A 4UQAA 4RW3A 4GACA 2DIKA 1XRVA 2QS8A 4JFUA 3TR2A 2WNNA 1ZP3A 1BVZA 1RP8A 5LA0A 1GPWA 3EKLA 3QJAA 4D8LA 1OK6A 3BG3A 4IMDA 4RV3A 5LA2A 3WJSA 5BXSA 1GOIA 1XISA 1W1B1 2QXWA 1RAKA 2DIEA 2PWVA 1RVGA 2Y6ZA 3VPLA 1ZS2A 3E3HA 3W26A 3ICJA 5FJOA 1PZ3A 1XLBA 1UROA 1UUQA 2R1LA 4JZ5A 2DUXA 9XIAA 3VNKA 3NZ1A 4CLMA 1AG1O 3C52A 4F2TA 4H8HA 4EE9A 3ZOAA 1C8YA 4UQEA 1VPQA 2FZNA 3GK0A 1EZWA 4ZO6A 4DZAA 4IIEA 4JQ4A 2A3HA 3K1DA 5I7GA 1S2WA 3IAPA 1BTCA 4GFIA 4UFJA 4Y90A 4UQCA 4C7GA 1DQXA 4A3UA 4HJFA 3U2OA 3IUIA 2HXTA 3KOZA 6PTDA 3GH4A 1M7PA 1X96A 1GOKA 3MCOA 3UD6A 3QVQA 1DTNA 5D2WA 3T81A 4D1IA 2D22A 3K8LA 5I07A 2RKXA 1WKDA 4Z0SA 4UBPC 2J7CA 4JIEA 1A4LA 1R3WA 2WC3A 4L5ZA 1KM5A 4U5IA 4AD5A 2C1GA 3QC3A 4CEUC 3UNTA 4U28A 3VFCA 4NHVA 1XSIA 1IHIA 1BYAA 4K36A 2VYOA 4PL2A 4X2RA 5FKYA 3CUFA 1O94A 3WEZA 3NURA 4UIOA 2RGLA 2WCSA 3WFLA 3LCWA 1DJYA 1M41A 1R2TA 3FEQA 4ZQNA 2PDYA 1EBGA 3VNIA 1O12A 2ZE3A 4HNUA 1NSJA 2XJ7A 2XGZA 6CGTA 4MNLA 1V0NA 4RUBA 1UR1A 4JN6A 1A5KC 1VFHA 3R2GA 4DUVA 2A3AA 4C6BA 3PPHA 1UKTA 3EMCA 1W32A 2DJLA 3T2QA 2OSXA 4EVZA 1MUCA 1FWSA 4AC1X 4NYUA 3G22A 1LL7A 5BRBA 3NGFA 3MO4A 4DZHA 1MW0A 5CLTA 3RK8A 2VKZG 2TODA 2O56A 3TWAA 4AD3A 3T1GA 3GFYA 2ASHA 2WNWA 1DJIA 3UW6A 2INFA 1GOXA 2PDKA 1NDZA 2FMOA 3W7LA 1CLKA 3H7RA 1ONWA 1GOOA 3AS3A 4R53A 2WBGA 3DGRA 3CHVA 3NQ8A 3LTPA 3W84A 4XX6A 3EX6A 3SJNA 1TQXA 3PJUA 3H53A 4QEEA 2GDUA 2V5JA 3OG3A 5KINA 5AHFA 4FNRA 3GZAA 2CERA 3N73A 4WY0F 2FIQA 3S47A 4D6FA 2DUZA 3U4AA 2WMJA 3INPA 4E8GA 2ABBA 3G0UA 4WQ6A 1O7AA 1SR0A 5E5CA 3NYZA 1H7XA 4XZIA 3MYPA 2CW6A 4JQ2A 1XLEA 4H4IA 3OGSA 3AOFA 4JN7A 4PBFA 4WD0A 1OC6A 3H2MA 2ZBTA 1Z44A 4DAIA 4QISA 4M3PA 2AQWA 2X1RA 1FQ0A 1M6JA 4JL1A 3UJ2A 1T8QA 4BWLA 3GHRA 4UR8A 2A7NA 2CEQA 1MZHA 1MVYA 1RQHA 2E40A 2E9LA 3N17A 4GH3A 5JH2A 4URIA 3EB4A 4JDBA 4HYVA 4JNYA 1V02A 3B9AA 4AWEA 3U5YA 3VIJA 2WK2A 2I16A 3PZMA 1LRTA 3VIFA 1I6NA 1I0BA 3A4AA 3JU2A 3LPPA 1KBJA 5A6LA 5JU6A 1A49A 4U2YA 1PZ0A 1W8GA 4F9DA 2EJ1A 2FFIA 2WJFA 1E9ZB 3SRDA 1BQCA 3MMUA 3QZ6A 2X2YA 3LRLA 3TW7A 2V8ZA 4GXWA 3WH9A 3NQGA 4RKAA 2ZZ3A 3V7PA 2PTYA 4MLJA 4F79A 1HUVA 1KM2A 2V2DA 1BF6A 4O13A 3S9IA 4KWVA 1WB0A 5D9OA 2GDQA 1V0KA 4O1EA 1G7VA 3P2VA 1ICPA 3N9KA 1H5YA 3WLLA 4IUOA 1NP2A 2DSWA 4V33A 5CSYA 5CZKA 3LSCA 4X0VA 4Q6XA 4FR6A 3V5OA 1DWHM 1GW9A 1ZQ5A 4OECA 2FHBA 4D8ZA 4X63A 3USBA 3S2MA 1HKVA 3L7RA 1EQPA 1E6XM 2QPUA 2PDBA 1FP9A 3KVMA 2YL8A 3NPUA 3KUMA 3EXTA 2UY2A 2ZRZA 3VDGA 5C5YA 1B30A 1YXYA 2VEMA 3U3HA 3BE7A 1VRXA 1QHZA 2GYIA 3AUOA 1H41A 4IZGA 3MB9A 3SB0A 3WDHA 1CEOA 4CQ9A 3SW6A 2DVXA 3RNDA 1CXFA 1BF2A 1XYCA 1X7FA 5H2ZA 4N9EA 4S2BA 1EIBA 1RQEA 4A05A 4F4RA 2GQ8A 2A2IA 3KZPA 3RMEA 4AWSA 4ZA0A 2J8GA 3GG7A 1LOSA 4H8NA 4W84A 5I0DA 1Q3NA 4K39A 3LN3A 1V3JA 4ZFMA 1B31A 3ABOA 3L2MA 2KX9A 1HW6A 3JW7A 1LWHA 3BDKA 2VFEA 1E4NA 4H83A 4GGHA 3E6EA 4B5NA 5T8GA 2CKRA 3UWEA 4AZCB 2OKTA 3LDVA 4AZ6A 2OU4A 4UFKA 3UT0A 3WH8A 1XLAA 3CYJA 1CB2A 1XLGA 4R85A 4FNUA 4HPHA 2QVHA 3HG5A 5LIUX 1HVXA 1E55A 4WF7A 5BZAA 2OT1A 3WQOA 2UY5A 2ACSA 3M47A 3B3DA 3I6EA 3AO0A 3PBYA 1CGUA 4OV9A 3RO6A 4GWEA 4LVDA 5BOFA 3I3DA 3MS8A 4JX6A 1KBBA 3N1AA 5LYRA 4NG3A 2V2HA 4WOQA 1AW5A 1OCBA 5JBEA 2OCZA 2G95A 3QQ0A 4LYKA 1R3VA 1DWGM 3RPMA 2YXGA 1TPUA 1FH9A 1Y0EA 4AHOA 5AYIA 2VGBA 3ZSSA 3R8GA 1MSSA 4XK2A 5IFTA 2Z2AA 3W1NA 4PMJA 4DJDC 2PDIA 3ARXA 4X2PA 2D2OA 1GTEA 3RGTA 3M7SA 4MDOA 5EMMA 5LNSA 4QTGA 2Z24A 1P43A 2R1MA 3H26A 4AD2A 1C92A 3BW2A 1W91A 3UYCA 3PZQA 2ALDA 4UFHA 2FHCA 1FBAA 4LC6A 2DVTA 3MWCA 4E4FA 3UESA 3UY8A 6A3HA 3PTKA 1A5OC 4Z2GA 2ACUA 1FWWA 3ITYA 3AMLA 5A8GA 3LBMA 2HE5A 4Z08A 2F61A 3CUZA 4O15A 1PIGA 1QT1A 3SIMA 1UIPA 1KWGA 4AZ7A 4LVFA 2OQHA 1CCWB 2VO5A 4UB9A 2QNEA 3UWZA 3RLUA 2OLAA 1GKPA 1U1JA 1UWSA 4ZTYA 3KTSA 3LHWA 1PB0A 4Q33A 4HA1A 4N0RA 4AB4A 3M0XA 2XZ7A 4XAPA 5AVNA 4I8DA 2PP1A 3KTCA 4J4KA 1V0MA 5HMSA 1KFBA 3WLMA 3QW3A 4EAMA 3A5VA 2B4GA 4ZBCA 4LAZA 4NJGA 3M0YA 4BFAA 4DB7A 2WVSA 3EA2A 1WOBA 2BOFX 2ZUVA 2ZRXA 3H2AA 3DEQA 2NX9A 1ZL1A 1MDLA 3W2JA 5F2GA 5AC7A 3C2VA 3EOLA 4BF5A 2V69A 1YTDA 4Z1DA 1E40A 2J13A 6XIAA 2XSXA 1P1MA 2V82A 3T09A 2CLOA 3UFYA 2WBKA 1QW9A 3CV6A 4OJYA 3G8EA 5HQMA 3HPSA 5CJMA 1PZ1A 1OX4B 4H6RA 5C2XA 2VUYA 1VIWA 2VCBA 4NJKA 3U2CA 1R7OA 1ZCCA 2ACRA 3CB8A 1Q63A 3U0HA 1JUBA 1FWTA 1XRTA 1B54A 3TFCA 3HJZA 2ZFAA 1NDVA 5G5IA 2W62A 3ZVHB 1H50A 3FXYA 1XIGA 5H8MA 2AMXA 3E0WA 3S9ZA 4OFCA 4A22A 1UR2A 3PPCA 4I6KA 3M0KA 5LIWX 4LUTA 1JD9A 4FK9A 1EX5A 5I3JA 2J24A 4W5UA 1ICQA 1OVDA 3BOFA 4MDPA 3HGSA 3I7SA 2G97A 1E9IA 3IAQA 2ACQA 3VCCA 5C9XA 2VFGA 4JEQA 1BD0A 3LG3A 5AHIA 1OB0A 2WW5A 1WAUA 4MOZA 1L0PA 3CLWA 5D2XA 1A47A 1HX0A 2YCIX 2WSRA 3VUPA 4EWND 2A79A 3UXKA 4F0MA 3GVRA 3ARPA 4JD4A 3TZNA 3RRXA 5FF2A 3WNNA 2VQUA 1AMKA 3PB0A 3GO2A 3BMXA 3PY2A 1OJXA 4B9ZA 2CBVA 1FWDC 3WLKX 3DHPA 1GG1A 1XQKA 1Z48A 1Z6KA 4UMAA 4YLWA 3PZNA 2CZFA 4IMFA 4DAFA 2QJMA 2BHZA 3W0KA 4K68A 3E0LA 2ZZ7A 1N8IA 1JD7A 4H41A 1W5PA 5ABTA 1LM1A 3IK2A 4I9MA 4IIHA 3BG5A 1OC7A 4MKNA 1PJ9A 1QOXA 2ATSA 1KFLA 4W8LA 5LNUA 3KOWA 1QVBA 4JIRA 5A95A 3TR9A 5D33A 4ZB5A 2ZTKA 2E1DA 2Q8LA 1YDYA 3EEZA 3S1XA 3UJFA 3QZEA 1SSGA 3GU9A 3RIKA 3P5YA 3T55A 1W1A1 3OB8A 1N8WA 4PGLA 1DP0A 3C8FA 1UWTA 1YTEA 1TREA 2HBXA 3GC4A 3L4WA 3AHVA 1PX4A 3I68A 2XVKA 1EH9A 1FUYA 1GUVA 4PCFA 3QGVA 3F5KA 3NXLA 1G4SA 3HFTA 4ZR8A 4JTAA 3ME3A 1C7TA 3CUHA 3VNMA 1XDJA 3HGOA 1LBMA 3E2VA 1AA1B 1HG3A 3H4XA 4PTNA 5M1TA 3TV8A 3DXIA 4W7VA 4YN5A 3WN6A 1PTGA 3L0KA 2QEZA 3W02A 3CZLA 1JF6A 1PDZA 2E3ZA 3PBUA 4B15A 1XX1A 5CH9A 1P7TA 2V68A 3E0IA 5G1TA 2GVJA 1OIFA 3OZPA 3RU6A 2H3DA 2JKEA 2WOQA 2ZUWA 3W85A 1QI4A 3VKKA 5DRCA 2DH3A 3GFXA 3MI2A 1EO5A 1SU5A 3MWAA 3RR4A 3AC0A 2GGGA 3V4BA 3S83A 1Y7VA 3APTA 1T6MA 4F2UA 3A23A 3UWUA 3PJWA 3P93A 4BEUA 1ZRQA 2V5LA 2C0AA 3MO7A 3WMLA 4L6HA 3S1WA 5HMEA 4Y9NA 3M4HA 7ENLA 4NILA 2Y24A 3OBAA 1HKKA 1YTKA 5REQB 2HPMA 1WZLA 2PODA 3AI0A 3D3FA 2OYKA 1MEWA 5E0CA 4IJBA 2VT0A 3MI6A 1CI1A 4XZHA 3QY8A 1H2JA 4PTXA 3UA4A 3EX1A 1S3TC 1OK4A 3NPWA 1OADA 3G3DA 4HBKA 4DYEA 2FB3A 3QGAC 3TCSA 3N4EA 2H9AB 4FNTA 4DYJA 1A5MC 1V08A 5U4NA 2A3BA 4MUZA 4G8TA 3AXXA 2OOFA 2GDVA 3SR7A 4MYXA 2PDPA 4UTJA 1CBGA 5FF3A 4LALA 3DBNA 5FF7A 3PM6A 3N29A 4ADTA 2IKJA 5EGRA 2QW5A 4I7WA 1UA3A 4L61A 1I1XA 4OQVA 3H4GA 4FP1A 2F6UA 2EPKX 2HWGA 2QCDB 4KWSA 2Z25A 3A64A 3VFLA 1AZ1A 5I3KA 3UWVA 4QE5A 3GDRA 4HGXA 3C86A 3APGA 1PAMA 4M1RA 1BG4A 1EJSC 5AYZA 1JDFA 2X41A 5C2GA 3HZ3A 3FOKA 1SMDA 3ANUA 4UNKA 1HKIA 1ITCA 1FRBA 3TQKA 2VZUA 1OFPA 4V27A 1Q7QA 4LUIA 2A7RA 3PNUA 1AMYA 3GU1A 2Q8XA 3TU9A 4RJEA 3COTA 4GHRA 4NIRA 2PDHA 4FOJA 5I09A 3GNDA 2VWTA 3NPVA 1MUWA 3F7JA 3S2LA 4QE1A 1JCMP 3LCLA 1Z7AA 3U2EA 3GDMA 1KFCA 2BB0A 4AHQA 3RCYA 3IGSA 3TN4A 2XM2A 4KRTA 4ERAA 4S39A 4IUGA 1EF3A 4K2SA 1CDGA 1KBLA 3UU0A 2ISSA 2YPIA 3TMLA 1E70M 2OWWA 1X1ZA 1E15A 1K8YA 1ZBKA 2Q02A 1Z9AA 3VAVA 4C1KA 3AAMA 1CPUA 1H7PA 1EDGA 1EC8A 3WF2A 1W0MA 3M5ZA 5CPQA 4M6PA 1QPQA 1MXSA 1UMLA 3CPRA 2IKHA 4PR4A 1F05A 2POZA 3A9IA 3OYZA 4LYRA 4IQLA 1A5LC 3ES8A 1D2KA 2DU2A 1NARA 4E38A 5HOSA 3NQMA 1JIBA 4QFUA 2B7NA 1VYRA 3KP1A 1ODZA 4IWWA 3WLIA 1H49A 1V93A 4B2DD 3NSXA 1OCNA 1OYCA 1ZAHA 1D8WA 5E93A 1NP0A 3SADA 2QCHA 3M07A 1GK8A 1EGZA 3ZVHA 2W3ZA 3FSTA 2QJJA 4DWSA 5CG7A 1J2WA 3LPFA 4UUIA 4MWAB 3R10A 2GPTA 4MY1A 3V5FA 3WD1A 2OZTA 3CUIA 1VJZA 1R6WA 2V2CA 5RUBA 3S8HA 4PUUA 5I3DA 3AXHA 5EPDA 1EKOA 3UY7A 1EP3A 3SBFA 5KZ6A 3AHTA 3S1GA 1IYXA 2CBUA 4KW2A 3HG3A 3NGJA 1DIOA 4HZ7A 4DRSA 2PC8A 1VEMA 2J7FA 5DANA 4GVIA 3T9PA 1RQBA 3V1PA 3AS1A 4UTLA 2ONEA 3EPMA 4JQAA 1SJAA 4N7QA 3FA4A 1JZ6A 2GJNA 4DBEA 3GFZA 1AFSA 5E9AA 3TIMA 3VIKA 3K8MA 4S3CA 3JZUA 1VLIA 2H3BA 2O9RA 1R3RA 4F66A 4LBRA 1TJ0A 5G1YA 3CL7A 4JNMA 1QPOA 2VR2A 2DSVA 3BZGA 3C3UA 4IPLA 1OC5A 3SCVA 2EBNA 2R24A 3I10A 3MUCA 1WP6A 4Y7EA 2YXXA 3TX9A 3UG5A 2AGKA 3SRFA 3IGUA 2YX0A 4S3BA 1UJPA 2GSHA 3EKGA 2ZVIA 3VO0A 3RLHA 3CQHA 1VBGA 4DVOA 1Q7ZA 2YCLB 3MV11 1CXIA 4CU8A 3VX0A 3VKBA 5D03A 4R3UA 1QI3A 1QO2A 4WRHA 4OBSA 4CNSA 1U2YA 2D3LA 1MNSA 3T0DA 3RDKA 4FX7A 1H3GA 4QXIA 4AU0A 4EWJA 1YXDA 1HJSA 3AQUA 1V6TA 3FJ6A 3N15A 1Q2SA 5HBFA 4HK7A 1HF6A 5F2LA 4ROPA 2YW3A 3BV7A 3SURA 1US0A 2GUUA 3PAJA 3PK7A 5KZEA 1JNDA 4Y9OA 1C9DA 4R7OA 2WZEA 1X8CA 4GQGA 3IGHX 3W88A 5TNVA 5FEZA 3J7HA 1ML1A 4IP4A 1ZBWA 2RFGA 3QV7A 1OABA 4CN1A 4JFTA 3H12A 2NQLA 3KLLA 3ARYA 2P1FA 3W37A 4FNPA 2C91A 3MDWA 3R12A 2O4QA 1TZ7A 3BAXA 1XFBA 4GD0A 1H0IA 2C1HA 5I5RA 2CETA 5FACA 1GG0A 2CZ5A 3CL6A 2UV8G 1CNVA 3R5EA 4NZ1A 3DG3A 3QR3A 1X38A 4D9PA 3RPDA 4F0RA 2XWDA 4RPPA 3IGXA 3QR1A 1R0MA 3GHSA 2F6XA 1S1RA 1XIDA 3KCOA 3PFRA 4E8CA 1FWCC 1DL3A 4B5VA 4JTHA 4NJHA 2NVDA 3ABZA 4DXXA 5FSDC 1Q6FA 4UQDA 4M7SA 5CGTA 1VEPA 4G1KA 5D9PA 1JPIA 1XLJA 1RBOB 3BPWA 4D6HA 3G6MA 4DM2A 1E1EA 2G96A 4OBTA 4QAWA 4IM4A 4EPEC 4W85A 1NM9A 2Z1VA 5D02A 3W82A 1KC7A 4QGCA 3KBVA 1EIXA 3DFYA 3LM7A 2PS2A 1A5NC 4REQA 2BVTA 1TR1A 1F5ZA 1MQRA 1RP9A 5EFDA 3QMRA 4G7FA 2QJNA 1O5XA 1DWIM 4AZCA 5FEXA 2O55A 1A4MA 2D2HA 3N3TA 4B4FA 3CH9A 3WJWA 4NP7A 3ARSA 3C6CA 1I9CB 5MKGA 3TH6A 4MFEA 1R2SA 3G3MA 4ZQRA 3AMDA 1H60A 2QPSA 3ARWA 3WNPA 3R0UA 2Q6ZA 2YL6A 2V0TA 4JTDA 3B4UA 4FIQA 1TFVA 4HYWA 5JQ9A 1QNSA 4HNNA 4ONVA 4FLSA 3AIVA 3STEA 1TELA 1F3EA 1FH7A 1E6SM 4Q7BA 3SAZA 5A8QA 3LHZA 2F84A 1ZBVA 3DFQA 4BQ4A 1SW0A 1QFEA 5E0KA 4OOUA 5H1WA 4QCEA 1HO1A 1BHGA 2YYUA 2GQ9A 7TAAA 2OO0A 2ISFA 1XSKA 2XVNA 2YBTA 2R82A 4GYPC 2OSYA 5J5RA 4GGBA 5JH1A 2CLKA 2P8BA 3A6OA 3WF4A 2BOGX 2QJHA 3W81A 3JVAA 1THFD 4E3VA 2VELA 1KM6A 4GQRA 2V5KA 5KZDA 3WLOA 1IR2A 5IOBA 3WD0A 4Q4QA 5FJUA 2FYMA 1VCGA 3V16A 4A2SA 2Y62A 3P84A 2PPGA 5EMYA 1IWAA 2VRJA 2J7HA 2O4MA 3OG2A 3FYPA 4WDTA 3WQEA 1D3HA 1PTAA 1M7XA 2X16A 1SW3A 4YIWA 3HF3A 4LVAA 3DN5A 2XIBA 1SO4A 1TV4A 5D2YA 1DYSA 1RJQA 1QPKA 2G41A 4B3KA 4N4PA 2ZZ5A 5GVJA 4FF7A 2GJLA 1Q45A 4YJ5A 1F8MA 2PWGA 3SRKA 4Z2JA 2D69A 3UJSA 5K9XA 1W1YA 1P6CA 4PSRA 1UZHA 1SVDA 3VD5A 1YPIA 2WC7A 4KGLA 1IZCA 2OEKA 5KMYA 2WMFA 3O0KA 2O7QA 1QAPA 1YPXA 2OJPA 3UJEA 3M16A 2FGBA 3NQEA 2FVLA 2D1ZA 3DOPA 1XBZA 5DXXA 4YYFA 4LFYA 1Q6CA 4B92A 1H63A 1TRIA 3TYBA 3VIIA 4RE0A 4YYCA 5AHNA 4LTSA 4Y2WA 3MJMA 1HVQA 4RR4A 2F38A 4JCMA 3VNZA 5DXYA 4MAVA 3TFXA 3W25A 3NM3A 2PTDA 3OQ8A 2HTMA 4UFMA 4QAIA 3ECQA 1QTWA 5A8MA 4NAEB 4GIEA 1BXCA 4IFOA 2DGAA 2WSPA 1QK2A 1UZDA 1TUFA 2WVTA 4MHBA 2YA2A 3I7RA 1O68A 2D20A 4GMEA 4N2YA 5D2TA 5HATA 4K1WA 4LNYA 3HJEA 4PMXA 1WCGA 2X1SA 3ITXA 4DN1A 1AW2A 4C60A 3UR8A 3V36A 1N7KA 4XUGA 5CXPA 3CYVA 1JQVA 3TA6A 6TAAA 4OTKA 1EC7A 1J8VA 3M46A 1VIZA 1OX4A 3TXZA 4MB3A 3WLJA 3JUGA 3LXAA 1V8EA 2I9UA 2PTWA 1W3KA 2ZRWA 4BF9A 4IPNB 3KXQA 1KCKA 3AYVA 1EJ7L 3BUVA 3HV8A 4MPKA 5DT7A 3EOSA 3LI1A 4GCXA 1EJTC 4ASTA 4O0KA 2CWNA 2DZSA 2RDTA 1K8XA 2WCAA 3WEOA 1HL2A 1EQCA 2X0HA 3QMSA 2J9XA 1DTUA 1RHCA 2OEMA 1CGWA 3N25A 2Z1BA 1QBBA 3LHUA 2VHLA 4D2JA 3NYDA 4K38A 5B7YA 2I14A 4C6NA 4TV6A 3SCNA 1NIUA 2VI0A 4MJZA 3B9EA 3G1AA 1IE7C 3S5YA 3TZFA 1W5QA 4B5SA 4E4PA 2HISA 2WCGA 4AEOA 1SW7A 4J3XA 3FSUA 4AZHA 1U22A 1GORA 1N82A 2AL1A 1PHWA 2YJQA 4GVGA 3TJXA 4DZ5A 5HNUA 1MI3A 1NOFA 1BSIA 1XCFA 2RAGA 4ES4A 3QV9A 5DCEA 3EOOA 1BYCA 2VZOA 4JX4A 2HBVA 3LPGA 1RV8A 4XTDA 3W28A 1K9TA 3A12A 3LCXA 1UB3A 3SSZA 4CQ8A 4FLOA 3CTLA 1KA9F 1AD1A 3W27A 3EX2A 4Q4OA 3P3BA 4CQCA 4L65A 1MMFA 5K7JA 4O1CA 3VU2A 3P7YA 1OYBA 1GOWA 1M01A 2YOCA 4MKVA 4QNWA 4LCSA 1S5VA 2HROA 4TR9A 5AC4A 1XP3A 1UKSA 2EG7A 1V3HA 3S9YA 4DPPA 2ZUMA 3S0CA 2DZVA 2DV0A 2PURA 1WUEA 1WQ5A 2J74A 1NFBA 1WZAA 4O17A 1B3YA 7PTDA 4GJJA 2PGWA 1PKNA 1UCWA 3CMFA 2NV9A 4C5ZA 1QOQA 4CVWA 5A3HA 3CJPA 2DEPA 1RVKA 1A5AA 4P2VA 3TJIA 2PC4A 4V1XA 4EF9A 2W6RA 3N2XA 2H8ZA 1EJXC 2J75A 3W4RA 1A3HA 1ESWA 1T0OA 3OVGA 4QHRA 1RSCA 2JEPA 1K02A 1AL7A 3MMTA 3TLQA 1TJPA 4IG2B 4D6JA 4DWSB 4XZ9A 3TYCA 2GVLA 3W1XA 2QR6A 1SQ7A 3FGCB 1J2BA 3OZMA 3EXSA 4HU0A 2GJRA 3T7VA 3DC0A 3U9IA 1HT6A 2C79A 4RW5A 4NVTA 4WSHA 3WD4A 2NV1A 4HK6A 5IBXA 1UPPA 2G5WA 1ISVA 4XUYA 2WB5A 4Q8OA 4A3QA 3MZNA 1TG7A 1UD8A 2DUAA 4IFRA 3E2RA 3GDTA 4FMVA 3Q67A 1TIMA 3WJZA 4KWUA 4FO4A 2OEJA 1JZ5A 1J9YA 2OGYA 1H4PA 1KBIA 1YNYA 1V79A 1J6PA 3QPEA 2HS8A 3NPXA 3WUFA 1HXJA 3LENA 4GI9A 3GXFA 3ITLA 4GNJA 3T6CA 3W74A 1MRQA 3QY6A 1Q2RA 2G50A 2DSZA 3NQBA 3TAOA 3W1TA 4J28A 3WQ8A 1YQ2A 3EWDA 1XLFA 4RNHA 1TE1A 4U10A 3M44A 4C90A 4XBSA 2RUSA 2YDQA 5F7UA 1OFOA 3PP7A 5HDRA 2OX4A 3LQLA 1OFRA 2ADAA 1R86A 4ZTXA 4FX8A 2QIWA 5TQLA 1MRAA 2GJXA 3NWRA 3MSRA 3APYA 3H24A 4INFA 3WLTA 2X0YA 1M7OA 4KESA 1GZ1A 2BGSA 5BMXA 1LZOA 5GNYA 1KQZA 5AYYA 5FF4A 2DZTA 1XDLA 1W9DM 4WCJA 3R1ZA 2VM8A 3AIWA 3GBDA 4IGNA 3TYZA 2IMRA 3HQNA 3MSDA 2WHKA 3S1VA 3E5BA 1DORA 5IFPA 4IMGA 4S3AA 3VKJA 3VOHA 1OZMA 4UZSA 4JS3A 2ZKMX 2VXNA 2CXGA 2XH7A 1W5NA 4YL2A 1U5HA 3BLFA 2O92A 5D05A 2PCEA 2FDMA 4I6VA 2EKCA 4B2DA 3EMQA 1QJWA 4KWOA 5HINA 3H8AA 3KEHA 3AHYA 4QLJA 4DJED 3CGTA 2A6LA 1F07A 2R1KA 3B8VA 4KKXA 3NDZA 1U83A 3LLFA 3GNXA 3CZEA 1W6TA 1TPEA 2C0HA 1EXPA 1TYGA 1IGSA 2Z4GA 3VMNA 3IIPA 4MB1A 4RZBA 1XICA 4HOWA 1CGVA 2Y5SA 1FXPA 2CIPA 3WH7A 1XD0A 1JFHA 1TV3A 3WD2A 4RXGA 4QSHA 4NYYA 4P8VA 3VXGA 2DSKA 3N14A 4HVXA 3FLUA 3LLXA 5MKGB 1E4IA 2XHYA 3L0NA 3N2TA 1I1WA 1V4YA 1PYFA 1L8NA 4KCUA 5CQ1A 1FP8A 3R8RA 1W2VA 5C55A 2OGJA 4Y6GA 3ALGA 3NZQA 2RDWA 3W1PA 1EYEA 1G0CA 1XKYA 4R5EA 4S3JA 5HPOA 2QAFA 4JKKA 2J7DA 2QZRA 2NT1A 4BQ5A 3W72A 3ABQA 4GFSA 4LQ1A 3TQVA 5G2HA 2E77A 1HJQA 3WBYA 5SWUA 1M5WA 3PZ9A 4HB7A 4L6DA 4J40A 2HK0A 4ZQOA 4JHZA 4QS5A 2WZMA 3NSNA 1F8IA 4P7QA 2XTKA 3ZIZA 3OVRA 4IL2A 5A1AA 1H62A 2LLEA 5DT5A 2XM1A 4O4WA 1LQ2A 2G4JA 5A6AA 2CYGA 2Q3OA 4Y96A 5H6HA 3QY7A 1QBAA 1V6UA 3M6YA 5BROA 2VX7A 3GLCA 3OLIA 1A5BA 4NNCA 1LUCA 5C70A 2W4XA 4AISA 3OOQA 4XZWA 3TDFA 4QM1A 1MFUA 3PSVA 4NY2A 4PUEA 4LT9A 1U33A 1I2RA 3EWBX 1T8XA 1ELSA 1A3WA 4PZVA 4JPGA 2WZHA 4ZVJA 2QYGA 1V6VA 3W7DA 4W8BA 2E6AA 1SZEA 4QJ3B 4NI3A 1FDZA 1E0XA 4U3CA 1F9CA 1IXQA 3BQ5A 4GJIA 1C91A 2J78A 4GJ1A 4J3WA 3FAWA 3KP0A 4MNJA 3NZGA 3TXVA 1NWRA 3WDRA 4JHMA 3NQFA 1KV5A 3F4CA 2X7VA 3FNDA 5FL0A 1W1IE 3GNPA 2GGEA 1JL8A 5HWMA 3HG4A 1RALA 1BLIA 4CKQA 4A3RA 2D2GA 2IW0A 3AWOA 3WL0A 1UR8A 4DUXA 2NWRA 4H7VA 4NZCA 1FDJA 3CHFA 3EPNA 3ZVIA 4LVGA 2PUZA 2GL5A 1HTIA 3WUEA 1UC5A 1OFDA 4FOKA 3FA5A 3T2OA 3DH7A 4DO7A 4MZYA 2Y5JA 1UP0A 3OIXA 1KXVA 2FHFA 3WQ6A 4A3HA 4AY8A 1Q85A 2EPNA 2BV9A 2WWCA 1R3SA 4WK9A 4JHOA 2VEKA 4R27A 4O28A 2G3IA 4IXXA 3N4FA 1RR2A 3CC1A 3PWIA 3VDHA 2E5BA 3LX9A 1B3OA 3VOFA 3W76A 1EDQA 3EWCA 5FSEC 1OINA 4UXDA 4AX6A 2VOMA 3JZEA 5GNZA 4WR3A 3RG6A 4D6CA 2WQDA 3G6LA 3GXPA 3SIZA 3P61A 4UC5A 3DDMA 3A5FA 4XSMA 1G9HA 2ZZ1A 1UG6A 1BWLA 1KR1A 1PKYA 1ZUAX 4C6EA 4L9YA 5I02A 1Q6GA 1M68A 4X9YA 5EY5A 2ZA2A 4QLKA 4XD3A 1XG4A 5I79A 4ZEPA 5I2UA 1E43A 2NVAA 3G1XA 4AIUA 4CCCA 4K8HA 4BCEA 2IKGA 3XISA 1TV2A 1VC4A 4LAKA 2BDQA 2XWEA 4XAZA 1RD6A 5LIKX 1I2PA 3EDFA 3O6DA 1JF5A 1YHTA 1E9YB 2CITA 2DJXA 1JZ2A 4U2ZA 3LU2A 4GYPA 3TC3A 4ALDA 3KBWA 1Q65A 4UCGA 2ZUTA 1K70A 3UR7A 1JJKA 3HGJA 3OHIA 1FVPA 5ABGA 3NVDA 2A4AA 4AW7A 2BVDA 1ONXA 1GHRA 1Q6QA 1BPLB 3QW4B 4JTTA 2UZ9A 2PRLA 4CNUA 1B3WA 1G67A 2ZDRA 5CPSA 2NXHA 4DO6A 3CV2A 1LTDA 3TTOA 1HJXA 2QCLA 4P8UA 3VOCA 4TVDA 1R8LA 4LUTB 4EIVA 4ERIA 3W9ZA 5ABFA 4Q7NA 3RX2A 3WLHA 3LSBA 4B16A 2PGRA 3IIVA 2TMDA 4S3KA 3CAQA 1TTJA 1VAHA 3V1HA 2VGGA 1E6QM 4I5UA 4DO5A 1VGAA 3BMVA 3IPWA 4C6IA 2W9MA 3W1RA 2VC9A 2QCMA 4US6A 3OQEA 1I2OA 1MDRA 3GE7A 3W2UA 3VVGA 1UWAA 3G2GA 3REQB 5AHEA 1K3UA 3FX4A 3L2IA 5LKYA 4MY8A 4PBEA 3BWWA 1Y65A 1B1YA 2R1PA 4NZFA 3ZR6A 3BJSA 2Z28A 3EGJA 4XB3A 2OLSA 3DGBA 5D30A 3QC0A 3SUSA 2D3NA 3W71A 1GKRA 2WJDA 1VYPX 5HWJA 1LWJA 1KLYA 1K7XA 1UQZA 4U33A 4GABA 3QR0A 1FFQA 4POCA 2Q8ZA 3A4WA 1ZJIA 1S5WA 2XGBA 3PVFA 2BFGA 3AIEA 2FZDA 3EDKA 1CX9A 1YKWA 3LBOA 3DYMA 3GUWA 4GQBA 5I3GA 4BY3A 4CNOA 5L6UA 4CNNA 1W3HA 4HN4A 1RCQA 1XH0A 3F4VA 1Z32X 3GIYA 1HNYA 2GJXB 2ZCGA 4YU1A 2IXUA 1AQHA 3T05A 4HD5A 2O0TA 1ZB5A 1R2RA 4QR6A 2CPUA 4LU0A 1OBAA 4AZIA 4OZOA 4AFYA 2Z6JA 1H1YA 2I1OA 4ACYA 5LGZA 1JUKA 1XL9A 1XYBA 4N9BA 3ZT6A 4Q8UA 1AJ0A 2I56A 3FIGA 1HJUA 2ON3A 3VDBA 2GWNA 5JIPA 2OB3A 4DUWA 2AKMA 3AZRA 4IMEA 3NFUA 2FGZA 4GO9A 5JIWA 3GQYA 1Q6EA 4PTWA 1IGWA 1CIUA 2E9BA 4LPCA 2YDSA 2YCLA 4TVCA 3VE9A 5LNVA 3MQTA 3V75A 3MT1A 4JL2A 4CQAA 2ZX5A 3M0LA 2PDNA 1XC4A 3TW9A 3S42A 3WF1A 5AB3A 2DT1A 4DLMA 2W79A 3W38A 4HA3A 3LXCA 3QOKA 1JDDA 2P0IA 1EPVA 1KV8A 1UWRA 4U4MA 2P5NA 3PSWA 1BTMA 3VNJA 4ATDA 7TIMA 1YDVA 5A6TC 1OGGA 2Y7GA 2CLIA 3WQ4A 3GVVA 3O2LA 3KM8A 3REQA 2NZLA 1V3LA 5C7HA 4NZ3A 3K2GA 3DI0A 1TKKA 4O16A 2W63A 4N6EA 3CH0A 4UOZA 2VEIA 4IF2A 3VZXA 3MUAA 1W9VA 1GTHA 4B3LA 4GBUA 3UBPC 2GWGA 3LCFA 1D8CA 1QMLA 1Q8AA 3RM4A 1GVRA 4OU1A 2ZXQA 3VILA 4RDWA 1O5KA 1ZAIA 4KEVA 1PHQA 1E72M 4YVXA 2V3EA 1MXDA 2VZSA 2OZ8A 3QTPA 4GRSA 3S2NA 2QAPA 1QDSA 2Z00A 2WAGA 4ATWA 3WMCA 3M0ZA 4Z2KA 2NX3A 1KR0A 3CPUA 1LL6A 1M9HA 2OZ0A 4E2OA 1E3XA 1TSIA 1W56A 3CQKA 4GOAA 3PWAA 3SUTA 2VDGA 3IK4A 2YR1A 1OCJA 3M0MA 3FJ4A 5AZ1A 2XN1A 2AGTA 4WJEA 2C1IA 2C13A 1JEZA 4FI4A 5HJLA 3PG8A 4UTFA 3SSJA 4MB5A 1EFZA 4XD4A 5J5DA 1YBQB 1X7IA 1S2VA 1SGJA 4HSOA 2XN2A 1ZHAA 1G4PA 1E0WA 4XKYA 3L66A 1LL4A 3W75A 1UUOA 1GVEA 4LX4A 1H7NA 3N6QA 4WGXA 3DG7A 4IISA 2CLLA 1NJJA 3TNOA 3GY1A 3K46A 3VC6A 5FA5A 4WKHA 2VR4A 5FJPA 4FNSA 1KNWA 3F4DA 1RA5A 4RK8A 4JTSA 3ZJ6A 3SQSA 1W1PA 1TWSA 1IQ8A 2D0HA 3MKCA 2A3LA 3MUZ1 3QSRA 1QHPA 1T96A 1IXNA 5EFFA 4PCTA 5KZMA 4WKFA 1Y5XA 3UPMA 4MJ4A 1ADSA 3KHDA 4JYDA 3T42A 1C8QA 5HNTA 4AIOA 2CU0A 2J9YA 1CW2A 3QYQA 2P10A 1HL8A 3UQNA 1J0JA 4FOUA 3GH5A 2BBFA 1OWQA 3KRSA 1O4UA 5DBUA 3WUGA 4MWAA 1OZQA 2XH2A 2QF7A 1LCOA 1RK5A 1I2NA 4O57A 3W1UA 4MNMA 5IRPA 1SJCA 3W1AA 2PLKA 3AROA 5DCDA 1NH6A 4D71A 4CCDA 3NOEA 3EWXA 1QCWA 3WBAA 3VIPA 2Y89A 1OYAA 3Q2DA 1UZ4A 4WZHA 4TQTA 3DFSA 2WKGA 3P8JA 5J8LA 3C0LA 4IOTA 2VMFA 2PDQA 2QIIA 5DQPA 5HNRA 2VFDA 3LV5A 1GKQA 4ZXOA 1WZMA 4MAZA 3BJTA 5GJPA 3VDAA 3LNMA 1J93A 1YW1A 2IPFA 2DDXA 3BICA 4Y9AA 4L1WA 3UYIA 1OFQA 2JKPA 4PB3A 4DXKA 2R14A 2JGYA 3NL6A 3M7WA 3NDYA 3B8SA 2PDCA 3HBLA 3L4TA 2TAAA 2XG9A 1TV7A 2JK2A 1UH2A 1NFGA 4GA8A 2PZ0A 1V6YA 3KOYA 2Y0FA 3IJQA 4X0NA 1ITQA 4O0ZA 3U5UA 4JDYA 5HQLA 4ORIA 1PZ2A 4ICNA 4Y8EA 1B2YA 4RDZA 4TIMA 1XLMA 5G2IA 3T0CA 1PKMA 3MCNA 2OO6A 4YHGA 2GSEA 3FEMA 2YB1A 4DBDA 4GY7A 1F74A 3P80A 5D8ZA 1PWMA 4DXVA 4I3GA 3B8TA 3H54A 4NL1A 2ODOA 2PLCA 4LS2A 3THDA 2G3JA 2XYLA 1PX8A 2JGQA 1UOKA 4RX0A 5F2IA 4TX6A 4AEFA 5F1VA 3C0SA 2PAJA 4R88A 3BCDA 5I3IA 5FAJA 3BLOA 4KFNA 1S39A 4ZOEA 1SZNA 2J88A 3P74A 2AQOA 2HS6A 1IEQA 4UOQA 3BAIA 3JRKA 2NQ9A 2ZX9A 2Y85A 1MUMA 1M53A 2BG5A 1JYNA 5XINA 4JIPA 4WY0A 2IPJA 3AU2A 4RLIA 4V2XA 3SGGA 2AL2B 4FXFA 2EJAA 3LPOA 4W7UA 1VFMA 3O8AA 3E5PA 1X98A 2OPJA 2CHRA 4L1GA 4XO6A 4C6FA 3TVAA 3CHEA 1WE5A 4GI8A 3F4NA 2EPOA 1EGVA 1M1BA 3G1DA 3UP8A 4KCWA 3LLDA 3EDJA 2ZZ6A 3RMJA 3VOGA 1Z8AA 1HL9A 3PBGA 4TU1A 4LB4A 4FALA 2JF6A 5KTLA 4IPJA 2VZTA 1XHGA 3D46A 4H04A 3RJXA 1RPKA 4ADSA 2QJIA 1MXGA 3MZ2A 2WVVA 5AFDA 3I6RA 1WDQA 1KQYA 1YLVA 4BZYA 1NELA 2WANA 4L4MA 4GPNA 5T26A 2HVOA 1F7BA 1FY6A 2IPWA 2EEXA 3IIXA 1GJUA 1B4EA 4O1FA 2QCGA 3EOUA 3S5OA 5HK4A 2WLYA 3WLRA 3AHXA 2YCJA 1XYFA 4DJEC 4UTMA 3WQWA 1LP6A 4IPPA 1P5BA 1KXTA 5C9ZA 1L2UA 4WXZA 5AKQA 1ZNNA 4FAMA 3SCQA 2V3FA 3IJDA 5CEWA 5D9NA 3EWWA 3O3RA 4J9JA 2VFIA 2Z7KA 1FCBA 1REQA 3B0YA 4JQ3A 3R94A 5EMKA 2XUCA 4WKAA 2Y5EA 3SCTA 1K7FA 1QNQA 2BGNE 1TB3A 4PTVA 1GQNA 1GZJA 4JTRA 2G37A 3ISIX 3UR5A 3VM5A 3NJ3A 3MUY1 3HO8A 1FWNA 1ENUA 3CPGA 1HFBA 4JIIX 3GTXA 4Z17A 1QNOA 2P3ZA 1A5UA 4JY8A 4FF5A 1IIHA 3ITGA 4C6PA 1UZ1A 4IX2A 1X1NA 2H6RA 3ITTA 3M6DA 3TN5A 3A3WA 2OYLA 3KDOA 4BK9A 2C7FA 1Q6OA 1TV5A 2XVGA 5DY2A 4E2DA 2BHUA 2BX7A 3TJLA 2FTPA 1K03A 3UZZA 2VNCA 1J0HA 2D73A 3CO8A 1UASA 2Z7GA 1W3IA 5DEZA 2VD9A 4DWSC 2W5FA 3PS7A 2JE8A 5EB8A 4EKJA 4F3HA 2ZUUA 1ISWA 1KFWA 3LBCA 4LYPA 3AWNA 4GI4A 4AZGA 2GGJA 3E9AA 3TTYA 1TPWA 3SCOA 1S2AA 3ZJ8A 1EZ2A 1MWOA 1EX1A 3GR8A 2EO7A 2WMIB 5KEZA 4CVUA 1RCOB 3GXNA 5DO8A 2INZA 3PANA 2CZEA 1DJGA 4G7EA 4CU7A 4BQ2A 5I00A 1TZ9A 3P62A 3L5LA 5AN7A 1WUFA 2X30A 5C2CA 2W67A 4AEEA 3H2FA 1KRAC 1O5QA 1F73A 2VCAA 2JIWA 2YA0A 3UG4A 2O9OA 2X8RA 3MP5A 4EXAA 3CB3A 3F5LA 5KITA 4HTBA 3GU2A 3D0CA 5I23A 3KFTA 3WH6A 4HSNA 5AHMA 3R58A 3IV8A 5CZTA 4ZQPA 3WIJA 4O4VA 3DESA 1TMQA 4KFOA 1L2QA 1OSEA 4KGJA 5E70A 3M5VA 1JGMA 2QVNA 1AH3A 2XIQA 3QSTA 2BS9A 3EA1A 3GG0A 3LYEA 3W1LA 3A4JA 2P0OA 3HTWA 3TMQA 2OSWA 1H51A 2XU2A 3QFEA 3UZJA 3P60A 3TYDA 1FWRA 4H9VA 3BLIA 3VIMA 1ONEA 2NSXA 3VGFA 4O14A 1DE5A 4C6CA 4BI7A 1R87A 2WZTA 4CN4A 4E2BA 4P7NA 3NO1A 3PPFA 2WMIA 3UXDA 1H11A 3VGHA 1NWTA 4XO7A 4DBSA 5BXPA 3W87A 5HUOA 5FJRA 3S6DA 4AZBA 3S5ZA 1VR6A 3WJYA 2CBIA 3BLEA 1R3TA 2J6XA 3HV9A 3SY1A 2E8YA 5BXRA 2VR5A 1R3QA 1V0LA 3P0WA 3KCLA 4QRNA 4HNLA 4J27A 4W5ZA 3WF3A 4KEUA 2C19A 1SFLA 3C4UA 2HJPA 3L0GA 3GNOA 4J5NA 3CZKA 3AHZA 3QQ1A 3WQFA 1TCDA 2PWHA 2QUVA 1UA7A 3MJYA 3GW0A 4PL1A 1K9FA 2YFOA 3GVQA 3P6LA 3K30A 1GQJA 2WHMA 2J25A 2Z1WA 1JR1A 1KM3A 7ODCA 4DQWA 1ME9A 4GY0A 4GIYA 3PFMA 1JGIA 1CXEA 3T40A 3PZVA 2IQTA 5EMUA 1QOPA 2YA1A 5C71A 5H8UA 4WHBA 5BRQA 4AIBA 1S2CA 1ITUA 4IGSA 4KIEA 1KGUA 2HVMA 3L4UA 3T0AA 3SZ8A 3T4CA 3OVQA 4NXSA 1XCXA 1ADDA 1GPFA 2C15A 2QMKA 2XN0A 3M9YA 2RH9A 3W00A 3IJ7A 2VGFA 4EANA 2PEVA 5DBTA 4JR5A 1PCWA 1PIFA 1ZFJA 3BAKA 4C1NA 1SO3A 4YPJA 3NZPA 1A0CA 4AVOA 2IUZA 4H6KA 4ACZB 2MUCA 1R30A 1TPDA 3LCHA 4PCNA 2V38A 1MZRA 3W1MA 3M41A 2HQAA 3W83A 2QULA 4GXMA 4UZUA 1V77A 4IIDA 5CZJA 5LIXX 2XFYA 2VRQA 3GAKA 4PFHA 3KVLA 3FY1A 1TQJA 4P8WA 4IGMA 1ME7A 1CGXA 1PCKA 1QATA 4WOZA 1Q6LA 5CLWA 3KAOA 3UG8A 3VD9A 3KVJA 2J8TA 4DJDA 3MKKA 5CBIA 1US3A 2RDUA 3IV3A 1O5RA 3CEUA 4HZ6A 1A0DA 1Y8BA 3U57A 1W3NA 3QV6A 3RYSA 2CZVA 2B81A 4WJ8A 1ISZA 3LGGA 4C6JA 3AJXA 5D37A 4LXFA 5IHSA 3RXZA 3BH4A 4QG8A 3BTNA 2FZMA 3BAJA 3EEGA 3OEXA 4AG0A 1CT5A 1YNPA 3R0KA 1NWUA 3MC5A 2IKIA 1W8SA 1IT8A 1HJWA 1EA0A 1XIJA 2PRHA 3RR1A 1XIEA 5HR6A 2PA6A 4NASA 3L65A 2Z2UA 1XD1A 1KXHA 3N4AA 1H09A 2EG6A 4GZJA 1ZJHA 2YL5A 4I8YA 3TCEA 4O54A 3BOLA 4K8GA 5DMLA 1EEPA 2GUYA 4JBRA 3NXFA 3MVIA 3W7QA 1GYNA 1TCMA 5EMLA 2YDRA 5ABEA 3FJNA 3OLDA 2X0SA 3RILA 3TNBA 4UOJA 1OFBA 3GXIA 4UMCA 3U4FA 2Q09A 3MMWA 1GZGA 1K77A 3MSYA 1E5JA 2OR2A 1BWKA 2TYSA 2IQDA 3VOJA 1JPKA 2ZRYA 4GISA 1P0NA 1WV2A 4LUYA 5CZSA 4A8NA 3N6JA 1VBJA 1P7TB 4M24A 1EC9A 4ZQMA 3SUWA 5DY3A 1JCTA 2BODX 3OHMB 1VENA 4PMUA 4B5UA 4CD7A 3R79A 4PUDA 1XBXA 1UD3A 3K4AA 3AUJA 1P0BA 1RCXB 4GK8A 3NNTA 3CWOX 5F4SA 3VNLA 2Y1HA 4AAJA 4KEMA 2WJEA 3GW3A 3DHUA 3LV6A 1L6WA 2FPYA 1UP2A 5C9RA 2OVLA 3HG2A 1HGYA 5A2CA 4NSBA 1G94A 2E09A 1CYGA 2ZC1A 3I4KA 4TX8A 5BWFA 2PP3A 1OQFA 3W2LA 1DHKA 4MFDA 2EKGA 2YCEA 3UXIA 4J3UA 1EPXA 3GM8A 3VM7A 1IEWA 3MBFA 1EP2A 1LLZA 1TIWA 3KWXA 4XAYA 4AWUA 2VUNA 3CS2A 1UPMB 4ZO8A 3O06A 2PF0A 3NQ6A 5FF0A 4WY0B 1J0KA 5BNKA 5MF5A 3HPZA 1SUXA 3P82A 3MKVA 3FDGA 1O60A 1Z41A 3PG9A 3N9RA 1JCXA 5AECA 3CK5A 1YIXA 4JIHA 2ZE0A 4HT3A 1XPGA 1MW2A 3LZ5A 1BGAA 3R7MA 3SGZA 1BRLB 4MWAC 5HR7A 3NQ2A 1W1VA 4NZ5A 2MANA 3CQ0A 1UR0A 3SO7A 1M03A 4ZO9A 1VCVA 3UXLA 4DEFA 3ITCA 1IT7A 3VX1A 4AYSA 2VOTA 3E74A 3AYRA 1KM1A 3Q58A 4KS0A 1XYZA 4Y9PA 4HHPA 4JGDA 4E5TA 2G3MA 3UGRA 3DYPA 2WYSA 1UMYA 3UNDA 3EB3A 2ZZ2A 3ES7A 1XSJA 4JTLA 3PUDA 3WQPA 1NVMA 1SR9A 5DCBA 3M64A 4KETA 2QUMA 4MWAD 1GOQA 3FCPA 4K8EA 3FAXA 3G1FA 4JNZA 3WL1A 4GC4A 2PU0A 4LY4A 4B4HA 1VH7A 3VCNA 1K7EA 3DZ1A 2HNHA 2F2KA 2HE8A 2JKAA 3ZWSA 3UWQA 2CKSA 4PSPA 3KCJA 2I5IA 3HPAA 4MZ8A 4QJ4B 1SZFA 3OP2A 2VGIA 3FJLA 4F48A 5AC5A 1UHVA 3QBUA 4QSFA 4UTUA 1XS2A 1V6XA 3UCDA 3A3HA 2IXVA 5A6BD 1A50A 3S4TA 2EHHA 3GHTA 1K8CA 4U3AA 2OFJA 5CAKA 4I5XA 1ITXA 3AIQA 3FS2A 5DMNA 2PI6A 1PS9A 4KPLA 3D3AA 4FHAA 3URBA 1ZBCA 4UMBA 5JXQA 1LOQA 3W1QA 1OF6A 1B9ZA 2Z29A 1VFFA 3SN1A 3TE9A 5A6JA 3IJ8A 5CC7A 2PP0A 3KBMA 2Y7DA 1DEDA 1KCLA 2QCEA 3TYAA 3LRKA 1TMLA 3A3XA 2GLKA 1TTQA 4PMNA 3E2QA 4PFMA 2DVUA 3DERA 1GVYA 4YNGA 3WSUA 1FWHC 3OO2A 4JICA 4EP8C 4V1YA 1XJBA 3FFSA 4GUGA 3QOMA 5IBXC 2ZTJA 4D6EA 2BWGA 4RNJA 1R9ZA 3SY8A 3RCNA 4BKNA 1UW9A 4UR9A 1J79A 3S6TA 2QUUA 2R94A 2OOGA 3QKEA 4NKCA 1TR9A 1FWEC 3PN8A 1ZJBA 3TQ0A 2NX1A 4AXNA 1U30A 2ZXAA 1XYLA 3CWNA 2BXYA 1LROA 3ZS4A 1K9EA 4J3ZA 1W3TA 4JTQA 3ZQ9A 1UQYA 1WDWA 1B3VA 3U2ZA 1JVNA 2PZNA 3ATZA 3W6YA 1EA9C 3W7IA 5JMUA 3KBJA 3KL5A 1BFNA 1WO2A 3LMYA 3LTYA 4J1OA 1ECQA 3ZSTA 2C14A 3CWHA 1OG6A 1GVIA 4C7FA 3PR2A 1S1PA 3CO4A 2O9TA 1FDYA 4U5KA 5LZLA 4FR1A 4L56A 4RPQA 3E0VA