3ZJKA

Crystal structure of ttb-gly f401s mutant
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
424
Chain Sequence
EKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLHHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRSGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA GLYCOSIDASE
publication title Semi-Rational Approach for Converting a Gh1 Beta-Glycosidase Into a Beta-Transglycosidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 155
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zjkA00
3AROA 3TONA 1ZS2A 3FAXA 1DWHM 2YL9A 1KGUA 3MUZ1 3VIFA 3VD4A 3RDKA 4OZOA 4AZCB 2WVVA 2WMFA 2WMGA 1W1PA 2UY3A 1EHNA 2QV4A 2VR5A 4JZ5A 2EQDA 1GHRA 2PI6A 1RP8A 3F5JA 3T08A 3ZO9A 4EKJA 4HU8A 3WFLA 1NP0A 5BROA 2WPGA 3APGA 4CUCA 1H1NA 2PBOA 1E43A 1ZBKA 5F7UA 1C8XA 4D6HA 4AD4A 1MFVA 1HKKA 3SCNA 3MKKA 4HPGA 2GUYA 1BYBA 5IFTA 4AD3A 3BAJA 1AQMA 1UD5A 4IISA 2ZUNA 1VIWA 3A4AA 4M8UA 3PZIA 1QI3A 1CLXA 3I3BA 2A3CA 3HJEA 3RIKA 3POCA 3AOFA 4PRWA 1W3KA 1D7FA 1B90A 5A6BD 4E8CA 3ZM8A 3BMVA 2VCBA 5DF0A 1EHAA 3CMJA 3NSNA 1C8YA 5JBDA 4F8XA 3MMWA 1B3YA 6A3HA 2WHMA 2QMKA 1JAEA 1UA7A 1PEZA 1OT2A 3OGSA 5HPOA 5BYWA 3HMCA 3AMGA 1BG9A 2ESCA 5ABHA 1LWHA 3NSMA 4KWUA 5LA1A 1VBUA 4TVCA 2OSXA 1UR8A 1H11A 5A69A 3IANA 1SMAA 1UD6A 1E4MM 2PWFA 4PMZA 2ZUVA 1OT1A 3WH5A 2VX5A 2ZX9A 2EPMX 3BAKA 4CN1A 2VTFA 2GJXB 3QOKA 2VZSA 2WZEA 3BAWA 2WYSA 2OWXA 4PMDA 3OLGA 4PUEA 3SCSA 2DEPA 1Z32X 4M1RA 1EDTA 5FOOA 3VIMA 1V02A 3A4XA 3AIRA 1QBBA 1WB0A 1E40A 4FMVA 4MJ2A 4D6GA 3AS3A 2GK1B 3AHYA 5E0FA 2X0HA 1SFSA 3W37A 4B3KA 1HP5A 1JF5A 1X6LA 1QNOA 1FH8A 3L4ZA 1GOWA 2WMKA 4YHEA 3SCQA 4CVWA 1ZJAA 2VRKA 4J3SA 4ZFMA 2WCGA 3AIEA 3WNLA 5ABEA 3TTSA 5A3HA 4WF7A 2DIJA 3N18A 1GHSA 1CWYA 3KZSA 1MQRA 2WC4A 1CXKA 3AI0A 5A95A 1BSIA 3SIMA 1V0KA 3GZAA 5CPTA 3AYSA 2ZX7A 1VFUA 1UKTA 3F4VA 4MB4A 1ZU8A 1HL8A 4KGLA 1C92A 2VVSA 2GDVA 5CPQA 5I5RA 1VFFA 1CYGA 3WNMA 3B9AA 1V6YA 4XUYA 1HJSA 2F8QA 1K6AA 4BZYA 4HU0A 3L4UA 4KRTA 4UFIA 3VDHA 1G5AA 2QF8A 1TUXA 3PZNA 1SYTA 1QI5A 1OWQA 2CETA 3GXFA 3RPMA 3ZQ9A 5M3WA 4PSRA 5A6AA 3GNPA 5FKYA 8CGTA 1BPLB 1O7AA 2XUCA 4KMQA 1UD2A 5HNNA 5D4YA 2E0PA 3VMNA 4KRUA 2PF0A 1HX0A 3PBGA 4D1IA 3VGFA 1GUVA 3ZOAA 4IPNB 2G41A 5HBFA 2VQUA 2E3ZA 2IUZA 2D2OA 1BAGA 3AMLA 1KXVA 1WE5A 2WMJA 4PMRA 3IAQA 1VJZA 2ZOXA 1JNEA 2FHBA 1UWSA 5E0CA 3WIJA 4DWSD 2XIIA 5JUVA 4L4PA 4W7VA 3SUVA 4W7UA 3ZSTA 3PZGA 3VX0A 1CBGA 1GONA 2J74A 1J10A 4V28A 1BFNA 1GPFA 2GVYA 3EDFA 2NW0A 1HN1A 3N9KA 1PZ2A 2DIEA 2W67A 1US2A 4GIAA 3VVGA 1HVXA 2CNCA 2A3AA 4JKLA 2YKKA 1HT6A 1DWAM 5ABFB 2PB1A 1LQ0A 3TTOA 3I3EA 3GTNA 3RM8A 4HMCA 2ZUTA 1CENA 1HJUA 5A6MA 4V27A 5DT5A 4ACZB 4NZCA 3AIVA 4W8AA 3HN3A 1GJUA 2VMFA 4WJXA 2OLHA 1L8NA 2CBIA 1L0PA 4W8LA 3ARSA 4ZE5A 1W32A 1JI1A 2WW5A 1JNDA 3K4DA 1FOBA 4Z2LA 2WK2A 4WSKA 5FCZA 1OD0A 1EO7A 4MPKA 2HVMA 3WF0A 1EO5A 3CUIA 2O9TA 3WNKA 3WN6A 3TOPA 2ZE0A 4H7VA 2XWEA 3FHQA 2QHAA 3S2CA 4L4OA 4AXNA 3WF3A 1Q6GA 1BQCA 1S46A 3EDDA 5E09A 1NM9A 4URIA 1TR1A 3NCOA 1UR1A 3WD4A 5A2BA 1QI2A 2ZXDA 1NOWA 2VR4A 4J3WA 2YDRA 3QR3A 3VINA 1V0MA 2D22A 1WZMA 4H04A 2X0YA 1BYAA 3RJYA 1LLOA 1W9PA 1MVYA 3VGEA 2YJQA 3NSXA 3VIGA 2J8GA 3AHVA 4HMEA 1C93A 2E8ZA 4CN4A 4DM1A 3VUPA 5D9NA 3EMQA 4FK9A 2XGIA 1WDRA 5TD4A 4BCEA 1UQYA 1VEOA 2A3BA 1AQHA 3VO0A 4AC1X 2VRQA 4UQEA 4DUXA 1WZKA 3VM7A 2J7CA 3SCUA 4A3HA 1UKPA 3FW6A 1W91A 4HZ7A 2F2HA 2PWGA 5LYRA 4PMQA 1E72M 1UZ4A 2CKRA 3BLKA 1TZ7A 4H8HA 1WDPA 1WPCA 3UR7A 3VU2A 4CGTA 1DWGM 1XRVA 3L4WA 4BS0A 2D0HA 2YIHA 3WQWA 2AOSA 3B9DA 4JKMA 3AS2A 3CZLA 5CLWA 2JFEX 4PMVA 3N13A 1QNQA 2BXZA 2XFRA 3TP4A 1TMQA 1KQYA 4AEFA 3ZT7A 4J27A 2W63A 5A6LA 1XD1A 4QDMA 4W86A 2BVDA 1XH2A 3AMDA 3K8KA 3IK2A 3SCVA 4CKQA 1GCYA 4HOWA 1KBKA 1Q4NX 1W2PA 1CXFA 4WKHA 5M5DA 4TUFA 1DP0A 2YA1A 1KXTA 1BLIA 2EEXA 5D9OA 3W82A 1Q6DA 3QHOA 1V02E 2BY2A 4MB3A 1KBBA 3EMZA 4H41A 4PCSA 2XM2A 2VNCA 4HZ6A 4UCFA 5JBEA 1QHPA 4JHZA 1W2VA 1HJWA 1NOUA 3WD2A 3ZIZA 2V3FA 4AISA 3WEZA 3FNDA 3S6TA 1HP4A 2WM0A 3NDZA 1B9ZA 4OJYA 3GNRA 4DWSB 3BH4A 1TA3B 3WH7A 1V0LA 1HJVA 2ZUMA 3ALFA 5CSYA 4MJ4A 3T2OA 1DEDA 5AYBA 3AFBA 4B9ZA 1TVPA 1ZL1A 4A3YA 1JZ5A 3PZMA 1MW1A 1JAKA 1NWRA 3EMCA 4AIOA 1ZBCA 3WMCA 4AD2A 2D1ZA 5C71A 3EDEA 3WL0A 4GQRA 3CUHA 1QOXA 1V3JA 5IXEA 1E6QM 3CUGA 4M24A 3WDJA 1CGUA 4MNJA 3UESA 4PTWA 4QCEA 4B3LA 4OUEA 1CPUA 3CHDA 4UOQA 1ITXA 1QNRA 4P7OA 4LXFA 5EFDA 4E4PA 1XH1A 2UWFA 2ZUWA 4HA4A 3MO4A 2ZWYA 3BGAA 3WNPA 1GVYA 1V0NA 4C7FA 2RGLA 4P8XA 2Y24A 2WBGA 5GNXA 5CSUA 4W89A 3U5UA 1IV8A 1J18A 4X9YA 4GZIA 3M46A 2AAAA 2DSZA 1KXQA 3OGVA 3VIHA 3EDKA 2WVVB 1OGSA 1UWIA 4P8UA 3PZOA 1US3A 2V3DA 1E0XA 3VIPA 1WAWA 5I0DA 2O9PA 1EGZA 1W1VA 4S3KA 4QLKA 2J8FA 1FHDA 3CZGA 2VZUA 1VEMA 4B9YA 3WBAA 5A8PA 3U7VA 1LL6A 1NWTA 2OSYA 3DYOA 1BGAA 1VFMA 3UG3A 1E6ZA 1KR0A 2VQTA 3WSUA 1UG6A 1E1FA 2UY2A 3LMYA 3G6LA 3N04A 4NF7A 5AYIA 3BAIA 4LYQA 1CGWA 4JL2A 3RCNA 3WQ4A 3FXYA 2J77A 3D5HA 1UZ1A 1OBAA 4MAZA 5BXPA 1W1YA 4MNKA 2ZX6A 2WVTA 1XCWA 3WNNA 2DT3A 3WUGA 1R7OA 1MW0A 3WDRA 4HOZA 2OWWA 2CEQA 1SMDA 3VMPA 2A3EA 2EO7A 2XVNA 1GJWA 4J7RA 3OZPA 3ZT6A 5M03A 5CPSA 5DEZA 2CPUA 1HKJA 2YA2A 4M29A 1J9YA 3AISA 2WWDA 3CMGA 4WKAA 4Z2HA 2Y2WA 3ARRA 1Q6CA 4PTXA 5D8ZA 1CNVA 3DC0A 1TG7A 2OSWA 3W28A 3CPUA 3MMUA 1RPKA 3M7SA 2OWCA 5JBFA 4OOUA 2BHZA 2DQXA 1XC6A 4PMYA 4D6FA 1E6NA 4P8VA 4UFMA 3AXHA 2XG9A 2QPSA 1JDAA 3CH9A 1E6PA 1M04A 3RM9A 3WKZA 3NJ3A 4W84A 3HU7A 1VF8A 1W3HA 4M81A 3O2LA 5HDRA 1GQJA 1H4PA 2EPLX 2PC8A 2VI0A 2DT1A 2RGMA 3BAYA 1WZAA 1DHKA 4H8VA 4JL1A 1KB3A 1LJYA 4D72A 3F5LA 2X2YA 3OBAA 1B31A 1QNSA 2FGLA 3U7BA 3GH7A 2V38A 4IPLA 1CTNA 1XYFA 5BXTA 4LYRA 4X0VA 1V08A 1B3XA 1QPKA 2E9LA 1OCQA 1CECA 3PZTA 4U3AA 1TE1A 1H09A 2VVNA 1V3MA 3WUEA 2CIPA 2WKGA 3G6MA 4TX6A 2EBNA 1ECEA 1GZJA 2JIWA 3L4XA 2XHYA 4W88A 1V03A 1H5VA 3KEHA 1PIGA 3W0KA 3SUSA 2W62A 1PJ9A 2VOTA 5E70A 1UH3A 3VGGA 4C7DA 1QW9A 1XV8A 5IHRA 1U33A 3WD0A 1H41A 1CEOA 1PBGA 2XIBA 3ZJ8A 2WHJA 4U5IA 3ZMRA 1FP9A 1JXKA 1E4LA 1K9FA 1WNOA 9CGTA 1J0YA 2YLLA 4AMCA 3KL5A 3BAXA 1W9VA 1BGGA 4Q7NA 4P7RA 1GQIA 2FH8A 2GSJA 2J78A 3CZ8A 1E73M 4JFVA 4CVUA 6CGTA 2DPEA 1KR1A 1OINA 3QGVA 1V6UA 2XFYA 4ZXOA 1QW8A 3QOMA 5E6YA 4LYPA 1EQPA 7TAAA 1G94A 1F4AA 1WDQA 4AZ7A 3SUTA 4IM4A 1Q6FA 2XGBA 4B15A 3WEOA 4HA3A 1V6WA 3QHNA 4P7NA 2BY1A 1JG9A 1HKIA 1C7TA 1UWUA 4ATDA 1LL4A 4MTVA 3WMBA 1GOOA 1XH0A 3VDBA 4CCDA 1UOKA 3MS8A 1E3XA 3CLWA 2IXUA 5AY7A 1AMYA 1BTCA 1MWOA 2EJ1A 4UZSA 1VEPA 4V2XA 3MUAA 4ZXLA 2Y4SA 4HMDA 1DWJM 1GQKA 2CBVA 2DSKA 1KWKA 2YOCA 1J0KA 5FIPA 3IJ7A 3RMEA 4UFKA 1HJXA 1PX3A 3IJ8A 3UERA 4CN6A 1XYZA 3T0DA 4WIWA 2X09A 2C7FA 2Y5EA 2J7EA 3WFZA 3AQUA 2NSXA 1W3JA 3K4AA 1YQ2A 3OLIA 4AZBA 5BRPA 2QLYA 4H2CA 2TAAA 2ZWZA 4PN2A 1IZJA 4M56A 1UR2A 4JCLA 2J25A 3LPFA 4UQDA 2YA0A 4QLLA 1VB9A 5EBAA 3VGDA 2A3HA 1C3FA 1BVZA 4MB1A 5AC4A 1ZB5A 4JFSA 5JIWA 3N12A 3FHAA 4MAVA 1VJSA 5CG0A 2FH6A 3KE0A 3W81A 3VNYA 2EPNA 1BVNP 1QBAA 3GM8A 4JKKA 4AWEA 1QI4A 3AMCA 3VNZA 5IFPA 2NT0A 3GXIA 5A8NA 1B3WA 2BHUA 3WQ8A 2E40A 2WZHA 1AVAA 3WBEA 4D1JA 2C0HA 3GDBA 1OGBA 3CO4A 1O6IA 1MW3A 1PX8A 1JI2A 1WP6A 3WF2A 5A6SA 3MANA 1JIBA 4ZENA 1XHGA 3CHEA 1GOIA 3PTMA 3NDYA 5IDIA 2G3NA 3WNOA 1JDDA 4CD6A 3PHAA 1UUQA 1PX4A 1E5NA 3WENA 4QAWA 1G9HA 4P7LA 1E4IA 2J79A 4ML4A 1JYVA 1N82A 4TXEA 1UKSA 1U30A 2UY4A 4D6DA 4HP5A 3SEPA 3VIKA 2G8ZA 1Q6EA 3NIYA 3AHTA 1UKOA 2J7GA 2Y8VA 5BRQA 1JYNA 3ARZA 3ARUA 1UQZA 4DM2A 3UG5A 1JZ2A 4J28A 1BG4A 1KCLA 3CTTA 1R87A 1H0IA 4LPCA 3AS1A 1WKYA 2YDSA 1W9UA 1E70M 2VCCA 3GH4A 1C90A 1GNXA 3AHZA 5I23A 3VKKA 1FH7A 2PWHA 3WQ6A 3TA9A 1UWRA 2BVTA 1TVNA 3E1F1 5D8WA 1RP9A 1MQQA 1LG2A 4UFJA 5C8BB 2WCSA 3WD1A 1FFRA 3OLDA 4TTGA 2JF7A 2X8RA 3A6OA 3GBDA 4C7GA 3MV11 5GNZA 1JZ4A 4OKDA 3B9EA 3GXMA 3MUIA 2JE8A 4AZGA 4IUGA 4N0RA 2WNWA 2DSVA 4UOZA 4E8DA 2WKLA 3RILA 1UH4A 1E6RA 1M7XA 4M82A 3TTYA 1CXIA 4HTYA 1ZJBA 4TOQA 3BLPX 4GQQA 1ESWA 3W25A 1EH9A 4MB5A 4CD4A 1GOMA 4WK9A 4DUVA 2MANA 2WSKA 5EB8A 2BY0A 2WZIA 1ISZA 1UR4A 1V6XA 3SCTA 1MYRA 1W3LA 3M6DA 1MW2A 2D3NA 5E9AA 4W85A 3SUUA 3II1A 2B31A 4AW7A 3GNOA 4RE3A 1UD8A 3THCA 4U31A 2Y8KA 3N17A 1NWUA 3L4TA 3AHXA 3PTQA 4P8WA 4OBSA 4PMOA 1JF6A 1G1YA 3W29A 1XCXA 3CBWA 3AICA 1J0IA 1H49A 4D6CA 2E8YA 4AZIA 4TVUA 1JD7A 1E15A 4MNMA 3OB8A 4J3XA 4QFUA 3MSDA 1EDQA 1OD8A 1G0CA 1GW1A 4FLRA 1C91A 1QI0A 5D9PA 1ODZA 4AD1A 4UTFA 2OYLA 2BXYA 3ARQA 2W5FA 1E0VA 2DT0A 3WH9A 1JFHA 1EA9C 1CDGA 1E1EA 3BSGA 2VX4A 3OGRA 2CKSA 3SURA 2ZICA 2BVYA 2XM1A 3K8MA 1UD4A 1XGZA 3PZUA 1NARA 4PEEA 3WUFA 1E6XM 4XZBA 3UCQA 3N1AA 2XSAA 4AZ5A 1GOQA 1OGGA 3WH6A 2WSPA 3AIWA 2WC3A 4Z2JA 4GXPA 3WDQA 2G3IA 2BHYA 1BYCA 1EDGA 1HIZA 1MXGA 3VD9A 4PUDA 1JZ3A 1C7SA 3W26A 3IAPA 1LL7A 5KZ6A 3VX1A 3L4VA 5M17A 3WF1A 4U5KA 4TTUA 1JZ8A 2J7HA 1ISWA 1B0IA 2WMIA 4MDOA 5A94A 5CJ5A 2E9MA 3VPLA 5I24A 4BA0A 2XFFA 2J7FA 4N42A 4HA1A 7A3HA 1KCKA 5FL0A 3VGHA 2JIEA 1UKQA 8A3HA 4AZCA 1QHZA 4F79A 3TTQA 4Z2IA 4FF5A 4B16A 3U57A 1UA3A 1GVIA 4HZ8A 1UH2A 2XWDA 3OZOA 3DECA 3T2PA 4WLCA 1I75A 3N15A 2XVLA 1V3KA 2W91A 3VDCA 3ARVA 4WSJA 3LPGA 4CU8A 4U2YA 1JL8A 1H3GA 1R7AA 1J01A 2WXDM 3AIBA 1D2KA 1JGIA 4UFLA 5I3DA 3UG4A 2J7DA 2WMHA 1OIMA 3W6MA 2V3GA 2E4TA 2WHKA 4GZJA 2CCRA 3WQ5A 3RM4A 4A4AA 3L2MA 3WUBA 2Z1KA 3AZSA 1OB0A 1UWTA 1EXPA 3ALGA 4W87A 1NP2A 2YBUA 1PZ3A 2DSWA 1XSJA 3KL0A 3KWXA 4W7WA 4CU7A 1IT0A 2CXGA 5A6KA 2WANA 4NRRA 1XD0A 3AZTA 1PIFA 4CD8A 2EPOA 1JD9A 1P6WA 4CD5A 1UR0A 2G3JA 4GINA 2VZVA 2JALA 2JEQA 1KFWA 1BF2A 1KGXA 2VZOA 3OG2A 1E55A 4PCTA 3K1DA 3SCWA 1CXEA 3T0BA 1RD6A 5GNYA 1LF1A 5I6SA 2W66A 2ZXAA 3VMOA 1MFUA 4R5EA 1B3ZA 4ATLA 3WMSA 2QPUA 1ISVA 4J3UA 5ECUA 4PTVA 2UY5A 4EK7A 2GJXA 3FN9A 3THDA 4Q22A 1LG1A 1VBRA 2ZIDA 3AXIA 4ACYA 4LQ1A 6TAAA 2DGAA 4TX8A 4UR9A 4YPJA 1KXHA 4CU6A 1HVQA 4PMNA 1V3LA 4AZHA 1JYXA 3BCFA 4GI6A 3B8SA 3ZJ6A 1X6NA 5DFAA 4R27A 2DH3A 4PSPA 2GK1A 3RJXA 1DWFM 1FH9A 1OIFA 2XSBA 4GO9A 2BY3A 2HISA 4MNLA 1E0WA 4AY1A 1CXHA 3GBEA 4EAMA 3VD3A 3DHPA 2WLZA 1K9DA 3WDPP 1F4HA 3KL3A 2XYLA 3GH5A 1QHOA 1R86A 3W4RA 5D9MA 5CXPA 5C70A 1KWGA 3A4WA 2D23A 2NT1A 1JZ6A 4W5ZA 2JEPA 3WQVA 3AIQA 2WHLA 1PAMA 3WDIA 3AJ7A 2ZUSA 5BWFA 3EDJA 1R8LA 2VJXA 3UR8A 2J62A 3ARTA 2CHOA 4TVDA 3NYDA 1EIBA 3BXWA 3ARPA 4F9DA 1TCMA 2ZX5A 1GORA 2J47A 3ZJ7A 2IXVA 3VIOA 3U5YA 1CXLA 5BXRA 2VZTA 2Q8XA 1CLVA 1B30A 1I1WA 1JZ7A 3OA5A 4GZEA 4ZE4A 4AIUA 4FLOA 3T09A 1FHLA 4PMXA 1JYWA 2VUYA 2VO5A 1ITCA 1DTUA 1ZBWA 5CZKA 1XSKA 3FAWA 2XPKA 4JIEA 1E56A 4RE4A 5JIPA 3CZJA 1B2YA 3SUWA 5I77A 5A1AA 3J7HA 4XB3A 5A8QA 4UQAA 4D6EA 2ZUUA 7CGTA 3ARYA 3VD5A 3ZSSA 4PBGA 1NH6A 1Y7VA 4JFTA 3AMKA 1OM0A 3A47A 5LA0A 1J0JA 1MXDA 3IJ9A 3K8LA 3VIJA 5CLTA 2D24A 1HL9A 4D6IA 2EPKX 3T0AA 4AEEA 3ZR5A 2E9BA 4MADA 1MQPA 3POHA 4DUWA 1A3HA 3MU7A 5LA2A 4Z2KA 5E6ZA 3W53A 2OYMA 4JFWA 1K9TA 5BXSA 3ARXA 5A8MA 2WC7A 3MV01 2VRJA 4GO8A 2YL6A 3WDHA 4D71A 3W27A 2J75A 4AIEA 3VM5A 4UQCA 1CGXA 5CQ1A 1UYQA 3CUJA 3VDAA 1B1YA 5FL1A 4U33A 3F5KA 3ARWA 4JCMA 2JF6A 3O9NA 2FGZA 1E6SM 2FDMA 1FFQA 1VENA 4E2OA 3DYMA 5ABFA 3PN8A 4JFUA 2W4XA 1EOMA 3CHFA 1SR0A 3MUY1 4XX6A 3N11A 1NQ6A 3AXXA 1KQZA 2ZXQA 5A6BA 3T2QA 1QNPA 5CGTA 2VL4A 5I2UA 4ACZA 4ZEPA 2VURA 5A2CA 4JHOA 3CHCA 2WWCA 4F66A 3A3HA 4AD5A 4AD0A 1JXJA 3BCDA 3L2LA 1R85A 4NRSA 3NUKA 1A47A 5HPCA 3PZQA 3JUGA 3VGBA 3GYCA 4OOZA 2YL5A 3VIIA 1D3CA 2WVSA 2WAGA 4D6JA 1HF6A 5I79A 5I78A 5A6JA 1M03A 1E71M 4XZWA 2X05A 2ZX8A 2CERA 1EOKA 2D3LA 3SCRA 3PZVA 3WH8A 1V3HA 1WCGA 2VX6A 4ATWA 3CUFA 4PMUA 1LWJA 1PPIA 4CCEA 2V5DA 4QLJA 1E3ZA 2XJ7A 4UNIA 2V3EA 2D0FA 3CIVA 2J7BA 4JAWA 4AYSA 1E4NA 4W93A 3ZJKA 3BSHA 4M80A 1UD3A 1W1TA 4U3CA 3DHUA 1FA2A 1IZKA 4CCCA 2ZXBA 3AZRA 2G3MA 3D3AA 4OIFA 3AIUA 2VCAA 2CBUA 1QVBA 3OIHA 2D20A 1ISYA 1UWQA 3MMDA 4QP0A 3SCOA 5GPRA 1W9BM 1BHGA 3WF4A 2DT2A 2W61A 2FHFA 1TFVA 3RO8A 2PWEA 4UQBA 2CBJA 3GXDA 1W9XA 4W8BA 4UFHA 3W6LA 1V6VA 1J0HA 1J0ZA 1NOFA 2Z1SA 1JFXA 2O9OA 5EFFA 2CHNA 4Z2GA 4HOXA 4DWSC 1UR9A 4J3VA 4J3TA 2V5CA 5BCAA 2DSUA 1HJQA 4KH2A 3WL1A 4K68A 2BS9A 3WY1A 3ZT5A 5FD0A 4UZUA 4UOJA 4Y7EA 1VAHA 5A8OA 2GDUA 2WLYA 3UEQA 4RL3A 5IHSA 2XTKA 1CGTA 1FP8A 2XVGA 4XV0A 4GI9A 2OYKA 4CD7A 2YBTA 4FLSA 4NI3A 2QMJA 1C8QA 1H0GA 2YL8A 2CYGA 2WVUA 1JDCA 4FLQA 1CGYA 3LPOA 2O92A 2EXOA 2W92A 2FHCA 2GJPA 1CZ1A 3FY1A 3I3DA 2CITA 3DYPA 4P7QA 4BF7A 5DT7A 2AMGA 4UQ9A 4RE2A 4PYSA 3EYPA 4LGXA 5EMYA 3VILA 2CESA 1I1XA 3VOCA 4LX4A 1CIUA 3WEMA 3L4YA 3QHMA 4F9JA 2VT0A 2PBGA 2X1IA 2F61A 2WCAA 2YLAA 4BQ4A 4GPNA 2O9RA 3AYRA 1NWSA 1WDSA 4BQ2A 1CGVA 3BMWA 5KEZA 3VTRA 3AS0A 4WKFA 1ODUA 4NSBA 4AZ6A 1DWIM 1J11A 1M53A 4EE9A 2XVPA 4PTMA 5GQBA 4EANA 1E9LA 1V3IA 4HPHA 5AC5A 5HXMA 2BV9A 2BFGA 1ISXA 4DWSA 2VX7A 3CZEA 1TA3A 2DH2A 4BQ5A 1VFOA 1KGWA 1GOKA 1RH9A 1G01A 4MDPA 4QCFA 2G4FA 5DMYA 3CGTA 2WB5A 3VD7A 3M07A 1EQCA 4YN5A 2C8NA 4KGJA 4YHGA 1X1NA 2BNJA 5ABGA 3SCPA 1E5JA 1XSIA 4GKLA 4X0NA 3W24A 3W38A 1HKMA 1WZLA 1W9DM 1UHVA 3MSGA 4U2ZA 1AQ0A 2J4GA 5CGMA 5A2AA 2D0GA 3K46A 3EBVA 1YHTA 3WD3A 4S3JA 1WO2A 2WBKA 4OBRA 1J12A 1U2YA 3ZR6A 4H8UA 5HOSA 2GJRA 4GI8A 1HNYA 2PWDA 1VRXA 2DDXA 2VC9A 1M01A 3UETA 3ECQA 3WELA 3PZ9A 5DO8A 1HXJA 2GFTA 2WMIB 2XVKA 1GQLA 1B3VA 1K9EA 3PTKA 3BC9A 1ZBVA 4W5UA 1BYDA 1OSEA 2YDQA 3O6AA 4BQ3A 3CZKA 3OLEA 3LPPA 1H2JA
chains in the Genus database with same CATH superfamily
1ME9A 3BW2A 3KM8A 3TONA 3FAXA 2YL9A 4DJEA 3VD4A 4OZOA 1F6KA 4PRTA 2Z6JA 4AWSA 3SQSA 4CQ8A 2QDHA 2WMFA 2WMGA 4FNRA 1EHNA 2VR5A 2EQDA 4JTIA 3QFEA 2WSYA 3N2CA 3T08A 4PUWA 1QOQA 3A3WA 4DUOA 3TK7A 1E43A 3GX9A 4D6HA 4AD4A 1HGYA 4OQVA 4HPGA 2GUYA 3V18A 1ZJIA 3IJ6A 1XLDA 3BAJA 3RPTA 2OKTA 4C6OA 1VIWA 4XKYA 1QI3A 1E9YB 3IJDA 4BF5A 3RIKA 3TLQA 1J79A 3POCA 4N9EA 4PRWA 5U7SA 4S3DA 2QCCA 1B90A 2ABAA 3H2CA 5A6BD 4E8CA 1KCZA 3C2RA 3KP1A 1LOSA 1P1XA 4OV4A 1RK6A 4DY1A 2HNEA 3B8IA 1C8YA 2QCHA 4ZZ9A 2NV9A 2WHMA 4OECA 2O0TA 3NQFA 2QULA 1AL7A 4GGBA 4M3PA 3UPBA 4KCTA 2VD8A 5BYWA 3HMCA 2V5BA 3LGDA 5HJXA 3QY7A 3N3TA 3O0KA 1H50A 4O0QA 4AWUA 4Q4PA 1QFEA 5LA1A 5C9ZA 1VBUA 4TVCA 3HG3A 3U2OA 3RHGA 1YPIA 4HMNA 2OSXA 1UR8A 2Y63A 4LV4A 1UD6A 4YWIA 1OT1A 1NTHA 2QJIA 4CN1A 4AY7A 1EBGA 4DO5A 4LALA 1RA5A 1F8IA 5K2ZA 4PZVA 4A2SA 1TMLA 3SCSA 4M1RA 4DYEA 1QR7A 2FZ9A 1V02A 2C14A 3BO9A 3MKCA 4F48A 1H1YA 2YCEA 3IV3A 5ECVA 1E40A 4H6RA 1ZP4A 2AQVA 1Q45A 3AHYA 5E0FA 2X0HA 1VRDA 3UJRA 4QQUA 1JF5A 1X6LA 1VPXA 4N9DA 4KCUA 2I9UA 4YHEA 2YW4A 2KX9A 3CMFA 3DC8A 4HHLA 3WJSA 1R30A 1YE6A 2IKHA 4J3SA 4ZFMA 3AIEA 3TTSA 5A3HA 5JXQA 4WF7A 4OGZA 2ZRWA 1CWYA 3KZSA 3P6LA 3LV5A 3MPGA 3NG3A 5DCEA 1Q6OA 3SIMA 1TB3A 3VZYA 2ZX7A 1R2TA 1UKTA 1VZWA 3ES7A 2RKXA 1C9WA 4KGLA 2FKPA 2VVSA 3MI3A 4YL2A 3MTWA 1VFFA 5CZSA 1KRAC 2R1NA 4MUZA 4O4WA 3L4UA 2QF8A 4UTTA 3N73A 3PZNA 1QI5A 4OT7A 4HNCA 1O66A 4BWLC 1TRIA 4H9MA 2XUCA 3DX5A 2HROA 1UD2A 2F2KA 1DJWA 3EPOA 2PF0A 5F1UA 2RDUA 3KS5A 3MJMA 3ZOAA 4IPNB 4A3RA 3WQOA 1SW0A 5C9RA 5LGXA 2VGBA 4LCRA 1BAGA 1KXVA 1WE5A 4PMRA 4FS9A 2ZOXA 2FHBA 2OJPA 5FJIA 4A3QA 3GSMA 3C0LA 2XIIA 2FTPA 2W0UA 3SUVA 3XIMA 4W7UA 5LNSA 1N2VA 3PZGA 1GONA 1J10A 3Q58A 5LGZA 1NELA 1DIDA 5DELA 1WBHA 1R5YA 4I3GA 2W67A 1WKFA 1US2A 4GIAA 3COTA 3IARA 2YKKA 1HT6A 1DWAM 4HN8A 3NURA 4GD0A 4A29A 3TX9A 3E2SA 4QG8A 3SZ8A 3I3EA 1F73A 4A8NA 1REQB 3PULA 4QM1A 1HJUA 2DZVA 5A6MA 5SWUA 1U5JA 3LOTA 7XIMA 3L67A 4ROPA 4K7VA 3KX6A 2E25A 5CCZA 5D2XA 4ZE5A 3ARSA 1R47A 4CEXC 4QGCA 1EWDA 1YDNA 2VWSA 3K4DA 4Z2LA 1MZRA 4AU0A 1OD0A 1F3WA 3KTSA 3UA3A 4LB3A 3WNKA 3TOPA 4H7VA 4RW5A 4GUGA 4B3ZA 3S2CA 2J24A 3T0CA 3WF3A 3MO7A 4H9VA 1S46A 4LV9A 3EB3A 5HWMA 1TR1A 3NCOA 5A2BA 1VBHA 1IGSA 4UMCA 5C9WA 1J96A 1IEWA 1KM1A 4ZB5A 1FRBA 1XBYA 3FVDA 3W84A 3EXTA 4RJEA 3GRIA 1Z8AA 3TWAA 2O4QA 1PKMA 5LHFA 3O16A 4UMAA 1O1ZA 1A53A 1UZDA 5TD4A 2OMAA 3NL6A 1G4TA 5KZDA 3B0XA 1CT5A 1VEOA 2A3BA 3H22A 4NXSA 3LXBA 4UTIA 3VM7A 4AHPA 2Q6ZA 2J7CA 5FEXA 4A3HA 3B8UA 4GOAA 2GSEA 3AXKA 4HZ7A 2PWGA 1KW1A 3IIOA 4NX0A 2R94A 3I6EA 1IEIA 1UZ4A 1XPYA 2CKRA 1GWJA 3BLKA 1WDPA 3IIXA 1HKVA 1TYGA 2Z26A 3GC2A 3LS9A 3B0VC 3VU2A 5AZ0A 1XRVA 2YIHA 3WQWA 3LGGA 3CZLA 4KRZA 1AMKA 2JFEX 1HO4A 3P0WA 3MYOA 3UYIA 3NQEA 3N2XA 3TP4A 3A22A 4DO7A 4WSHA 1W6TA 2C71A 4K3ZA 4LBRA 1F3EA 1UJQA 1XQKA 4J27A 5C2XA 3CXOA 1U1JA 1XD1A 4QDMA 4ICNA 3KVKA 3K8KA 2BOFX 3IK2A 4GFIA 4GHRA 1DVJA 1Q4NX 4OUIA 2HZGA 5G2IA 4L1GA 1DE5A 1DP0A 5D30A 1BLIA 2EEXA 4Q4KA 5D9OA 4PE8A 1V02E 2IW0A 2BY2A 3KAOA 3C3NA 1KBBA 3EMZA 4NAEB 4GC4A 4FR1A 2NZLA 3EA2A 1AFSA 3QKEA 9XIMA 1HJWA 2OT1A 3QY6A 1K4GA 3ZIZA 3CK5A 1FXPA 3TYCA 2CW6A 2AQOA 4MYAA 1B9ZA 3GNRA 4REQB 3S5YA 1TA3B 4LS2A 3WH7A 1R3QA 2O4MA 5BU6A 2Z24A 3IIPA 4HK5A 5FJOA 3O8AA 3T2OA 3A23A 2EKCA 1G67A 3AFBA 1LBLA 4S3FA 3O06A 3RO6A 3L0KA 3HIJA 3L9CA 1L8PA 1NWRA 4AIOA 1XIHA 3V0SA 1MUCA 3EDEA 3WL0A 5LNWA 3TXZA 3QZAA 2V30A 1LRNA 4AVOA 5IXEA 3PBYA 1AL8A 3CUGA 3WDJA 4R9XA 2VGIA 1CPUA 7TIMA 3TROA 3SGUA 2QCGA 1ITXA 1KC7A 3OHMB 1QNRA 1TTQA 2ZUWA 4FOUA 3MO4A 3GAYA 1GVYA 2PA6A 5GNXA 2C15A 2HCVA 2VOMA 4XSMA 1J18A 2PRLA 1HL2A 1K7FA 3E12A 4GZIA 3U6WA 2DSZA 4US6A 1JCTA 3LV6A 3VIHA 3EDKA 1TREA 2WVVB 4P8UA 2IKIA 2OKOA 1US3A 2V3DA 4JIIX 1E0XA 1QWKA 3H2NA 4ML9A 2O9PA 4JPGA 3MSRA 4WY0F 4DJDC 1UMYA 1DQUA 2O56A 3JVAA 4B9YA 2D73A 2ZFAA 3CAWA 3TWBA 5AN7A 3WSUA 1UG6A 3M0YA 4TMCA 1AW2A 4NF7A 2OEJA 1KRBC 4JL2A 3RCNA 1YDOA 2J77A 1KM4A 1OBAA 3H55A 5BXPA 4XBJA 2WOQA 3I4EA 2ZX6A 3DDMA 2G50A 3EXRA 3VC6A 1XCWA 2ZKMX 1JQVA 4HIBA 3KTCA 3QSRA 4QX4A 5AHFA 3W2NA 2CEQA 4AQLA 2R6OA 3ZVIA 4QS6A 5M03A 3E0FA 4ZVJA 2ISSA 3LM3A 1POKA 1TSIA 4DAFA 4KBXA 4K7YA 1YPXA 4FF7A 1Q6CA 4CNOA 4XAFA 1TG7A 4DI8A 3W28A 2VD9A 4C60A 3M7SA 3V16A 5JBFA 3CTLA 3MQTA 2BHZA 4PMYA 3SB0A 3MVTA 3AXHA 3W7HA 1E6PA 3RM9A 2QVHA 3FOKA 4W84A 1OJXA 2NXHA 3PBVA 4EIVA 1QRQA 1NVMA 2PDIA 2PC8A 2VI0A 1A3WA 1HZYA 4H8VA 4JL1A 3W22A 1JVNA 1LJYA 4D72A 4PODA 3UY7A 2R91A 3NOYA 3LCIA 4LJ3A 3GXNA 4QSFA 5GJPA 3VKJA 1KLZA 5CC5A 3KOFA 1CTNA 5D2TA 1K77A 5BXTA 4Y9NA 3PUGA 4Y9AA 1ZQ5A 4X0VA 3DG6A 1RJPA 3E0VA 1VH7A 2E9LA 4F2UA 3FA3A 5LZLA 1F8MA 1H09A 4AF0B 4A05A 1V3MA 4LF2A 5RUBA 1OEPA 3WUEA 4HK7A 2EBNA 1QPQA 1GZJA 3VI2A 4FB7A 3H6OA 2XHYA 1YBQB 2YCKX 3UXIA 3W0KA 2W62A 1PJ9A 4E6MA 2HEJA 1A49A 1OHLA 1B57A 1U33A 1H41A 3ZVHB 5DN1A 2INZA 3QTGA 1DQXA 1XYAA 3ZJ8A 1FP9A 1RD5A 1E4LA 4HK6A 3LB0A 3R8GA 1J0YA 2YLLA 4A8LA 4AMCA 1JPHA 3KL5A 1YW1A 3NVTA 3RCYA 2GSJA 2J78A 1E73M 4RZ4A 2DPEA 5CC7A 2Y89A 1KR1A 1YE4A 3PAJA 1V5XA 4GIYA 1XYCA 1QW8A 3QOMA 5E6YA 1UBPC 3UWVA 4ZB0A 4LYPA 4DXXA 1W3NA 4BEQA 3C2FA 7TAAA 1F4AA 3W7GA 4RNIA 3OW1A 1Q6FA 2XGBA 3WEOA 3W87A 3QHNA 4JYEA 2EAWA 3W7OA 2Y5SA 2DZUA 4L80A 1HKIA 4ZO6A 1GOOA 1IIGA 4JDYA 3VDBA 4CCDA 2CHRA 1UOKA 4AX7A 5CC6A 4HBKA 4DXKA 4FEZA 4A2RA 1D3GA 2QDDA 1BTCA 2FFCA 3LN3A 2C6QA 4ZXLA 3A5VA 1Q8AA 2Y4SA 2DSKA 4AY8A 4IIGA 5H6HA 1TPC1 3SI9A 1PDYA 3IJ7A 5I3JA 4UFKA 1I2PA 3BLEA 1PX3A 1OC6A 3UERA 5LNRA 3RLGA 4WIWA 2NXGA 4UTJA 5FEZA 4IPJA 2OGYA 1NFPA 3VDGA 3DHFA 4IGNA 3TC3A 5MKGB 2OEKA 3K4AA 4PUUA 2FZDA 1NF0A 1AK5A 3GK0A 2QLYA 2INFA 1GKRA 3QXBA 1LBMA 3CAQA 2QUVA 2GGIA 2PCEA 3DFOA 4QLLA 3VA8A 2Q71A 3FHAA 3DI1A 2CXEA 2QGHA 2WNQA 1VPQA 2YXXA 3N29A 4AWEA 3AMCA 1PS9A 3VNZA 5LIXX 2ATSA 2NVAA 3QR0A 4C90A 4Q7BA 3WQ8A 4Q4QA 4EACA 4M6VA 4Q8OA 5F4WA 3DFTA 4JTAA 2DUZA 3M0IA 4D1JA 3CO4A 3NM1A 2GQ8A 1PX8A 4YIWA 3CHEA 4L64A 1FCQA 2IS7A 3M16A 2DZBA 5IDIA 4CD6A 3NZ1A 4YU1A 1UUQA 4BFAA 1SSGA 5LIKX 5C2GA 3IGUA 4P7LA 3VC5A 1EJUC 1JYVA 2Y7FA 2XH2A 2UY4A 2RDXA 3GVRA 1DXEA 1GVOA 2Y8UA 3W1NA 3LRKA 3M47A 2Y8VA 3WLQA 1EF2A 1JYNA 3ARZA 2J6XA 1YDYA 1UQZA 1VC4A 2EPHA 4GH3A 4DM2A 2HK0A 1N8FA 4ZR8A 3IUHA 3UXKA 1IQ8A 1R87A 2FIQA 4A8RA 2G37A 3UXDA 4UNLA 1WA3A 1TPB1 2A5HA 1WKYA 3RF9A 4WGXA 4WY0A 2E67A 3W85A 3G1SA 1ZUAX 4C5ZA 1FH7A 3NXFA 1UWRA 4IX0A 3E1F1 1RJQA 3PUDA 1RP9A 1MQQA 4H6QA 5LIUX 1XLGA 1RJRA 1FFRA 1OX6A 4NJGA 1FWNA 3A6OA 3GBDA 5GNZA 1TWDA 3R43A 3MUIA 4IUGA 3KWSA 5F4XA 1SFJA 2Z1XA 4YLWA 2QIWA 2Z25A 3CQIA 4K6AA 1GVQA 3UXLA 3C0JA 1E6RA 2G4JA 1M7XA 4M82A 4DJDD 5J5DA 3LRMA 4TOQA 4MLRA 3N14A 3K1GA 4IMDA 1R38A 1ESWA 1EH9A 4MB5A 4WK9A 3NO5A 3S3GA 2GYIA 2MANA 2ZRYA 3MW7A 5HNRA 2BY0A 4BK9A 3MP4A 3QN3A 3QLDA 4GC3A 5AOUA 1A0DA 3LCXA 1EFZA 1VBJA 3M6DA 1Y5WA 3SUUA 2WJEA 3II1A 1XF0A 4O1EA 5REQB 1DE6A 3BQ5A 4U31A 2Y8KA 1OC5A 2I56A 1NWUA 3AHXA 3MI2A 4WX2A 2GUBA 1J0IA 3W7JA 5IOBA 4OWGA 1IE7C 1EDQA 4WOQA 1G0CA 1GW1A 1XBXA 2AKZA 1QI0A 5D9PA 2ZZ2A 2OYLA 1E0VA 5D05A 3P5YA 4HPNA 3IVUA 2ISWA 1DIKA 2FDSA 3OGRA 1RR2A 4Z08A 2XN2A 2ZICA 5ENLA 3JRKA 3K8MA 4O1CA 3ONCA 3JZEA 3W1XA 3WUFA 5MF5A 3N9SA 1OYBA 1GOQA 2G95A 3WH6A 4XTIA 2WC3A 4Z2JA 4Q6XA 3WDQA 1YXDA 1X97A 3KRUA 4INFA 4DVOA 1JZ3A 1M7OA 1DXFA 1ZENA 1DJXA 3CT2A 3C86A 4ADTA 3WF1A 4U5KA 4LUIA 2EHHA 4GUHA 4JQ1A 5A94A 4PFMA 4BA0A 1HG3A 3PJTA 4QHRA 1TX2A 3TFXA 7A3HA 3O3RA 4B5TA 1VP5A 3FKRA 3LHUA 1XLLA 1OYAA 3BLIA 1XCFA 3T78A 5JH2A 5G5IA 1UKQA 4F79A 4RPQA 3TTQA 4B16A 3TJ4A 1H5YA 5L9FA 1GVIA 1KKOA 3EOUA 4F3HA 1XIMA 2XVLA 2W91A 4CU8A 4NX5A 1QASA 1F7BA 3GQYA 3KTXA 1JL8A 1KFBA 3GC5A 1GEHA 3AIBA 1JGIA 4UFLA 5I3DA 3UG4A 2J7DA 3ID7A 3VNMA 4H9YA 1RQEA 3V75A 2VM8A 3QMTA 2I14A 2H90A 2CCRA 4JTEA 4AUBA 3LNPA 3NZGA 4MIMA 3L2MA 3TIMA 1EWEA 1OB0A 3NAVA 1XI3A 3ALGA 3P8JA 4W87A 2V82A 3W7PA 3SQLA 4UTUA 2DZPA 2FZNA 2QV5A 2ZA3A 3KWXA 3TKFA 4CU7A 2PMQA 4IT1A 2FQIA 4JOMA 2PGEA 1VFHA 1A5AA 3H26A 2B7NA 4K38A 4I7WA 4Q4RA 1RK5A 1KGXA 3OG2A 3G1YA 3VABA 3M44A 3G1HA 1CXEA 3S6DA 1NDYA 1K7EA 4NZ1A 4LNCA 2PDMA 1D9EA 1LF1A 4C65A 1MDLA 1Y0EA 1MFUA 1B3ZA 4ATLA 4GYKA 4IUOA 5ECUA 2CLFA 3IUIA 2PTZA 1KBJA 3THDA 2B7QA 1LG1A 1VBRA 3AXIA 3PBMA 3B8DA 3UCDA 2ABBA 6TAAA 4JBRA 1F3XA 3KRSA 4TX8A 1ZY9A 2F84A 4JIHA 1VKFA 4B5XA 1KXHA 2P8BA 4CU6A 2EKGA 1HVQA 1M3UA 3E6EA 5DBUA 1QCWA 4O1DA 3SRDA 1V3LA 1EC9A 4QXIA 3DERA 4Z1YA 5DFAA 4R27A 1FWBC 3RJXA 1FH9A 1OIFA 4GO9A 4I7UA 3AXMA 3DCPA 1HO1A 4UTWC 1SZNA 4EAMA 5K9DA 5K7JA 3DHPA 2WLZA 1TPVA 3WDPP 1F4HA 3UWUA 1SSDA 3GH5A 1QHOA 1WV2A 3SQMA 3VFLA 1EP1A 5D9MA 5CXPA 4JIPA 3A4WA 3B3DA 3GR8A 1I2OA 2JEPA 3GU9A 3WDIA 4ZFCA 2ZRZA 3NZPA 1R8LA 3UR8A 2CHOA 4O13A 1EIBA 1D3HA 3EKGA 3ARPA 4ZO8A 1WOBA 2VFGA 3ZJ7A 3IGXA 1WXYA 3U5YA 4IJCA 1CXLA 2VZTA 5H2ZA 1EYWA 3DN5A 5I3GA 1R0MA 4ZE4A 1PKYA 2CZVA 2XIMA 4QJ5B 1FHLA 3HM7A 2PDNA 2XISA 3LQLA 5L6UA 4ILSA 3CZJA 3QSTA 5I77A 3L5LA 4D6EA 3ZSSA 3W1PA 1NH6A 3W88A 3AMKA 1OM0A 2HQAA 3BZGA 4AX6A 4CQ9A 1ONRA 1XYLA 3YPIA 3IJ9A 3K8LA 2Q02A 5CLTA 3VUSA 3GKFA 2GOUA 2AL1A 4D6IA 2P3ZA 3CL8A 2E9BA 1DHPA 3K30A 4MADA 1AUSL 3USZA 5FF7A 5LA2A 1RUSA 3B04A 4JFWA 2Z6IA 3BK0A 1SUXA 3TSMA 2ZVRA 2FZBA 3MV01 2VRJA 1S3TC 3WDHA 4DHGA 1HGWA 1R9ZA 1IWAA 1CGXA 1UYQA 1B1YA 5FL1A 1V7AA 4U33A 4JCMA 3BWWA 2FGZA 1E6SM 2QUTA 4QS5A 4JFUA 4F2BA 1EOMA 3CHFA 2QT3A 3MUY1 3ANUA 1VLWA 1REQA 3AXXA 1QPRA 4S38A 3NR0A 1DTNA 1RA0A 3QFWA 3CHCA 2WWCA 4AD0A 3BCDA 3A21A 1R85A 1A47A 3JUGA 5AC8A 3VGBA 2R82A 2QZRA 2B4GA 2E6DA 3AU6A 4F0SA 2OPJA 4OOZA 2YL5A 3VIIA 4HPJA 2WVSA 3W7NA 4DELA 5D33A 5I78A 1XJBA 1M03A 8XIAA 4XZWA 2X05A 3ITCA 2YW3A 3GVWA 3AUOA 3CS2A 1WCGA 3CUFA 4H8NA 1N8WA 3CV6A 1PPIA 2ZBTA 3NQGA 2D0FA 3PANA 3WK3A 2MUCA 4JAWA 3IVSA 1E4NA 2FVLA 3NZRA 5AC7A 4O28A 3P14A 3FYOA 4U3CA 1IZKA 4CCCA 6ALDA 3EOLA 3TJLA 1RY0A 3AAMA 4AVFA 4GK8A 2EJAA 1XBVA 3GTHA 2YCLB 2Z00A 3RO8A 2PWEA 3BJTA 1VIZA 3MDUA 4UQBA 4AIBA 1ZFJA 3T8LA 1TZZA 1J0ZA 1M1BA 2KAUC 4I5UA 4FX7A 4ZODA 1JFXA 4Z2GA 3G1RA 4HOXA 4DWSC 1UR9A 3E2QA 2V6AA 5D37A 5CC3A 3STEA 2I5QA 4LS1A 5BCAA 3ELFA 4XZHA 3AALA 3V35A 5FD0A 3S2JA 1VAHA 3WX7A 3R8HA 3UEQA 4NJKA 4DF2A 1PXGA 1FP8A 2XVGA 3BZJA 2NLIA 4GI9A 1XIGA 3LXCA 4CD7A 4LH8A 3LERA 4O52A 2X40A 4NJHA 4GYJA 2WVUA 3GG1A 1JDCA 3WMLA 1CGYA 1KFLA 3LI0A 3KLLA 2Q01A 4WHBA 3I3DA 3DYPA 4P7QA 3SGGA 4GVGA 2AMGA 4UQ9A 2ACQA 4RLIA 5K3VA 4NAFB 4TIMA 4LGXA 3TUUA 1J2BA 4Y8EA 2OZ0A 2OQLA 5AKQA 4C91A 1VPYA 3VOCA 3UNDA 1FDZA 3L4YA 4NNAA 2Y5JA 2PBGA 4NAEA 4BQ4A 1S1RA 3LZ3A 4MKVA 4LAUA 4JS3A 4Y6GA 4GPNA 3W74A 2OXNA 4DJEC 3PB2A 2O9RA 1TIMA 1TO3A 3KVMA 4DRSA 5AB3A 1A4LA 2NUWA 1ODUA 4AZ6A 1J11A 3R8RA 2XVPA 2BWGA 2NQLA 5A8GA 4PTMA 2BB0A 4EANA 1B54A 4HPHA 3W1AA 3P61A 1ONEA 4REQA 2YYTA 1TA3A 2CZFA 1LT7A 4PGLA 3BUVA 1EGMA 1KGWA 1GOKA 4FOKA 1G01A 1I0BA 1I9CB 2QXWA 3I7QA 5DMYA 5D02A 5F4SA 2HXUA 3LLXA 1JCYA 3T8QA 4G5DA 4KETA 2P53A 1KFEA 3GS6A 3HQNA 1AW1A 1X1NA 3NPWA 4H6EA 4DYKA 1XSIA 1P5BA 5G4EA 1HKMA 1UHVA 2D0GA 3GB6A 1YHTA 1OX4A 4FXSA 4HHMA 4S3JA 2DJLA 4K1WA 3LHWA 1DL3A 1J12A 4KQNA 1OVDA 4X60A 3CWNA 3ECQA 4X2RA 5K9XA 3VNDA 1BQGA 3BC9A 4W5UA 1GKPA 2RH9A 1OSEA 2YDQA 1VFLA 2IKGA 3E0WA 3HGRA 4ZQRA 3MDWA 4O18A 1H7XA 4AZCB 1EC7A 3UZJA 2WVVA 2PLMA 4J40A 1WAUA 3FA4A 2UY3A 2QNEA 4JZ5A 3K5XA 4BJHA 4L65A 4RR4A 3F5JA 5IBXA 3TW6A 3ZWSA 3ZO9A 4EKJA 3NM3A 3VNLA 2DP3A 3G5EA 3WLPA 3APGA 3FLUA 3M5ZA 4CUCA 2DZXA 1H1NA 2PBOA 4XISA 3IVTA 4YWSA 1HKKA 3E74A 3U4AA 3MKKA 3TZFA 3GLCA 3ITGA 1BYBA 3REQB 1XIJA 3IACA 4WRHA 4YXGA 4IISA 2OZ3A 4ERAA 4XVDA 2X1SA 4AEOA 4C1KA 3CAKA 4AWTA 1Y5XA 3H23A 3PZIA 1JCNA 3U8GA 3UYCA 5B7ZA 1CLXA 3I3BA 2A3CA 4DBDA 3TW7A 1A3XA 1JCJA 3S2NA 1CB2A 1D7FA 3EWZA 4DJFD 4GJJA 4X3ZA 3ZM8A 2VCBA 3R2GA 3GW0A 4LRTA 3ME3A 4NZFA 4F8XA 1B3YA 3QGAC 1S2CA 3FSUA 2BGSA 3KOWA 3BDKA 2YFOA 1LLZA 4K36A 4IFOA 5HPOA 2BX7A 3WLRA 1Z89A 2P8CA 3AMGA 2RJGA 2P3EA 3ZLGA 2ESCA 4PUKA 3Q94A 1LWHA 2ACSA 3NSMA 3LLDA 2TPSA 4L5ZA 3KBNA 2GVGA 3IANA 2PGFA 5F2GA 2PWFA 4PMZA 2WPBA 2ZX9A 1NEYA 7ENLA 1WXZA 1GZGA 2GJXB 5HMDA 3QOKA 1V77A 4UTTC 2WZEA 4BR1A 1Q7MA 3BAWA 2AKMA 1XLAA 2Y6ZA 1A4MA 1KO0A 4PUEA 3QF0A 2TSYA 1EDTA 4ZSTA 3SSJA 2BGQA 5AHNA 4UTMA 1SZRA 1V8EA 4JX6A 1XDMA 4MJ2A 4B2DD 3AS3A 5GJMA 3B9NA 1SZGA 5AZ1A 3ENLA 4AF0A 1PTGA 3SFKA 3CIXA 2NXIA 3SCQA 4LUSB 4NZ4A 3KDNA 2VRKA 1KM6A 4F0HA 1O5XA 1YBQA 2VEIA 4F0KA 2OO6A 3UJSA 1MUWA 2DIJA 3W1QA 1ONXA 3RR1A 1MQRA 3ZVHA 5A95A 1BSIA 5KTLA 4O14A 4ZOEA 3KHDA 1QUMA 1UUMA 5JH1A 3UT0A 3AYSA 1RCQA 4OU1A 2CWNA 4XD3A 1ZU8A 5D38A 1HL8A 1C92A 1LQ2A 4WDXA 1DXIA 1Z41A 2OOGA 3B9AA 1V6YA 2GSHA 3KBSA 1HQTA 1HJSA 4KRTA 1TZ9A 2QDEA 4E2DA 2PAJA 1TUXA 3W6YA 4PBEA 3GXFA 1NIUA 1TTJA 2A6LA 3GNPA 1NF7A 3FJLA 3C2EA 1BPLB 4G56A 3N2OA 1KFJA 1D7KA 4JTKA 3TZNA 3QYSA 3VOGA 3VOJA 5HNNA 5D4YA 3VMNA 2HPMA 3VNJA 5T8GA 3SECA 3UGRA 3UR5A 3PBGA 1GEQA 4D1IA 3VGFA 5JU6A 4DBUA 4I7VA 2G41A 2VQUA 2E3ZA 4MM1A 2OU4A 4Z0SA 3WLMA 1VJZA 3G1VA 4QR6A 3GR7A 5E0CA 4DWSD 3MC5A 2B7OA 1EJSC 1ZRQA 2ZZ7A 3CL6A 4L4PA 4W7VA 3ZSTA 2G96A 2F6XA 1YTEA 1W5NA 5MKGA 3ABXA 4KW2A 3N9KA 3UZ5A 2PGRA 4BI5A 4G1KA 1HVXA 2XIOA 3N4FA 4XQ6A 2A3AA 3RR4A 2QJGA 2PDLA 2J9ZA 2PZNA 2ZUTA 5A5WA 4V1YA 4V27A 4KT2A 4M6UA 4PC8A 4NZCA 1QXLA 4W8AA 3FXGA 3HN3A 4IJBA 1L8NA 3C5QA 2CBIA 2QUMA 1L0PA 1SVDA 1WQ5A 4D8AA 1JI1A 2ZE3A 3QW3A 1FOBA 1ZHAA 4RXGA 4MYXA 4WSKA 1JQXA 5FCZA 4KFNA 3WF0A 2INEA 4DJED 2CLLA 4HQVA 2A4AA 4JXCA 3QPYA 2Z1VA 4BI7A 3T05A 4AXNA 2YBVA 1XLBA 3H2EA 5E09A 3WD4A 4ADUA 2VR4A 2Y7GA 4J3WA 3N4AA 3CM4A 3SM0A 3NA8A 3VINA 1V0MA 1MUMA 1PIIA 1ZALA 4GVFA 1YXCA 2X0YA 2GQ3A 2WJDA 3VGEA 4WDUA 3NSXA 4YTUA 1XPGA 3AHVA 1C93A 3AU2A 3HGOA 1Q8JA 3MWCA 3EMQA 3ERPA 4FK9A 3S2MA 3TLLA 2CLEA 2BOGX 4HU4A 4RCXA 4B92A 4XK2A 4F0MA 1TV5A 1AQHA 7PTDA 2X1RA 4I9MA 6REQB 3SCUA 5DRIA 1UKPA 3UXAA 4L61A 4MMWA 4PMQA 1E72M 1UC5A 3NFUA 4S39A 4H8HA 1WPCA 3BGGA 2Z2UA 1EJTC 2R1KA 3CC1A 4IIHA 4YTQA 4LF1A 4E2VA 1TIWA 3UCCA 1T6MA 1ITUA 4BS0A 2D0HA 4K1GA 4JKMA 3AS2A 5F2LA 3W02A 2A7RA 2VFFA 2BXZA 4FP1A 5BW6A 1Q3NA 4GNKB 2XFRA 4AEFA 3M6YA 1ZPTA 2F6UA 3H4WA 1O95A 2ZVIA 2ZCGA 1XQLA 4O12A 2CZEA 1XH2A 3SCVA 4B90A 2MNRA 1CXFA 4GYFA 2PDXA 3KVLA 1KXTA 4LSBA 3I7SA 3QHOA 3CH0A 3BARA 3L12A 3GHRA 4H41A 3IWPA 3T07A 1LUCB 4GUFA 2J8TA 3SY8A 1R9YA 1VQTA 4HZ6A 4UCFA 4Q7IA 1QHPA 3CV1A 1AJ2A 4JHZA 1W2VA 1FWAC 1M68A 5REQA 3WQGA 1TMHA 5IM51 2V3FA 3FNDA 3N2TA 2XN0A 1HP4A 2NVCA 2YPIA 4GWEA 4C6DA 1EKOA 3IJQA 4OJYA 1V0LA 3L5MA 1HJVA 3PBWA 4CNNA 5TQLA 1SJAA 3GUWA 5CSYA 4KESA 2PDFA 4ERIA 2H6RA 3KDOA 2DZSA 2GJLA 1U1UA 1MW1A 1SFLA 1JAKA 3EMCA 4HNOA 5ABTA 1A50A 4HSNA 3WMCA 2D1ZA 1R46A 3CB3A 5C71A 3DBNA 4I5RA 2QUNA 1AH0A 1Q85A 4CQDA 4OV9A 1VYSX 4ASTA 4QG9A 4D8ZA 1F5ZA 4D8LA 3TYBA 4OUEA 3CHDA 2ZRXA 2ODOA 4FO4A 4E4PA 1OFPA 1XH1A 3HA1A 2V5JA 2Y7DA 3BGJA 1X96A 1KNWA 2X7WA 1P7TB 4C6KA 4MWAB 1UP2A 1IV8A 2YB1A 1FWHC 3VYLA 1KXQA 3OGVA 3WLSA 1OGSA 1UWIA 3W7LA 4Z1BA 3G0UA 3VIPA 5I0DA 3P7YA 4QG6A 4DF1A 3W7EA 1EGZA 1W1VA 4LVDA 3WBXA 3R12A 4HNNA 1FHDA 5JQ9A 1VEMA 1FTXA 3WBAA 4PCFA 2QAFA 4DO4A 1LL6A 1NWTA 2VEMA 3UG3A 1FWIC 4M0XA 1H7WA 1E1FA 2CLIA 4LCSA 2HVNA 4PH6A 3LMYA 3LCFA 4DBWA 5DRCA 2HJPA 1EXBA 4CQBA 2ICSA 4FAMA 5AYIA 2R14A 3BAIA 1CGWA 3FXYA 3D5HA 2JGYA 1O4UA 4AXKA 1W1YA 2ZZ5A 4CNUA 5AYZA 4JYDA 2WVTA 5IDZA 3URAA 1MW0A 3AJXA 3U2ZA 4O53A 4JTTA 4IP7A 3PNZA 3Q2DA 1ML1A 4YVXA 3GDKA 2OWWA 1HKWA 2V5LA 2XVNA 4J7RA 3OZPA 2X1UA 3TQ0A 3HPXA 3ZT6A 2YA2A 1B9BA 3AISA 3CWHA 2WWDA 3CMGA 4WKAA 1Z48A 4YTTA 1PE1A 3MI6A 4KIEA 1XLHA 3CPUA 5TIMA 3MMUA 4ZSUA 5CH9A 1ADDA 2VFIA 3UPMA 1K4HA 3SJ3A 3USBA 3R0UA 4D6FA 1E6NA 4Q8VA 1B5TA 4P8VA 4ORMA 1M04A 1DJNA 3WKZA 3UVAA 3EX4A 3UWEA 3B05A 4HT3A 1H4PA 5HNUA 1DHKA 1EEXA 1KB3A 5CAHA 1K8XA 1ZCCA 3F5LA 2X2YA 4I8YA 1Q2SA 3MHGA 4KWSA 5I7GA 1RQBA 3U7BA 3GH7A 2V38A 4IPLA 3A13A 1XYFA 1KLYA 3TV8A 5PTDA 4O10A 1G7UA 4XZMX 3FVMA 1BEUA 4QDWA 2E6FA 2BSLA 1EPXA 3WJXA 1OCQA 4U3AA 1B3OA 4I90A 2VVNA 4MY8A 3WZ0E 4AC7C 2W79A 4BHYA 3FSTA 3EPNA 3GWQA 3L4XA 1V03A 1H5VA 2V8ZA 3KEHA 3P93A 3C0QA 1A5NC 4NUWA 1UH3A 3W1TA 2X2GA 4S1FA 2XIBA 3NYZA 2WHJA 1EUNA 4YMZA 3F4DA 1JXKA 1K9FA 2HWGA 2FPTA 3NWRA 9CGTA 3AUJA 5HQLA 1W9VA 3OZMA 4Q7NA 5HQEA 3KRBA 4DNHA 1KRMA 1OINA 3H12A 1V6UA 2XFYA 1T8QA 4ZXOA 4H7CA 3B4UA 4NYUA 3ANVA 4FZIA 4AZ7A 3SUTA 4NZJA 4HA3A 1V6WA 1EPVA 1Q65A 5HATA 2BY1A 3F4WA 5AVHA 3W7DA 4R33A 1JG9A 4TO8A 2Q3OA 3WMBA 3RU8X 1E3XA 1C8VA 2B0MA 4LBUA 4E3TA 4M7TA 2IXUA 1AMYA 2EJ1A 4V2XA 3B03A 4XSLA 5HNTA 2BVWA 2Y0FA 4UC5A 1GQKA 2CBVA 5D2WA 1KWKA 3BG5A 2PWUA 1KKRA 3D47A 4NT0A 4RX0A 4H9TA 5CBBA 3RMEA 4AAJA 3PWIA 4AYGA 3RMJA 3IJ8A 3HV9A 2VENA 2EGZA 1OF8A 4XZ9A 2C7FA 5E0KA 2DVTA 4TU1A 4QE4A 4UXDA 3CYVA 1YQ2A 3OLIA 4RXFA 2E7FA 2QVNA 4PN2A 2GQAA 2GGHA 4MF4A 1XLJA 3LPFA 3IRSA 4UQDA 1I2QA 2YA0A 1VB9A 3VGDA 1C3FA 1EBHA 3CV7A 3PJUA 4HYRA 1VYPX 4JFSA 4WGHA 1VJSA 5CG0A 3KE0A 3W81A 3GY1A 2GVJA 1O68A 3VNYA 1ZGDA 1QBAA 3GM8A 3HV8A 3UBPC 1WX0A 3HB9A 4U10A 4DJFA 1A5KC 2NT0A 5A8NA 1B3WA 5C9XA 3S9YA 3BSMA 1CLKA 1EL3A 3CQKA 2HTMA 2C0HA 4UTLA 4XUGA 5FJUA 1O6IA 1MW3A 1WP6A 3Q4DA 3MANA 4MLJA 3VNIA 4DZAA 4PR4A 4ZENA 3VE7A 4FNPA 1GOIA 2YYUA 1JDDA 3NOEA 4IGMA 3WENA 1BKSA 4LEQA 5G2WA 4QAWA 4ML4A 1R3VA 1VD6A 1LOQA 2A79A 3LQGA 4HP5A 3SEPA 4J35A 3VIKA 2FZMA 4BKNA 3E0IA 2E09A 2J7GA 1DIOA 2CZ5A 3W07A 3ONBA 1BRLB 4EAYA 3UG5A 4Q8QA 2Z7GA 5CJMA 4J28A 1BG4A 4I5XA 1FWFC 2OELA 4K8HA 4LPCA 2YCLA 1X98A 3AS1A 4E8GA 3FEMA 1RQHA 5C5YA 3GH4A 1C90A 1GNXA 2PWHA 4GNJA 3W70A 3WQ6A 3HQOA 1TPUA 4LANA 1UWAA 4DB7A 3K4WA 5D8WA 4Q4OA 2CZDA 2WCSA 3OQ8A 3PS7A 3OLDA 4IIDA 2X8RA 2V9DA 4C7GA 3DKLA 4J3ZA 3Q45A 3PPCA 3GHSA 4OKDA 3Q65A 3GXMA 4S3GA 3QBUA 2ZDSA 1C29A 2J9XA 4N0RA 2DORA 3B0UX 2DSVA 4JEJA 3W1UA 4IJRA 4HSHA 3TTYA 3G77A 1CXIA 4EWND 4MPQA 4HTYA 4HGXA 3STPA 1MRAA 3GFXA 3BLPX 5H8PA 4CD4A 1GOMA 4N7QA 3T40A 1EIXA 4RKAA 4NAFA 4Q8WA 3VCNA 2WZIA 1XR2A 5BMXA 1V6XA 3SCTA 3TMLA 1P43A 3PFRA 2D3NA 5E9AA 4W85A 4MKSA 2QJNA 2B31A 5FI8A 4JTSA 5EMLA 4RE3A 4KWVA 3PTQA 4PTNA 4OBSA 1XCXA 3CBWA 4AZIA 2QDGA 1JD7A 1E15A 1G69A 1C91A 3TJXA 3U48A 4R3UA 2PTDA 2W5FA 4KF1A 1QT1A 3LHZA 1F61A 1W37A 4PFHA 4Y90A 1OK6A 2VX4A 3INPA 4DLFA 4HU3A 4R88A 1TWIA 3B06A 1CW2A 1NARA 3PZUA 4PEEA 1TJ2A 3N3MA 5H91A 4K8GA 3N1AA 2XSAA 1SFTA 1A5LC 3ZLHA 7ODCA 3C2YA 4Y9MA 2WSPA 3TNBA 1QJWA 2BHYA 1EDGA 5AHLA 1MNZA 1MXGA 3VD9A 3JU2A 1C7SA 3O7UA 1U22A 1TR9A 3SFWA 2J7HA 5T26A 4W9TA 2E9MA 3T44A 3VPLA 2XFFA 2J7FA 1PSCA 2XIJA 2IPJA 3BANA 5FL0A 3OPSA 5DMNA 4IL2A 2JIEA 1OQFA 8A3HA 4AZCA 3TN4A 4Z2IA 1FWWA 1J93A 4YCPA 3U57A 1UA3A 1UH2A 2XWDA 3QMRA 3ITVA 3APTA 1A80A 1V3KA 3ARVA 1J01A 2WXDM 2GGEA 4CQCA 3NGFA 9XIAA 3CIWA 1W1A1 3E3HA 1HFBA 3U3HA 1DPMA 1BXCA 3REQA 4O16A 2J6VA 4ECLA 2ISFA 4DN1A 2E4TA 5FF4A 4GZJA 3RM4A 3IS4A 4A4AA 4C6PA 1I45A 2Z1KA 3WUBA 1FWDC 1UWTA 4JIRA 5M2FX 2DSWA 2C18A 2O7SA 3KL0A 3DESA 2V81A 4W7WA 4FXJA 4H00A 4NRRA 3I4KA 4CD8A 2ZQ0A 1AODA 2EPOA 2WNNA 1M9HA 1XS2A 4GINA 3URNA 5C7VA 2JALA 2XZ7A 4ORIA 4GISA 1KFWA 3RG6A 3WLOA 1E55A 2X0SA 4PCTA 1XLCA 3MYPA 2HSAA 3SCWA 4YJ5A 4I8DA 5FJTA 1PTAA 2B81A 1TJRA 5GNYA 3CLMA 3QZEA 5I6SA 4GNVA 1GVFA 1LP6A 2HDJA 3SN0A 1K02A 1ISVA 4TV6A 2NWSA 4PTVA 2XH0A 4EK7A 2GJXA 3NPUA 3MBFA 4Q22A 4ACYA 3AC0A 3AWOA 4UUIA 2ZTJA 2DGAA 5J5RA 1RSCA 1OX5A 4YTSA 1AJ0A 4PMNA 4JEQA 1EP2A 1JYXA 4GI6A 1U5HA 3B8SA 3LLFA 3ZJ6A 1X6NA 3V0UA 3LHVA 2DH3A 1AA1B 4IG2B 3RK8A 3HG5A 4E38A 1UB3A 4L6DA 2DV0A 4MNLA 3GBEA 4LUSA 3STFA 2NX3A 3JZUA 3DG7A 5I09A 3RLVA 3RRXA 3W4RA 4QJ3B 3CHVA 2BASA 6PTDA 3TQPA 5AYYA 3EWUA 5KMYA 4Y2WA 1KTBA 4MY9A 4GXWA 4ZGYA 3S47A 2WZTA 2QKFA 2VJXA 1EEPA 1TRDA 4EPDC 1PCWA 1P4CA 3OVGA 1BVWA 4F9DA 2PDWA 1TCMA 3APYA 2W6RA 2IXVA 3SO7A 5C6MA 2Q8XA 1CLVA 2OQHA 1JZ7A 1UP0A 3OA5A 4GZEA 3T09A 3M0VA 4QJ4B 1Z7AA 1DTUA 2PODA 1XSKA 3FAWA 1E56A 1B2YA 3SUWA 5A1AA 3J7HA 1KM3A 1XM3A 3RPDA 1IT7A 4NL1A 1TWSA 4M6PA 5FSDC 3BOXA 4WJ8A 2D24A 4PB3A 4IP4A 4KWWA 2ADAA 1MQPA 1A3HA 3U0HA 4ALDA 5E6ZA 1GJPA 3TR9A 1K9TA 4O0ZA 4ZTXA 3ARXA 2WC7A 1OFEA 2UBPC 5MHBA 2GWNA 2PD5A 1LWIA 3W27A 4EPBC 3H53A 5E9XA 3S5NA 2Q09A 3CUJA 3VDAA 3NQCA 3STGA 3CU2A 2JF6A 4E2OA 1Y5VA 3VKCA 2GJNA 2X7VA 3S1WA 1SR9A 4C6MA 1NQ6A 1X6UA 3R94A 3GUGA 2ZXQA 3JW7A 3NQ8A 4QISA 2QS8A 4H19A 5CGTA 2VL4A 4YNGA 1QK2A 4ZEPA 1TJ0A 2HV5A 4AD5A 4PL2A 1M65A 4NRSA 3NUKA 3ABSA 4HNVA 4ZMGA 4O4VA 1EF3A 3GD6A 3GYCA 1LROA 4FXRA 1D3CA 2DVXA 2XFWA 4D6JA 1WOAA 1GGOA 3FV9A 1IF2A 1S5WA 3RAOA 2ZX8A 1NFGA 2LLEA 2D3LA 1PHQA 1GYLA 3QQ1A 1XLIA 1LWJA 4CCEA 2V5DA 1DKWA 3MHFA 2XJ7A 2V3EA 1AW5A 2J7BA 1QDSA 4DYJA 3CUZA 3H70A 4IP5A 4ICMA 5I07A 4L56A 1JPMA 4W93A 2P1FA 3NQ7A 4RUBA 4M80A 2VC7A 3DHUA 3M5YA 3M5VA 2WM1A 4OIFA 2PGWA 5HMEA 1MZHA 3E49A 2D20A 1ISYA 3MMDA 4QP0A 3C0SA 3WF4A 4P5UA 2W61A 5BWAA 4IGSA 3G1AA 2P76A 1W9XA 4W8BA 1OCBA 4UFHA 3W6LA 1V6VA 3MBDA 3MCNA 4IMGA 6REQA 2ASHA 3WJZA 3RLHA 3UGVA 9RUBA 5EMJA 1W1IE 5M1TA 3F4NA 4A21A 1DOSA 3GIPA 4J2PA 3F7JA 3EEZA 1EJXC 4NKCA 3UZZA 1HJQA 1XISA 3ZT5A 2OQYA 2CLMA 4HA0A 4Y7EA 1N7KA 3MP5A 4RL3A 2A1YA 5BOFA 1RLCL 5CGQA 2EF9A 2OYKA 2YBTA 3G8EA 2ZDRA 3JS3A 1ECQA 1H0GA 2CYGA 4Q6JA 1X8FA 3GVQA 3LPOA 3M0HA 4FX8A 2W92A 2FHCA 1CZ1A 2VR2A 4IXHA 5HA7A 3VILA 2CESA 4DO6A 1SM9A 2VFHA 1S3HA 1FHUA 2X1IA 2WCAA 3NVDA 1H51A 2OR2A 4ONVA 1LUCA 1A5UA 3TYDA 1LLWA 3N6HA 3RFAA 4DF0A 1IXOA 2R8WA 1NWSA 4BQ2A 1CGVA 3TN5A 3WQFA 2I1OA 2QCMA 1DWIM 1YNQA 1V3IA 5IBXC 5AC5A 5HXMA 3CJPA 4O15A 2DH2A 4IMAA 4BQ5A 1VFOA 1UIPA 4QCFA 3UPWA 3IEBA 3LNMA 3CGTA 1HUVA 3VD7A 4DI9A 3M07A 5CBJA 1EQCA 4YN5A 2C8NA 1EX1A 4KGJA 3CQJA 5HUPA 2PDKA 4LTSA 3M5XA 3EKZA 4GKLA 3QQWA 3W24A 1W9DM 1XKJA 2J4GA 5CGMA 1FBAA 2R1PA 5A2AA 3BPWA 4AG0A 3WD3A 2QCFA 3TSDA 4A8IA 4OBRA 4O8AA 1RPXA 2GJRA 2DDXA 2VC9A 1GG0A 4QIUA 4GUIA 4NZ3A 4X63A 2XDFA 3LHTA 5G4HC 1L6FA 3C4UA 5HR7A 2BGNE 4MZ8A 2BP1A 3AO0A 1GQLA 1B3VA 3KS6A 1ZBVA 2OGJA 3UZXA 1BYDA 5CPLA 3LSBA 3E38A 1K3UA 1H2JA 1P7TA 1JUKA 4GH1A 4MWAA 1TWZA 1ZS2A 3R4IA 3MUZ1 3VIFA 4MG4A 5D2YA 3W23A 5D03A 1UBSA 4X61A 1OFQA 1W1PA 2QV4A 3PUOA 3UY8A 4O11A 1RP8A 4LC8A 4H01A 3KP0A 3NO1A 2C3ZA 1NP0A 5BROA 3GDLA 5AVNA 3T1GA 4MY1A 1K7XA 3QRHA 1BKHA 1ZBKA 1C8XA 4U4MA 1MFVA 2C91A 3PTDA 4LVGA 3SCNA 1ONWA 3ZFHA 3TOYA 3H2FA 2O7QA 1UPMB 2P88A 4AD3A 4ZOCA 3LBMA 2HE8A 2ZUNA 3RRAA 3VAVA 3B8TA 2OVLA 3GNNA 3HJEA 3K13A 3TQVA 1W3KA 3AYVA 1SJDA 2PCQA 3FIGA 5DF0A 3QKZA 3NSNA 5F2MA 5EMMA 1JULA 1X7IA 2IQTA 2QMKA 4FX6M 3V5OA 1JAEA 1UA7A 1PEZA 5KZEA 2E5DA 3OGSA 5JVLA 1FWSA 4QE5A 3ABQA 5F2IA 4IHCA 4N4QA 4PUJA 2NWRA 3BICA 4GBDA 3FFSA 3D3FA 2IPFA 4KWUA 4LVBA 2QEZA 3UA4A 3N6QA 1UIOA 1UW9A 3W9ZA 4BY3A 2GWGA 3M1ZA 2D2GA 1H11A 3R89A 5A69A 4EX4A 1US0A 3KFTA 5BMWA 5DX7A 1DJYA 1M7JA 2ZUVA 3WH5A 2VX5A 3FYYA 3PUEA 3MUXA 2VTFA 5C7HA 2FZ8A 3GU1A 3WQPA 3NEVA 3A24A 1UOZA 5FA5A 2FJUB 2Z1WA 1W8SA 3CAVA 1IR2A 1JGMA 1Z32X 4JNYA 4NY2A 3W2KA 5FOOA 3VIMA 1I2NA 1LBFA 2YFNA 3AIRA 4MZYA 5I00A 4XBKA 4ZOBA 3QW4B 1TQXA 2FLIA 3QVQA 5H8MA 1XBZA 3WLTA 2E5BA 3L4ZA 4JN7A 1YPFA 2I5IA 2WMKA 4JD4A 4Z1DA 4P2VA 1ZJAA 4FNUA 4QROA 2WCGA 3EX2A 4H3DA 3R1ZA 4LAZA 1M41A 4DX3A 1WXJA 3LCWA 1F05A 7REQB 2WC4A 2OT0A 4ZQPA 4Q4MA 5CPTA 5D04C 4U28A 1KBIA 3F4VA 3EWXA 3S42A 2GDVA 1NJJA 5I5RA 2KZHA 1CYGA 5CSSA 3WNMA 1EB3A 4QRNA 4IQLA 4Z0JA 2F8QA 5I3KA 4BZYA 1L9WA 1DJIA 1G5AA 3OODA 4N6EA 5E5CA 1SYTA 3FKKA 1KFKA 1OWQA 2CETA 3ATZA 3TA6A 3ZQ9A 3I7RA 4PSRA 3SR7A 5A6AA 3KOXA 4XWUA 8CGTA 3B97A 4KMQA 1JPIA 2E0PA 1K1DA 4KRUA 2PP0A 1VBGA 1MMFA 2QPXA 3HJZA 1YX1A 2QF7A 1GUVA 2GVLA 3QV8A 4H1ZA 2IUZA 2D2OA 3AMLA 1D8WA 2QUUA 3IAQA 4KEVA 3W01A 1JNEA 1UWSA 5CAKA 4UNKA 2HMCA 3KBMA 1TV8A 4IZGA 3JR2A 1CBGA 3OBEA 4GJ1A 1BFNA 4C6LA 3EDFA 1PZ2A 1TX0A 3G0XA 3R79A 1KD0A 2PRMA 3LK6A 3VVGA 1DQWA 4NP7A 2CNCA 5XIAA 2HBXA 5ABFB 2PB1A 1LQ0A 3CEUA 3SRFA 4QE1A 3URQA 5LNVA 4HMCA 3RU6A 3HTWA 1G7VA 5DT5A 3BTNA 2W3ZA 4X22A 1XLEA 1EJWC 4WJXA 2OLHA 2E6YA 4JY8A 4I6KA 4W8LA 3N4EA 1W32A 1CB7B 4AMAA 2OOFA 3HURA 1FWCC 1XGDA 3HPZA 3S9ZA 4HVXA 2WK2A 2VGFA 1XG3A 4XVEA 1VYRA 4MWAE 4G7EB 1EO7A 1GW9A 2HVMA 4M51A 2O9TA 4ZQOA 4NXKA 3FCPA 2ALDA 2PDBA 3FHQA 4JX5A 1T7LA 4PRRA 3XISA 1JR1A 1XFBA 3OZYA 1Q6GA 1J6OA 1PWMA 4HSOA 4CEUC 3M9YA 2NX1A 3THQA 1NM9A 4URIA 1QI2A 3T55A 3ICJA 3LCHA 3VK5A 1NOWA 6ENLA 1L6YA 2AAMA 2YDRA 2X1TA 3QR3A 5DLCA 2P50A 4FALA 1BF6A 1KM2A 1WZMA 3GO2A 4R7WA 1BYAA 1W56A 3TW9A 3UU0A 2YJQA 3ITXA 5G1MA 1O94A 2E8ZA 1R2RA 3OBKA 4TMBA 1BRLA 3MVIA 4D9PA 5D9NA 5TAOA 1R6WA 3EOOA 4GQGA 2BXVA 2ZTKA 1GZ1A 2WNZA 1L2QA 4BCEA 2Z2BA 3HFTA 3DFNA 4LY4A 4G9PA 3VOIA 1I4NA 1QWGA 2BBFA 4AC1X 2VRQA 3NPVA 4UQEA 4DUXA 1WZKA 1UPPA 2G0WA 1EJVC 3FW6A 1W91A 3H7UA 3MKVA 2F2HA 4GUJA 5LYRA 3IGHX 2RUSA 3MUCA 1TZ7A 3UR7A 4DBEA 3O15A 4CGTA 3EGJA 2AOSA 4XZLX 2G5WA 3IK4A 5CLWA 1H7NA 4PMVA 1SZFA 4DQWA 4M7SA 1QNQA 3M43A 2ZRUA 1A5OC 3ZT7A 3DAQA 3EXSA 3LENA 4EOUA 5A6LA 1FY6A 3UVIA 1GVSA 2V5KA 4HN4A 4Z1CA 1DV7A 4CKQA 1E9ZB 2YCIX 5EMUA 1QO2A 3FGCB 4HOWA 4XBSA 3F2DA 4WXYA 1ALDA 3FK4A 3MJYA 4WKHA 4PUMA 3O1NA 4TUFA 3W82A 3WJYA 1M6JA 3RX2A 4MB3A 3T0TA 4NU7A 4PTDA 2XH4A 5CPMA 1NOUA 2IPWA 3WD2A 4GBUA 3KBVA 1G4PA 1YNYA 4E0CA 3WEZA 2POTA 3OHIA 1QO5A 4OVXA 3S6TA 2WM0A 3N9RA 1YIXA 3S1GA 1XLFA 3B9OA 2QCEA 3ABRA 1YXYA 1R3RA 2WQDA 2ZUMA 1A0CA 3ALFA 3NZQA 5CKSA 4MJ4A 1DEDA 3S6OA 2QAPA 5AYBA 3UJ2A 4PUNA 1LT8A 3HPFA 1NDVA 4TX9A 5C54A 4B9ZA 1FDJA 3CQHA 3GG0A 1KM5A 5J8LA 4BI6A 1JZ5A 1XG4A 4J2MA 3SW6A 2VP8A 4PB4A 1ZBCA 4NNCA 4AD2A 3F4CA 4GQRA 2J27A 3CUHA 3S5ZA 1F76A 1NSJA 4FIQA 3A12A 3UQNA 1FKXA 2PU1A 2C1GA 4YVVA 1WKDA 1CGUA 3UESA 4PTWA 3IJLA 2VEGA 3NXLA 3VKBA 2AQWA 4HCHA 4P7OA 3O6DA 4LXFA 5EFDA 3T7VA 5AECA 4HA4A 3CT7A 2ZZ6A 3BGAA 4FI4A 4C7FA 2OEMA 4S2BA 3ITLA 4P8XA 2Y24A 2WBGA 5CSUA 3U5UA 1VFSA 2HRWA 4GY7A 3M46A 2AAAA 2PZ0A 4C1NB 3UZYA 2DZWA 4JTQA 3FEQA 3TAKA 1Q4WA 1Q13A 4NASA 3AYTA 2VEFA 1K70A 3PZOA 4N9CA 2PS2A 4FOJA 1B4EA 3NPXA 4S3KA 1K8CA 3CZGA 3WLKX 2VZUA 3N25A 4RV3A 4L6HA 2P0OA 5A8PA 3DYOA 2DQWA 4DNMA 1E6ZA 1A0EA 4EWJA 5AFDA 2VQTA 4W4QA 2UY2A 3G6LA 2UV8G 4LU0A 3P2VA 3N04A 5I3FA 2BMBA 4K2SA 3WQ4A 1RY8A 3E5PA 4KKXA 4MAZA 4MNKA 3Q67A 1P1MA 3TAOA 2FJKA 3WNNA 3UR2A 2DT3A 3DUGA 3WDRA 1EP3A 2OZTA 1SMDA 3TE9A 3VMPA 2A3EA 3BVJA 3PB0A 2EO7A 1GJWA 3P3BA 1XYBA 3BOLA 5CPSA 1HKJA 1G4SA 1J9YA 5FEPA 4KFOA 4Z2HA 2Y2WA 1GVRA 3ARRA 3W7RA 3W1RA 4PTXA 5D8ZA 3DC0A 3VE9A 2OSWA 1GK8A 3F2CA 1AZ1A 3TCEA 2OWCA 1EX5A 4OOUA 5DXYA 3HF3A 3SAZA 2DQXA 1BWVA 1MEWA 3PJWA 1XC6A 5KINA 4UFMA 3CH9A 5D09A 3GW3A 1CCWB 3HU7A 1W3HA 1S5NA 1LTDA 4IMEA 5HDRA 4B4HA 1UMLA 3T81A 2EPLX 3TMQA 3BAYA 2RGMA 1WZAA 3PPFA 2JKAA 3PBUA 4FIRA 1GTEA 1DYSA 3EOEA 2TMDA 1PV8A 4IPPA 2Q3RA 5DXXA 2FPYA 3OBAA 4NILA 1QNSA 4JHMA 1P6BA 1T99A 2FB3A 2Z28A 3QY8A 3RN6A 4NNBA 3S8HA 2VEPA 1H1ZA 1CECA 3PZTA 3OOQA 1RXOB 4DEFA 1TE1A 4EPEC 4M5PA 4JTDA 2L5HA 4IG2A 3PR2A 2PUZA 2F9RA 1ECEA 5EKYA 4Q33A 2ACRA 1PIGA 3LRLA 1CX9A 2F38A 3VGGA 1X7FA 4C7DA 3G8RA 3QR1A 1XUUA 3UF9A 1AD4A 4RZ5A 4QITA 2TYSA 1JJKA 1W1ZA 3BAXA 5BOEA 5LXXA 8TIMA 3HGJA 4HCLA 4KS0A 2ISDA 4P7RA 1GQIA 2FH8A 3UD6A 4E3VA 4JFVA 2ZRVA 1OG0A 3UJEA 1OZMA 5B7YA 4HCDA 1ZP3A 1EQPA 2ZZ1A 3OQEA 5HR6A 1WDQA 5KZMA 1IYXA 4DJFC 1SW7A 4IM4A 2DZTA 4B15A 3LZ5A 3H8AA 4OHQA 1F74A 4P7NA 4RDZA 4HZMA 1C7TA 1UWUA 4R53A 4ATDA 4MTVA 4ZQNA 4O17A 1XH0A 1S2VA 4XIMA 3MS8A 3EZ4A 3O0FA 3CLWA 3GNDA 4LC6A 3SGZA 1MWOA 1YNPA 4L9YA 1VEPA 3MUAA 1IIHA 4HMDA 3HOJA 3N19B 1JUBA 1GQNA 1FWJC 3NDOA 1P6CA 1YKWA 1HJXA 3CASA 5EBUA 3V4BA 1XYZA 3T0DA 4UIOA 3W83A 5F1VA 2X09A 3NL3A 3CWOX 4XZNX 2Y5EA 1XIBA 5BRPA 4Z42C 1OY0A 1WKEA 2ZWZA 4M56A 2J25A 5T9BG 2P0IA 5EBAA 4MB1A 4F40A 4K37A 1OK4A 1PZ0A 1ZB5A 2TODA 4RZ6A 1I60A 2FH6A 3H4XA 2DZAA 3IIVA 2EPNA 1BVNP 2V2DA 4LYKA 1QI4A 3HG4A 1FUYA 3DFQA 3MWAA 2OTDA 1Y8BA 2V68A 1FCUA 1KV8A 2WZHA 4FA3A 4QTGA 3GDBA 1JIBA 5CG7A 1Z3NA 4B91A 2G3NA 4EF9A 3UWYA 5AC6A 3PHAA 3QPEA