3ZJKA

Crystal structure of ttb-gly f401s mutant
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
424
Chain Sequence
EKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLHHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRSGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA GLYCOSIDASE
publication title Semi-Rational Approach for Converting a Gh1 Beta-Glycosidase Into a Beta-Transglycosidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 155
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zjkA00
5CPQA 4D6JA 3SCNA 2QPSA 4DWSA 5LA1A 2VCBA 1ZL1A 3UG3A 1MW1A 2XVNA 2CNCA 4FLRA 2DSVA 1LF1A 6A3HA 3BH4A 1EDTA 1V08A 3ARVA 3NDYA 3B9EA 3CUIA 1QOXA 2YJQA 3W38A 1C91A 3AMGA 2CBUA 1Q6DA 2BVDA 4H7VA 1CNVA 2OLHA 5M03A 3AIUA 1R7AA 4CCCA 4PTWA 2F8QA 1JZ7A 1ISZA 4KRUA 5EB8A 3WL1A 1UWRA 4X0NA 4AY1A 2WLYA 2O9OA 3CH9A 1W9UA 4KGJA 2XM1A 4C7GA 2EO7A 1E6ZA 1FHDA 2WVSA 3SURA 1BHGA 4R5EA 4AZGA 1M01A 3GXFA 2G4FA 1W1YA 3PTQA 2XG9A 4AWEA 3AMDA 4E8CA 5BXPA 1G9HA 1KR0A 4WSKA 1V6XA 4Z2JA 1BYBA 4CN1A 5A6MA 3VX1A 1UA3A 1B3WA 5CQ1A 1H41A 1XH0A 4PMYA 2DT3A 5BCAA 1XCXA 1FP9A 2WAGA 2NW0A 3WUFA 1C7SA 2PWHA 2VQUA 4A4AA 1GOOA 2XYLA 4UZUA 4YPJA 2EPOA 1W3LA 2FDMA 2OWWA 1WAWA 3WMCA 1KB3A 1QVBA 2WMFA 3ZO9A 1CWYA 1EXPA 4Z2LA 5CPTA 4IM4A 4WF7A 1OCQA 3J7HA 3RIKA 5A6AA 1OBAA 2JF6A 1B9ZA 1Q6FA 2EPLX 2YA1A 2WHKA 4PMUA 1V3HA 4B3KA 3CZJA 1W9VA 1NH6A 1QNQA 3VMPA 4KGLA 1HN1A 2PWFA 1SMAA 2VZSA 4AC1X 1C92A 1OGGA 5IXEA 1F4AA 3N18A 1BGGA 1OGSA 2DSUA 4UFJA 3IJ9A 4XX6A 4P7RA 3I3DA 1JAKA 4Z2IA 1O6IA 5BXTA 3ZR5A 1BAGA 1CGYA 3WF1A 3BSGA 1EH9A 3BCFA 5GPRA 4E4PA 3LPFA 3AYSA 5A2CA 3DYOA 2V3FA 3VGGA 1E4MM 3W6LA 1X1NA 2GJXB 4CVUA 2VURA 3VIFA 5KZ6A 3SUVA 5E6YA 5I79A 5IFPA 5I78A 3POHA 2D3NA 3RDKA 4W89A 2X09A 1EHAA 4CCDA 1JNDA 4AD2A 3EMCA 1RPKA 1CXIA 1I1WA 1L8NA 2CHOA 4CN6A 2HVMA 1WB0A 3NSXA 5EMYA 2DSWA 4YHEA 2BV9A 3A3HA 1W1PA 4M8UA 3GTNA 3A47A 1KGWA 1XD1A 4IUGA 1M03A 4JL1A 2XUCA 4MNKA 1K9TA 4CD4A 1HJXA 3AIQA 3VNZA 3T2PA 1B3YA 5DEZA 1JXJA 4W5UA 5DT5A 3B9DA 4P8UA 4F8XA 1CGVA 1N82A 2D24A 2WZEA 3FXYA 4OOUA 4HPHA 4V2XA 4P8XA 4TVUA 5JIPA 3GZAA 1UR4A 4FLQA 1ISXA 1RD6A 4H2CA 3N11A 4GZJA 1GHRA 1OINA 2BHUA 2WC4A 4GO9A 1TZ7A 3ARRA 5HOSA 1YHTA 2UY4A 3NCOA 2W92A 5FD0A 1QBBA 4TVCA 3SUTA 1KBKA 2VL4A 1FH7A 3ZM8A 3VDBA 1GOQA 1DWJM 4PMQA 4S3JA 5E6ZA 1W1VA 4D6CA 2G3NA 1KGXA 5A8MA 1EQCA 3T0BA 2WVUA 3CUHA 4QCEA 4QFUA 4W8AA 4AD4A 4N0RA 4GI6A 3OLDA 1JDDA 2PWDA 4C7FA 3T2QA 2A3BA 3ARUA 5IDIA 2Y4SA 3AXHA 4M24A 1HL9A 4GIAA 3ARQA 3WY1A 3SCOA 2WANA 3AQUA 4CU8A 4ZEPA 3AIVA 3CUFA 1NOFA 1R87A 3IAPA 3DECA 4PN2A 5DFAA 1FP8A 2BXYA 3GNPA 3OG2A 3O9NA 2WBGA 3N04A 2VZUA 2E8ZA 4LPCA 1E40A 5A6BA 4U2YA 1UD4A 1NWTA 1C8YA 5LA0A 1CLVA 1ZBCA 1E3XA 3MKKA 4U31A 4IISA 4WKAA 1HJQA 2DIJA 3UERA 3WDHA 2X8RA 3W25A 2JIWA 3L4XA 3MUAA 1UKPA 2OSYA 4JKMA 4LXFA 1V6YA 4AZ6A 4J28A 4BCEA 2X05A 4HTYA 2WHMA 1UZ1A 1J0KA 3ARYA 4W5ZA 4DUWA 4JAWA 3VGBA 2VJXA 1ISVA 2W63A 3WQ8A 3WFZA 4ML4A 3GH4A 1GZJA 1UH2A 3T2OA 1XHGA 2YBTA 4QP0A 5ECUA 3TTSA 4CKQA 2GDVA 5D4YA 1C7TA 1MYRA 5A8OA 3W0KA 1H49A 2E8YA 2EPMX 1E4LA 2BY3A 1SMDA 2E40A 3WD0A 3QR3A 3U5UA 3N12A 3W28A 1V0NA 3PN8A 1WKYA 4V27A 1BQCA 2WPGA 4W86A 4FMVA 3VILA 3CZKA 3WEMA 3K1DA 1DTUA 3HU7A 3NDZA 3WH6A 1EDQA 2FHCA 2J8FA 4EE9A 2Y24A 3SCQA 3UR8A 1ISWA 4CD7A 4J3TA 5FOOA 1HP5A 3AS0A 4MB1A 2Z1KA 1BG4A 1LL7A 4TUFA 3CHFA 2VZVA 1ITCA 5ABGA 4GQRA 2YA0A 2BXZA 1K6AA 3MSDA 4MNJA 3DHPA 3UEQA 1GVYA 1ZBKA 1ISYA 1E43A 1XGZA 1JYNA 3EDKA 3CZEA 4WIWA 1JAEA 4OBRA 1MW3A 4AZ7A 5HDRA 1AMYA 2VOTA 4MADA 1TUXA 3RILA 1JZ8A 1XH2A 1PPIA 4AIOA 2WC7A 1J0JA 4U5KA 1JZ3A 1JD7A 5JIWA 3ZR6A 2V5CA 2V3EA 3VX0A 4HMCA 4H8HA 5D8ZA 4PSRA 1I1XA 3UESA 5JBFA 1AQ0A 4OJYA 4TOQA 5I0DA 1Y7VA 3VIKA 3TOPA 1ZBWA 3ARZA 1V3LA 4TXEA 1A3HA 4E2OA 3EMQA 3M46A 3IJ7A 1FOBA 1FH9A 3U57A 1E6NA 4F9JA 3SUSA 1VFFA 2JIEA 1EOKA 2ZWZA 4UFLA 3SCPA 2PWGA 3VKKA 2VZTA 1LL4A 2XTKA 4F66A 4S3KA 4UFIA 5A6JA 4MPKA 1E6SM 5E09A 3TTQA 2WMGA 3ALGA 1J12A 1HIZA 4MAZA 4W87A 1AVAA 1IZKA 3OLEA 1NOUA 3G6LA 2GJPA 1UKSA 2WHJA 4UQBA 2BY2A 4RE4A 3ZT7A 1RP9A 2YL5A 3MMWA 3WD3A 4MJ2A 2WWCA 5DT7A 3RJYA 3WDRA 3WBEA 3ALFA 2W66A 1BLIA 5CJ5A 4AZCB 5BYWA 5LYRA 2WSKA 1JFHA 4W93A 3TP4A 3NSMA 3WNOA 2JEPA 1OIMA 3RPMA 1E0XA 1R7OA 4TX6A 3GYCA 5CLTA 2WMKA 3HJEA 2CHNA 4PBGA 3W53A 1EIBA 1TVNA 1GVIA 4D6HA 1GQJA 1E56A 4X9YA 4D6FA 2ZUMA 5A8PA 4P8WA 4W8BA 5A2AA 1JYVA 3VIPA 3W37A 4RE2A 2VCAA 4AD5A 1BFNA 1VBUA 3FN9A 2D22A 2DSKA 3WIJA 2VUYA 3POCA 1V0KA 2JFEX 4B16A 4UZSA 5A8QA 4AZIA 4LYRA 2YL9A 4UOQA 1ITXA 1QPKA 5E0CA 4H8VA 1QHZA 1PBGA 4U3CA 3NYDA 4EANA 1QHPA 3RM8A 2YIHA 4X0VA 5BRQA 4MNMA 2ZX8A 4TTGA 2PB1A 4GPNA 4Q22A 4PMDA 5CGMA 4UQDA 2YDSA 4AD1A 1O7AA 1LWJA 4PMXA 1BG9A 4HMDA 1GOIA 1JFXA 1QI5A 3AFBA 3N17A 1VEMA 1E1FA 4BQ5A 2YL6A 4HU8A 4HOXA 1V3JA 1OM0A 2JALA 2QMKA 5A6SA 2VR4A 1HNYA 2WMIB 1J0HA 5D8WA 3WH7A 3L4YA 1R85A 1H4PA 5HNNA 3PHAA 2QV4A 4AD0A 3AS2A 4N42A 2AAAA 3I3EA 4E8DA 2EXOA 3CUJA 3WBAA 2DQXA 1U30A 3AZTA 1UQZA 3WH8A 3SUUA 5E0FA 2VRJA 3CZLA 1UWIA 4UFMA 5I24A 1CECA 4UFHA 6CGTA 1VB9A 1J18A 1E3ZA 2O92A 2YL8A 4HPGA 1QI3A 2CEQA 3MSGA 3WUEA 3WUBA 3WNMA 1TA3B 3S2CA 3CZ8A 1H09A 3VD7A 1I75A 1KCKA 4DUXA 4OUEA 4B9ZA 3WH5A 2WW5A 4DUVA 3WUGA 2JEQA 5KEZA 1CXHA 3OZOA 2CESA 2GK1B 5D9OA 4JFWA 4PCTA 4AEFA 2J78A 3AIWA 4MTVA 3WNPA 1UD6A 4WJXA 3DC0A 4AIEA 4ZXLA 4ACZB 2GK1A 2W67A 2E0PA 3WDQA 1NQ6A 3NJ3A 4ZE4A 1D2KA 1WDRA 1V02E 1KQYA 4CU7A 4AIUA 8CGTA 2ZUUA 4LX4A 2Z1SA 1PX3A 4OOZA 2IUZA 1UWQA 1HXJA 1QW9A 4PYSA 3B9AA 2NSXA 1WDQA 3K4AA 3KL3A 5BWFA 3BAJA 1CXLA 1TE1A 4W7UA 4W7VA 3VOCA 5CGTA 4JFTA 4JFUA 1K9DA 2J7DA 2WLZA 3K4DA 1HJSA 2VR5A 1VJSA 2CYGA 1PX4A 4J3SA 4XV0A 3CLWA 3BCDA 1V3MA 5HBFA 3VD9A 4CCEA 1AQMA 2Y5EA 3WD2A 3ZSTA 1UD3A 5BRPA 4HA3A 1WCGA 1H0IA 4NRRA 3WQ5A 1GQKA 4NZCA 1JNEA 1SR0A 4HA1A 5BXRA 2J62A 2VNCA 3FHQA 2VCCA 4J3WA 1UWTA 1RH9A 1BSIA 2B31A 1UKTA 3MMUA 1R86A 4UR9A 5JBDA 4NF7A 2DT2A 4J3VA 3OLIA 3B8SA 3SIMA 2GJXA 4XZWA 3MMDA 2BY1A 1LG1A 1EHNA 3PTKA 3KL5A 1JZ6A 3KWXA 1UR0A 3OLGA 2G8ZA 2GSJA 5A95A 4L4PA 3CHCA 1E1EA 2CPUA 2OSXA 1UG6A 1US3A 4WLCA 4R27A 4XUYA 1VENA 5FKYA 1E73M 5FCZA 1U2YA 3VGEA 5IHRA 1V02A 5A6KA 2Y8VA 3GXMA 2WYSA 2VT0A 2PC8A 4M1RA 5CSUA 3A6OA 4PEEA 4AZ5A 2EPKX 3RO8A 1GOKA 3QHOA 4D6IA 5I23A 2VX6A 1E15A 1JDCA 2XVPA 3VM7A 4UQCA 4ZXOA 5I3DA 1GNXA 1G94A 2WZIA 1OD0A 1CDGA 2WBKA 3CO4A 4CUCA 1QNOA 1XH1A 2WVVB 3WMBA 4KRTA 2HISA 4RL3A 3OBAA 4GQQA 5FL1A 2J25A 1JYWA 2JE8A 1E6QM 1B3ZA 4PMOA 2FGLA 1MW0A 1UD2A 1M53A 3D5HA 1FFRA 1E4IA 3MV11 5CXPA 4AW7A 1W1TA 5M3WA 1A47A 1G01A 1KXHA 2ZUTA 1IT0A 1XRVA 1GONA 1MXDA 1Z32X 1ZS2A 3A4WA 1VBRA 2G3MA 1Q4NX 1UA7A 1KXVA 2BVTA 2QMJA 3AHTA 1JF5A 1GQLA 2ZUNA 3DHUA 2VX4A 5A3HA 1B2YA 2GUYA 4GINA 2D2OA 2J74A 2QF8A 1CTNA 1QI4A 3VUPA 2UWFA 1AQHA 4Q7NA 1XYFA 2WZHA 4CVWA 1VEOA 3DYMA 4HZ7A 4HA4A 4JHOA 1C8QA 1RP8A 4B9YA 1CXFA 3BLKA 1WPCA 5A94A 3W27A 1CYGA 1QBAA 2UY3A 3NUKA 4MDOA 2XM2A 4ACYA 3G6MA 4P7LA 4AYSA 4MDPA 1UQYA 3QGVA 2F61A 2G3JA 3O2LA 2BNJA 1HKJA 3AROA 2OWXA 1ZBVA 1HKMA 2VO5A 2YKKA 1E9LA 3PZUA 3K46A 2ZXDA 1Q6CA 1CLXA 4V28A 2WSPA 5A69A 1BYAA 1VJZA 2VVNA 1E0WA 2QLYA 1JZ2A 2W61A 1WO2A 2VTFA 3FY1A 4XB3A 4FK9A 1NM9A 3EDDA 5GNYA 4CD5A 1KWKA 2BFGA 3NIYA 2ZXAA 2VRKA 1W9PA 4B15A 1W32A 2CIPA 4GO8A 3M7SA 3IJ8A 4OZOA 4WKFA 1JF6A 4GI8A 3PTMA 1CIUA 4JCLA 3CZGA 2ZIDA 1H11A 2UY5A 1MFUA 4HZ6A 2WKLA 8A3HA 1CEOA 4JZ5A 4ATLA 3ZJ8A 4U5IA 1W3KA 3GDBA 3WNNA 2J75A 4D6EA 1XSJA 5GNXA 2XSBA 3W29A 2CXGA 3S6TA 1GHSA 4M29A 1W9XA 3BMVA 3VDAA 4AXNA 2V3GA 4BS0A 4L4OA 3AJ7A 2ZXBA 3SEPA 1HJWA 1MW2A 3ZOAA 1TR1A 2DSZA 3SCUA 3OA5A 2ZICA 1V6UA 2BHYA 3CMJA 1WP6A 1PX8A 1GJUA 4PMNA 4UQEA 3A4XA 5ABFB 3VDCA 3VTRA 3F5LA 5I77A 4M82A 2WM0A 2EPNA 1SFSA 3M07A 1NARA 2EQDA 4PUEA 3LPPA 3RCNA 4P7OA 4LGXA 3N13A 5E70A 4ZENA 4DM2A 2J7HA 9CGTA 2XIIA 3OGSA 1GJWA 1TMQA 3VMOA 3JUGA 3ZT5A 2XWEA 3GBDA 5EFDA 2OSWA 3AOFA 1H5VA 4CD8A 5AYBA 3T0DA 3DYPA 1PIFA 1GOMA 2J7GA 3CIVA 1W2VA 3CMGA 3T09A 3MUY1 4JCMA 4H8UA 5FL0A 3VM5A 4OKDA 3VDHA 3PZOA 2EJ1A 1JZ5A 2ZWYA 1H2JA 1B3VA 5AYIA 1HVXA 1BYCA 1H3GA 4AMCA 1UR8A 4CU6A 5E9AA 2RGMA 1S46A 3CBWA 2VMFA 3BGAA 1PEZA 4A3YA 2CKSA 1JZ4A 3AIRA 3BC9A 4U33A 1NWUA 4NRSA 3FAXA 3AHZA 1HX0A 3APGA 5C8BB 1LQ0A 3WH9A 2A3CA 1V6WA 1VF8A 2Y2WA 2ZX5A 4MB5A 1KXQA 3CPUA 4MB4A 5AC4A 4W7WA 3I3BA 1UH4A 4QDMA 4TX8A 1EDGA 1J0YA 5DO8A 4JL2A 3AMLA 3GNRA 2XHYA 3UETA 3VIGA 1CPUA 1D3CA 3WDIA 1H1NA 5AC5A 5ABEA 2E9MA 2XWDA 1C3FA 2YBUA 3N9KA 1UR2A 3GNOA 1OT2A 1VAHA 3ZIZA 4AZCA 1PZ3A 4KWUA 4QAWA 3D3AA 4M81A 2FGZA 1C90A 2J79A 4KMQA 3ZT6A 3ZJKA 3KEHA 1PZ2A 1JXKA 3EBVA 1GQIA 1NWRA 1DWAM 1JGIA 2E3ZA 4HOWA 2WCAA 2WVTA 1TVPA 1NP2A 4WK9A 1L0PA 3AICA 2J7EA 2FH6A 3WELA 3AHYA 3W6MA 1P6WA 3W4RA 1GCYA 3MV01 1Q6GA 3WD1A 3WNLA 2G41A 5ABHA 1G0CA 2ZX6A 1KQZA 4HU0A 2WXDM 1J0IA 1LJYA 3AMKA 2FHBA 1CGXA 2FHFA 2OYMA 5TD4A 1US2A 5IHSA 1PIGA 3EYPA 4UTFA 2WC3A 2J7FA 1K9FA 4AZHA 2A3AA 4XZBA 1KR1A 3IK2A 1W9BM 3AXXA 3BAYA 4BQ3A 3OB8A 4PSPA 5D9PA 1ZJBA 3ARTA 2XPKA 4BQ2A 5HPOA 1CZ1A 1E5JA 3MANA 2WKGA 4QCFA 1FH8A 7TAAA 1UHVA 3EDJA 1VFOA 3LPGA 4JHZA 3VNYA 4GXPA 2WMIA 1UH3A 4CD6A 2D3LA 1E6XM 1MWOA 2O9TA 2IXVA 3MUZ1 1W3JA 4YN5A 2J7CA 2X0HA 1EQPA 3VD5A 5EFFA 1CGUA 1IV8A 1GPFA 3ZJ7A 5AY7A 4J3XA 4BF7A 2RGLA 2WNWA 2XSAA 2XFYA 3AS1A 3VIOA 4W88A 3M6DA 2Y8KA 2GDUA 2D20A 3EDEA 3FHAA 3GH5A 1BYDA 1PJ9A 1DHKA 1E55A 5C71A 5D9MA 1HJVA 1V0LA 1TA3A 2D1ZA 1LL6A 1HKIA 1XC6A 3OGRA 2PI6A 1EA9C 5HPCA 4LYQA 3VGDA 1W3HA 2X2YA 3VO0A 2EEXA 2IXUA 4KH2A 4H04A 1QNSA 1WZMA 4GZIA 4H41A 2WB5A 2WWDA 1JL8A 1KFWA 3L4VA 4WKHA 4M56A 1XSIA 2X1IA 4ACZA 2ZX7A 1ZB5A 3KL0A 3WFLA 1HVQA 4NSBA 1ODUA 5DF0A 1HT6A 3UR7A 4GKLA 1UOKA 2WMHA 2J4GA 1KGUA 2GFTA 1HL8A 1C93A 1UR9A 1V03A 4BZYA 4LYPA 4P7NA 3AZRA 2ZUWA 1ZU8A 1LG2A 3BAWA 1KCLA 1QHOA 4W85A 1VEPA 1WDPA 2DPEA 2D0FA 3PZ9A 3KE0A 3WQ4A 3UG4A 2ZUVA 3BAIA 3UCQA 4D72A 3CHDA 4MJ4A 1V0MA 4ATDA 2YLAA 4PMZA 1CGTA 4FLSA 2EBNA 1QI0A 4IPNB 1XV8A 2ZX9A 2YLLA 3GH7A 4PRWA 3NSNA 2VI0A 4CGTA 5A1AA 3AS3A 4U3AA 1HKKA 2DDXA 3WDPP 3LMYA 1XSKA 1ODZA 3WENA 3AZSA 2CBIA 5LA2A 4QLLA 2PF0A 1UWSA 4A3HA 1E72M 2AOSA 2DT0A 4MNLA 3BMWA 2BS9A 1PAMA 1OWQA 4HP5A 1W2PA 1XYZA 3WSUA 2YOCA 4UNIA 1QI2A 3TTYA 1VFUA 3ARSA 3K8MA 3VGFA 1TCMA 3ECQA 3EMZA 3PZMA 4D6GA 5A8NA 1C8XA 1CBGA 4ZFMA 1TG7A 1QNPA 3EDFA 3PZVA 2XVKA 4Z2GA 3L2MA 3BLPX 4OBSA 3W82A 1UKQA 3RMEA 3WN6A 5F7UA 1GORA 2OWCA 3L4TA 2VZOA 1UD8A 4AEEA 3WQVA 1M7XA 3VIMA 2TAAA 3L4UA 3PBGA 1BVZA 4TVDA 2O9PA 3OGVA 3SCWA 1G5AA 2DH3A 5A6BD 3MS8A 2G3IA 1WE5A 4M80A 1ZJAA 1UWUA 4AISA 2OYKA 3U5YA 4UFKA 1MXGA 6TAAA 1FHLA 2CETA 2PWEA 1JYXA 1J9YA 7CGTA 1X6LA 4W84A 3ARWA 1VRXA 1MQQA 3QHMA 1WZLA 4UCFA 2MANA 2J8GA 4LQ1A 1U33A 3VPLA 4Y7EA 1MQPA 4ATWA 1E4NA 4IPLA 2WHLA 5CZKA 2VRQA 4MAVA 2CKRA 5CG0A 5M17A 5CLWA 1KBBA 2WVVA 1G1YA 2PBOA 3SCRA 3GM8A 1W9DM 1CXEA 1NOWA 2CCRA 4BA0A 2WK2A 1J0ZA 2C0HA 1UKOA 4GZEA 5BXSA 1B31A 4TTUA 1GUVA 2XJ7A 3WF0A 2WMJA 2VQTA 3AYRA 2ESCA 3AI0A 4PCSA 1FFQA 1B1YA 4DM1A 3VINA 3W81A 3WNKA 2D0HA 1J11A 1V3KA 3N1AA 1FA2A 2XFRA 1J01A 3A4AA 1EO7A 2DIEA 4UOZA 4FLOA 2VX7A 2XFFA 2YDRA 4F9DA 4EK7A 5BROA 4URIA 3TA9A 2QHAA 5I6SA 5I5RA 2DEPA 1NWSA 1HJUA 2XVGA 3THDA 4PTVA 5CSYA 2W91A 2C7FA 1LLOA 3AISA 3RM4A 1CENA 2NT0A 3ZSSA 4HZ8A 2XVLA 2JF7A 2ZE0A 3VD4A 1JI1A 1GW1A 1IZJA 3K8LA 3WD4A 4MB3A 3VD3A 2E4TA 4UQ9A 4QLJA 2V3DA 3W26A 1NP0A 4JKLA 3VIIA 4D71A 2W4XA 4PMVA 3VGHA 4CN4A 4B3LA 1OGBA 4D6DA 3WMSA 1B90A 1XD0A 2FH8A 3ARXA 3CHEA 5GQBA 1BTCA 2VX5A 4JFSA 2D0GA 4AD3A 1BF2A 2O9RA 1K9EA 3T0AA 3WF4A 4D1IA 1E0VA 2ZXQA 3PZGA 4J3UA 3VMNA 2YA2A 3L4ZA 3CGTA 1V6VA 7A3HA 2E9LA 1HF6A 2ZUSA 1DEDA 3THCA 1DWGM 5CPSA 3ZJ6A 4K68A 1UYQA 1UZ4A 3HN3A 3VU2A 5EBAA 2AMGA 1E6PA 2C8NA 5A2BA 5M5DA 3OIHA 1WZAA 3GXIA 1EGZA 1OD8A 3AIBA 3QOKA 4F79A 1D7FA 3GXDA 3AHVA 3UG5A 2NT1A 3WKZA 1BPLB 4OIFA 3BSHA 3L2LA 5A6LA 4W8LA 3QOMA 4P7QA 5DMYA 3PZTA 3KZSA 5JUVA 2CBVA 1DWHM 2E9BA 1OIFA 4UOJA 3PZIA 3F5JA 1JG9A 4HMEA 5ABFA 3WF2A 5JBEA 3SCTA 4ZE5A 4HOZA 2W62A 3BAKA 2F2HA 1VIWA 2OYLA 2J47A 2D23A 3OZPA 3CTTA 3E1F1 1MQRA 4PMRA 3WL0A 3U7BA 4QLKA 1YQ2A 1E71M 4P8VA 1TFVA 2WCGA 3SCSA 1WZKA 3PZNA 4U2ZA 1BGAA 1JIBA 4J7RA 2BY0A 5I2UA 3L4WA 1HP4A 1OT1A 3FNDA 2DT1A 3II1A 4PUDA 2V5DA 3BAXA 1EO5A 3ZQ9A 4BQ4A 1F4HA 4JIEA 3WEOA 3AIEA 2XGBA 1CGWA 2QPUA 4PTMA 2DGAA 1V3IA 2W5FA 3F4VA 4UQAA 3U7VA 2YDQA 1UR1A 1E6RA 4DWSD 4Z2KA 4GI9A 4NI3A 3AMCA 1J10A 1SYTA 1UUQA 2CITA 2DH2A 2XGIA 2PBGA 2V38A 3SCVA 3WEZA 1DWFM 4JKKA 1B3XA 5FIPA 2WCSA 4RE3A 3PZQA 3SUWA 4EAMA 2GJRA 5HXMA 1E70M 3MU7A 2UY2A 3ZMRA 3WQWA 1KXTA 1R8LA 1OSEA 4DWSC 2VC9A 3CUGA 1DWIM 2BHZA 4WSJA 4Z2HA 3VIJA 3BXWA 2XIBA 1ESWA 1OB0A 3VIHA 2Q8XA 3FW6A 1JD9A 1X6NA 1LWHA 1B30A 1BVNP 1QW8A 4FF5A 1VFMA 1Q6EA 1WNOA 1H0GA 5D9NA 1UD5A 3LPOA 1ECEA 1QNRA 5GNZA 2A3HA 2GVYA 2VVSA 3WDJA 3T08A 1B0IA 3RJXA 3N15A 3GBEA 3MO4A 3VVGA 5C70A 1KWGA 3IANA 3AHXA 4J27A 3TTOA 3RM9A 2J77A 1MVYA 3WQ6A 2BVYA 3W24A 2A3EA 5IFTA 2CBJA 3TONA 3O6AA 4YHGA 4PTXA 1E5NA 3HMCA 1DP0A 1JI2A 4EKJA 3ARPA 1CXKA 2X0YA 4C7DA 3AXIA 1EOMA 1XCWA 3FAWA 3K8KA 1MFVA 1WDSA 1M04A 4AZBA 4D1JA 2ZOXA 2J7BA 1JDAA 3IAQA 3QHNA 3WF3A 4JFVA 1GOWA 4DWSB 3F5KA 1W91A 3MUIA 2CERA
chains in the Genus database with same CATH superfamily
8XIAA 2SFPA 4IMCA 1IEVA 4NVTA 4D6JA 1XFBA 2Z2BA 4UTUA 4DWSA 3W23A 3PPHA 1T41A 2HMCA 1SJBA 4AWTA 1TPFA 3BW3A 4O50A 2XH2A 4FLRA 3WJSA 3QKEA 4K39A 1LF1A 3NQCA 2ISDA 5D02A 3NDYA 2EKGA 3B9EA 4E6MA 4RNJA 4S3CA 1BWLA 1C91A 1Q6DA 2BVDA 1CNVA 2OLHA 5M03A 3AIUA 1R7AA 1TX0A 4AY8A 3QN3A 2HZGA 4A8IA 4B5SA 1R3QA 3GC5A 3NL6A 4O4VA 3QV9A 1EP2A 4O19A 2WLYA 4L6OA 2PD5A 1W9UA 3NVTA 5EGRA 2EO7A 2XN1A 1Y5VA 1FHDA 1BKHA 1EX1A 2WVSA 1OCBA 3OHMB 3SURA 1XYBA 3R79A 3T55A 1B5TA 4R5EA 4NHVA 1NAL1 4IUOA 1W1YA 3PTQA 1JDEA 4AWEA 3P80A 4KRZA 3CQ0A 4E8CA 1KR0A 4WSKA 5REQA 5K7JA 1H41A 1XH0A 4PMYA 1IWPA 1IGWA 3TVAA 1EJ7L 3DX5A 2NW0A 3QPEA 4UZUA 4YPJA 2HJPA 2YB4A 4WX2A 1XKYA 1KB3A 3EX2A 4O11A 1EXPA 5CPTA 4IM4A 3L12A 3CQIA 3J7HA 3RIKA 3PSWA 4QR6A 3MJMA 1VCGA 1OBAA 3TYEA 2QCLA 1Q6FA 2R94A 3W7HA 2EPLX 2WHKA 3E0IA 3TDFA 4MM1A 4C5ZA 4PH6A 1NH6A 3NOEA 3S46A 2Y63A 4KCUA 4LVGA 1RSCA 1OX5A 3LHZA 1C92A 1OGGA 4GH1A 1KKRA 4UFJA 3BTNA 1PKLA 2CW6A 1JAKA 2UZ9A 4IMGA 4GUHA 1F3XA 3TROA 4FX6M 1BAGA 1CGYA 1EH9A 1JPIA 1MSSA 3LPFA 1AJ2A 3DYOA 3KVJA 4GIYA 3VGGA 3S8HA 4K7VA 4CVUA 5CZTA 3SUVA 3CV2A 5I79A 1XDJA 5B80A 3POHA 3EWUA 4UR7A 1LBMA 5HJXA 2D3NA 3PBVA 1TWIA 3LSCA 2HK0A 1JNDA 3QC0A 5F2MA 3EMCA 1G67A 4P5UA 1I1WA 2UV8G 4JY9A 4CN6A 1SZFA 1U5VA 4O1CA 4QG9A 1W1PA 3WQEA 3GUWA 1KGWA 4IUGA 4PE8A 1GQNA 4CD4A 1F3EA 1HJXA 1KBLA 2X7VA 3T2PA 3TK7A 1CGVA 3T44A 1RQEA 1SW7A 2D24A 2WZEA 3VC6A 4OOUA 4HPHA 3H7UA 3UCCA 4TVUA 3NO1A 4O8AA 3GZAA 4H2CA 3N11A 4RV3A 1JUEA 1OINA 1WV2A 5LNUA 3ABQA 3JRKA 2CLIA 2VELA 1T6MA 1OFOA 3LCXA 2VFDA 3CYJA 1FDZA 2VL4A 3WMLA 1EWDA 5C55A 5BMXA 4F0LA 2HROA 4WY0F 4D6CA 1DQWA 5A8MA 3BGJA 4W8AA 2X40A 3OLDA 4O1FA 3PM6A 4C7FA 4QROA 7REQA 4L61A 2G95A 2J9XA 2GQ9A 3WY1A 3NL5A 4NY2A 4QNWA 4PN2A 2O0TA 3GC4A 1TR9A 1Z7AA 4FZIA 3KRUA 4DO4A 1EEPA 1NF7A 4YTQA 4LPCA 3RK8A 3B8WA 4LB4A 3DUGA 1QWKA 4GRSA 3G1AA 4NNCA 1IE7C 4U31A 1HJQA 2IPGA 3WDHA 4FI4A 2X8RA 2JIWA 4DLFA 3L4XA 3MUAA 3ZLFA 2OSYA 2QVHA 4LXFA 4LSBA 4AZ6A 4J28A 1I9CB 4IG2B 2WHMA 1J0KA 3ARYA 4JAWA 3VGBA 1A0CA 1ISVA 2W63A 3WQ8A 1GZJA 2NUXA 3SIZA 3USZA 4Q32A 3QW4B 1A5CA 2PGFA 2YBTA 4I90A 3NPWA 3TFXA 3TTSA 3PPCA 3L21A 1K8CA 2J9ZA 2E09A 4EVZA 2P1FA 1TPC1 1XIEA 4OQVA 1TYGA 4GBDA 1DE5A 3W0KA 4C60A 4JTJA 7XIMA 1DPMA 4JTQA 2O7SA 1E4LA 1SMDA 5I3IA 3U5UA 1RXOB 2HS8A 1WKYA 3PN8A 3MO7A 4W86A 2BVWA 4FMVA 3MVIA 4WCJA 3CZKA 3K1DA 2E1DA 2PFHA 3WH6A 2B7PA 2Y24A 3FKKA 1ISWA 4LUSA 5IRPA 2VDIA 1LL7A 5E0KA 3VCCA 2GGGA 3PUGA 5AC6A 1ZQ5A 3EDKA 1ICPA 3V4BA 1GKPA 2QIWA 3UZYA 1H60A 5A8GA 3QGAC 5G2HA 2D73A 1JZ8A 4AIOA 1F8MA 4HBKA 2VGFA 4QIUA 1S2CA 4DJDA 3LERA 2GUBA 3VX0A 4H8HA 1HZYA 3QGKC 1T8QA 3GAYA 3BUVA 1AQ0A 2E1WA 3R11A 5AZ0A 1Y7VA 3VIKA 1XLFA 3SGGA 1EJVC 1VS1A 2VGBA 4E2OA 3E12A 3HURA 3IJ7A 1DQXA 1E6NA 3SUSA 2QJIA 4K7YA 1ZSXA 4UFLA 4FX7A 3SCPA 3VKKA 3W7DA 4F66A 1EGMA 4HCDA 5A6JA 3IUHA 4MPKA 5E09A 3O63A 1KM6A 4MAZA 1XLLA 1IZKA 3MUCA 2GGIA 1Y5XA 1UKSA 4RE4A 1RP9A 3V5OA 3WD3A 3K1GA 5DT7A 3RJYA 4MKNA 3ALFA 1BLIA 3L0KA 2DZPA 5LNSA 5LYRA 1LP6A 1JFHA 4B2DD 3KVKA 1TVLA 3PFRA 4PBGA 3BPWA 4LVFA 1TVNA 5DBUA 3S1GA 1GQJA 2PP1A 4D6FA 1QXLA 2PTZA 2NX9A 4W8BA 3PC0A 1CX9A 2VD9A 2VCAA 1OCNA 3VOIA 3LTPA 1R9ZA 3CPGA 3BQ6A 2D22A 3EWXA 1XIHA 2F7FA 3B3DA 5A8QA 3GFZA 5E0CA 1QHZA 3I7SA 2BP1A 2HXTA 1QHPA 2HQAA 2PC4A 4LT9A 4GPNA 1N8FA 2QJHA 3IV8A 4PMDA 4DF2A 1BG9A 1JFXA 2FTPA 4DLMA 3QV6A 3N17A 2QXWA 2YFNA 1E1FA 2E6YA 4QS5A 4HOXA 2RDXA 5A6SA 1Q7MA 2VYOA 2WMIB 3C2FA 5HNNA 5DMMA 4AD0A 1PKMA 3E49A 1XIJA 2AAAA 1SJAA 3I3EA 1FTXA 1BWKA 1XLJA 5CGQA 4RXGA 1U30A 3AZTA 4EPEC 1QTWA 3P7YA 4ZO9A 3SUUA 1XLBA 3OQ8A 4LALA 2O55A 2WZTA 1B54A 4UFMA 1CECA 4KFPA 2ALDA 1VB9A 4N4QA 4UWMA 1J18A 4RZ5A 1YRRA 4HCHA 3UZJA 4LVAA 3G1DA 4UTTC 3MSGA 4M1BA 1TA3B 3CZ8A 1XP3A 3VD7A 1I75A 4OUEA 3WH5A 4LY4A 2JQXA 4HVXA 1Y5WA 2CESA 4PL1A 5D9OA 3DBNA 4PCTA 5FF3A 2J78A 3BE7A 1TTPA 1UD6A 3N2CA 4IGNA 4WJXA 4B5XA 4LH8A 3TNOA 2GK1A 2W67A 3NFUA 3WDQA 1H63A 1M41A 2PSNA 3L67A 2X1RA 1LLWA 3LCLA 4IMAA 3P84A 1KQYA 2ZUUA 5CSSA 4OOZA 2IUZA 5C9UA 4FS9A 1HXJA 3B9AA 3K4AA 3KL3A 4MJMA 1UJPA 1YBQB 3BAJA 3NYZA 1MUWA 2QJNA 4JFTA 1K9DA 1XRSA 2Y62A 1V4YA 2CYGA 1PX4A 4XD3A 1SU5A 3C0LA 2QDGA 4AHQA 1MRAA 4MYAA 4PL2A 1V3MA 1ADSA 4CCEA 1AQMA 1Z6KA 3N73A 3ZSTA 3N2XA 1WCGA 5CAKA 3VNIA 2WNNA 4NZCA 1ALDA 1JNEA 1H51A 1SR0A 4HA1A 3SN4A 3W7JA 1HO1A 1JUBA 4N6FA 1RH9A 3BJTA 1BSIA 3Q4DA 3EA2A 3N6HA 4LEFA 2YSWA 4PB4A 3PBYA 3NQFA 4QJ4B 4XZWA 1LG1A 3GR4A 2YW4A 3KL5A 2ZBTA 1UR0A 1YDYA 2GSJA 3CHCA 1E1EA 2BOGX 2XH4A 3DERA 4KW2A 1US3A 3Q37A 4XUYA 1IXNA 2PDMA 3U2CA 2A7PA 4NQ1A 1OFAA 5IHRA 1ZAHA 4G56A 2Y8VA 1QCWA 4JX5A 3IGUA 3WK2A 4IIFA 1P1XA 1XR2A 1U83A 2FKPA 3G2GA 4C65A 3WLJA 3UWWA 1E15A 1VFSA 5AB3A 3UJEA 5I3DA 1GNXA 1G94A 3UR2A 3T1GA 4A22A 1QNOA 5L6UA 1PHQA 5LIKX 4HTBA 2WVVB 3L0NA 3WMBA 3RITA 2HISA 4HMNA 1LRTA 2C15A 2FGLA 1X98A 1UD2A 3D5HA 4WZHA 1SFLA 3IIVA 1A47A 3LRMA 4Z1BA 1V77A 2ZUTA 4X61A 1GONA 3ZS4A 2QCDB 4G2DA 1VBRA 4JEJA 3W84A 1UA7A 3AHTA 4ORMA 1VR6A 1OG0A 5AHMA 4KERA 2VX4A 5A3HA 4GINA 4NZ5A 3UYIA 3QR1A 3VUPA 4PUUA 1FCVA 1AQHA 3C2EA 4KETA 3QW3A 1TQJA 3DYMA 1UPPA 4BI7A 5D04C 4CQ9A 3QMTA 4V15A 1QBAA 4ACYA 3G6MA 2PTWA 4XVEA 4PTNA 1XLDA 4MDPA 2PPGA 2IQTA 4AVFA 2MNRA 3GTIA 2VO5A 3KVMA 2J9YA 2ACRA 3A3WA 2YKKA 2ZXDA 1Q6CA 4V28A 3W83A 2WSPA 2YXGA 4H83A 1BYAA 1VJZA 2ALRA 1BXNA 1L6YA 5FACA 4CNNA 2VTFA 1RLDA 1QK0A 4B15A 1GVEA 2ADAA 4GO8A 3M7SA 4GI8A 2GGEA 1M7JA 3UXIA 8A3HA 1CEOA 4JZ5A 3TIMA 3BOFA 4U5IA 4QHRA 1RHCA 3OTRA 2OEMA 2ZZ6A 4HYRA 1F5ZA 4IQLA 2AL2A 2NLYA 3CMFA 1LT7A 3W29A 3S6TA 1GHSA 4C6LA 3BMVA 1D3GA 3P0WA 3A12A 2ZXBA 1SPQA 3FOKA 2ACUA 2GOUA 2PTXA 1H61A 3K2GA 3EOEA 2VEMA 3OA5A 4QEEA 1KFLA 3CMJA 4XIMA 3S2MA 4GACA 3UY8A 1QASA 3P8JA 4JTAA 4PMNA 3KM8A 1U22A 3SY5A 1H7XA 3T7VA 3F5LA 3DFHA 1REQA 4M82A 2EPNA 5DY3A 3M07A 2EQDA 4CLMA 4IJRA 5C9XA 2NQHA 3LPPA 1A50A 4KCVA 2Y0FA 3RCNA 4R7OA 4H6QA 3CQJA 3PY2A 7ODCA 3VMOA 3JUGA 2PD9A 2PCQA 3AOFA 2ZA1A 1H5VA 5AC7A 1FVPA 3CMGA 2VEFA 2Y85A 3QY7A 1BRLA 2ZE3A 4LS2A 4KS0A 5FL0A 5F4XA 3U9IA 3RO6A 2RDUA 1IXPA 1H2JA 2QAPA 3PK7A 5AYIA 1ONRA 1UR8A 4GC4A 2INEA 2VMFA 2VFIA 4A3YA 4LS1A 3R12A 4ZOBA 1PZ1A 4ZSTA 3KCLA 2A3CA 1V6WA 4NAFA 1FWHC 1S2WA 3V0UA 4MB4A 1ZALA 2PRLA 1EDGA 3W01A 5CPNA 2XHYA 3UETA 3CPRA 3W3OA 1D3CA 4H4IA 3WDIA 5AC5A 2O4MA 3CAVA 2YBUA 1UR2A 3R0KA 3YPIA 1OFEA 4GYPA 2DJXA 2A21A 4M81A 3TN4A 2FGZA 2ISVA 1C90A 3W7OA 1SJDA 1UIOA 1PZ2A 1OCJA 1NWRA 3TYCA 5H2ZA 4FNPA 4HOWA 4C6DA 1L0PA 2YPIA 3NPUA 3AHYA 2OKOA 3MT1A 1P6WA 3W6MA 3W4RA 1DIDA 1GCYA 1Q6GA 1GG0A 1KD0A 1MZHA 1S3HA 4X2RA 1Q45A 1G0CA 4C6JA 4O8RA 1SSGA 3LRKA 5C2CA 1US2A 3EYPA 2WC3A 1IEWA 2A3AA 4O0KA 3I4EA 3AXXA 3OB8A 4RW5A 1EGVA 3UPMA 2R1LA 2V5BA 5U7SA 2GGJA 5D9PA 3PB0A 2NV1A 2OFJA 4JTKA 1WA3A 3B05A 3WLLA 5FEZA 1E5JA 5BNKA 5G4WA 3SI9A 3ISIX 1ZHAA 1VFOA 3N29A 1BF6A 4GXPA 1A5OC 1F05A 1YXYA 2V2HA 3GR7A 1IZCA 2O9TA 3A5VA 3MUZ1 2J7CA 2X0HA 3OZMA 2JGYA 3VD5A 2PGWA 3QVQA 3DC8A 1NFGA 4BF7A 2WNWA 5FAGA 5LIXX 4HNTA 3W88A 1UUOA 4BF5A 1Z41A 4BI6A 2GDUA 3BANA 3GH5A 3V1HA 2R8WA 4QSFA 3N25A 4PB5A 5D9MA 2PLKA 4FOKA 1XC6A 1F73A 3W2UA 4LYQA 3VGDA 1DJYA 3I6EA 1EF3A 2DVXA 1QNSA 5T91A 3LZ5A 3Q2DA 3TFCA 1UR3M 2WB5A 4ZOCA 1JL8A 1ZCCA 4WKHA 2OX4A 2DUZA 1A5KC 5I00A 3PS7A 1TTQA 1ZB5A 3KL0A 3WFLA 1HVQA 4BWLC 5DF0A 1DXFA 4GKLA 4CNTA 3L68A 4E2DA 2NUYA 1HL8A 3M5ZA 1ECQA 3I10A 1DJZA 3IUDA 1R9XA 3GNNA 1UMYA 1XXXA 2ZUWA 3BAWA 4W85A 3Q45A 2V82A 2H6RA 3PZ9A 3WQ4A 3L5AA 3U48A 2CLOA 3CV7A 2ZUVA 4N4PA 1KTBA 4WR3A 1V0MA 3NL2A 1Z69A 3S9ZA 1CGTA 2H3BA 4DYJA 1W3IA 1QI0A 4IPNB 3TV8A 3MY9A 3PR2A 4PRWA 2WQDA 3KDOA 4DNMA 4TIMA 4U3AA 2FVMA 5C9ZA 3LMYA 1XSKA 2ACQA 5HJLA 3NO3A 2QCEA 4JTUA 5LA2A 3IPWA 4AHPA 5CZ0A 4DI9A 4K3ZA 2DT0A 2AOSA 4GE8A 3LNMA 3FCPA 4JX6A 1PAMA 5I3GA 1OWQA 4Y2WA 4HP5A 3DAQA 5AKQA 1M9HA 1UW9A 1FKWA 2YOCA 3ARSA 3ECQA 3VFCA 2W27A 1XQKA 3KWSA 4D6GA 3CT2A 2YDAA 3A21A 4ZFMA 1TG7A 1QNPA 3GFYA 3PZVA 4KCTA 4Z2GA 5C2XA 3B4YA 4OBSA 2Z27A 2A6NA 2CLEA 1M1BA 1P7TA 3VOJA 4UTHA 5F7UA 1GORA 2J24A 1UD8A 2WNQA 1EJTC 3VIMA 3LUTA 3EX1A 5IM51 3PBGA 1BVZA 1DQUA 4TVDA 2O9PA 2HPIA 3SCWA 2DH3A 4HCLA 5A6BD 1GVQA 3MS8A 4HZMA 4F48A 2E5BA 3FA4A 4QRNA 1TV5A 4M80A 1ZJAA 1UWUA 3C86A 4AVNA 4AISA 4O1AA 4LAKA 4UFKA 4J2MA 4BEUA 3OJGA 1JYXA 1J9YA 3LN3A 3F4DA 4W84A 2ATMA 3ARWA 1GZGA 1DJXA 1WOAA 2XZ7A 3WBWA 1E4NA 4IPLA 4GJJA 4XBKA 1RJQA 4YCOA 4FAMA 3BDKA 1AW5A 2PURA 5DRIA 3GM8A 1FXPA 5DY2A 1NOWA 4BA0A 3MA8A 4XISA 1I45A 2C0HA 3OBEA 2B4GA 4Q6JA 3R6IA 4TTUA 1FWEC 1GUVA 3KLKA 3WF0A 3IIOA 1OK4A 5K9DA 3ANYA 3OO2A 1TPWA 2ESCA 4YTUA 5AECA 3AI0A 4PCSA 1FFQA 4DM1A 1OX6A 4PFMA 3N1AA 3VNLA 2XFRA 1FXQA 3TYZA 1EO7A 2DIEA 4UOZA 4FLOA 2VX7A 1YE4A 4MLJA 2XFFA 3ATZA 4HKPA 3EWYA 3NQ2A 5I6SA 5I5RA 3A4JA 3TJIA 3N2OA 1JPMA 2Q3RA 4QX4A 1XGDA 4PUKA 4PTVA 2FIQA 1CENA 2XVLA 1LT8A 3F2BA 2PWUA 4IZGA 4MB3A 3UXLA 1FWAC 2PLJA 1A4LA 4UTJA 4OU1A 4CN4A 4HA0A 4B3LA 5EPDA 3HGSA 1XD0A 1R3SA 3CHEA 3G8RA 1EJRC 1O1HA 4C6QA 3ANUA 4JFSA 5LIUX 1G4SA 1L6WA 4X9SA 2BTMA 3T0AA 4D1IA 1LOQA 2PAJA 2DFAA 3NAVA 3WQDA 4TU1A 4J3UA 2PRMA 3TMQA 4DF0A 3CGTA 7A3HA 2E9LA 4JTFA 1DWGM 3ZJ6A 3BZJA 4MZYA 2ZRXA 2W9MA 4UTMA 5M5DA 4LRTA 3GXIA 1OD8A 3R2GA 4B4HA 2QCHA 4IMFA 3AIBA 3QOKA 2POTA 3GXDA 3UG5A 4Q8OA 2NT1A 3NXLA 5C7VA 5BOFA 4K8HA 4YL2A 4W8LA 3QOMA 4R88A 1B4EA 1WBHA 4IWWA 2QIIA 1LOLA 4GH3A 2CBVA 1DWHM 1FRBA 4UOJA 3RRAA 3PZIA 5FJIA 3F5JA 4XZNX 4ZA0A 3ABOA 1HTIA 4O57A 4ZE5A 3PPFA 5C6MA 1ZENA 1VIWA 4DZHA 5FJJA 2OYLA 4A8RA 3W07A 4E8GA 2QVNA 1EIXA 1MQRA 1EKOA 2PZ0A 3L0GA 1J6PA 1K70A 2PU1A 4U2ZA 3HA1A 4JY8A 4EXAA 2H9AB 1GZ1A 1OT1A 1VBHA 4AQLA 2OLAA 1DTNA 2F38A 3EX6A 4Q8QA 1K4HA 4JIEA 3UZWA 2XGBA 2QPUA 4DB7A 2DGAA 1V3IA 4DBEA 1EJWC 3ZYZA 2YDQA 2OB3A 2BGNE 5CPLA 3CJPA 1DXIA 4XKYB 4GI9A 5H8PA 1MEWA 4Q4MA 2G4JA 3CV1A 4JTLA 3S6OA 1JCMP 1Y0EA 2BOFX 2PBGA 3SCVA 4AYGA 3IRSA 5FIPA 4JYFA 4EP8C 3PZQA 5AYZA 5FJUA 1JPDX 2GJRA 4ENLA 3UF9A 2UY2A 1PB0A 3IJ6A 2OVLA 3ZMRA 3RXZA 3P2VA 3WQWA 3V16A 1XBZA 2NLIA 4X60A 1A5SA 4FXJA 1L9WA 1R3RA 4HK7A 4DWSC 3BLFA 4EXBA 1EXBA 2BHZA 1ESWA 1OB0A 1TELA 2OZ3A 3G1SA 1VCFA 4HIBA 3FW6A 3SGUA 1JD9A 4EWND 1B30A 1QW8A 1VJIA 1P4CA 1Q6EA 1WNOA 4F0RA 1H0GA 4XZLX 3W7IA 1UBPC 4PUJA 5GNZA 3MKCA 3MKVA 3W22A 2GVYA 1C8VA 3EOLA 3T08A 3RJXA 2QGHA 3N15A 3GBEA 3V3WA 3IEBA 3UXKA 3TTOA 2OEKA 3QXBA 3RM9A 4D8AA 4DO7A 3MCNA 3TONA 1Q2SA 1BD0A 3A3XA 2HPMA 3R1ZA 1O5QA 1E5NA 5DCBA 4NILA 3WQPA 2CZFA 3NEHA 3IAQA 4IQDA 3G5EA 3WF3A 3F5KA 2Y88A 5D2XA 2CERA 4C90A 2NXHA 1YNQA 2EGZA 5HR7A 1OQFA 2VCBA 2CLMA 4UIOA 1MW1A 2G5WA 3TXZA 5D32A 1FCQA 6A3HA 2IPWA 1V08A 1XLMA 4QJ5B 1EUNA 3IWPA 1JEZA 1QOXA 3CHVA 3W38A 2GVEA 4EOUA 3V75A 4M7SA 4H7VA 1KLZA 2OKTA 4GABA 3GVRA 4PTWA 4MWAE 3RLGA 1YX1A 2QUVA 5EB8A 1KRCC 4FNQA 3DCPA 1UWRA 1TJ1A 4UTKA 1MI3A 1NJJA 4TR9A 3RNDA 1LRQA 3CH9A 1XICA 1AG1O 3JVAA 4J4KA 4GKTA 3WLOA 1QW7A 3B0PA 3N3MA 4GGBA 2PDWA 4BK9A 3K4WA 3OA3A 2XG9A 4C1NB 1A5LC 2RHGA 4HNLA 3SSJA 2X16A 3AMDA 3GU2A 4IF2A 1I0DA 4KESA 3FK4A 1PTDA 2QDDA 4PC8A 3LNPA 1UA3A 5HQLA 1PE1A 5BCAA 1XCXA 4GLEA 1C7SA 2PWHA 2VQUA 3VNKA 1H62A 2JGQA 4AHOA 2OWWA 3GC2A 4F0SA 3N3TA 3NA8A 4IHCA 4RDVA 4AC7C 2NVCA 4LCQA 3W7KA 1CWYA 2EF9A 3UPWA 2Z2AA 1FWRA 1GVOA 2V68A 2WSYA 2YA1A 4NJGA 4PMUA 1V3HA 3ZVIA 1R5YA 5CZJA 4MFDA 1DIOA 5H8UA 5CJMA 1QNQA 3DHDA 4KGLA 1IXQA 2V63A 1AD1A 1SMAA 1GPWA 3N2MA 5IXEA 4IPJA 1TE6A 2QNEA 1OGSA 4P7RA 3I3DA 1XQLA 3H8AA 1O6IA 1RJRA 3W1AA 3QQ1A 1K3UA 3BSGA 4Y9MA 2Y1HA 3BCFA 3PG8A 3AYSA 3A22A 1T7LA 3W6LA 1X1NA 2G50A 3VIFA 5KZ6A 1L8PA 1XPYA 4MVAA 2EJAA 5I78A 3T81A 2PLMA 1AL7A 3MSRA 3KP1A 3RDKA 4A8NA 5E93A 1EHAA 1EC9A 2PA6A 5PTDA 1NVMA 1CXIA 2G0WA 1L8NA 1VLWA 2CHOA 1YKWA 2WV8A 2HVMA 3CB3A 1WB0A 4L6DA 3SZ8A 6PTDA 3AO0A 5F4SA 2F9RA 4MGGA 3TTEA 3EGJA 2VC7A 3QSRA 1M03A 3R8GA 3ES7A 2XUCA 4LWWA 5DRCA 2IPFA 4US5D 4AY7A 4W5UA 1OYBA 4P8UA 4F8XA 6TIMA 4I8YA 1R2RA 4P8XA 4ZOEA 3PULA 4IGHA 4GO9A 4RDWA 3QPYA 3ITCA 5HOSA 5E1QA 3NCOA 5F2GA 2R6OA 1QBBA 3CV6A 3SUTA 4MPQA 1KBKA 4HNNA 3DHFA 1AZ1A 3BJSA 2VEPA 1H7NA 5C2GA 2XINA 2FPYA 4S3JA 5D2WA 5E6ZA 2I17A 1W5QA 3HB9A 2D2JA 5DQPA 1Q4WA 3OVGA 3G0SA 1KGXA 4FF7A 5LXXA 3GY1A 4JTDA 3CUHA 4N0RA 3B0XA 2OX1A 4NKCA 1JDDA 4X3ZA 3IACA 1Q6RA 4JTCA 5F1VA 3FYPA 2W6RA 1HL9A 4M24A 5HUOA 3ARQA 5FEXA 1FWDC 1H1ZA 1VBGA 3G22A 1M6JA 1J8VA 3CUFA 1ICQA 1R87A 1FP8A 3NQ8A 4FNTA 3GNPA 3F1QA 2WBGA 1K6WA 2QUTA 2E8ZA 3P60A 4WHBA 4O1BA 3GG7A 4HYWA 2ABBA 3LX9A 2ZRYA 1UD4A 4U2YA 1TV8A 4RNHA 1C8YA 4MJZA 5IOBA 3C3UA 1QPNA 3TCSA 5D09A 1MDRA 1E3XA 3MKKA 3F4CA 3UERA 2QQ6A 3TCEA 1UKPA 3WCZA 3BG9A 2RJHA 2X05A 4HTYA 3BWWA 1FWBC 4DUWA 4WUIA 4DI8A 4FXFA 4ML4A 2IW0A 1UH2A 1OABA 4PB3A 3OIXA 4QE1A 4QG6A 4QP0A 3TXVA 1IEXA 2QF7A 4DJDC 3VOFA 5BZAA 4FO4A 3BURA 2V2DA 3N4AA 2OOGA 5D4YA 1OC7A 3ZFHA 1JVNA 4F2TA 5D33A 4EF8A 4ES4A 2WJEA 2BY3A 3WJXA 3ORWA 3WD0A 3T05A 2OELA 3PVFA 3N12A 3W28A 4V27A 3CQHA 3G0XA 2P8BA 1XINA 1DTUA 2R9RA 1A49A 2J8FA 2YCEA 4EE9A 4J3TA 5HWNA 5FOOA 1F3WA 1REQB 1BG4A 3VNDA 1S2UA 3CHFA 2VZVA 1ITCA 5DX7A 1RBAA 1NQKA 4GQRA 4Y6GA 2A1YA 2YA0A 1K6AA 3MSDA 3DHPA 3NL3A 1E43A 4PCFA 1YNPA 1LBLA 3LV6A 3CZEA 4WIWA 4OBRA 4Q6XA 2R14A 2QUNA 3B0UX 5HDRA 1Q7QA 3GVVA 2ON3A 1EPXA 2E28A 2XIMA 3RILA 1BRLB 1PPIA 2WC7A 1J0JA 1JZ3A 2NQJA 4ZVJA 4IX2A 3ZR6A 3W70A 2V5CA 2V9DA 3TQ0A 1PIIA 3KOYA 4HMCA 3OP2A 4INFA 4PSRA 4YNGA 1P0EA 1I1XA 3UESA 5JBFA 2QEZA 4OJYA 4MF4A 3TX9A 3ARZA 1RCXB 3M46A 4DN1A 4WEVX 1FH9A 3GTFA 1LZOA 4NAFB 1QR7A 1XUUA 3KHJA 1EJSC 1VFFA 3B8DA 3L5MA 1PSCA 3EPNA 2VZTA 2FDSA 4WRHA 3THUA 3P0XA 3EEGA 2TRSA 3TJXA 1XLGA 1E6SM 3TTQA 2WMGA 1J12A 4Q4RA 3EX3A 1FWCC 2IS7A 5A6TC 1NOUA 2GJPA 3W2KA 3ZT7A 1QFEA 1S5NA 2YL5A 4QJ1A 3MMWA 4MJ2A 5CJ5A 5BYWA 4U4MA 3AWOA 1I60A 4W93A 2EG6A 3GYCA 5CLTA 2CHNA 4DYKA 3GDLA 4QAIA 1EIBA 3JU2A 1E56A 2TSYA 2ZUMA 3FXGA 4JIPA 4P8WA 4LVDA 3H54A 3W37A 1DYSA 3GW3A 3LENA 1FBAA 3VXGA 3W7LA 1ZZMA 3FN9A 3EWBX 3UR5A 1X6UA 3L23A 1QO5A 4AZIA 3JZUA 4UOQA 3VCRA 1ITXA 1QPKA 1FWWA 3RX3A 4HD5A 2HE8A 1LORA 2O7QA 3ITXA 4MY9A 5EL1A 4EANA 2C6QA 1OJXA 1IHIA 4YVXA 5BRQA 4Q22A 1TZZA 3TSDA 4IP4A 2YDSA 1O7AA 2ZRZA 1LWJA 4PMXA 3MI6A 2KAUC 4DAIA 1VEMA 4BQ5A 1VP5A 2YL6A 2JALA 3PJXA 1UUMA 4ML9A 3BV4A 3VKDA 5D8WA 5LZLA 5DMNA 3TW6A 1DVJA 3SQLA 3FEMA 2EXOA 3KDNA 3CUJA 2B0MA 3LHVA 3NXFA 1MO0A 5E0FA 5GJNA 1ME9A 2VFGA 2VRJA 3IRDA 3DI1A 3TU9A 5I24A 4UFHA 2NQ9A 5AOUA 3UY7A 3GTXA 3DI0A 4L4LA 1AW1A 4Q4PA 1QI3A 2CEQA 3LCIA 4LCRA 1YE6A 2WQPA 3WUBA 1RUSA 4Z1YA 1H09A 3KXQA 1ZUAX 1BXCA 2JEQA 1KFEA 5DBTA 4Q4OA 5KEZA 1CXHA 2UBPC 3TA6A 1S3TC 4JFWA 3DG7A 4AEFA 4LS0A 4EIVA 4ZXLA 1TPUA 1DOSA 2E0PA 1G4TA 4I5RA 1NQ6A 3GW0A 4UR8A 1FWTA 1HG3A 1L6SA 4DNHA 1TKKA 1VFHA 1DJGA 4RJEA 1V02E 4M7TA 3N6JA 1PDYA 2PS2A 4JPGA 3GTHA 4LUYA 8CGTA 5FSDC 2P3EA 4S3GA 1QJWA 4LX4A 1PX3A 3NGJA 1QW9A 1X96A 4E3VA 2WSQA 4L1XA 1WDQA 2OG9A 4POCA 3IIXA 5EMUA 4NXKA 4XBJA 3KFTA 3MCOA 3QZEA 3K4DA 1VJSA 2C19A 1D8CA 3R5EA 1HKVA 4IX0A 2GQ3A 3VD9A 1PCKA 4YU1A 2E25A 2V69A 1T0OA 2Y5EA 3WD2A 1TUFA 5BRPA 3M0KA 3KTCA 3QR0A 3IVSA 1MNSA 4NT0A 2VNCA 3FHQA 2VCCA 4J3WA 4GFIA 3NQ7A 3GRIA 4UR9A 5JBDA 2ISSA 4NF7A 4J3VA 3OLIA 3RFAA 1DIEA 2GJXA 1BXBA 4DJED 1FCUA 3MMDA 1P7TB 4GYJA 2CZEA 1JCXA 3W86A 1EHNA 1JZ6A 4N02A 1W17A 3OLGA 4LTSA 5SWUA 2G8ZA 4OVXA 4EPKA 5A95A 1I0BA 4ICCX 3R10A 2HCVA 4H9XA 5FESA 3E02A 3G18A 2AKMA 3FV9A 1XIGA 2XZ9A 1E73M 5FCZA 1K77A 1F6YA 4I5XA 5A6KA 5CPOA 4ICNA 2OQYA 4S3DA 2VT0A 3FS2A 1SZNA 2PC8A 4M1RA 5CSUA 2DV0A 1Q6OA 4PEEA 1IF2A 3GU1A 1QPQA 3OG3A 2XVPA 4YTSA 1Q8AA 1GG1A 3WLSA 2WZIA 4H01A 1OD0A 4TV5A 3QF0A 3G3MA 3KLLA 4RNFA 4WDWA 4G7FA 4RL3A 3MWCA 4H9TA 5FL1A 2JE8A 4PMOA 1KV5A 1OC6A 3MI2A 1M53A 1FFRA 2BMBA 1W1TA 1A0DA 1A80A 1G01A 1KXHA 2DZTA 4GIEA 2A4AA 1CB7B 4G8TA 3FDGA 5K9XA 3M0MA 4JTIA 3DHUA 2QCDA 2GUYA 3U6WA 3SW6A 3MDUA 4CVWA 4ZL1A 4N9BA 4KT2A 3M0ZA 4M0XA 4JHOA 4HA4A 1JCLA 3G3DA 4B9YA 1CXFA 3FA3A 1WPCA 4DJEA 3W27A 1CYGA 3NUKA 4UTWA 3LCFA 3IGHX 2V5JA 4AYSA 4YWSA 1MXSA 3H2NA 4H19A 3QGVA 3CUZA 2B7OA 1ITUA 2BNJA 2Z0IA 3TN5A 4XQ6A 1KM2A 1YEYA 2QYGA 3G8EA 1RA5A 3KOXA 5GVJA 1UASA 1CLXA 4N2YA 5KITA 4CQCA 2FFCA 5A69A 1NDYA 1E51A 1AK5A 1OZMA 1E0WA 2QLYA 4XB3A 4CD5A 1Z9AA 3EDDA 3NIYA 3SSZA 2VRKA 3GUGA 2PP3A 2QS8A 1W32A 1JF6A 4OFCA 3W7MA 1K7FA 3HPFA 1CIUA 1AW2A 4BHYA 2ZIDA 3OYXA 2UY5A 4HZ6A 2WKLA 3ERPA 2QR6A 3P67A 2W79A 3WNNA 5GNXA 1TV3A 2D69A 1TPVA 1F9CA 2VXNA 3C2RA 3W2LA 1PVNA 2Y61A 4AXNA 5HMDA 4BS0A 3MMTA 3SEPA 1MW2A 3ZOAA 4Q7BA 1GW9A 1R47A 3HG5A 2ZICA 2C1HA 1D8WA 2OT0A 4GD0A 2V5LA 1H7WA 1GJUA 2QULA 1ELSA 1EYEA 3A4XA 3VDCA 5I77A 3EPOA 1A0EA 2CFFA 2DZAA 2OODA 2WM0A 3R58A 1NARA 3HV9A 5D2VA 3FKRA 4H7ZA 4P7OA 4LGXA 1QU4A 3B0YA 2FZBA 1AA1B 4DM2A 1I2PA 4GYPC 5C9WA 1U1HA 2XIIA 3OGSA 3ZT5A 2OSWA 4OV4A 5HANA 5AYBA 3SB0A 2PF8A 3R8RA 2HS6A 2J7GA 3REQB 3MC5A 3KRSA 3BO9A 3MUY1 3VUSA 4H8UA 4OKDA 1I2RA 5KETA 1YDOA 4J35A 4O12A 5C54A 4Q8TA 2AGKA 1JJKA 2RGMA 1I2QA 1BEUA 3BG3A 1PEZA 3BGAA 1W5PA 3E0WA 4C1KA 4C1LA 3NQAA 2C14A 9XIMA 3AHZA 3APGA 1TCDA 4JTRA 3UFYA 3BICA 4KEUA 3QLDA 4MB5A 4JYDA 2REQA 4W7WA 3QY8A 4GX8A 3I3BA 2I9EA 3M5XA 1J0YA 1P0BA 2XN2A 3AMLA 3VIGA 4R53A 3NZGA 4M6PA 4J5NA 3BSMA 5G2IA 4L7ZA 3VNMA 3WX7A 5LKYA 3LEPA 3HBLA 2HSAA 1VAHA 3ZIZA 3IS4A 3E9AA 1PZ3A 1Z42A 2A85A 3H7RA 4KWUA 1WXJA 2Y7DA 4KIRA 3ZJKA 3LGEA 4MFEA 5XIMA 1DWAM 3HO8A 1TVPA 1YXDA 4WK9A 3W1NA 4IJCA 4AF0B 2R1KA 1KCXA 2DZSA 3IVUA 3DFPA 3MV01 1MDLA 2DY3A 4C6KA 3WD1A 2EKCA 4Y8EA 4O4WA 4M5PA 2ZX6A 1W0MA 3HGJA 2WXDM 1LJYA 5AYYA 1ONXA 2FHBA 1CGXA 2FHFA 2OYMA 1VGAA 2OXNA 4L9YA 2J7FA 1K9FA 4KFNA 3UWUA 3ELFA 1KR1A 3IK2A 4UXDA 1W9BM 3BAYA 4GJ1A 1XWYA 4Y96A 2AL1A 2AQOA 1ZJBA 2PP0A 1FKXA 2DORA 3SBFA 3W02A 2WKGA 3VE7A 1XRFA 4QCFA 2BZNA 5KTLA 7TAAA 3PF3A 1G69A 3AYVA 3BMXA 3EDJA 2GSHA 4C6NA 2YCJA 4H6KA 6ALDA 4DJFA 3TQKA 5JH2A 1F3TA 3E6EA 4XVDA 2GL5A 4H1ZA 1EA0A 3W76A 5EFFA 1BSLA 3DFNA 1GPFA 3ZJ7A 4Q4QA 1EC8A 1XIBA 3M0IA 3SN0A 2Y8KA 1NSJA 3MWAA 3I7RA 1SGJA 4AB4A 3FHAA 2VHLA 1BYDA 3O0FA 3IIZA 4AIBA 2VFFA 5C71A 1YTEA 2D1ZA 4MLRA 3OGRA 1EA9C 5HPCA 5HNRA 5IBXA 4IICA 4NYUA 2EEXA 2Z2UA 1EFZA 3T40A 2VC5A 1XSIA 3H55A 4ACZA 4ZR8A 4GJIA 4ICMA 1HT6A 4HT3A 2WMHA 3S9IA 4JYEA 1KGUA 2GFTA 4KPLA 1XJBA 4NZJA 1KLYA 1E0UA 2QKFA 4LCSA 5M1TA 4S2BA 4BZYA 4LYPA 3TSBA 2V67A 4L64A 1KCLA 2DPEA 2D0FA 1V5XA 3UG4A 5HAOA 1Q8JA 4D72A 2BOEX 4MJ4A 3T8QA 5CBBA 1SFJA 5DCEA 4PMZA 2EBNA 1SSDA 4GQ0A 1SFTA 1XV8A 2YLLA 3TOYA 3GH7A 4KWVA 5A1AA 4UCGA 5TF0A 3G24A 2DDXA 2DIKA 4K1GA 2ATSA 4L4MA 4H6RA 2V81A 3NEVA 2ZDRA 4QLLA 4Z0JA 1W37A 2PF0A 4S3BA 4P2VA 4LNCA 3BMWA 5G1TA 2BS9A 1B3OA 1BVWA 1W2PA 4MZ8A 3WLTA 3ZZ1A 4JQAA 4UNIA 3ZLGA 3MUXA 1QI2A 3TTYA 1VFUA 4XK2A 1YLVA 2C3ZA 1TCMA 4MZ1A 3C52A 3DFOA 3RLHA 4EPDC 1GKQA 2XVKA 3STCA 2FTWA 2GQ8A 3QV8A 2VEGA 2O56A 1WXYA 5CCZA 3L4TA 3L5LA 5D38A 4G7EB 5DELA 1RCQA 3IGSA 2TAAA 4GY1A 5I7GA 2OT1A 2A5HA 1F6PA 2YCLB 4JQ4A 3L2IA 1G5AA 3N19B 5CBIA 4K37A 4CQ8A 3E2RA 4QTGA 4LOCA 4K6AA 2YXOA 2OYKA 4HN4A 4WJ8A 3U5YA 3I4KA 3C8NA 4E5TA 1ADDA 3I6RA 1MRQA 2CETA 2PWEA 3BG5A 2P50A 2JBMA 1QRQA 1VRXA 5AC8A 3ITVA 2J8GA 2P8CA 1UMLA 3VPLA 2WHLA 1N55A 3GG8A 4IFRA 3TJLA 1UZHA 1J96A 4IXHA 5CG0A 3QPZA 4ROQA 3H2FA 3MP5A 2PBOA 4MKSA 1W9DM 2CCRA 3KW3A 3DIPA 3OBKA 3LCHA 4O17A 3QZ6A 4H9MA 1XLKA 2AGTA 2WMJA 2X1TA 2VQTA 4UB9A 4XD6A 5LIYX 2ACSA 3HMJG 1B1YA 3VINA 1RY0A 2TYSA 1V3KA 3A23A 1AUSL 4C6BA 1KRMA 2J27A 4AWSA 4XAFA 4REQB 3S3GA 4EWJA 3DKLA 3RLVA 4BEQA 2XVGA 3THDA 4WQ6A 2ABAA 5CSYA 3R4IA 2W91A 2C7FA 1IT7A 1LLOA 2PDGA 3C2VA 2GOKA 1JI1A 2VENA 3RR4A 1IZJA 1TMLA 4HK5A 3P14A 1OC5A 4QLJA 5FF0A 3W26A 2FZ8A 3KAOA 3W7PA 4D71A 4B91A 3RG6A 2OR2A 2PDUA 1XIDA 4D6DA 3ARXA 1EC7A 4DJDD 3LS9A 1I4NA 4NXSA 2CLPA 3QJAA 1BTCA 2VX5A 4AD3A 5CC5A 3LXCA 5I3KA 1EWEA 2VWSA 4KEVA 1E0VA 1KA9F 2ZXQA 3PZGA 3WLKX 1TRDA 3DFSA 2WPBA 3U0HA 1V6VA 1DEDA 4B5NA 3TR9A 3UZXA 3VAVA 4JQ3A 1UYQA 1W1B1 3VU2A 5EBAA 2AMGA 1E6PA 1MEHA 1XLHA 3CAQA 1WZAA 1RBOB 4A2RA 1RLCL 4O1DA 1D7FA 3GNDA 4OECA 1SO4A 3Q65A 1JDFA 1PCWA 4NZFA 3TYDA 3EB2A 4UMBA 3RAOA 3WKZA 2RDTA 3W73A 5MHBA 4OIFA 4PRRA 5CPMA 1KM1A 3L2LA 3XINA 5A6LA 4CQDA 3UGRA 4P7QA 1F74A 3PZTA 2D2GA 5FF2A 1FDJA 3BLDA 3S6DA 3G1FA 5ABFA 1O66A 3SCTA 1MNZA 4XBSA 4RDYA 2NQLA 2D23A 3OZPA 3CTTA 3TC3A 4HYVA 5H1WA 1OX4A 3GWQA 1XLEA 4JTGA 3U7BA 3LDVA 4B5UA 4P8VA 2OZ0A 2R24A 2H8ZA 1LUCA 2QJMA 1BGAA 1JIBA 4J7RA 3U2ZA 1TZ9A 4AEOA 5GJMA 4BKNA 4PUDA 1KV8A 2Y8UA 3WBXA 2H9AA 4IIGA 2VEIA 1EO5A 3ZQ9A 1F4HA 2GWGA 4PGLA 3AIEA 2W5FA 3F4VA 3BLIA 1X1ZA 4UQAA 4YVVA 4Z1AA 4CNSA 4O13A 2DW7A 3KCOA 1YYAA 1VPYA 1FHUA 4Z2KA 4NI3A 2YYTA 1J10A 1SYTA 4JIHA 1TV4A 4M3PA 4MYXA 1XBVA 4XKYA 1T5AA 1B3XA 1POKA 3S1WA 1AJ0A 4EAMA 3FX4A 4WGXA 3DN5A 3MU7A 2GVGA 2I7GA 4IPIA 4ERGA 1WUEA 4LC8A 3LLXA 1KFKA 3O16A 1WQ5A 3B97A 4C6PA 2ZRWA 3URQA 4HQVA 4NZ4A 3G77A 1E0TA 1UC4A 4C6EA 3H2MA 2F6UA 1RPXA 3GYEA 2BGSA 2XIJA 2P5NA 3WYZA 1IIGA 2I16A 2Q8XA 1VHCA 4F2BA 4GY7A 3SY1A 1P5BA 3CT7A 2XIOA 2P0IA 2C13A 4H9ZA 4J1OA 1QNRA 3KTSA 2VVSA 3HF3A 1TIWA 5DANA 4MMWA 1B0IA 4OT7A 3MO4A 1KFJA 2X1UA 1JQXA 4J27A 2J77A 3WQ6A 4ROPA 1CB2A 2A3EA 4DO6A 5IFTA 3B40A 4YHGA 4PTXA 3HMCA 1DP0A 1OFDA 3ARPA 1A53A 4GYFA 2Z6IA 5HNUA 4C7DA 3B8UA 4QGCA 1M04A 1XGEA 2J7BA 3ZWTA 1JDAA 4E2VA 3EKGA 1UB3A 3HV8A 4FR6A 3QHNA 1W91A 2DZUA 1KRBC 5I3JA 4Q8WA 3BLOA 5CPQA 2E6FA 1ME8A 4ALDA 3SCNA 4XD4A 2G96A 3NM1A 1YDNA 2XFWA 3ID7A 3M5YA 2CNCA 4DHGA 1QWGA 4YWIA 5D37A 3NURA 3BH4A 3UJFA 1EDTA 5AHIA 3ARVA 3KBVA 2YXXA 3CUIA 4LBRA 4ZQCA 2YJQA 3AMGA 2CBUA 3KOWA 4MUPA 2ZTKA 3IVTA 2VFEA 3R0DA 3S4TA 1JCTA 1Y65A 2F8QA 4RUBA 1ISZA 4KRUA 4KWWA 4Q8VA 4AY1A 1K02A 5HA7A 3P6LA 1GWJA 2VEKA 2GDQA 2O9OA 4JQ2A 4WXZA 1MUCA 3SRKA 2XM1A 1E6ZA 3M0LA 4FR1A 4K38A 4AZGA 4ASTA 2TPSA 3W72A 1QOPA 1W8SA 3SM0A 2BDQA 4AX7A 4PUMA 1TJRA 4OE7A 4C1NA 4PUWA 1V6XA 4CN1A 4I9JA 5EA9A 1B3WA 3GXPA 2DT3A 1S38A 1HQTA 1YTKA 3WUFA 3PJTA 4V1XA 2HTMA 1GOOA 2WOQA 2FZDA 3G1HA 2FDMA 4FOUA 5FEPA 3FJLA 1WAUA 3VCNA 2CLKA 3MDWA 3ZO9A 5CJNA 3KOFA 1OCQA 3UBPC 5HJYA 5A6AA 4H6EA 2JF6A 3S47A 3F7JA 1B9ZA 4R3UA 1H50A 1X39A 3F03K 1Q66A 2HV5A 4B3KA 8TIMA 4C91A 5I3HA 1FX6A 1HN1A 2POZA 2PWFA 5DN1A 4E4UA 3VDGA 3LHYA 4AC1X 4PCPA 3TSMA 3N18A 1EL3A 1BGGA 5FEWA 1QMLA 4Z2IA 4O52A 5BXTA 2R1NA 4MWAA 2CZ5A 3WF1A 4GVGA 3N6QA 4E4PA 2NZLA 4GGHA 5A2CA 5T9BG 2O4QA 2V3FA 1E4MM 2GJXB 3ATYA 5IFPA 1TPEA 4LF2A 2ODOA 2Q6ZA 4B90A 4W89A 1EJUC 1VCVA 4CCDA 4TMBA 4Q7IA 2Y6ZA 4ZO7A 1RPKA 5LIWX 1XM3A 1LDCA 1EP3A 4ZZ9A 3NSXA 5EMYA 4PMJA 3UVAA 2DSWA 3PAJA 3IGXA 4YHEA 1UP0A 1E1CA 1Z3NA 1M7PA 4M8UA 3A47A 1XCFA 3NNTA 5FA5A 4MNKA 1K9TA 2ICSA 4GOAA 4ZSUA 1B3YA 3OVPA 2Y5SA 1RBLA 3B9DA 1N82A 1FQ0A 4V2XA 4KIEA 3CQKA 5JIPA 4FLQA 2FGBA 4LB3A 4RZBA 1ISXA 1RD6A 4FX8A 4GZJA 3NQGA 4HHHA 1FY6A 4O53A 2WC4A 1TZ7A 4M6VA 3ARRA 2UY4A 3BARA 4HPXA 1JCNA 2NUWA 2QJJA 1FH7A 5EU9A 4OWGA 4N6EA 4IP5A 3E2VA 3CM4A 1MZRA 3VDBA 1GOQA 2Z28A 2CC0A 1ZP3A 3E0VA 3LD5A 5C0QA 3DFTA 1EQCA 1TV7A 2HE5A 4QCEA 4UTIA 3CEPA 1R3YA 3K5XA 1J2WA 2Z6JA 2A3BA 2PWVA 3ARUA 5LNVA 4CEXC 2Y4SA 3AXHA 3KBJA 4FNUA 3B04A 5TIMA 3SCOA 4CU8A 1U1JA 2C18A 4ZEPA 4C6MA 3IAPA 3GVQA 3DECA 5DFAA 3WFAA 2BXYA 4K2SA 2RAGA 5D03A 3GFXA 3N04A 4IQJA 1XYLA 4XZ9A 3HOJA 3EAUA 4XSLA 3QTPA 3FYYA 5LNWA 1CLVA 1ADOA 1ZBCA 3S5NA 4IISA 4RW3A 4RKAA 3UA3A 2DIJA 3WQGA 1EEXA 4QBXA 1LCOA 3UVIA 1IWAA 3OVQA 4JEQA 3URNA 1Q6QA 6XIMA 3PWGA 4LEQA 3PB2A 3U4AA 1X7IA 4DVOA 1DL3A 4WXYA 1R38A 3BOXA 5K9CA 2C16A 4DBWA 4KWOA 2FZNA 3GH4A 4TMCA 2OLSA 1PWMA 4C6IA 4YJ5A 5KZEA 4CKQA 4I9MA 3E0LA 4DQWA 4RNIA 1ENUA 2GDVA 3QFEA 1C7TA 1MYRA 3WLMA 4TQTA 1PKYA 1H49A 2E8YA 4NZ3A 2PEVA 4Z1DA 2RJGA 2E40A 4Q8PA 4QDPA 1G4PA 2ZZ5A 2Y7EA 4JN7A 3P5YA 4S3AA 2I57A 2A0NA 1K7EA 1V0NA 1P6CA 3GVGA 1BQCA 2WPGA 3GO2A 1ICSA 3PJWA 3W87A 3WEMA 3NDZA 1EDQA 2FHCA 1KW1A 2PCEA 1RD5A 3WLNA 1A3XA 3SCQA 3UR8A 4LAUA 4CD7A 2IQ0A 1HP5A 1U5JA 1GYLA 4TUFA 1XBYA 1WBJA 2BXZA 3ONCA 4MNJA 3UEQA 3VYLA 1Y8BA 1GVYA 4F40A 1Q63A 4WD0A 1JYNA 1WDDA 1JAEA 2DQWA 1SJCA 3OEXA 3M6YA 1AMYA 1EBHA 2ZZ3A 4AFYA 4BI5A 2VOTA 4MADA 3O8AA 4YS1A 3M0XA 2Z1BA 1X8CA 4U5KA 3USBA 3NQMA 3M0YA 2BXVA 2V3EA 3LU2A 2NWSA 1XIIA 5AZ1A 3EB3A 1KBIA 3ITTA 3B9NA 4M51A 2ISFA 3NQEA 4TOQA 5I0DA 3EWDA 5BW6A 1QNVA 5EY5A 1DE6A 4TXEA 4LC6A 3EMQA 3AC0A 3A24A 3U57A 4F9JA 3EXSA 4G6CA 2JIEA 3NZRA 2PWGA 2REQB 1LL4A 2XTKA 5HULA 2NXIA 3TAKA 4JX4A 4UFIA 1OFBA 4L9ZA 2GJLA 3FLUA 1DHPA 2HEJA 1HIZA 3ALGA 4W87A 1AVAA 3W1UA 1R30A 3DKJA 4GA8A 1THFD 3U3HA 3CIWA 3B03A 3TUUA 3W00A 1B4KA 2WWCA 3ABXA 4I9AA 3WDRA 2ONEA 4LY8A 2W66A 5G1MA 1H5YA 1WKFA 2WSKA 3AU6A 3NSMA 3WNOA 3RPMA 1QDSA 1R7OA 2EPHA 3HJEA 3KCJA 3D3FA 4O14A 3W53A 1W1ZA 3T0TA 1HGWA 4L6HA 3MQTA 4X9YA 5A8PA 1RV8A 5A2AA 4WY0A 3QRHA 3POCA 1V0KA 3B0VC 2JFEX 4AG0A 2ZQ0A 4B16A 3M0JA 1FWNA 1VBJA 1R3WA 3THQA 2FLIA 3W1PA 3O0KA 3A13A 5TBOA 3WO8A 1ZP4A 2E7FA 3RM8A 2YIHA 3S0CA 4MNMA 1K03A 3AXMA 4LUTB 2ZX8A 2PB1A 4L65A 5CGMA 4UQDA 4AD1A 4HMDA 1GOIA 1NELA 1SZEA 3S5ZA 3SQSA 1QI5A 1X97A 3AFBA 3A9IA 1NDWA 7TIMA 4HU8A 7PTDA 1OM0A 2QMKA 3NPXA 2VR4A 1RALA 1BTMA 3L4YA 5I3FA 3PHAA 4DPPA 3GSMA 1KNWA 4H9VA 3W1TA 2PGRA 3WBAA 1Z89A 1UQZA 1H7OA 4HPJA 1TJ0A 3RUBL 5KZMA 3TYAA 3CZLA 1UWIA 6REQB 1V8EA 4UNLA 1JR1A 1WOBA 1M68A 2O92A 1E3ZA 4HPGA 1R46A 3ME3A 3IJDA 5KZDA 2PRHA 3ZVHA 3S2CA 5AYXA 1KCKA 4DUXA 2QCGA 4L80A 3FEQA 2PU0A 2WW5A 2A6LA 3WUGA 3C6CA 3OZOA 4DBSA 3AJXA 4PFHA 1W8GA 3HQ1A 4DXXA 3NQDA 3H2AA 3DC0A 4AIEA 4HK6A 4ACZB 4LFYA 3RMJA 5JU6A 3WJYA 1F07A 2OZTA 3DH7A 4IIEA 1TTJA 2RKXA 1D2KA 4NJHA 1XLIA 4CU7A 5JXQA 1GVSA 1NDVA 3CL7A 3JZEA 1UWQA 3K30A 2Q8LA 5BWFA 4O54A 1CXLA 3MYOA 3HFYA 2NQ5A 1XLCA 1TE1A 1XIMA 2IPJA 5CGTA 2X1SA 4O0QA 4ZTXA 4G1NA 1RK6A 1Q6LA 2J6XA 4GYKA 4J3SA 1EF2A 1EZWA 4B5VA 1XPGA 3M64A 3BCDA 4CCZA 3D47A 1XDMA 4DZAA 4B3ZA 5KSWA 1PDZA 1J79A 4UNKA 1UD3A 3GK0A 4HA3A 2E68A 4NRRA 1R9YA 1N2VA 4ZCWA 4LW7A 1NDZA 2J62A 4C6CA 4FHAA 3TLQA 2B31A 1UKTA 3M7WA 1R86A 3MMUA 1ZJHA 2DT2A 4IMEA 3W1LA 3SIMA 4DELA 2QV5A 3LCWA 1W56A 3M5VA 1JRCA 1POJA 2J66A 3V0TA 1KO0A 3KWXA 1TIMA 3OU8A 1RAKA 2OSXA 1S1RA 4WLCA 3FGCB 5FKYA 1P1MA 1Q5MA 5EKYA 1FCBA 3LGDA 5KINA 3TR2A 2VWTA 1U2YA 4L5ZA 1G4EA 4KEMA 4ADSA 1BWVA 3MZ2A 1V02A 4HHLA 3GXMA 2WYSA 2I5IA 3OYZA 3P5ZA 4JNZA 3SADA 1T40A 5MKGB 4DJEC 4HNOA 3M4HA 5H6HA 2PUZA 3RCYA 3RO8A 1EZ2A 1GOKA 4UTWC 3U2OA 5I23A 3IUIA 2VX6A 2L5HA 4L56A 4XO7A 3L7RA 4AWUA 2G3FA 3MYPA 2IKGA 2WBKA 3CO4A 1XH1A 3V36A 4JNMA 3FA5A 3W7QA 4CNOA 3L66A 4GQQA 2ZFAA 2WZMA 2PDKA 4CQAA 3SJ3A 1B3ZA 5HMSA 4PODA 3BJFA 1HGYA 1MW0A 2YZ5A 3R7MA 5CXPA 3CL8A 4J40A 5ECVA 4GUJA 2ZADA 3WQFA 2OGJA 1IT0A 1XRVA 2QDHA 1MXDA 1QOQA 1Z32X 3BLEA 3NGFA 2G3MA 1KXVA 2BVTA 3N34A 2VOMA 4GG9A 2HRWA 4DIAA 1M65A 2D2OA 5TAOA 2QF8A 4XTDA 1CTNA 4NL1A 4Q7NA 4JTTA 4LF1A 1QATA 5BU9A 3TN6A 4HZ7A 3TEVA 1ZTVA 3H2OA 5A94A 4NAEB 2UY3A 3E5PA 2XM2A 4P7LA 3WK0A 1UQYA 4YTRA 2PDCA 3B8VA 5ENLA 4O16A 2G3JA 3O2LA 1DIKA 3I7QA 1HKJA 2ZA2A 3AROA 2BGQA 2OWXA 2XSXA 5AHNA 2BG5A 1ZBVA 3DG6A 1HKMA 3LBCA 9XIAA 3UD6A 1E9LA 2Q01A 4HNVA 2H3DA 3TW9A 3O15A 1LTDA 3QFWA 1SZGA 3MJYA 3QQWA 1YPXA 3CEUA 2VDHA 1WO2A 4FK9A 1S2VA 3KOZA 3GG0A 2ZXAA 4JTSA 3EX4A 2OTDA 4Y90A 4E0CA 1W9PA 3B8IA 2ISWA 3M16A 1Q13A 1O4UA 4GNKB 1R2SA 4JCLA 2CHRA 3CZGA 1TRIA 5I03A 2PDFA 3BK0A 1MFUA 4JBRA 3LY0A 3GDBA 3N9SA 2J75A 4D6EA 2CLHA 1PXGA 4GX9A 4GNVA 1V51A 1SO3A 2XSBA 3GHRA 1AZ2A 3GDMA 2GQAA 3ZLHA 4M29A 1UZDA 4U28A 1TWWA 4L4OA 3CL6A 3AJ7A 4AMAA 1HJWA 4Q8UA 1TR1A 2DSZA 2W3ZA 1CT5A 1MMFA 3WLQA 1Q7ZA 3S5YA 1UJQA 1KFCA 1VHNA 1PX8A 5DXXA 5ABFB 4K1WA 1P48A 3BLLA 1SFSA 3RGTA 3GXTA 1RVKA 4JXCA 1OX4B 1TSIA 3EWWA 2YCIX 3N13A 4HGXA 5E70A 4ZENA 1NEYA 3UNDA 3GDKA 4HJFA 1OHLA 2J7HA 1LUCB 1GJWA 1TMQA 2OZ8A 8XIMA 5EMLA 2XWEA 3GBDA 1M3UA 3RHGA 4CD8A 1EPVA 4H3DA 1PIFA 1GOMA 1RY8A 3CIVA 3BGGA 1GK8A 4JCMA 1W54A 4IFKA 2DZVA 3PZOA 3SFKA 3REQA 2EJ1A