3ZJYA

Crystal structure of importin 13 - rangtp - eif1a complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Nuclear Export Activity of Importin13.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
total genus 37
structure length 169
sequence length 169
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zjyA00
3DOEA 4PZLA 1T6NA 5KDLA 1OYWA 2WPDA 1TU3A 4BFVA 1G21E 4V0MA 1PJRA 3AP1A 1I2MA 1QHGA 1A2BA 3OIYA 4K81B 5FOXA 4D4KA 2VSFA 4LYFA 3DVLA 4M21A 3GLFE 1OXTA 4FWTA 2WWWA 3IIJA 2PL3A 1RRGA 1P72A 4I1SA 2YV5A 4WXRA 1Q57A 4NPHA 4YONB 1O3YA 2ZYVX 5EJEA 4JJZA 1T3SA 4H9GA 1OH5A 1N6NA 3GFTA 1LY1A 3TQCA 1IQPA 1N5LA 2IS6A 1DAKA 2IYVA 3ND8A 3B7GA 1Z22A 2BJVA 3KTAA 3KXKA 5DN6A 1XNJA 3W6OA 1E2KA 1R6BX 1SZPA 3AVWA 1Z07A 5G53C 1H65A 5EE5B 5K8IA 2YC4C 2QENA 3QE0A 4NYIQ 1J7KA 2WSSA 3AUYA 1Q1BA 2OE2A 1KI8A 1U0HC 1ZP6A 4UKDA 4UNQA 1UDXA 1Q20A 3VX3A 1M7GA 4MRRA 3RS0A 4JMPA 4Z1MA 1U8YA 2BMEA 3FVQA 4Q9JA 5E7MA 4LJ9A 3GEEA 4QBGB 1ZAKA 3MCAA 1CJUC 1P2TA 4HAXA 3AGQA 4IEEA 2NIPA 1TTTA 1CTQA 2J87A 1W7AA 5EP4A 3K09A 5SZIA 1OH7A 1N0VC 3CNLA 4NE2A 4MRPA 3QXSA 3B1VA 3R8CA 3VR1A 5LD2C 1PUJA 3U7HB 4FCVA 1N25A 1XJCA 4MKHA 2HV8A 4M53A 1TPZA 2JLWA 1VECA 2FGJA 1LB1B 4D81A 2FG5A 5EE0A 3T34A 4DEXA 2ZI3A 3ZZUA 5FH9A 5KNCA 3BOSA 1G19A 2WAYA 4ZCMA 3Q5DA 1IJFA 4OK5A 1RYHA 4A0HA 4Q9IA 1YZLA 3DOFA 4AYTA 4JZKA 4W5JA 3TAUA 4B3CA 3RS5A 2QPAA 1KO7A 5FPTA 5FBLB 2RHDA 1G3UA 1UKZA 4NU0A 4G01B 4IOKA 2ERXA 3I3SR 4OHVA 4DLWA 1H8EA 2ZRMA 5HE8A 1X3SA 2CMKA 2QMUA 3FHCB 1E2DA 2G9NA 4HB3A 3RC3A 3ZZTA 3GLHA 1E2MA 4M22A 1EFCA 4IDQA 4OI1A 4EQ6A 3LVQE 4US2R 3SC3A 2ZVQX 3KXIA 2A9KA 3VKWA 2IYQA 1IXRC 1TNDA 5FTMA 1XX6A 2XSZD 3HPRA 2YWFA 1HURA 5UKDA 3L82B 4BASA 1JJ7A 2WOOA 1KO8A 2GXUA 1XEWY 1P9WA 4OK3A 4GDFA 4OKSA 4ERNA 4B6FA 2V54A 3Q7QA 2J0VA 3HR8A 1KSFX 2B7CA 1U81A 5D3MB 3PFIA 4YMWA 1W36C 4HAYA 3DO6A 3KUCA 1XMJA 4QOSA 4JLNA 3LDAA 3BORA 2WJIA 2H16A 221PA 2X19A 3HYTA 3J81k 1D8TA 3KKOA 1UM8A 3FKSA 4M1MA 1UAAA 1HEIA 1ELOA 1KI4A 5FBWB 4RFSA 2ZRDA 4PR0A 4HAVA 2GKSA 3KDSE 1MABA 1NL3A 3BK7A 1WP9A 3QPUA 3LBNA 4MRNA 2X77A 521PA 4BFUA 5BYJA 2J59A 4BFZA 2QAGC 4D4MA 4YMUA 5H68A 2AK2A 4NYMR 4WBSA 2DWQA 5JWHA 1DAIA 3VHLB 3WRXC 4GNKA 4ZO4A 3BH7A 1NKTA 3VMFA 1D2NA 2GAAA 1N6OA 2I1QA 3SYKA 4R7ZA 4Q48A 4CZ2A 1XTRA 4GMDA 1U90A 1VCOA 2YWEA 5FI1B 2OCYC 3V9PA 4C0AC 2NZ8A 1HH4A 4LJ8A 2VP2A 1Z47A 4Q1BA 5FTKA 421PA 2TMKA 4DB2A 4LDJA 1QG4A 4Q1DA 4HDOB 1FNNA 3GEHA 5LDDC 1MO4A 4LSGA 3GCGA 1CRPA 2CCKA 2OFWA 1E32A 4HYYA 4JSTA 5DI3B 1OHHD 3C16C 5JWRA 2WV9A 4A1FA 1KMHA 4PFSA 4ZKDA 4L15A 2QMHA 1MRNA 3SYNA 3ASYA 3X1XA 1EXMA 3HU1A 1OLOA 1I4DD 2WIAA 2QNRA 2OV2A 4JL5A 4W5WA 5CJPA 1WE2A 5KTYA 5FOVA 4O25A 1TUEA 4FCTA 1YR8A 3AF2A 5KSOA 2XOKD 3U60B 1S9HA 3EIQA 1GAJA 2F1HA 2R65A 2XB4A 3QF4B 4FW9A 2JATA 3EX7C 4CDGA 1II0A 5FOUA 2QG6A 2QAJA 2FPKA 2WSMA 2YVUA 2RHMA 3QPVA 2WHXA 3UG6A 5JSZA 2IC5A 3RS7A 2H92A 2O8BA 2G6BA 3TRFA 2OXCA 4DLUA 3PQCA 1G8FA 2O8CB 3L8YA 4NZYA 1UADA 1UKVY 3B1XA 1IN8A 3W8NA 4K8OA 4V0OA 3U6KA 1G8HA 2AN9A 3U7GA 4MUBA 1CJKC 3NKVA 3ZVRA 1YZUA 2OILA 3CUEF 4QGHA 2LCFA 3MAAC 1OHHA 5EP2A 5CYOA 2OLKA 1AS3A 2VSXA 3P1JA 4MGKR 1AGPA 2J0UA 2OSBA 1U0LA 3U61B 4DDTA 5AK0A 2GCNA 2W00A 3ZJYA 4BFWA 5JI2E 1AK2A 3IDQA 1A5TA 2E1RA 4PQYA 3SBEA 1W2GA 3BWDD 2JDID 4E5UA 1CP2A 4AYWA 4D2IA 2WVJA 2IYUA 1QZXA 3O47A 2HYIC 1J8MF 3FKQA 4DDUA 3S1AA 1XEXB 3ASZA 4CIDA 1JXOA 2V55B 1ONBA 2WKQA 3KKPA 3GLIA 3CWQA 2B6HA 3IPYA 1Z0KA 2ZI6A 1EK0A 2WWHA 2RGGA 3NBXX 3CF0A 4PO8A 4KFSA 4PZYA 3VU9A 2XX3A 4ZIRA 5ELXA 4TL7A 3DEFA 5A4JA 4WZ6A 4X8OA 1DAGA 2BV3A 1K5GA 1Y63A 2EFCB 1YZTA 1CRQA 2D2EA 2WKRA 2XNDD 3OEEA 2ZJAA 1KJYA 2ZYUX 4Q9HA 4D4JA 4TYNA 3IEVA 4PAQA 1NG1A 2RB4A 2GTPA 4MUAA 3I5XA 2QAGB 3AM1A 4TLAA 4BWYA 2FGKA 3BB3A 3CH5A 4I1OA 4OI0A 2ZR7A 4P33A 4P4SA 3T5DA 3PIRA 1J90A 3FDIA 1T5LA 3CX6A 5M04A 1DG1G 4JKYA 4JT2A 2PEYA 1NJGA 2REOA 2X2FA 1Z29A 2NPFA 2O8EA 4H1VA 2R9VA 1NMZA 2IK8A 3I62A 2NZJA 2ATVA 4MKGA 3LH5A 1SVSA 2FFHA 1RJ9B 1RYFA 4HLQB 4KVGA 4C0QC 3ZD7A 1KI6A 3GJ4A 1XTQA 2Q9AA 2VPPA 4D80A 1Z63A 1FMLA 3D31A 2IWHA 1RC8A 5SZJA 2ZS8A 3WMGA 2FE4A 1X8LA 3E5HA 4C9BA 1AN0A 4GZLA 1OSNA 2P65A 1NMYA 1GITA 2YOFA 3X1ZA 3PUYA 4A0RA 2H57A 5KPDA 1E0SA 2PX3A 1ZNZA 4O0MA 4C2TA 1US8A 2QPTA 3ZS8A 2RCNA 4D4LA 1EFUA 2W0MA 2ZVPX 5KNDA 3CF6R 3KB2A 2Q3HA 2NGRA 3PEYA 4URXR 4Q7LA 4ESHA 4KXFB 3VQTA 1S8FA 3EPHA 5J4YA 4DCUA 3IQXA 2PT7A 4EFLA 1N3BA 4M2LA 2DWOA 4M1KA 3FKSD 1KO4A 4TMWA 5H8WA 1TQDA 3QKSB 1EG7A 1G18A 3AP2A 2B21A 2ZRNA 1ZUHA 1VKJA 4NYJR 2XTMA 1E98A 4QG7A 2J0UB 4QM7A 3MLEA 2DBYA 5GVRA 1Q12A 1UKYA 1AKYA 2W2TA 1KO5A 4WW0A 4TYPA 3TW4A 1KNXA 2DYKA 4GMXA 1S4QA 3U3OA 3PJRA 3UG7A 3PV0A 1W4BA 3VR3A 1KGDA 1IXZA 3TGPA 2AWNA 2H8KA 4JLAA 3T61A 2JAQA 5BN4A 2CEAA 2PMKA 1P62B 3NBFA 3S1AB 4OQNA 1CLUA 1G291 2AXNA 2CE2X 1Q1ZA 3LXRA 4Q1AA 5TDHA 1SVWA 3GEIA 5DH9A 4CEIA 3PUWA 4Q4AB 1WCV1 5DIFA 3T15A 4EIWA 2ZM5A 3NXSA 3O8CA 4V0ME 4C7OA 4OHYA 4PHGA 4HZUA 1GOTA 1FMJA 1R7RA 1GG2A 4A4DA 1KDRA 4A6PA 5C4MA 4WAUA 4QBHA 2C2HA 4EPYA 1SXJE 5JMTA 4C0JA 3RLFA 4BRWA 4KAXA 2LKDA 4FD2A 3CLVA 1KI7A 3BERA 5CLQA 2ASEA 1SHKA 3TW8B 5AUNB 4PPGA 4Y0VA 5IK2A 2MSDB 3ONWA 1W4RA 3ECCA 5FUVA 1MH1A 2J0SA 5LB4A 1E9RA 2ZUCA 1ODFA 1SHZA 2KI5A 3B60A 2CVFA 4NKRA 3LO5A 2ZAOA 4KODA 3DMNA 1AKEA 2W58A 3Q3JB 1G5TA 3T35A 2HT1A 2YNMA 3TE6A 4HLDA 1OH6A 4N0EA 1HY3A 5JECA 2YWGA 4KLNA 1R4AA 2IW3A 2BM0A 2CCJA 3BJIC 3VR4A 4O2LA 2CCGA 2NG1A 5JS7A 2Z4RA 4CRWB 1FQJA 2J7PD 2CL0X 2FPMA 4Q02A 1M7BA 4M1TA 4QL3A 1G5RA 2FPLA 4D82A 3F5FA 2ODBA 4Q03A 4IVQA 3DM5A 3TJZA 4MRSA 1ESMA 2C77A 3FPAA 4EJSB 3U44A 4UXHA 1YR7A 4G1UC 3SHFA 3QVVA 1ANKA 4LPKA 2HEIA 3RRNA 2A78A 2O8EB 3X2SA 3Q8XB 3ZVLA 8OHMA 2HF9A 1QF9A 1N6KA 4ARZA 1SVLA 2B7BA 4V02A 4YXWA 4B32A 4TT3A 1VG9B 4RD0A 1NJFA 3IKJA 1T8UA 4E07A 5FTLA 3BE4A 2OUKA 2RGDA 3GJ8A 1M8PA 1W0KA 1G8GA 1EX6A 2ZRAA 1R0ZA 4RSGA 2YWHA 4XJXA 3RYTC 4Z54A 2OCBA 3VHXA 5L3VA 3T1QA 3TKLA 5J4HA 4A8JA 4FMDB 2O0HA 4Q4HA 4KFTA 4ASUA 5E3HA 4NP6A 1FTSA 1R0YA 1RFLA 1SXJD 3K9LA 4C7OB 1KJWA 4MITA 2DFKB 1XCPA 1RZ3A 4DIDA 4OQXA 3TMKA 1ZW6A 4EKDA 5KOYA 1D2EA 5JJIA 1XPRA 2K5UA 4IXMA 1CR2A 5FL7A 1OXSC 1QDEA 3LLMA 3T1TA 621PA 4R98A 2ZQ5A 5FI0B 4QJ4A 3BXZA 2NO1A 4WZBE 1E2IA 3BC1A 2C9YA 1P5ZB 4B71A 5KSYA 1G41A 4YXWD 2EWWA 2YHSA 3EA0A 4DKXA 2OXRA 4BFYA 2ERYA 1MV5A 3A1UA 2ZITA 5L8VA 3IQWA 1ZM3A 1W49A 2CJWA 1TAGA 2ZROA 3PCRB 1BYUA 1JECA 4MYHA 4LPSA 3ADKA 3P4XA 1OKKD 3X1WA 4BZPA 4P0TA 4OI2A 3NEJA 1E2NA 1IONA 2XZLA 1KDPA 1P6XA 2GILA 4GZMA 2WJVA 2KE5A 2J9RA 2ZSFA 3OFNA 2XXAB 2C8VA 4BRUA 1QHIA 4B3GA 4ARZB 4PO1A 2JA1A 5BXQC 5KDDA 2IYSA 1YZKA 1OB5A 4DZZA 2RGNC 3NG1A 4X8MA 4P4UA 2QP3A 1QHHA 3ND9A 3SE0A 4C3ZA 2V7QA 5AJYA 2G1KA 3EZ9A 4XSHA 5HKKA 5AUPB 2C95A 4YMVA 1G4UR 1NG9A 2Y8EA 1YR9A 2WWXA 2GEDA 4LYJA 4HLUC 2VF8A 3QF4A 2ZSDA 2BDTA 1G17A 3CRW1 4QHYA 3UANA 5HPYB 3UWOA 2YKGA 2ONJA 5FUYA 3G0HA 1T3LA 1QVRA 1VCNA 2ZYTX 4G5GA 4LBWA 1PVOA 1TF2A 3HPQA 3QG5A 4OJKA 3A6PC 3B1WA 1DO0A 2XJ4A 1AS2A 4U7DA 4C0KA 1WMSA 2P6UA 1Z0FA 1HQYE 3Q9LA 4YMTA 3B78A 2WMNB 4KVAA 2YZ2A 2ZRFA 1PLJA 5EQTA 4JLOA 1W44A 1Z6GA 2R6AA 1F2TA 1B23P 3K70B 4IEIA 4DIEA 5L3SB 2O8FA 3CRRA 2UZIR 4OQMA 1I2DA 4TLBA 1ZD1A 2FFBA 2W0SA 3AKYA 1I4TD 2JJ1D 2ZE7A 4JS0A 4JVMA 3W9YA 4AKHA 4IRUB 4RCZA 1D9XA 3DZDA 5KPJA 5HE9A 4TTQA 2MMCA 2R6GA 4WXPA 4DHEA 3BRWD 4P31A 4OBEA 5EXSA 2FSFA 3QXCA 3W5IA 4KSCA 3WYFA 2FDCA 1OPXA 1ZU5A 4QC2A 2ZU0C 3L0OA 1QHHB 5BN3A 2IS4A 1NSTA 3V00A 3Q72A 2HJGA 2ATXA 4D0GA 4DSNA 3QBTA 1OT3A 4OJQA 3NDBB 2XNDA 2EFHB 1Q3TA 1XPOA 2OM2A 1EWRA 4RZ3A 1KIMA 2HYDA 2YOHA 3KFVA 2V7QD 1OV4A 2WICA 3IHWA 3L43A 4Q00A 1GIAA 2QAGA 5IK2D 4F7WA 4B73A 1KOFA 3A36A 1OH8A 3C8UA 2ZI5A 1IY1A 4QGAA 4QGGA 5EUQB 1Z6YA 1WDTA 2W83A 4XIGS 1SKYB 5JZVA 1Q3HA 2ZRLA 2VEDA 3IBGA 4GBMA 1W1WA 1A82A 2P67A 3I4LA 1SKQA 4U00A 1OXVA 3CRQA 4URWR 1GL6A 1CJMA 2WWIA 1KI3A 1FW6A 4PQRA 2GHIA 2ONKA 3KFXA 4RD1A 5G3ZA 3CX7A 2Q9BA 5GJCA 1HV8A 2VQSA 4NCNA 3O8DA 3ZYCA 4AKIA 3WHLA 3WBKA 4CT5A 3FYHA 4LHZA 3G5UA 2P3SA 3R9WA 3AVVA 3WYGA 4FXPA 3U3MA 4DXAA 3UATA 4YDSA 2XNSA 4UJ5A 2V6IA 4LBZA 4PC3A 1IHUA 4NTZA 3OIWA 4RZXA 4RKFA 3U4QA 3FFAA 3KQKA 2GVDC 2PJRA 2ZE8A 2IYYA 2ZJZA 3KJIA 5FUXA 4NBSA 3UK6A 2V3CC 1N2CE 5EE9A 2ZSBA 4Q4HB 2ZIAA 1ZIPA 1FX0B 4KBFA 3WMEA 1G64A 4PC1A 3ICEA 3H2YA 3LNCA 5EP1A 4DRZA 2G0TA 1YKSA 2EW1A 1Z0AA 1COWD 3L8ZA 1E0KA 1HA3A 2BCGY 1W4CA 4AC9A 3SNHA 5C46F 1FFHA 2WWYA 2ANCA 4DSOA 1EWQA 2IS1A 3RSOA 2OO7A 2VHQA 4G0NA 3W3AA 1F2UA 4Q7MB 4LJ4A 4M1WA 2C78A 5JLJA 3THOA 3PEUA 5CDFA 4EFMA 1CKEA 3ZD6A 4JLVA 5DNYB 1E94E 5DISB 5CB8A 3IILA 4DUGD 4KU4A 1XJ0A 2MSCB 1NN3A 4H1UA 4GI7A 3VX4A 2FH5B 4B2LA 1ZC4A 3P27A 2GXAA 3VR2A 2PZGA 2QRNA 4O2RA 1RRCA 2VP4A 3AF1A 4XWOA 3LQRA 2V1UA 4O3MA 2I1VB 3R7WB 2FEMA 4Q19A 1F5NA 2DY1A 4D0NA 1ZJ6A 2BHRA 821PA 5FBVB 4CGZA 1E9FA 3FTQA 3EZFA 1FTNA 1XMIA 1EFRD 1JQLB 1VYVA 2QGNA 2B92A 2GEVA 3RS2A 2BMFA 5L3SA 1II8B 4J0QA 2Z4SA 3N5CA 4A92A 1Z2CA 3VAAA 4AKGA 4ON9A 3IIKA 1OIXA 2BMDA 2XSZA 3QF7A 2EQBA 2EFEB 5K8TA 1IY2A 4M9XA 2O0JA 5FPYA 4PPNA 1AQUA 4BE7B 2FN4A 3EZ6A 5FL3A 3QPWA 4TSFD 3U7EB 4P32A 2A5JA 4TL8A 2ODWA 1JR6A 3BAFA 2Q0HA 2V9PA 1KK2A 3G82C 5A0FA 1CIPA 1IAQA 2GZHA 2REXB 2F9LA 3RRMA 4EUNA 2IS2A 2OFXA 5FOSA 2SHKA 2JLRA 3NHAA 4HB2A 4HI0E 1C9KA 2ODEA 1G8YA 2J45A 4XTCS 4RVCA 2G88A 3UXMA 5BN5A 2CXXA 1GNRA 1KYIA 2P0EA 1LS1A 4JVNA 3LD9A 2ZUBA 2ZRIA 3CRMA 1Z6TA 2AFHE 2Q3FA 3H4MA 1IJEA 1Z0IA 1XTSA 3M4YA 4DEYA 4JBYA 5J47A 3LVRE 2WPDD 4OHWA 4Q5IA 4B47A 2WJJA 4EPTA 1V43A 2BWJA 1XD9A 2O8DA 1ZMXA 1E1QD 1X86B 4AYXA 1XMSA 2WJGA 3B8HA 5L3QB 2XGJA 2W6JA 1OB2A 2O8BB 1OIWA 1TX4B 2RGNA 5B58C 1SXJB 1DAHA 1D2MA 1DE0A 1W5SA 2LWIA 4E03A 3AVYA 1FOEB 1R8QA 5JS8A 4XOIA 1XTJA 2CLDX 3AQ4A 5F3WB 5GVSA 3AVPA 2XEXA 3OIUA 4RY2A 2PCLA 4AG5A 4FMCB 5JEEA 4DLSA 3TR5A 3QKRB 1KK0A 2PLRA 1SVOA 4TTRA 4IFBA 5FTNA 3K0EA 4EPXA 2IX3A 1W47A 2QTVB 4A2PA 4EQ6B 3L0IB 2CK3A 5JJKA 2CLSA 2CHGA 4UQOA 5TXGA 4AY2A 1N6RA 2ZRKA 4BLTA 2ZI9A 2FZ4A 3THYB 1JR3E 1E4VA 4HEJA 3A1TA 1J2JA 3QQ5A 2FEOA 2CHQA 3ZGXA 1GL7A 4IOJA 4DLRA 4LX0A 3U5ZB 1EFHA 3M0EA 4BECA 3SZRA 4WIAA 4JLDA 5FBRB 1G7TA 3CW2A 4KSBA 1Q22A 3AGPA 4C0HA 5CYPA 4FMCF 2ZU6A 3OZXA 1T0JB 3WP1B 1XEWX 1VIYA 2XTZA 2AFIE 2KBEA 1LW7A 1YVDA 1S2MA 4ILEA 1G7CA 1JNYA 2IWRA 1CR4A 1L4YA 4LHVA 3NBZC 3PENA 4ACBA 4MDEA 4QRHA 1DBSA 2NOAA 4XTRA 1Q21A 2CL6X 3N2EA 4LJ5A 1E6CA 4LWZA 2D4HA 1KSHA 3TQFA 1RW4A 2CL7X 1QRAA 2DHRA 4PC7A 5DO9A 3QENA 4IDPA 1MABB 2AHOA 2WZQA 2HUPA 1ZD9A 4DCTA 1KSJA 2DFLA 3RAPR 1S1MA 5JSZB 4KFRA 3B1YA 4ACAA 3CRVA 2PX0A 2WKPA 4AIIA 4B3DA 1AZTA 4ZDKA 4R2IA 1KI9A 1BH2A 4PC6A 2NO6A 3OF5A 1NY5A 1G16A 1UEIA 3DZ8A 3HJNA 4Q1FA 3TUIC 1ZRHA 5CM9C 4UNNA 2GJAA 2IXFA 3LAWA 2VYFA 3PXGA 3REGA 2V6JA 4X8LA 4B48A 2GRJA 4Q47A 4PPFA 3QNUA 3KZ1E 2NO9A 2BJWA 2VHCA 5JCZA 3CZPA 4FMDF 2RGBA 1Z5ZA 4M9SA 3DDCA 4II7A 5JRJA 1ESNA 3GFOA 4A15A 1XP8A 2CNWD 5DI3A 1AGRA 1J8YF 4PAOA 4EJSC 2BMJA 5AJWA 2QU8A 3D7MA 4ZCIA 1JALA 4FN5A 3GFPA 2VF7A 2C99A 4ZV4A 3MWYW 4A36A 1ZYUA 2QI9C 3FMOB 4PHTA 1D9ZA 2QA5A 4CEJB 4W9MC 3EWSA 1F2TB 4PC2A 4KBGA 1T5IA 1VIAA 4RJLA 3GLGE 3EPKA 3F8TA 4PHFA 1P2SA 4X8HA 1UEJA 3GD7A 3U4QB 4XH9B 1KTVA 2VP9A 4MYUA 2AX4A 1NY6A 3AP3A 2OT3B 4Q9KA 4OHZA 4HAZA 2GAOA 3LA6A 4YQFA 1N5KA 4U02A 1QHYA 2JGNA 5D3QA 2H5EA 4MGIR 2GF9A 4QBFA 1W0JD 2R8RA 2XZOA 4CT4B 4JKIA 4P4SB 4IDNA 4B74A 4R9UC 4JLKA 3W5JA 3GLGA 1E99A 4DB4A 1SQ5A 2BBTA 5DYGA 1UF9A 4CYMA 5JRZA 1L7VC 1W2HA 3A37A 4LK2A 4GFDA 3CONA 1F2UB 1BIFA 3EARA 4YC7A 3NHBA 1S1CA 4U5XA 4UNSA 3W90A 1W36D 1QG2A 4RKEA 4TMXA 3T06B 4LHYA 3TAHA 4IDOA 2FX3A 1R5NA 2KJQA 5D3MA 3E2IA 1R5BA 2V1XA 3GJ5A 1BMFD 2BBSA 2C03A 2WWGA 3C14C 5FOWA 1TL7C 4JLMA 3NDPA 4C0BA 2FMXA 5K8UA 4N3NA 5HZKA 2PMDA 1G1MA 1XXHA 3IGFA 2EFGA 1LF0A 2AKAB 3N2IA 5JCPA 1CR1A 3KQNA 3KKQA 1XDBA 4DSUA 3CNNA 2Q3MA 4QGFA 4IW3B 4KCGA 4ASUD 4DSTA 1F60A 1XF9A 3A1VA 1HUQA 4BQSA 2F1IA 4F93B 3VU9B 2IHBA 3SFVA 3OAAA 1XCMA 1M34E 4ZPXA 1XZPA 2OESA 1F6BA 1O87A 4B33A 1WRBA 2IYXA 4GOKA 3T1OA 1SVMA 3M6AA 4NONA 2AD5A 2QPOA 3R9XA 3VR6A 121PA 4TYWA 2W6ID 2IL1A 2H17A 1GNQA 3V4RA 2JEOA 4MQBA 5FPHA 2ODNA 4FCWA 3CNOA 4C2UA 1FP7A 1UKEA 1U8AA 2J41A 2VHUA 3AB3A 2YYZA 2RH5A 3C7KA 1U0JA 2C96A 2O8CA 2N42A 3P26A 3LW8A 4D6PA 1ZNYA 4XVRA 1OW3B 1KY3A 1Z83A 2P6NA 3MJRA 3FMIA 1HT1E 4KJZA 4BFTA 3C15C 1WF3A 3B2EA 4ZCLA 4HATA 2GZAA 2ZR0A 2RGCA 2PJZA 5GJVC 2GJ9A 1GZSA 1KK1A 1IN4A 4TMVA 4E09A 1BS1A 3BFVA 4XWKA 3H0KA 4XVUA 2GEUA 5IT5A 1MOZA 4M9ZA 2D3WA 3GLFA 1N6PA 1P4SA 4JLPA 1US8B 3AVTA 4HZUB 3VNUA 2QQEA 2VLIA 1ZVQA 3LBHA 4FI3C 4DT1B 3ICQB 4R2HA 2ORIA 1XEFA 2ZUDA 4I99A 4BUJA 4DCNA 1II9A 4F4JA 1Q0UA 3MWKA 4B44A 3NC0C 2IT1A 1R2QA 2FSHA 2JJ1A 2UVQA 3EA5A 3R7WA 1K8RA 3QXJA 4JT4A 2Z5FA 4ZDJA 3RS3A 2WJHA 4Q66C 2NO0A 3ADBA 3QIAA 5DE3A 1L8QA 2REBA 4EPVA 5E4FA 3AV0B 1F48A 4URVR 5CIQA 1RJ9A 4BPBA 2GJKA 1FQKA 1Y3AA 3AF0A 1G3IA 2GBLA 3NEYA 5C4GB 1G8PA 1R0WA 3LXXA 3K0FB 1CXZA 3QG1A 4HUQB 4MA4A 3SN6A 2AD1A 2JIZA 1RIFA 3T5GA 3P32A 1PUIA 4S2EA 3WBJA 3FOZA 4BGDA 2P5SA 2IBMA 1LS6A 2DB3A 2F1RA 3B82A 3IHLA 4A82A 2VP6A 1EFTA 2GDJA 1NVUQ 3MWJA 1HQCA 4LV6A 3VTKA 1G3MA 1W0JA 2JLYA 3RABA 1KHTA 2J3EA 1S3SA 2KWIA 4MH0R 1JEEA 1CR0A 3GJ0A 5SZHB 5H1YA 4B6EA 3QOFA 3I8XA 2BEJA 3V4FA 5FBQB 3SYLA 1EX7A 1KZ7B 2X2EA 2XXAA 5FOTA 2G1JA 1XB2A 4EFNA 2OBLA 1AQYA 2ZRCA 1NI3A 4NH0A 3QKRA 4PSKA 3KXLA 4IVRA 3ZS9A 3OESA 5E7IA 3CO5A 4GOXA 1E9EA 4JL6A 3BS4A 3CKLA 1JPNA 3CB4A 4DLTA 6Q21A 2ZSEA 3RWOA 3PR1A 1CEEA 3BBPA 4PTLA 3I8SA 2P2LA 1MKYA 1TU4A 3EZ2A 2GCPA 1JEDA 4LHXA 3OFND 5B57C 1SGWA 3L0SA 1TEXA 1S0UA 4BFXA 4DDVA 2R44A 2WAXA 1KO1A 2AXPA 1KY2A 2KSQA 2HLDA 3KKNA 3GLGB 2O0KA 1GRQA 4D26A 1PLLA 3A1WA 3GQBA 1GKIA 2CBZA 2C5LA 2AK3A 3ZDQA 4CEIB 3NTUA 1ZBDA 1N6IA 4BLOA 2NPIA 5KYKA 4G5OA 4Z8YA 2ZRJA 1FL9A 1GWNA 4PX9A 4Q1CA 2O8FB 4EPWA 1E9AA 1LFDB 1RKBA 2J0QA 1G20E 4L4UA 5GADl 1I4LD 5B2ZA 1E9BA 1WBBA 1ZCAA 4RCYA 1NNEA 3UWKA 5KDOA 4Q4JA 2RMKA 1TADA 5AUOB 3TNFA 1GKUB 1W46A 3HWSA 2OAP1 2C9CA 4A6XA 4BEBA 1HYQA 2FNAA 3QEOA 2A30A 1DEKA 1SXJA 2XITA 5CIWA 1GSIA 5EE1A 1WA5A 5AJZA 3HU3A 4TQ9A 3WRYC 1VYTA 4QHSA 1IOZA 4LBYA 3AKEA 2XJ9A 1E79D 1E9SA 2JLSA 3KQUA 1NBMD 3QKSA 4I1VA 3SJCA 3DHWC 5L3RA 4C0SA 2A2ZA 3EC2A 2B8TA 2NMVA 4JL8A 4RZ2A 1P61B 4DJTA 4QHTA 1BO6A 4PSAA 4M1OA 2DCUA 3RDPA 1U8ZA 3IO5A 3FWYA 4IOMA 2DPXA 1ZUNB 3TSWA 2IYZA 2YINC 3FMPB 4PZZA 3A4LA 5LD2B 3PUZA 5E7JA 1Z0JA 4TQAA 2AKYA 5SZKB 2FFAA 3VNVA 2JLUA 2QORA 1NIPA 1E1QA 2Z0MA 3PITA 4BLRA 1VYUA 5HZHA 3T1VA 3K9GA 3P20A 2QEQA 1W36B 2QUZA 2CDNA 1X1SA 4ZDWA 1W4AA 3NBYC 1IN5A 1IN6A 1CS4C 4HUQA 4IFEA 4NYMQ 4XD7A 2J46A 4LV5B 4N1AA 3RRYA 3WNCA 1DAFA 4LC1A 5BWMA 1JBKA 3U3RA 1KJZA 4JLJA 1VG8A 1T9HA 2E9SA 1MO5A 1NKSA 4WA7A 4A8JB 4PXAA 3ADCA 1JI0A 2IHYA 4Q4JB 2GBLC 4KYUA 4MYCA 5GJBA 2ZRHA 3VFDA 1L2TA 4EJSA 3UIEA 3U44B 1QHXA 4MGZR 3KKMA 2G3YA 1HE8B 5TB5A 3PUVA 1RVDA 3LQQA 4M8NE 4I1UA 2J7KA 3WMFA 5F9FA 1RE0A 2HCJB 3H84A 1W0KD 2GXSA 1A4RA 1YHNA 2PT5A 1YE8A 2O52A 3FFBA 3NC1C 3WP0A 3M1IA 4ESVA 2GESA 3E1SA 4LY6A 2DWPA 2CHVA 3KUDA 5DHFA 1AJEA 2GA8A 3D3QA 3WNDA 1EFRA 1WQ1R 3ZIAA 3OHMA 1KKLA 1XWIA 1ZM9A 2C9OA 4IKEA 4JBWA 3MMPA 4HLCA 2ZYWX 1QBKC 1OIVA 3C5HA 3ZZ0A 5EXPA 2CVHA 4L16A 2GK6A 1XD2B 1G3QA 3BGWA 3LX5A 2IF0A 3GLIE 2EYUA 4OI4A 1G3RA 1AIPA 4XWAA 4LYAA 2QE7A 1E2FA 2EWVA 3K0SA 3SQWA 5LPNA 2RGEA 3EXAA 2JCSA 4CF7A 1C4OA 2A5YB 4NCJA 1JAIA 1FZQA 2OLJA 3O8RA 4C30A 2GK7A 3L2OB 4V0LA 2OAQ1 3NH6A 1Z6XA 4GL2A 4UNRA 4TZ6A 1Q1QA 2ZE5A 2CJWB 3FHOA 2W6IA 2QMOA 3C5CA 4NYIR 1TQ4A 3BH0A 4HB0A 3QI2A 2QY9A 4QNMA 2EYQA 3IBYA 1P2UA 4PANA 4EPRA 1MR3F 1E2GA 4MKFA 2FU5C 2Q6TA 5ANRB 5AJXA 1N0WA 2QTHA 4BEJA 2JASA 2ZJ2A 1TMKA 1OE0A 2W2VA 4F4IA 5CK5A 3K0CA 1U9IC 1HT2E 3DPUA 2P6RA 5J4VA 4R71A 2QM8A 3EWAA 3PVSA 2A3RA 3H1TA 4Q7JB 4A2WA 2L0XA 3VKHA 2F43A 3IPXA 4NCKA 2AWOA 1DADA 1JAHA 2BCJQ 3AEZA 5TY0A 2FV8A 4WOPA 2F55A 1M7HA 2ZXUA 1ZM2A 4NHOA 3MG9A 4PQFA 2YJTD 2AR7A 2BM1A 2ZI4A 3SDZA 4FIDA 3BD9A 4HZIA 3TH5A 1KDOA 2F7SA 4LYHA 3PG5A 3RS4A 1JJVA 4OQLA 5J4LA 3BH6A 4RFSB 2P5TB 4HDCA 4BZXA 3AUXA 3OE7A 4BFSA 2R62A 5DLQC 2DFTA 4LHWA 1RRPA 4WVFA 1N5JA 3THWA 1KDTA 4G3XA 2J5XA 3I72A 1ZM4A 4URUR 1R0XA 4A0GA 2PEZA 1U9IA 1JPJA 3VR5A 1CF4A 4OYHA 4YMSA 1IN7A 2OBNA 4TT3D 5H70A 3TBKA 1NLZA 3BB1A 1CJTC 1T91A 1NLFA 4L5BA 2JJ2D 3EZ7A 2AL7A 4PHHA 4F4CA 2FSGA 1VMAA 4FMBB 4US1R 3OAAD 1XXHE 4LCBA 2NTYC 3CBQA 1TEVA 3ZLJA 1FUKA 4Q01A 2QSYA 1ZU4A 3BFKA 3IIMA 2BBWA 3HU2A 1QHNA 3I92A 1X8JA 4M4SA 1U2RA 2E87A 1G7RA 3K9NA 1E9CA 5TVKA 3SFZA 2GCOA 1JQJC 1FNMA 1GNPA 4AK9A 1UDWA 1CJVC 5FR2A 1N6HA 4P4TA 1E0JA 2QBYA 3L0PA 1CULC 2D7DA 4KLZA 3QXXA 3GJ6A 3QVUA 1KMQA 2VP5A 2LKCA 2A5DA 1IM2A 1H8HD 4JYBA 4AG6A 1T0HB 2Q21A 3ADDA 4QNRA 1NF3A 3MD0A 5JWOA 1QVAA 1JR3A 1TUIA 3D6TB 5KU1A 2G83A 1K6MA 1OKKA 3MFYA 4XD7D 2J1LA 1UPTA 2ORVA 4XVQA 4D0LB 2GWHA 2FF7A 4CEHA 3R9IA 5JI3E 4G5SA 4A8JC 2JLQA 4F92B 3GLHE 5CITA 3K0AA 1E4YA 1M2OB 2BOVA 5AUQA 2XOKA 2ZJBA 1HTWA 2WMOB 4YDHB 3QBVA 2ZPTX 5JHHB 2IXEA 2IUTA 4M1YA 1NBME 4M9QA 1WB9A 1UJ2A 3OEED 5BW8A 1U94A 3AH8A 2BEKA 3B13B 2WIBA 1EESA 4PSVA 3TVTA 2JJ2A 3DM9B 3PEVA 3K1JA 4KV9A 3OIVA 4E22A 2ZS7A 2F3RA 4TMKA 2OFOA 1N6LA 4V0NA 4Z8XA 3KJGA 4JJKA 3CWZA 3SJAA 3DKVA 5FPSA 4CEJA 3O8BA 2GZDA 3DKPA 5HCNA 721PA 2EFDB 2IYWA 5EZ6B 3REFA 1XD8A 5HKKD 3THWB 2VHTA 5KNBA 1II8A 1A7JA 1T3HA 1S3GA 2VL7A 3LFUA 1DG3A 3CPEA 4TL9A 5HCIA 4QKQA 4ZI2A 2O8DB 1Z28A 1XXHB 1JB1A 4YLGA 4PO9A 1ZCBA 4L8GA 3NIBA 4XSGA 3UPUA 3BB4A 1C1YA 2OCAA 3EC1A 2YC2C 3TVDA 1E9DA 1DOAA 1GRRA 4HAUA 4RD3A 3HR7A 4QBIA 3AVXA 5CLLA 3AVQA 1Z2AA 1FX0A 3B6EA 1S9DA 1VG1A 1DVRA 4LBVA 1GILA 2OG2A 3OE7D 5C18A 2BBOA 3U2QA 1YJ5A 1KK3A 1YZQA 3CR7A 1G7SA 4ZIRB 2ZETA 2J7PA 3B9QA 4W5HA 2QT0A 2RGXA 2GJ8A 3GJ7A 3THXA 4DLVA 2NQ2C 4B34A 1PLKA 2CE7A 1GVNB 2RKOA 3SR0A 1T8TA 2ECKA 2VRWA 3ZVNA 3PUXA 2VA8A 2D2FA 3EG5A 3B1ZA 3QXHA 1OFHA 5G40A 1VG0B 4HSEA 5L3QA 4ZI3A 3FHTA 3K0CC 3AVUA 1XCGB 5EE3A 3I32A 1OFIA 4NYJQ 4B76A 3LRPA 3GLIB 4WZAE 4M0LA 4NL4H 2JDIA 1KZGB 2R6CA 2VTKA 1NN1A 1TQ6A 3RRZA 2F1JA 3K0AB 2RAPA 1NRJB 3EPLA 4RD2A 2WWFA 2QMEA 2XZPA 5CB6A 4GSYA 3RWMB 3IEUA 4BLSA 4DDWA 4HLUA 3TUZC 1VHTA 4HB4A 1BKDR 1YZNA 4POAA 1XD2A 3IUYA 2JIZD 4DLYA 4A2QA 1P7CA 4CEHB 2GETA 1XTIA 4LGMA 1VDZA 1NIJA 5KSPA 3AKCA 4GT1A 1ZIOA 4OQFA 3TUJC 2BKUA 4TL6A 4DLZA 1X6VA 3GJ3A 3K70D 2QROA 3A4NA 2KB0A 3TLXA 1GP2A 3B5JA 1IY0A 1E2JA 3I61A 3CR8A 1E2PA 2PZEA 4B3BA 2F9MA 1MRSA 1D6JA 1LF5A 2PH1A 5LB2A 3GLFB 1FPMA 1PZNA 4QJ5A 4LJ7A 4TLDA 5AR1A 4Z1MD 1DAEA 4B3FX 3FGNA 1MO6A 4NCIA 4UJ3A 5TV2A 1NBMA 4DC9A 4OK6A 2QQ0A 3CH4B 2BIFA 5EP3A 3BIFA 1NVVQ 2WSSD 1COWA 1K5DA 4TSFA 5F9HA 2QSZA 2GXQA 5HTKA 2DFNA 3SJZA 2IUSA 5P21A 2FJUA 5JEDA 2XTNA 3CX8A 2PZFA 3T12A 2OCPA 2VHJA 4UXIA 1DELA 2HCBA 4W7SA 3UMSA 3JVUA 3I73A 2PBRA 4JBXA 4PPQA 2IEYA 1DO2A 1Z6AA 2A5GA 1JR3D 3C41J 2OBMA 1R5OA 2W2XA 1UBCA 2QGZA 4F38A 1G4AE 4ZKEA 4EDHA 2OZEA 2WBLC 3QKTA 4C0LA 4GP6A 1NP6A 2GJSA 3B9PA 1XTKA 3H86A 3QKUA 4Q18A 1P75A 4A9AA 2WOJA 5CDFE 1KI6B 4HDQB 2XAUA 3AVOA 3K53A 2ZS9A 4MYTA 3RVBA 1J99A 4F91B 1PV4A 3AF4A 2WTUA 2FA9A 4JIMA 4DUGA 2WM9B 4G5RA 3PEWA 2VH5R 3Q85A 1IXSB 5FTJA 1XBTA 4KO8A 1OJLA 3RANA 1TF5A 2H18A 4KI0A 2ZREA 4Q4AA 4QM6A 4B75A 1G5PA 4B2PA 1B0UA 1G9XA 4Q7KA 4DCVA 4AI6A 3GMTA 4AKEA 1UBGA 5EUMA 3WNBA 5TARA 1TF7A 2I4IA 3K70C 3UMFA 3GPLA 2IEZA 3HYRA 3WHKA 2UZ3A 1T4GA 2CLCX 1XEXA 3IO3A 5GJWC 1GM5A 5HR5A 4AD8A 5F2EA 3ZIAD 3MJHA 2F3TA 2ZRGA 4DT1A 4TN1A 4KHZA 2MSEB 5CJ2A 2QL6A 2BVNA 1NVXQ 5DSZA 5J5CA 5FL7D 5J4KA 2G0NA 2X8AA 2FFQA 3SJBA 4BLQA 4TMTA 3QY0A 1GRNA 1NN5A 3LW7A 4GPTA 1XFAA 2A7QA 2W6JD 1FUUA 1BYIA 1L4UA 3N70A 3W8RA 3EIEA 4UXJA 2HLDD 5LBIA 3R8FA 2ZR9A 3TR0A 1DTSA 5C1BA 1J70A 1G6HA 4EAQA 4ABYA 4TQUS 4B2IA 3LY5A 3K0FA 1H8ED 1Q1EA 2HXSA 3A1SA 3A8TA 3LWNA 2Z43A 5TMPA 2B8WA 4ITRC 2JLXA 1GKYA 2I3BA 1Z8FA 1OFUX 1XU4A 3FMFA 2ZRPA 4DLXA 1ZUIA 1SVKA 5CK4A 2UKDA 1ZC3A 3MRSA 2QZ4A 4GOJA 3RC8A 2EVWX 1VTKA 1SKYE 1LNZA 2ZANA 3WY9A 4TLEA 2ZSAA 3SS8A 2R6FA 3KJEA 1E3MA 1E2EA 2QTFA 4TYYA 4OHXA 1OXUA 4LJAA 5B64A 3I1FA 1UFQA 1Z0DA 2IF2A 1IBRA 3C4JA 4V0KA 5DHAA 2PLFA 2ZTSA 1V5WA 3EIHA 4IXNA 3W6NA 2BC9A 2ZJOA 1ETUA 2V4ZA 2A5FA 1HE1C 2OEPA 3GLHB 2GF0A 1X1RA 1NLYA 2F6RA 1DAMA 3K8YA 4L9SA 2FZLA 5K8LA 2KBFA 3RSLA 5KO2A 2IYRA 2VP0A 1S96A 1CU1A 1P60A 3JZMA 4GRAA 2ZEJA 5DGXA 1UBEA 4TMZA 1GDDA 3W6PA 2DR3A 1D5CA 3TK1A 2ZJ8A 1AM4D 3NWJA 3K09C 4TYQA 1NVVR 1XPUA 4C4PA 4M1SA 1NMXA 1JXMA 1E1RD 3NVAA 4TLCA 3JZAA 1N5IA 2HDNB 1Z06A 4RD4A 2G77B 2GCOB 1QHSA 1A1VA 1UBFA 1ZNWA 1BOFA 3WXMA 1H8HA 4Q21A 1W5TA 1ZINA 2QBYB 1MO3A 2D74A 5E95A 3KX2A 3LLUA 2PCJA 2VIIA 1OXXK 1AS0A 5DYIA 1RRFA 3CPJB 4AURA 3EW9A 4FINA 1M1YE 4LI0A 1DPFA 5FR1A 1YU9A 4I4LA 2HXYA 3JVVA 3SU8A 5JFGA 4GP7A 1FP6A 2N1BA 3SBDA 4QJ3A 4LV8B 3LBIA 4NDZA 2JLVA 3F3YA 5KSZA 3Q7PA 2ANBA 4IVPA 4LUCA 4FWIB 3KQLA 1GL9B 5KHOC 3NH9A 1KNQA 5BYKA 4KYIB 1Q44A 3UMRA 4KITB 5KUTA 3THXB 2HT6A 1P73A 2QM7A 2C98A 1CBUA 4LRWA 2ZJ5A 5BQ5A 4V03A 1MT0A 2WJYA 3CZQA 1ZD8A 2ORWA 3KL4A 2C04A 3W3ZB 2FOLA 1VCIA 2QN6A 1DS6A 1BMFA 3MSXA 1KKMA 3SQXA 3P4YA 1P3JA 4JSYA 4KFUA 2Z6VA 3A58B 4B35A 4B43A 5IF9A 3UKDA 2Z83A 3GJXC 4TZ0A 4OL0A 4RFVA 5IHPA 4LJYA 1WBDA 3QEJA 4K46A 3CPHA 2D7CA 3SI7A 1YR6A 4CW7A 3RHFA 5F98A 2VO1A 3Q5EA 2JLZA 1A2KC 2YOGA 2Q9CA 1GFIA 1P9NA 2FSIA 1M6NA 1VHLA 4N0DA 3EPJA 1LVGA 2GVZC 4UNPA 1P9RA 1R10A 3RNLA 1WXQA 5G41A 4HAWA 1RPZA 5AJVB 3AKDA 2H1LA 5IDVA 1GTVA 4MRVA 1GUAA 1Z08A 1XMVA 2X1VA 3CF2A 3I5YA 1OF1A 3ZVMA 3EAQA 4IOLA 3U3KA 2BKEA 2IA5A 3AF3A 4MKIA 2ZRBA 4IDHA 2R2AA 2H7VA 4RZUA 1U98A 3X1YA 4LOAA 3BFXA 4B3XA 5EZ5A 4Z51A 3U6BA 4ZDIA 4RD6A 1E2LA 2MMGA 2QP4A 5JJLA 4AWXA 2FWRA 3EASA 4BZQA 3CIOA 1N0UA 2D06A 4D25A 1LTQA 1LV7A 3OEHA 4MDFA 2HJVA 4DCSA 1F3OA 3TIFA 2ZAMA 5EXTA 3W34A 4DWJA 1XRJA 5JBQA 4US0R 3HDTA 1SXJC 3TSOA 1XJQA 2N46A 1AA9A 2OHFA 2GNOA 3B85A 4JLBA 4URYR 4DVGA 2XB2A 2O5VA 1E2QA 1NN0A 3QUSA 1EGAA 2F43B 4JYCA 2RGAA 4CVNA 3A4MA 5C2JB 1OFTA 5CM8B 3F0TA 1XZQA 4JVSB 5EXXA 3GP8A 5FPKA 4QXAA 4HUTA 4I81A 1KI2A 2HF8A 5DI9A 1AZSC 4IJMA 2QRZA 4LJ6A 3U3JA 4QFMA 3KQHA 4TTPA 2IYLD 1YQTA 2ZI7A 1E0AA 4MGYR 1TQ2A 1KMHB 2IYTA 4Y0AA 5FUWA 1E1RA 5DN6D 2QT1A 4LC0A 2NO7A 4NMMA 2ZJYA 1Z3IX 2JJ8A 1DARA 3E70C 3R20A 4DBLC 4NCHA 5FFMA 3MGCA 4BLPA 1G6OA 3U7FB 3K9HA 3OEHD 4L9WA 4A0FA 3KTAB 1ZM7A 2R6DA 3ZH9B 2CNWA 5A5GA 1KAGA 2D62A 3HP1A 1KI1A 1E96A 3FB4A 4IHQA 4Q4LA 4S35A 2IUUA 4URZR 2ZE6A 3LV8A 1P2VA 4G5QA 5J40A 2QP9X 3VKGA 3QSYA 3X1DA 4TWZA 1SVIA 1SULA 5IRCD 2CK3D 2VBCA 1R8SA 1YRBA 2EU8A 1E69A 4JVLA 3ZQ6A 2IXGA 1YZGA 1VPLA 1E2HA 4LZZA 3KJHA 1VCMA 3LX8A 5AWFC 3SHWA 1NSFA 1X8KA 3D8BA 4PAMA 4P3YA 1KAOA 3TSZA 1M74A 3QJYA 1NVWQ 4Q1EA 3SOPA 2VSOA 3ZQJA 5B30A 1E79A 2V8OA 5JHGB 1U99A 3CM0A 3MWLA 3SEAA 1OYYA 3FE2A 1W48A 1YRAA 3MUFA 1ZNXA 3ETLA 4Q9LA 5G3YA 1KSGA 3WYAA 2QE7D 3THYA 3KB1A 3DMDA 3DL0A
chains in the Genus database with same CATH superfamily
4WNAA 4II3A 4QTTB 1T6NA 3LT1A 2AZ4A 5KDLA 1OYWA 8AT1A 3FRHA 5CA1A 3KSMA 3TPCA 1FXUA 2QTWB 3FPCA 1GDHA 2HGZA 3REQB 1C9DB 1EK6A 4GGMX 3T7SA 3FUXA 3BMXA 4HTFB 4YLEA 3OIYA 3SDSA 4WJKB 3VJRA 3SF0A 5A5DA 1OMOA 2C4TA 2YIDA 1P74A 1J0BA 3H5TA 1Y7PA 4I9GA 5KYXA 2WWWA 1KPIA 4WX2B 4YP6A 4Q6BA 1E6EA 1GTSA 1AK1A 3DBOB 3MJCA 2BLNA 3VKUA 5HS6A 4IDAA 3SR4A 3SX2A 1Z88A 5EJEA 2ZYVX 4AMZA 4OSEA 3U1TA 1OH5A 1QP0A 2AA3A 1N4AA 2R66A 1IQPA 2VDOB 1R4MB 3DW1X 1NJ6A 5JD5A 1ORVA 4HDRB 5EJ6A 1XNJA 2VNIA 1E2KA 1AZLA 3PTLA 1BGWA 1E1NA 5IUNC 3DTVB 1F38A 1ORRA 4M3NA 1EMDA 2YC4C 1BX3A 3QE0A 4CEJB 4O08A 1J7KA 1M8GA 2WSSA 2ZIXB 1Q1BA 1VLQA 3AUYA 1LU9A 4LQDA 1Q50A 1KI8A 1R6TA 2XUIA 3MELA 1W581 4RKRA 4BTVA 1OLSB 4E32A 4LEIA 4UKDA 4UNQA 3V4LA 5JRDS 4MV9A 4HC4A 4G5FA 1Z68A 3SVTA 3MTQA 3EJ6A 4HQNA 4DXDA 2KQUA 3N7TA 4R9NA 1UH5A 1VJCA 1Q7BA 3RS0A 2WVHA 2WMYA 1U8YA 1I7PA 2BMEA 3U81A 3EW7A 1JHMA 1J9ZA 3N0VA 4KE7A 5A02A 5AI8A 1DQZA 3PTZA 1EQ2A 1IRIA 5LYJA 1JH9A 3GEEA 5CA0A 4Z7QB 1TXGA 3IRVA 2QXUA 2WQ6A 4QUIA 1P44A 3PWZA 1M54A 3CG0A 4IEEA 4QA9A 1FU8A 3H5NA 3GLUA 1RHRA 3A1EA 3DVSX 3EXHA 2HCTA 2V7BA 3HCCA 3IIEA 5KOHA 1VXRA 1N0VC 3CNLA 5CTAA 1MX3A 5DVZA 1X1EA 3PNQA 3R8CA 3VR1A 1QTRA 1PUJA 5MF6A 1SEPA 5CJJA 5IJ9A 1PTJC 2FQQA 1LK5A 1PT5A 2BFFA 3BVPA 4K26A 5JCOC 1XMXA 2JLWA 4NBTA 4Q1VA 3T3DA 2FGJA 1XVUA 4PX2A 4W8OA 2IPNA 3NFRA 2FG5A 4F6LA 3A3OA 3R5TA 4L5YA 5EWMA 3KCQA 3HFJA 1QMGA 2WAYA 1J25A 2F3SA 2PGIA 1Q74A 3T4PA 2QW8A 3Q7RA 2JJQA 3UV7A 4DG9A 1W5AA 4L3VA 1YZLA 3TO5A 3QTTA 2FUG6 3AB7A 4W5JA 1C3XA 1Q0LA 3CKMA 4PVDA 3RS5A 4B3CA 3LUAA 2NU9B 1V1MA 4TOIA 2CJYA 5FPTA 3AW8A 3WLKX 1UKZA 4NU0A 4DLWA 3IUSA 5KKCA 1K86A 1KJ9A 2ZRMA 1N8SA 5HE8A 2CMKA 3FHCB 4MA5A 4WFIA 2LP4Y 5IH3A 1RP7A 2G9NA 4L4SA 1CHDA 1P91A 1G42A 3HCRA 4RSRA 4RWEA 4TVOA 3V32A 1E2MA 3T1NA 4BWVA 1EFCA 4DR1B 4L8YA 5LIRA 3IQZA 3LVQE 5CH3A 4US2R 1AU9A 3RBAA 4CMEA 1CE8B 5BSGA 2JI9A 2NVOA 5EKSA 3IQGX 5B3AA 3RIMA 3G2MA 4G07A 2BE9A 5DBOA 2YIVX 5D5QA 5FTMA 5E2IA 5B1YA 5COAA 5BWLA 2IOFA 2XSZD 3B5EA 3HPRA 4XGKA 4UCXA 1CNFA 1PO7A 2LUOA 4DFDA 4IXTA 3FHLA 4B8ZA 2Q41A 3IOMA 3MGKA 5UKDA 1LSSA 2WOOA 3U40A 1SG6A 1P9WA 4TKVA 3VYTB 2V54A 1YRQA 2X9QA 5F76A 2J0VA 3HR8A 1KSFX 3NBQA 4XEHA 2ZJ4A 1E5LA 2B7CA 1U81A 2WDZA 1U8TA 3HCOA 1ZH0A 3QUBA 5DLDA 1Y4DE 4YMWA 1W36C 4YFVA 1WMDA 1GV0A 3N5KA 4G8BA 1BH6A 3HB5X 4OSPA 1AX9A 1XMJA 3UT0A 1E62A 4N8SA 4BCBA 4HWRA 4WCFA 4FHFA 1RIIA 1CUEA 3H75A 1QIGA 3TG8A 1UMBA 3L4KA 1OBHA 5ICSA 2F4VB 1T5OA 5DBIA 2JIMA 4DR6B 4JB0A 3FTPA 1F17A 2JLCA 4BV8A 1J0XO 4BKUA 4CG1A 1UAAA 1ELOA 4KRYA 4R16A 2CB0A 1Q0SA 5IVPA 4RFSA 3GNSA 2BCEA 4PR0A 2GKSA 2X9VA 1WP9A 4KR0A 3LBNA 1JVSA 2NU7A 5BYJA 3I37X 1HRKA 2NUBA 4M46A 4WBSA 1J49A 3ZWNA 1QO0A 4ZO4A 1L7OA 3BH7A 2LXNA 1Y6QA 1CF9A 1HLPA 1NKTA 5DGDA 1T9GR 4DLPA 3VMFA 4JJ7A 3UHFA 1NTOA 3MTBA 1R4MA 2G7MC 2OYCA 3ZWBA 4C4TA 5KYVA 4Q48A 1ADFA 4HX2A 2J9XB 2OTCA 4ZA2A 5BT9A 1Q2UA 4JP8A 3V9PA 4C0AC 1HH4A 3E3AA 1Z47A 2QJOA 2WQZA 3G1UA 2VZ9A 4PX3A 4BQQA 1QMPA 2HA5A 3FSGD 4LDJA 1DAPA 4Q1DA 1WXEA 4JI5B 1FNNA 1MJNA 1H2FA 1JQBA 1OV6A 3B51X 4LSGA 4K8RB 5IARA 4GGPA 2X2OA 4HYYA 4MICA 3AIKA 4UMEA 5JWRA 2IZ0A 5ALWA 3TZKA 3B8EA 5EVCA 1T4DA 2QV0A 2WV9A 1KMHA 4FB5A 1SC9A 1L7EA 2QMHA 5EMJA 2BTEA 2X15A 4ECEA 4YDRA 5ECGC 5E9WA 3CZ5A 4MHSA 1EX1A 2Q45A 3JYNA 4P3PA 2GCEA 5AW7A 3ESXA 4JL5A 4W5WA 4H4EA 5CJPA 3T3HA 1QV7A 1WE2A 4J43A 2Y9MB 1ILWA 1YS6A 1CWUA 5FOVA 1TO2E 3ZX5A 5KTYA 1TUEA 3AF2A 4WY2A 5AVJA 3BGOS 4FXOA 3V8VA 5T6BA 2Z95A 1O4WA 5TNXA 1FFXB 2F1HA 2R65A 2GPNA 2QRVA 2HTEA 2Q4DA 4G8JA 1ODCA 2CKMA 2JATA 5JV5A 1IHYA 1ZA1A 4GECA 1MOPA 2O2CA 1JT9A 2PIDA 2QAJA 2QG6A 3D6UA 3PQFA 3S7TA 3UG6A 2WHXA 2E6UX 2CFRA 2PXHA 1FFSA 1L8LA 2NXCA 3MT7A 3VVBA 3VZSA 5IFKA 3AHJA 5C35A 4BY9E 2AC2A 3C6XA 1RBMA 3GVXA 1VE3A 3PYMA 4ID9A 1Y3IA 4MWOA 3P9IA 5JQGF 4HDAA 1UANA 5E4JA 3B1XA 2P2DA 1ZX1A 3G2KA 3LP6A 4IZOA 4ZCTA 3VI3B 3PEEA 3NGXA 5KNBH 1YS4A 3V2IA 5AMXA 4K8OA 4LECA 2PN1A 1G8HA 4FYXA 1TJ4A 1CJKC 3ZVRA 4E88A 1M2OA 2ODPA 4M37A 5JDCC 5CD1A 1T3ZA 3I53A 2ORED 2HF2A 3HNOA 3AF6A 4WZAB 3WLEA 1CQPA 1AS3A 1VGRA 2VSXA 3P1JA 2OSBA 4LDPA 4MS4A 4INAA 4PPYA 4W9NA 2FWAA 4X6LA 5AK0A 2GCNA 3MJ4A 3Q2OA 4LZNA 3ZJYA 4BFWA 4JXJA 1AK2A 4BP9A 1GFWA 5TE9A 5LUBA 4U2FA 3ZDCA 3N05A 1J0DA 1EXNA 4QUKA 3BWDD 1RAHA 4LF7B 1XVTA 3OD5A 4M0KA 3NDRA 4AYWA 4D2IA 1PF7E 3T1HB 2GDZA 2RGYA 4LXQA 2VSNA 1X42A 3I6MA 4G9BA 1JXOA 4UEQA 4A16A 2WKQA 1E4EA 2XUFA 3LA8A 5LOVF 3IPYA 1Z0KA 1UJMA 1QLJA 2NXWA 3PVCA 1GO2A 4HRYA 4DA6A 1EK0A 4RPLA 5F7JA 4B4VA 5IP5A 5HS4A 4ZVKA 1PEAA 2GARA 1ZXXA 2C2KA 2XX3A 3TW0A 3VGPA 4TL7A 1AXEA 5IPFA 5A4JA 4J3FA 3WYBA 4C1BA 5BQ3A 1DAGA 1X7WB 1K5GA 3ZQ6A 2YZ7A 3CVXA 3OEEA 3IEVA 2IUEA 1AO0A 1NG1A 1ORDA 3QJ5A 4MUAA 4Q93A 3WOVA 1IZYA 2QAGB 4JA0A 3HKDA 1DI0A 3J80A 3ZG6A 3CH5A 4I1OA 4DHWA 3LKBA 4KYTA 2ZR7A 1U31A 2ZFUA 3UC9A 3UV6A 1JG7A 4YV2A 2XMGA 5WRFA 4XI9A 1LD3A 5IDQA 4CQMD 5M04A 3CX6A 1OI4A 4R4JA 4JKYA 1X1CA 4WLVA 5AW5A 4DADA 4NDNE 4YO8A 3RJ9A 3TRDA 2NNLD 5DXFA 4H1VA 4KQIA 2IK8A 1YA8A 3I62A 1UOOA 5I7UA 3FI0A 3N7UA 2ATVA 1KJJA 2FFHA 2HH9A 2P9EA 2WA1A 3NV9A 1FF9A 2VJNA 4HLQB 4RVUA 5FFFA 1XTQA 3WV4A 4KMOA 4OFXA 4DILA 5FQNA 1DWQA 3D8TA 1Z63A 4MQEB 2PJDA 4U7TB 3EXFA 1QKIA 4RS3A 1FMTA 5JS2A 2P4HX 2Q49A 3X1MA 1VL1A 2R7KA 3WMGA 2IHNA 1T10A 2FE4A 4C9BA 1P5FA 1JHZA 2E55A 1PWYE 1K3FA 4FIZA 4G0WA 1UJ5A 3GRKA 1NMYA 1N0IA 1LI5A 2P79A 3RV4A 4UEKA 1AHHA 1Y3FE 2H0QA 5MFZA 4ED9A 5IU6A 1E0SA 3Q0EA 1ZNZA 2F67A 3SHOA 1XL1A 3G5LA 3JVDA 1X7ZA 4D4LA 5LLDA 1EFUA 1EVIA 2GTHA 2ZVPX 4W9RA 4ZI7F 3CF6R 3DS8A 3E1GA 3KB2A 4Z6KA 2B94A 2Q3HA 2CMFA 3PEYA 2IPMA 4YS6A 1T6BY 3OICA 1NW5A 5CVEA 1VP9A 3QW4B 4KXFB 3VQTA 3TD9A 2Q3EA 3TRKA 3ENQA 1J0EA 2XYPA 4KGZA 3EPHA 1P1CA 4OD0A 4DCUA 3IQXA 5LKRA 1YBVA 4JGIA 1UEXC 4WRRA 3K1YA 1J00A 3FKSD 1KO4A 2BFEB 4M1KA 4QDTA 4X65B 1AV6A 3WJ1A 4MTLA 1EG7A 4R2JA 3LI2A 4HG2A 2QE6A 3N6RA 3U7IA 2XTMA 2Z4TA 2QL5A 2JD1A 5KTKA 3GRPA 3MLEA 1TLFA 3ZZMA 1UKYA 2CYCA 2W2TA 1MAWA 3K05A 4FT4A 1K2WA 4LNHA 2GBCA 4QYWA 3GYBA 3HBNA 4LGCA 1BX1A 1ODJA 3MWGA 3ZTYA 5LP6F 4MQ5A 1XMQB 3L46A 1QP8A 3WMXA 4JLSA 3PJRA 4JUAA 3E9NA 2OMKA 3LUKA 1KGDA 5SYAA 1D2GA 1IXZA 3TGPA 2XB2A 3BGIA 4JXZA 4BLWA 1E5DA 2CEAA 2PMKA 1P62B 4GOLD 4UM8B 1TPYA 3K5WA 1CLUA 1UKCA 4WNIA 1G291 1GA1A 1Z5PA 1FYFA 2AXNA 1N9KA 2MINB 3DAGA 1Q1ZA 4LOIA 4OATA 4FGLA 1JHOA 5K6AC 1GGHA 3EEYA 2C1XA 1NWCA 3PUWA 4L78A 1HR0B 1IM5A 3FVVA 3HU5A 5DIFA 3RGWS 2ZUFA 4MKZA 1Z39A 3CF4G 4NAVA 9MHTA 3F8WA 4PHGA 4OHYA 1GOTA 2F3PA 1R7RA 3GDWA 1KDRA 1ZCZA 3GGJA 1PW5A 4WDQA 4WAUA 4QBHA 1KEEB 3WA6A 2VWGA 3PJEA 5AFSA 4C0JA 3ZHSA 2I4TA 3RLFA 1I0LA 3ZV3A 1NOKA 1S2LA 4WKGA 1JDUA 5FA5A 1IAVA 2C2XA 3BHMA 3EVCA 2Q4OA 3RLIA 4XGQA 5ECDA 5CLQA 1SHKA 1VJ1A 3GYGA 1ARZA 2FMIA 2M2IA 3VAZA 1V41E 5JQGB 5IK2A 4Y0VA 1E3SA 3CEMA 3UJBA 1DLIA 1WXHA 1F06A 3AHDA 4FLFA 4NZNA 3ZR4B 2ZUCA 1PI3A 1ODFA 2RHHA 4NKRA 3FNHA 1LLDA 1AUOA 2N9UA 1MEEA 2ZAOA 3KD2A 4FYMA 3E8MA 2ADFA 4KODA 1PG5A 4F1WA 2IOFK 2AB0A 2W58A 5JVDB 1CG6A 1G5TA 1Z0SA 3S28A 1EQUA 5U1PA 1U02A 4HNVA 2HT1A 3TE6A 3RTEA 1ZDMA 4ZFNA 4MPDA 3I09A 3MMZA 3CXRA 1J07A 1CRWG 2RBEA 5ER9A 1R4AA 4UQPA 4I5IA 3BJIC 2GK4A 2CCGA 5JS7A 2NV6A 2J7PD 2V6FA 3GEDA 4ZK6A 4KUEA 3O2NA 1JGTA 1ORTA 1G5RA 5CVVA 3LGSA 1JG6A 2OVBA 3ETCA 3FETA 5C1IA 5HF6A 4JI6B 3IH5A 1KOLA 3TINA 4IVQA 3DM5A 3FRIA 2NUTB 1QQAA 5IH7A 1DRJA 1GD1O 4RMHA 1HT0A 2OCXA 3EGOA 1CFJA 2Q3LA 3WLAA 1J1IA 4G1UC 4EKNB 3ZW7A 4QEKA 1C7IA 3PIIA 2HEIA 3G23A 4I14A 2VN8A 4LJLA 3X2SA 4AO7A 1NRWA 2F48A 3ZVLA 3TIXB 3FDJA 1FPQA 1Z5GA 3PHIA 3QPCA 1KH1A 4V02A 4XXHA 3NETA 2JRLA 5CT4A 3OJWA 1XZIA 3IKJA 1T8UA 3DWGA 4E07A 5FTLA 3IE1A 2RGDA 3LUGA 4MHTA 1W0KA 3PKZA 3UWDA 4FUTA 2YWHA 4GLFA 3LE8A 1PFVA 2WU0A 2IYEA 3RG2A 3NYRA 3CGWA 4BO3A 1IVYA 1GQFA 3FY4A 1F9EA 5TF0A 3ACCA 1SBTA 2W90A 4OFWA 2I7TA 3IT1A 3RC7A 3RFCA 3T9AA 3TCNA 3MT0A 1RWWA 3V97A 4MITA 4DR3B 4F71A 3H9CA 3OURA 2XUHA 1RZ3A 1EKXA 4OQXA 3TMKA 4EKDA 3WHPA 2Y93A 1N7GA 3LLVA 2AX3A 3PE4A 3DBRB 3UA3A 3TB6A 4C08A 4IXMA 1CR2A 2HSGA 1QOPB 1TMYA 1ES9A 1X7DA 2QN7A 4GGOA 2XUGA 2X0IA 4CMBA 1E2IA 4FYIA 3GAMA 2C9YA 2XCOA 4BEVA 4EF5A 2JW5A 4EDFA 1BE0A 3CS3A 1JSRA 4H08A 1G41A 3ORQA 5DTEA 1DJNA 2VPZA 3C1TA 2QVYX 3K7EA 2LZ0A 1O03A 5I9MA 5DHPA 1H1LA 3EA0A 3HA5A 3LUPA 4BFYA 3WV5A 1ZRNA 3OJ0A 1MV5A 2R87A 1SHJA 3I3OA 4UC0A 5L8VA 1EUZA 5ICEA 1ZM3A 1W49A 2ZROA 3PCRB 4MYHA 3UJ9A 1QZUA 1ZKMA 3I9FA 3KOZA 4LPSA 4Z9BA 2XZDA 3UJDA 4EG7A 2QTAA 3KKZA 5BQPA 2A1TR 1CUHA 1KIFA 3D43A 4H3KB 1P19A 2HV9A 3CCBA 3OZVA 4DA8A 4P0TA 2YVQA 4OI2A 1TYBE 1IONA 2NNWB 3HLKA 5DNUA 1U7DA 5I51A 4OYYA 1LH0A 1X7ZB 2FUKA 1QYVA 3E58A 2JIOA 3M89A 3N74A 3R5FA 4B6OA 4BAZA 4ARZB 2P78A 5KDDA 4RF4A 2IYSA 5I6DA 1KYTA 4DZZA 4AQDA 3GA0A 1ZGBA 1QHHA 1E9VA 3JPWA 4C3ZA 3NOQA 3D8SA 1NXOA 3EZ9A 2V9ZA 3KOOA 5ICMA 3EQ2A 3L8GA 3PRHA 1L6IA 1NG9A 1JG2A 2R5NA 2JBAA 1KY4A 2Y8EA 3MJFA 2GEDA 3N0RA 2B61A 4HLUC 1INLA 2VDWA 1CDEA 2ZSDA 3UANA 4QHYA 4JASB 4RGVA 3KYDA 3OFJA 4G89A 4DUZB 3BA1A 3OZRA 4NFHA 4PGMA 1J09A 3NJ8A 4DJFC 1YQQA 1HDOA 3G0HA 2ZYTX 2B98A 5C7YA 3IFSA 4TWAA 4GVXA 4F04A 1YE5A 3ER9A 3QSGA 2EKPA 1EH5A 4R2XA 4D41A 4QLOA 1T2VA 2G8LA 4E14A 4M83A 1DO0A 2YZGA 4B4KA 3DOCA 5A4IS 3H8WA 4UNIA 1WMSA 2B25A 3FCYA 7GPBA 1T2AA 1TJ3A 5T7BA 5EL0A 3WLQA 3QX8A 1C9NA 3UA4A 3BQNB 1PLJA 3EQ7A 3GQVA 4JLOA 3E27A 4F3RA 4CCYB 1GEGA 1H1DA 4P53A 3LHFA 1ICEA 2Q4TA 3C7AA 4EHIA 4ZTZB 1B23P 3Q12A 1NW7A 2AYZA 4CWAA 3K70B 2BDUA 3ZGZA 1GZ3A 2G07A 1NHGA 4RTRA 4OQMA 1ENZA 4TKUA 2ZIVB 4AS1A 1FVFA 3AHEA 2UV8A 4XIFA 3AKYA 5TGTA 1I4TD 2IKQA 1T2NA 2ZQZA 3RB8A 3VR5H 4JELA 3IA7A 4P98A 3N1UA 3W9YA 4IRUB 2Z5GA 3WNVA 5HE9A 4DHEA 2XDYA 1HFWA 1LPBB 1FDSA 3BRWD 3RYFB 4Q3CA 1ABEA 5DIZA 3QXCA 1LDMA 1XNRB 2FW7A 3T9DA 2FETA 3L0OA 1PBNA 1ODSA 1QHHB 2FQXA 2RKWA 1P5RA 3DAHA 3Q72A 3GPBA 3E9EA 2VYNA 4JEMA 3S0JA 3SSOA 3C6BA 4OJQA 2XNDA 1JQ3A 4DQDA 1MGPA 2HU2A 9GPBA 1HE3A 1Q3TA 5LIPA 1C30B 1XZGA 1XPOA 1UWCA 4GPBA 2QR2A 2VDPB 2MU1A 3KFVA 2V7QD 4MI9A 4S1WA 1GIAA 1RI2A 4Z7OB 3LP8A 5G0SA 3A36A 4LQ4A 4DJDC 5CXUA 3LJKA 2ZI5A 3GOQA 4QGAA 1WO8A 1XQYA 2W83A 4XIGS 2J4DA 3DZFA 4WK2B 1SKYB 2QUIA 1VL8A 4IGKA 4C2BA 1XL0A 2CNBA 5JZVA 5BVHB 1DJOA 2BFAA 2OQ2A 3I4LA 2XUQA 4NXMB 1U3CA 1G8KA 1P4AA 5FQOA 3UJHA 4Y2QA 3ZTWA 4CIYA 5LZ9A 1RXUA 3GN1A 3DMHA 2X8JA 2DJIA 2DY0A 1QAMA 4RD1A 1NBHA 2J07A 2XYRA 4HTFA 4CFZA 3KETA 1AG9A 3FROA 3CX7A 3AY7A 4ZOLA 2Q9BA 3VZRA 4FW8A 1MHPA 1TUGA 3NB0A 3UXYA 4C29A 1M76A 1TTPB 1WEKA 3HBAA 1XNQB 1IBKB 2VTBA 1J1UA 4YJ2B 3QEMB 4FXPA 1YD7A 4R1NA 2W6OA 3WQBA 1A4XA 2XNSA 2H06A 2Q1TA 4LK3A 2QN1A 2WTBA 5E7QA 5AXBA 5AM1A 4PC3A 5CA0F 1JP7A 4HNSA 4M89A 1DNPA 1IHUA 4NTZA 4RIGA 4RZXA 3WA7A 1KQGA 4LRXA 2PJRA 2FN9A 1VMEA 1WHSA 5TX7A 4CQMA 1N2CE 3LDHA 4HQOA 1LQUA 1P8AA 4M7OA 3ENZA 4KBFA 2WIGA 5LZ5A 1BVRA 1KPHA 4FE7A 1K68A 1Q95A 3BTVA 3H2YA 1QCDA 2XE7A 1SZJG 4DRZA 1XUOA 3W1WA 2G0TA 1TIKA 1Z0AA 5B7PA 1HA3A 1PHRA 3KPUA 4JI4B 2GN4A 1IHXA 4GF5A 1PD0A 2H08A 2WKWA 5KJCA 4MULA 4AC9A 4MQ6A 3M6FA 4F4HA 2VT3A 5FB3A 4B0PA 1FUIA 4DSOA 1EWQA 2HKIA 5MFPA 2IS1A 2VHQA 3PC8A 1E1MA 3OSZA 1F2UA 3U7JA 4LJ4A 4M1WA 2O0LA 4MCJA 5EJMA 3E8SA 1DC7A 4WNAB 1ZHHA 1WUYA 3THOA 5CDFA 1NDQA 5IVHA 4ZOEA 3QMWA 3TZHA 3GLKA 3ZD6A 3HN7A 2Q28A 4F3TA 1E94E 5DISB 1VOTA 4KUHA 3AFGA 5CB8A 1N2JA 1DJLA 4HYEA 1CF2O 4KU4A 1QH8B 3PLRA 5ELLA 3ZTTA 3ZVKA 4H1UA 2KPOA 4GI7A 1MC5A 1TKRA 4B2LA 4ARAA 3SBXA 3OTHA 2ZSJA 2PZGA 4S05A 4O2RA 3AF1A 2LPMA 3ILHA 4XFDA 3UPDA 4XWOA 3RH0A 3VTZA 1MOSA 2BI7A 3MRVA 4V0QA 4CMIA 1ZJ6A 3DL2A 2BHRA 1G66A 2VH1A 3TTWA 3K71B 1BGXT 1E9FA 1J20A 2ATCA 1P18A 2Z5LA 3EZFA 1FTNA 3EWIA 3FGPA 2AEEA 3I04M 2C5GA 3BF8A 1JQLB 3WB9A 4EY7A 3DF9A 5AESA 1VYVA 3W2FA 2OY0A 1GPBA 3RS2A 1TYZA 3ZCXA 5E8RA 2AJDA 2QRGA 3MTGA 4AJ2A 1OIXA 5T57A 2VDNB 2EP5A 1Z36A 1UPCA 2EQBA 1C3OB 3DEYX 1VE1A 4J2HA 1Z5UA 2FN4A 3AOEA 3C8HA 1IQUA 1T34A 3PNBA 1GPMA 4NAHA 1H0SA 5CVCA 2A5JA 3R7AA 5AOBA 2ODWA 1EHIA 3E5RA 2Q0HA 3GDHA 1KK2A 3G82C 4LMRA 2GN2A 2MYUA 2F9LA 4J7AA 3JYHA 4OGGA 4RMGA 5GZ6A 4EUNA 3OQPA 2OFXA 4YAJA 1H2ZA 2SHKA 5CLJA 3TW6A 4HB2A 1PIWA 2XVXA 3F6RA 4UULA 2ODEA 4RW0A 1I4EB 2G88A 2YJZA 3HSKA 5C31A 1GNRA 2OZPA 1S7CA 1FTQA 1KYIA 2GSWA 5A71A 5H80A 4AP6A 1SIWA 1U1GA 3L06A 2XR1A 1JFSA 1Z4JA 4UTNA 4AJPA 1CY6A 2AFHE 4EP1A 1RWBA 2Q3FA 3H4MA 4DG8A 1AKQA 1Y1LA 3I23A 1I1OA 4NU6A 2ATEA 3NYQA 4AUKA 5KWIA 4HBZA 1RYZA 2B5VA 1FFAA 4J1TC 1GYPA 4PZEA 5J47A 1FRQA 2WPDD 3FAZA 2ZSUA 3LVRE 3GC6A 4AF8A 1X80B 1Y34E 3KZKA 4B47A 3H65A 4EZBA 3LCUA 2BF7A 2HLPA 1E1QD 3NTOA 5JPIA 2O48X 3RJTA 5KQRA 5L3QB 4IX9A 3G7SA 1OIWA 2E85A 3N2NA 5B58C 1AKVA 1KFEB 3T1YB 3AVYA 2I4RA 3NGMA 2FQWA 3T6KA 4XOIA 4E2YA 5JS8A 4UBLA 1W4ZA 1B1CA 5GVSA 2YQZA 3HE3A 3M1YA 3D5EA 1P7VA 3OTGA 3NIDB 4FMCB 4DLSA 5JEEA 1KK0A 4ZGGA 1SVOA 3PX2A 3AK4A 3AEKA 1NVBA 5KWJA 1XFDA 2FSVA 2WUFA 4HFJA 1FNBA 1W47A 2QTVB 3GBPA 5H0IA 4CLXA 1E89A 4EQ6B 5JJKA 3EXHC 1FBNA 3A6LA 1C41A 2CHGA 1IK6A 2EF1A 1JBEA 1N6RA 4G0YA 4O29A 1EK5A 5LZ8A 2ZRKA 1Q0RA 1K0FA 3DCJA 4KO2S 5TJHA 2V7UA 3CMCO 2BUBA 2FZ4A 2ZR8A 1JR3E 2YHIA 3EAGA 2P2YA 5EFOA 1E4VA 1EJ0A 1R18A 1VGVA 2N3ZA 2Y1OA 3M9XA 4QUHA 3ETGA 3ZGXA 3LVFO 3IR6A 4H1HA 1JF8A 3U5ZB 5EC8A 2PMEA 3M0EA 2QX9A 4W8GA 2BR3A 1LK7A 3FNQA 1NNSA 4JLDA 4RLFA 4Q24A 4WIAA 5FBRB 1G7TA 3GDGA 1PCXA 2JGDA 4KSBA 4Q37A 5CYPA 4GPAA 2ZU6A 5K99A 1PUXA 1T0JB 1GU0A 4B6PA 1VIYA 2VHXA 2XTZA 3DE0X 2AFIE 5CXQA 2KBEA 1LW7A 2JKZA 5A3RA 5KWEA 1Y7LA 3BRCA 3PPYA 3KXDA 1ZEMA 3GUHA 1DBSA 4DLNA 1E66A 1JHVA 2CL6X 4FDMA 4LWZA 5EJ7A 3M1AA 2D4HA 1KSHA 4LYGA 2CL7X 3WX0A 1QRAA 2DHRA 2P2NA 1D6SA 1X1QA 2OV3A 5DO9A 5B7NA 3QENA 4YRSA 1PJ4A 4XQGA 4Z0PA 3FJOA 3O3MB 4DCTA 4J0KA 5E9AA 5JSZB 3B1YA 5BV2P 5J2UF 4X1KA 4QRIA 4CDRA 3DBHB 1M2EA 3OJCA 5KC8A 4B3DA 1AZTA 4CUJA 4R2IA 4ZDKA 1V8ZA 2UZ0A 2ZWPA 3R3UA 4RE5A 1TCUA 2V7GA 2XDAA 5KVAA 1UEIA 5FORA 4G0QA 4NEQA 3TUIC 1NUSA 2W2LA 3L84A 4FGKA 1ZRHA 4KNVA 1Z37A 1QH0A 3K9BA 4WTOA 5CM9C 1BD3A 4UE2A 4ZVMA 4KWTA 3D6HA 3FOBA 4HAOA 4X8LA 1DWPA 1Y8AA 2GRJA 2X7JA 4PPFA 4B48A 2W9XA 1RC8A 2BJWA 4PNZA 3ZN2A 1HZZA 1BNCA 3T54A 3TQRA 2RGBA 1Z5ZA 3Q6NA 4M9SA 4AMGA 1HDXA 5JRJA 2YFQA 3GFOA 3IHKA 3IT0A 4FZVA 1NKVA 4OF4A 5JFTA 3IELA 2CNWD 3MTAA 1IK4A 4XQCA 1J8YF 4I4TB 2P3QA 4F5WA 2H1WA 3FKJA 4M54A 3ZW9A 3I1JA 4PYMA 1POWA 1V3UA 3BSSA 4AUNA 1SCKA 1JALA 1CUGA 1XALA 4FN5A 3GFPA 1MJFA 2RH4A 4A36A 4A23A 1QOZA 1OCEA 1OLXB 2QI9C 2JFUA 2XIJA 4G0MA 5KAMA 4FGJA 2PSHA 4JLUA 1FVHA 3PP8A 4L95C 7ADHA 2PWZA 1JWLA 4CL2A 4YR7A 5AOVA 3A3PA 3NC4A 4UUQA 1C8LA 2F00A 3BXOA 4KQ9A 1QF6A 5IM4A 1JSXA 1RJDA 1WD5A 2EKDA 2J3JA 4MW0A 4CU2A 4RX1A 3GD7A 3U4QB 1SCIA 1TVKB 2XQKA 4XH9B 2CJXA 1D03A 4X7MA 1R8YA 3UJAA 4L7QA 4F45A 1LQTA 3V80A 3HWX1 4Q9KA 2OT3B 1ODLA 3EFEA 3H8VA 3D2AA 3V2GA 5FUQA 3CSDA 1T36A 1ID1A 3LA6A 2FMHA 4W7IA 3MC1A 2PPLA 2Y6VA 4XARA 4YK7A 5D3QA 2HC9A 4KACA 4EY5A 1TE2A 1QTQA 5IVDA 3VZDA 4IJUA 3TLCA 3CZ4A 2GF9A 2NYUA 5G0UA 4W5QA 1Y9DA 2FKAA 2OORA 2QX4A 2XZOA 2G04A 3GWGA 2GZRA 4IDNA 3V3TA 4PZPA 4JLKA 4EX6A 3GLGA 2E5FA 2W6NA 3HVKA 4KC0A 1SQ5A 2BBTA 5DYGA 1UF9A 1DUSA 3HKCB 3I6IA 2YVKA 3L7IA 4CYMA 4NBUA 2VWQA 1O6ZA 2ZAYA 1UDRA 2UYOA 4LK2A 4GX1A 1F2UB 1ESZA 1SD1A 3BD8A 1ABFA 5AIBA 3NHBA 1QS0A 1XRNA 5FPPA 4HXGA 3W0LB 5JZBA 1OTXA 3D5TA 4RKEA 4TMXA 3T06B 4D4IA 5HKLA 2FX3A 2ZBRA 2PYZA 3D3KA 4RIFA 2GKOA 5L53A 3INGA 2G08A 1PHPA 2FWPA 2DFVA 1BMFD 5DP1A 1AQNA 1ZVJA 4ZT2A 1OBCA 3NDPA 1G2PA 3KSDO 4C0BA 3EK2A 4BQRA 3AIMA 1WDKA 1SO8A 3EGXA 1ZHOA 1UBSB 1KFCB 3OFVA 1FXWA 4GMHA 1NXPA 4N3NA 4DLKA 2YY5A 1MENA 2HD4A 1XXHA 4KGVA 1VI6A 1QFMA 2V98A 3N2IA 4NV3A 3PQ6A 5BSMA 1Y1QA 5F5LA 3CNNA 3DDUA 5CDGA 1QZTA 4BN4A 4EHHA 3MHPA 3A1VA 1X8XA 2YFYA 4ME6A 2IEBA 4UMVA 4BQSA 4RUKA 8LDHA 2HSDA 1GQYA 3GXBA 5ES4B 1QGOA 5ED0A 3SFVA 1XCMA 1QK4A 1PR5A 1V25A 2AEFA 2OESA 2ZCUA 4ZVQA 1QU2A 2AVDA 3L77A 4YUYA 1IEQA 1T13A 2X5NA 1YASA 2QPOA 4HX5A 3PQDA 3UGQA 1QZ3A 1E7QA 3I6QA 121PA 1H5UA 1KRHA 4Q6WA 1AD2A 1T24A 2IL1A 2WA2A 2HBZA 1M9NA 3KFLA 5FPHA 3ZBQA 4AY6A 1QGYA 3KE8A 1UKEA 4C2UA 1OTHA 2ZB2A 2VHUA 2YYZA 2PSSA 3NAZA 1WULS 3T5CA 2GVNA 1EUCA 1WP4A 3TNLA 3K4PA 1ZJJA 2VVTA 1Q7TA 3FPKA 3H6KA 4A26A 3L8CA 4E3ZA 3EEBA 4MAFA 4PZ0A 3SC4A 2IU6A 3G2JA 3TLYA 4I3GA 4B5LA 1SKMA 5JNWA 3FMIA 1DC8A 1KPGA 4HD8A 2BEVA 3Q15C 2HFJA 4HATA 3M5CA 3IKLA 2HSJA 3ROTA 4R54A 4NBNA 4C21A 1A8PA 1J21A 4DUPA 2C61A 4OHOA 1UC5B 1V45E 2M32A 3BFVA 4N5MA 3H0KA 1GRVA 3E22A 4XWKA 5IT5A 5K4HA 1WB5A 3W5DA 2HQ1A 3O1IC 1H9BA 2RONA 1GKLA 1N6PA 1P4SA 1VZ3A 2QUJA 4INJA 2CWDA 3DF7A 4UMDA 1U2SA 2WYWA 2B30A 2PKXA 5AVOA 4AFNA 3VNUA 1T9AA 4ENUA 4JR1A 5DV9A 2IY7A 3EMBA 4P84A 2QRMA 2X8LA 1L5RA 3I76A 4CQJA 4XDZA 4LF4B 4BUJA 3TDNA 1II9A 1HSOA 1Q0UA 3MWKA 4G37A 2DLDA 1GUFA 4R51A 1TZCA 3EA5A 3R7WA 1IM8A 4IHKA 2Z5VA 3QXJA 1ORWA 3AJ9A 4P5PA 4ZDJA 2H4FA 5C1OA 4GX5A 5AW3A 5TIIA 3B20A 1ZVMA 4N01A 3QIAA 1DXOA 1SZCA 1HG0A 2AJTA 2REBA 1M0TA 3OMLA 4KRGA 5DE3A 5LCXA 5K3EA 3BJMA 1RJ9A 3PSHA 1YBFA 2AHRA 3K0BA 3OCWA 3PS9A 4CTMA 3PGMA 4FCCA 1QFZA 4RA9B 5EOVA 1YJCA 3H99A 3LXXA 4O63O 1M8JA 4BMVA 4ENTA 1BKYA 3BT7A 3EXFB 4HUQB 1T4CA 5F4BA 8ATCA 4YRPA 5B3JC 4I5DA 3ZCPA 2BF4A 3OJLA 3BWVA 4J1SA 4MJLA 5ALYA 3L1JA 2QSUA 3IHLA 3MSCA 3OMWA 1AMNA 2GDJA 4Y98A 4ZQHA 3WRWA 3MWJA 4LV6A 2XUKA 4HGQA 2JLYA 4Y9SA 1N7IA 3RABA 2Z09A 1S3SA 3KEGA 4MH0R 3ESCA 3QZUA 3HSSA 4AMYA 5KOJA 3OQHA 3G9XA 5H1YA 4B6EA 2PUCA 2BEJA 4OHFA 5FBQB 4X6YA 1BXRB 1K5HA 2VJLA 3DHVA 4M87A 2XXAA 2OYRA 1M3SA 1VSTA 3E9DA 5IVKA 1UBHS 1IBSA 2G1JA 4EFNA 2OBLA 1XQWA 3UYLA 1ENPA 3CU5A 1A9XB 2WD8A 4P83A 3T41A 2QR3A 4Z9YA 1FY2A 1LDNA 5G4KA 4EY3A 4PSKA 1VIDA 3KXLA 1ULTA 2Q5QA 3OESA 4KDFA 2PUAA 4JL6A 3EFOB 3M49A 5I7WA 3CKLA 4RBNA 1OFUA 4G0VA 3SMQA 6Q21A 1ONNA 2C0CA 3RBVA 3RWOA 5EJ4A 1UQUA 5IKXA 3WO0A 1SBNE 2HIGA 3TW8A 1E64A 5AKLA 5T3UA 3AHCA 2IXAA 3BBPA 3IBFA 1UDCA 1MKYA 2P2LA 3IXQA 4ECAA 2GCPA 3TIVA 4KOEC 2V5AA 3T7AA 4WD3A 3AWIA 3QTLA 2X7HA 3CZ9A 5JNRA 4R1UA 4EGSA 1VHQA 3N8HA 1SUPA 2EJWA 4TS1A 1KY2A