3ZJZA

Open-form navms sodium channel pore (with c-terminal domain)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ION TRANSPORT PROTEIN
publication title Role of the C-Terminal Domain in the Structure and Function of Tetrameric Sodium Channels.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zjzA00
3UKMA 2KB1A 2HFEC 3E83A 3AG2C 1XL4A 4GX0A 2HJFC 3RVZA 3STLC 2X6AA 2WLHA 4MTFA 3OR6C 4HYOA 3WG7C 5CBHA 4R50A 3FB6C 3K0DA 4MVSA 4LCUC 4XDJA 3LDEA 3K06A 5EC2C 4LBEC 3ABLC 2Q68A 2HVKC 1ZWIC 4QNHB 2H8PC 4MTGA 3E89A 3SPIA 4XDKA 2A9HA 2JK5C 5KUKA 2WLLA 1J95A 3R65A 3SYAA 3LUTB 2Q6AA 4EKWA 3IGAC 4DXWA 3BEHA 4LP8A 4G28B 2HG5C 3F7VC 4MW8A 2WLIB 3KG2A 1R3JC 3ASNC 2EIKC 4X8AA 5EC1C 3SPJA 4PDRA 1KKDA 3SJQC 2Q67A 3AG4C 3OUFA 2DWDC 1R3IC 4KFMA 4MW3A 3STZC 5IY5C 1M57C 4WFFA 4G27B 3SYOA 2EILC 2HVJC 1V54C 3K03A 3LNMB 3EFFK 4UUJC 5EBMC 1BL8A 3VOUA 5EBLC 2DWEC 2WLMA 4PA4A 4MVUA 3SPHA 2R9RB 2X6CA 3ABKC 3E8FA 2DYRC 2WLNA 4HZ3A 3F7YC 3FB5C 3F5WC 4F4LA 3X2QC 3T1CA 1R3LC 4X89A 4XDLA 4WFHA 4J9YB 1V55C 4J9ZB 5B1AC 3ZRSA 2OCCC 2K1EA 3T2MA 2ITCC 4JTCB 1JVMA 3E8BA 4GX5A 4R6ZA 5EK0A 1R3KC 4P9OA 3T4DA 3UM7A 4OXSA 4RUEA 4MVOA 1OCCC 2EIJC 2BOBC 2EINC 2EIMC 3FB8C 4RO2A 3TCUA 4P2ZA 3OUSA 3K0GA 2ZXWC 3ZJZA 3SPGA 3SPCA 4PA7A 1M56C 4CBCA 5E1AC 2Y69C 2A79B 4JTAB 3K04A 4MVZA 4R8CA 1LNQA 2ATKC 4PA9A 4I9WA 1OCOC 3ASOC 2WLLB 4GX2A 4P30A 4WFGA 2AHYA 2DYSC 3AG1C 4H37A 3E8HA 4RAIA 3ABMC 3RW0A 3RVYA 3LDCA 1ORQC 4JTDB 5KUMA 5B1BC 5BZBA 5EBWC 5J9PC 4MS2A 2A0LA 3PJSK 3HPLC 4R7CA 1S5HC 5CBGA 2IH1C 3OR7C 3TETA 2WLKA 1XL6A 3OGCC 4RUFA 4PDMA 4PA6A 2AHZA 4X88A 2BOCC 3SYPA 1P7BA 2P7TC 4H33A 4QE9A 4BW5A 2NLJC 1K4CC 2WLIA 4P9PA 3FB7C 3GB7C 4WFEA 3LDDA 1K4DC 2W0FC 4GX1A 2Q69A 4QE7A 4MVQA 2YEVA 3E8GA 3E86A 4MVMA 3RBZA 3K08A 2ITDC 1OCRC 4MSWC 3IFXA 4MTOA 4MVRA 1G4YB 3T4ZA 4PDLA 1QLEC 2ZD9A 2QTOA 3SYCA 4PA3A 2IH3C 2X6BA 2QKSA 4ZBMA 3AG3C 2WLJA 3JYCA 4PDVA 3SYQA 5B3SC 5CBFA 4TWKA 1OCZC
chains in the Genus database with same CATH superfamily
1AB3A 2P90A 4DRXA 3RYFB 1BQ0A 3BFRA 3P30A 1N36O 4LFAB 1S76D 2Q68A 1VQ4V 2ZR3A 1XHXA 3JD4A 2A9HA 5KUKA 3R65A 3LUTB 4X20A 2Y4TA 1K34A 1R3JC 1KUQA 2QWNB 2YUAA 4DR3O 5IWAB 3CCJV 4DR5O 3CC7V 5LGTA 2LJ2A 4YJ3B 4TQDA 2OTJV 1XNQB 4B3RO 4WFHA 1E79G 2A06H 3TJTA 1BQZA 2K1EA 5JJJB 1JVMA 5HFMA 5BR8O 2ZIOA 3B4SA 1VIBA 2CE4A 4UCVA 3ZRVA 2Z5UA 4JI3B 1HNZB 3TCUA 2UXDB 4TSFG 2VQFO 3SPCA 2YEVB 5KMGB 1URFA 1F7YA 1OCOC 1I08A 1OZ0A 1H2KA 1AP6A 3M8AA 4TV9B 2PYJA 2IJKA 1GM8A 3OM3B 1TA8A 4FM2A 5CB4B 2WLKA 5DM6V 4DR4O 1IBMB 2QSAA 1XMQB 1CPYA 3J7AU 3CCRV 2BTOA 5FNVB 1LR1A 1K4DC 2W0FC 5LMUB 2JGDB 5KHGA 5K1XA 1KQSU 1M9NA 2XT9A 1MMMA 3A0HZ 4PHZA 1SQGA 1Q6HA 5LP6A 4YHHO 4FLVA 4LWSA 1F4MA 1JFFB 4X62B 4YY3O 3Q4HB 3JYCA 4DO2A 2DQ3A 3E83A 3I55V 1A32A 2JVDA 4O2AB 3QO8A 2WLHA 1AR5A 4MTFA 5GONB 1AI6A 1AP5A 1PL0A 3BAAA 1VQNV 3CRQA 5L3BA 4IGGA 1I5YA 4MTGA 3CYOA 3CXCU 5JVDB 2E5LO 3JD3A 4DR3B 4KFMA 1AILA 5LXTA 4DR5B 2JJ1G 3BA8A 5EBMC 3VOUA 3QNEA 1SQXH 3B8NA 4YIOA 1D2DA 2OCHA 3F5WC 1EN5A 1R6TA 4UXNA 4ZI7B 2HEPA 2QKAA 3ZHSA 1NBMG 2UUCO 1Y76B 4B3RB 3HKDA 5J2TB 5BR8B 3E8BA 3CCSV 4B08A 4ZKIA 4JI6O 3CCMV 4X64O 4A5UB 2VQFB 4G2KA 2A79B 4MVZA 4FFBA 5JH7B 3RW0A 1SETA 5BY1A 4IHJA 3ZRWB 1ZUQA 2F4VO 3N2GB 3K9AA 5DN6G 2XASA 3DGEA 4DR4B 1R73A 1WAZA 4CZZA 1TUBB 4JZGA 4JI0B 2CTQA 2E74B 3RBZA 3DC6A 1H38A 2CH7A 4YHHB 2ZE6A 3SYQA 4YY3B 4I0XB 1Y66A 3AG3B 1K5SA 2HJFC 2ZNIA 2WSSG 3JASB 3BVOA 4FVMA 1E1QG 1R6KA 4LF7O 3H1KH 2Q5ZA 4AI8A 3OFNG 2LP7A 5EC2C 1W0JG 4TT3G 2Q73A 4Z1VA 2DMXA 2VWJA 3DXRB 1XNRO 1J95A 3WB0A 4DV2O 2WWWA 2RN9A 2CUGA 5LYJB 2E5LB 4U3JA 3SPJA 4TV8A 4PDRA 3BA9A 2GTSA 2EIKB 2ZM6O 5D5PA 1Z2GA 2Z3YA 3ETDA 2EILB 4FLWA 5IYZA 3E8FA 3FKSG 1R3LC 1YEWA 2EBOA 2UUCB 5EIBD 1V55B 4JTCB 5EZYB 1RPRA 4UVBA 1F23A 4JI6B 4D7SA 3K0GA 4X64B 3ZJZA 2EINB 2EIMB 3FAVA 4DUZO 3G6BA 1G8MA 3GWOA 1NVPB 3CCVV 4WFGA 4W4LA 1KD1W 5KUMA 4U7OA 3OTOO 3JCUZ 1JQ0A 2F4VB 3OR7C 4PA6A 4J11A 3SYPA 4X1IB 4L87A 1PP9H 3GB7C 4FZ0A 3LDDA 2Q69A 3M7MX 4LFCO 2YI8A 1NH2B 3NXSA 4PI0A 3VBBA 3E22B 5EYPB 1NVPD 2X6BA 1MABG 2P4KA 3AG3C 4FZ1A 1Y6XA 1UJWB 2HFEC 4FM0A 2CK3G 1NQTA 3ZS8C 4PD4F 2EULA 1H8EG 5EIBC 4LF7B 3OTFA 3LDEA 3R66A 1MNGA 1FS0G 3ABUA 3NR7A 2Q0OC 4O4JB 2L35A 3D8CA 3JAKB 2W6JG 1XNRB 2O57A 4DXWA 1Q90D 2EJ7A 4DV2B 4CH6A 1IDSA 2EIKC 1BSMA 3RFRA 3B8MA 2ZM6B 2EILC 1OV9A 3D3QA 2HVJC 2YXHA 1BS3A 2W6IG 4PI2A 2HJDA 2WLNA 1KU9A 3JD1A 1AJQA 2NN4A 3T1CA 3B77A 2LFSA 3RYHA 5A9GA 1V55C 1YJNV 3MHSC 1DK1A 3P3PA 1S0VA 4NVPA 4P9OA 2QDOA 1M1KW 2EINC 2EIMC 4K35A 3CCLV 1M4UA 5E1AC 4DUZB 4DV1O 5LMNO 1O9HA 4Q20A 3B2EE 3L9DA 4LFBO 4JASA 3ASOB 4X20B 4FLZA 3K79A 5GTHZ 3OTOB 3RN4A 3S3XA 2BTQB 1BE3H 4X65O 3TETA 2ADQB 2UUBO 1FXHA 3CS5A 2KSDA 3E2EA 1N8RW 3T1YO 3RT3C 1IX9A 2LGWA 1AVMA 1JX9A 4LFCB 2KKWA 4EFBA 3D3IA 4HNAB 1PNKA 4DV0O 5C8YA 4PA3A 2IH3C 3SGIA 3CSXA 1JA8A 3BPZA 2FMLA 3UKMA 4JYYA 4IYHA 3AK2A 2YIAA 4J7JA 2P06A 5CA1A 3FB6C 2OYQA 1VF5B 3H9VA 5IJ0A 2XAJA 4LF4B 1YZBA 4JYCA 4ZOLA 3W7SA 4LP8A 5C93A 3TK1A 3KG2A 4ASUG 4X8AA 3HKCA 1EBOA 4O4HA 1G1XB 2Q67A 3BY6A 1YSCA 2RQ6A 3SR2C 4ZIBA 4G27B 2CDYA 3AG4B 1E1RG 2VS0A 5IY5B 2JS5A 3HR0A 5H5NA 1QVFU 3F7YC 5L3CA 2QM4A 3L71H 3CHXA 1PM9A 2QWRB 2XAFA 5J2UA 2EZOA 4GKKO 4IIJA 3JATB 4O4IA 4JAAA 4FM1A 2F43G 4X1KB 1MZEA 1GMGA 4DV1B 3ASOC 4TUYA 5LMNB 4OX9O 2AHYA 4UV9A 1VF6A 2FYUH 2PI5A 4LFBB 1FXKA 5L3GA 1YJ9V 1Q7YW 2UU9O 2ILMA 3JSNA 2UUAO 3I56V 1SERA 3UO3A 1GN6A 4X65B 2IJIA 3I5DA 5CA0A 2BOCC 1HWYA 2UUBB 5LXTB 3ZCCA 4O2BA 4WFEA 2PZSA 4JYAO 3T1YB 4TQFA 1GM9A 2LW1A 1GRJA 1IBKO 4PELA 1RFYA 3J81N 1HNWB 3K08A 1YJWV 2ITDC 3HKDB 2P67A 4B3TO 2ZD9A 4DV0B 2LFRA 4ZBMA 2XAQA 2ZT9B 1QQCA 3VQVA 3CC4V 2IJJA 1OJHA 4FFBB 3OR6C 1WPBA 2UXCO 2UXBO 2GUZA 3N2KA 1T5EA 1KP3A 1NTMH 4JI5O 1BHAA 2JK5C 1DLBA 4DR2O 3SYAA 2Q6AA 1Q5OA 4JI1O 4JGSA 4DR1O 5KAIZ 1KC8W 3AG4C 4J7KA 2Y4UA 3ASNB 2GSMB 1H2MA 5IY5C 5FL7G 3JALB 4LF8O 1VMGA 1N0NA 2WLMA 4PA4A 3FYEB 4LNUB 1P49A 3RYCB 2CH7B 3FB5C 5AG2A 1FPOA 4DV6O 1H8HG 2YSUB 4WFAV 2QA4V 1N32O 1WA8B 4N23A 4GKKB 1K33A 4I55A 4KUMA 4LH7A 2BSKA 4F6RA 1FJGO 4I9QA 4D7TA 1IVSA 5B66Z 3K5MA 3SPGA 2EIJB 2WPDG 2Q8VA 1M56B 4OX9B 3KKYA 1MA1A 2DYSB 1XQ8A 3WB2A 1PD3A 2UU9B 1Y67A 5B1BB 4U3JB 3ZEDA 2HR3A 3ABTA 3CX5F 4DK1A 2UUAB 1YI2V 1XL6A 1AI5A 1XEQA 2BE3A 4PDMA 1RPOA 4UCSA 2YIBA 4H33A 4I50B 1S77D 5H6QA 1VF7A 5IYZB 4JYAB 1DF4A 4QE7A 1IBKB 4DV3O 1WP8A 1I0HA 1BHBA 4Z2WA 2Y0PA 4GT1A 3RGBA 4B3TB 4ICGA 3VQYA 1QLEB 4PV1B 4JV5O 1ZSPA 3HKEA 5D5QA 2MK3A 3PN1A 3AG2B 3CB2A 2UXCB 1NTKH 2UXBB 3TXSA 4LCUC 1US6A 1SESA 4KXRA 1TAEA 4JI0O 4O4LB 5KX5B 2N74A 1HP8A 4UCOA 2LW7A 4JI5B 3ABLB 4U3FH 4DR2B 1LUWA 5TISZ 3QVNA 3F7VC 1XMOO 4JI1B 2QE7G 3ASNC 1VQLV 3QO7A 3ZHUA 4BIZA 4DR1B 3STZC 4LF8B 3LNMB 3ZHTA 2YS8A 1GAXA 2AXTZ 1CP9A 1K9MW 3ZMTA 4F4LA 4ZHQA 4DV6B 1ZX3A 1AI7A 3C3SA 1N32B 3G80A 5LBQA 1WLEA 4UV8A 4GX5A 4I4TA 2Q7GA 3CRRA 3T4DA 1FJGB 2EIJC 4RO2A 1TUEB 1M56C 2ADPA 1L1FA 4K8XA 4K8ZA 3WFVA 1EN4A 2ZXWB 1SKVA 2DYSC 5KLVH 5B1BC 3ZMSA 3ZHQA 4JI2O 2M6YA 3SJCC 4HAMA 1XI1A 4QE9A 1F51A 1L0NH 1ZTEA 2D3OW 2C2AA 3CRCA 4DV3B 4MVMA 2OT5A 3MD0A 3OMNB 4JAUA 4NB5A 4QJFB 1G4YB 4LF9O 1OCRB 2ODMA 1MG1A 2Q9LA 4X1YA 1QLEC 1QBZA 1I94O 1YVWA 4D6TH 2AZ2A 1SC5B 4JV5B 3AG2C 1M5IA 1GK9A 3CJHA 2LQTA 2Q0AA 1RSOA 4YJ2A 3K06A 1VQ5V 3ABLC 3AEIA 2HVKC 2H8PC 1KECA 1PNLA 1O9GA 2QWPB 3BEHA 1XBLA 1XMOB 4UFZA 3K03A 5H6RA 1OHHG 1PKXA 1BL8A 3P3NA 3VQWA 2VWKA 2X6CA 1H2LA 3DC5A 4AQYO 1QNMA 3ABKB 2DYRB 2FTKA 4UB6Z 1VQPV 5C8YB 1SS3A 3FD9A 2N05A 2B5UA 4DUYO 4WF9V 2EZPA 2OCCB 2QGNA 1R3KC 1VQMV 5CA1B 4JZ2A 3K58A 2ZXWC 5IJ0B 3ZMVA 1H2SB 2P5OA 5K1PA 2ATKC 1XOUA 3FYIB 3LDCA 5H9CA 3X2QB 4YJ3A 1X4TA 1MSDA 4JI2B 3HKCB 5JJNB 5CBGA 1N4CA 4O4HB 2IH1C 3ZBHA 1Q43A 1K97A 3A0RA 5BMVA 1IZ3A 2YICA 1XDCA 2YEVA 4E4EA 3CEIA 1OCRC 2KG7A 2LO1A 4U7NA 4MTOA 1EM1A 4J41A 5J2UB 1K8AW 4LF9B 1NS1A 3D36A 1QLNA 1I94B 2IJHA 4O4IB 1MZFA 4LR3A 5LA6B 2P4VA 4NTXA 3H1LH 1FFXB 1XL4A 2A7WA 3CE2A 2CTRA 4TUYB 5FNVA 3ZN0A 1FXKB 1XILA 4J7ZA 4LBEC 5JQGB 3IC7A 3H01A 4JPRA 2JGDA 1ZL8A 1VARA 1HNXO 3W7TA 5CA0B 5JJEB 2HG5C 2RNBA 4ABMA 4H0LB 2QEXV 1K3EA 1JFFA 3Q4HA 2PTMA 2DWDC 4WBNA 2NR5A 3MHHC 1SZXA 1XHZA 1GN4A 3L73H 2IU0A 3ZRXA 1V54B 1IXBA 1VEWA 3ABKC 4DR6O 2DYRC 4GCZA 4LF4O 4AQYB 4JF3A 2P6JA 1NR7A 4F6EA 1AR1B 1W0KG 3G4SV 1J5EO 4X9QA 2OCCC 2F23A 4DUYB 5B1AB 2N04A 4R6ZA 2OIGA 1K5QA 4GUNA 3K3WA 5ITZB 1TVKA 2AGAA 4JTAB 4R8CA 4CS2A 2QTSA 1Z5WA 3CCUV 3X2QC 3FX7A 3A8TA 3K5OA 2G38A 2JS3A 1ROPA 2R72A 1S5HC 2B9ZA 5CN0A 4NTYA 5J2TA 2MW2B 4DRXB 4QPJA 3OEHG 1AROP 3CCEV 1WJZA 1Q6IA 4K0KO 1Y74A 2CTPA 3L75H 1S3JA 2XOKG 1YXBA 4UCUA 2XAGA 5JH7A 2E76B 3CRAA 4I55B 5B1OA 1QR8A 2BSKB 3ZRWA 4F6RB 4TWKA 1R6NA 4GX0A 1B6QA 3LSSA 1VF6C 1FXKC 3APQA 1HNWO 3OGIB 3E89A 2DW4A 1RP3B 1HNXB 1Y4MA 1IXMA 1XUQA 2XHBA 1EFRG 3EHBB 3ETQA 4MW8A 1WPXA 1IBLO 3T1HO 2RJZA 5KA5A 2Q7HA 4I0XA 3SYOA 1IURA 1V54C 4FMTA 1WN7A 4UUJC 1SQQH 3UT5A 3JASA 3C3TA 1Q6UA 2R9RB 4GKJO 4DR6B 1AJPA 3DTUB 2YI9A 1KP2A 2FKXA 4J9YB 5B1AC 3ZRSA 1J5EB 1WB8A 2QJ1A 1K73W 2L6LA 5IYDO 3H1JH 5LYJA 4MVOA 3FB8C 1VQ8V 5IE9A 5JCOC 2YIBD 1WB7A 4CH3A 4PA7A 4NR1A 1NJIW 3TGUH 4GX2A 2Y69B 4RAIA 1FKAO 3E8HA 5LP6B 3U0ZA 2RCVA 3K59A 4LWSB 1B04A 4X66O 2A0LA 3ABMB 3ZIAG 2QKCA 4CS4A 1JJOA 5KHIA 3QO5A 4KHPO 2DE0X 1FXVA 1K4CC 1SRYA 3KZIZ 2M7WA 2DOSA 1LUVA 4RWUA 4K0KB 4ZHQB 2IU3A 4TOIA 3CD6V 4MSWC 5GW7A 4IT5A 3JARA 5IYCO 1F4NA 3T4ZA 3WB1A 4DV4O 2PUSA 3P32A 3SYCA 1HDJA 4AHCA 2DN9A 2HHHO 1VQ6V 1SQVH 1WNSA 1P84F 4R50A 2QWOB 1X59A 3WG7B 2CGOA 4CC6A 2E3CA 3HKBA 3SPIA 1QVGU 3ZX6A 2AZ0A 2OWOA 3F5TA 2ZE7A 4G28B 1Q3EA 4LF6O 1IBLB 1AI4A 1DF5A 1FAFA 3T1HB 1Z5VA 3OUFA 5L3DA 1COWG 4JYBA 1GKFA 3U11A 5E79Z 4WFFA 5CMUA 3OW2U 3JD0A 2F66C 2CAZC 1VQ9V 3ETEA 5EBLC 4GKJB 4HBNA 2D2CB 4IHJB 4EFEA 2GV9A 2OIEA 1KBHA 4XDLA 3OAAG 2ZIMA 3LNNA 3WU2Z 2QR4A 1RSOB 2HLDG 1FFTB 4P2ZA 2GBOA 1SQPH 1PNMA 4KL1A 2Y69C 3O9OA 3L72H 3A2FA 5LP6C 2A3QA 2JDIG 4I9WA 4PA9A 4YXWG 3ABMC 1UPGA 4X66B 5LHGA 5LHIA 2ETNA 1SQBH 4R7CA 4BWAA 2UXXA 3JD2A 4KHPB 2WLIA 3K9SA 2IBZH 1THZA 3OMIB 3O65A 3KCXA 1B06A 3H1HH 4JI4B 1SF9A 4NYKA 1KMIZ 1VP7A 4MTXA 4N21A 4MVRA 2GHYA 2V7QG 4DV4B 2CTWA 5IJ9A 4TV8B 1Q81W 2BTQA 2GDSA 2HHHB 3C90A 3RYIA 3FFQA 2YXYA 3JSLA 2JEXA 3OT7A 3JAMN 2K9PA 3WG7C 2NNUA 4MVSA 5KHKA 4BIOA 2X0LA 2Q4PA 2F93B 4I5SA 2B1GA 4HNAA 1JOYA 4LF6B 4CH5A 4QPKA 5BMVB 3RWRD 1PL4A 4MW3A 1Q82W 3FAVB 4FFKA 1NU1H 1WP7A 1HW7A 2ZQMA 2B1IA 2ZDIA 3CPWU 2DWEC 1QR9A 1QU7A 2KG7B 1CEZA 1UFIA 3AK1A 4OGQB 1D5AA 3K5LA 3IC9A 4YIPA 4RQFA 3H1IH 3T2MA 1YITV 3CXHF 4B3MO 5EK0A 2Y0IA 4FK5C 1EN6A 1ZL8B 3U10A 3JAWA 3GVMA 3RVYA 4BW9A 4DR7O 1MSWD 3KCYA 3HPLC 4WFBV 2YDEA 4EB6A 4WBNB 3BABA 2PY5A 3ICXA 3JATA 4DW0A 3B09A 1NZ6A 2LGQA 1N36B 4X1KA 4FLTA 2ZCEA 3IFXA 2PF4E 2QTOA 1BGYH 4DV7O 4E2LA 1SA0A 2AW9A 4UCRA 3A0BZ 5H2FZ 3ZMUA 5IT9N 2WA3A 1TVKB 2E75B 1I5XA 4QIWF 3RVZA 3STLC 3BCCH 2H94A 5CBHA 5LOVA 3MAQA 1GM7A 3K0DA 4EEQA 2YIDA 5LL6Y 1ENVA 3RYHB 4QNHB 4XDKA 1DGSA 2WLLA 4IL6Z 3L70H 3LSQA 1U97A 3CMEV 1CXZB 4B7EA 3OD4A 4FLXA 1Y74B 4J10A 3EFFK 1H2GA 5DECA 5FPOA 4JAVA 2QM8A 1FD9A 4MVUA 4FLYA 2KQXA 3D36C 2ZE5A 5KAFZ 3CMAV 4PJ0Z 3OEEG 1P4RA 1JCHA 1NT2B 5JWPA 3CWBH 4FJCC 2WAMA 5B5EZ 2W0XA 1I7FA 1SQFA 2EX3A 1Q86W 3CCQV 1RM1B 4B3MB 3AK3A 3ZMZA 2BOBC 3W7XA 4CBCA 3B40A 3JALA 3RYFA 3K04A 4BAYA 4NXMO 1LNQA 1K92A 5F2VO 4LNUA 2R9IA 1S5LZ 3RYCA 1K7DA 5BZBA 4DR7B 3AG1B 5EBWC 1EZVH 2FB5A 5IDJA 1M90W 3CRMA 1WA8A 4X88A 2GTAA 2YXLA 4P9PA 3UT5B 1L8DA 1YDXA 5FPRA 4MVQA 1YHQV 4ZOLB 2BCCH 3SDLA 4WCEV 1Q8IA 4DV7B 4PDVA 2H3OA 5CBFA 2PYLA 4H44B 4UVCA 3N27A 3W7WA 4I50A 4HYOA 1N33O 1HR0O 4W4KA 4B3SO 2Y48A 5KMGA 4K3AA 3VQXA 4TV9A 1QHTA 4IIJB 4BIUA 5CB4A 4FLUA 1KKDA 5CA3A 2V1DA 3G6EV 1M57B 1YTFB 4J80A 5L3FA 1BZKA 2R9AA 3JARB 3K5NA 5LGNA 4O4LA 5KX5A 2WA4A 1NI8A 3BRCA 4J9ZB 1U96A 1RM1C 2UXNA 1ZAUA 4CC5A 1JPXA 1BMFG 4O2BB 4OXSA 3CP1A 1JR9A 4DK0A 5IYBO 4DV5O 1OCCB 4O2AA 3K57A 2Q7EA 3HKBB 3EXAA 5GONA 4NXMB 4P30A 3AG1C 4KP4A 2ZKOA 4Q6GA 2OTLV 1N0JA 1ORQC 2DQ0A 2XTAA 2VRZA 1YTFD 2FL4A 3OE7G 3CC2V 3J80N 2AHZA 2JIZG 2QWQB 3GWKC 4CH4A 4QGPA 4LF5O 5JVDA 3ZHRA 4RQEA 2HP8A 2GUZB 4NXNO 2X7RB 3N2KB 1GH6A 3DSQA 1B3QA 3ETGA 3E8GA 5KHHA 1SZTA 4MT8A 3AG7A 1GTOA 2JJ2G 2QKSA 1NH2D 4DW1A 1YCIA 4ZI7A 4IYIA 1Y76A 4L8JA 5LHHA 4GZRB 5LGUA 3TXQA 2KB1A 2X6AA 4J42A 2ZR2A 1N33B 1HR0B 2V4DA 4B3SB 4JI8O 4AILC 2ZNJA 1ZWIC 3OMAB 3HB3B 4OPHA 5KA6A 3IGAC 2WLIB 4BR6A 5EC1C 3G67A 3N2GA 5GTIZ 1R3IC 2VQEO 2JGUA 1M57C 1R1BA 5DEDA 1PV0A 3THOA 3W7UA 3SPHA 4I7ZB 4HZ3A 1TUBA 5IJ9B 1BCCH 4X89A 1QCEA 1FYJA 4JI7O 5B1NA 2ITCC 4UVAA 1L0LH 3RYIB 1H2NA 4UCTA 3UO2A 3IJ4A 1VQKV 3UM7A 1OCCC 1XREA 4DV5B 1JJ2U 2JEUA 3JCZA 1N34O 4H37A 1W59A 3S3WA 1JMKC 2RDCA 2XNDG 4MS2A 2JRIA 2RMKB 4GLXA 3BHPA 4XBFA 3ZHVA 4LC1A 3DXRA 2ZINA 3HKEB 3UCSC 1P7BA 2F95B 1PPJH 4LF5B 2XUMA 1MOFA 4DYLA 4NXNB 3QF7A 5HFLA 3QTCA 3M99B 3E86A 1V9PA 1EZJA 5KHJA 1S72V 1YIJV 5A2QN 4PDLA 2P22C 2WLJA 4NKGB 3MDSA 2EJRA 5B3SB 5EZYA 5L3EA 1OCZB 1P7GA 1GN2A 4H13B 1KYOF 4LFAO 2HKOA 4JI4O 3JAWB 3LSUA 4XDJA 3SJBC 1AJNA 4JI8B 2R70A 3SJAC 4EB6B 4EKWA 4I4TB 1ZLZA 5FLXN 5BXZA 1TGOA 5LA6A 3SJQC 2IW5A 5IWAO 3L74H 1YF2A 4OPAA 2VQEB 1NKDA 1FFXA 2Z0AA 3IAYA 4C7UA 4X1IA 2CGNA 2ARHA 1XNQO 1NR1A 1D5NA 5JQGA 1SA0B 1GO3F 4LH6A 1BT8A 4JI7B 1G6UA 3APOA 1AR4A 1KB9F 3E22A 3EVKA 1DTOA 5EYPA 2DJVA 4NTWA 5LOVB 4RUEA 4JI3O 4GYCB 1HNZO 1GN3A 2UXDO 3OUSA 1W2BU 1N34B 2WLLB 2PI4A 2PGGA 4X1YB 1OCOB 4JTDB 4B7KA 5J9PC 1S5JA 3PJSK 1KKCA 3ML0A 4O4JA 3JAKA 3OGCC 4RUFA 3G71V 4FPPA 3CJHB 2ZDIC 1IBMO 2P7TC 3UQ8A 1XMQO 4BW5A 2NLJC 4Z1MG 3FB7C 4YJ2B 5LMUO 2F1MA 4GX1A 4UB8Z 3ZN1A 1M93A 1VQOV 5ITZA 1VQ7V 4CS3A 2ZE8A 5JCOA 2IM9A 2XAHA 3QG5A 2YC0A 4FIPC 2QM7A 4X62O 5B3SC 1NTZH 3E35A 1OCZC
chains in the Genus database with same CATH topology
3UKMA 1XL4A 1I5XA 2P90A 4QIWF 3RVZA 3STLC 5CBHA 2H94A 3FB6C 1GM7A 3K0DA 3P30A 3ZN0A 1S76D 1FXKB 4LBEC 2XAJA 2Q68A 1ENVA 1VQ4V 3IC7A 2ZR3A 3H01A 4JPRA 4QNHB 4XDKA 3JD4A 2A9HA 5KUKA 3W7TA 2WLLA 3R65A 4JYCA 3LUTB 3W7SA 3LSQA 4LP8A 2HG5C 5C93A 3CMEV 3TK1A 1K34A 2QEXV 3KG2A 1K3EA 1R3JC 4X8AA 4ASUG 1EBOA 2Q67A 3CCJV 2DWDC 3BY6A 1YSCA 3MHHC 4G27B 3AG4B 1E1RG 3EFFK 5IY5B 1H2GA 2IU0A 3CC7V 4JAVA 3ZRXA 1QVFU 2QM8A 5LGTA 1V54B 4MVUA 3ABKC 2DYRC 4GCZA 3CMAV 3F7YC 5L3CA 2OTJV 3OEEG 1P4RA 4JF3A 2P6JA 1JCHA 1NR7A 2XAFA 1AR1B 1W0KG 4WFHA 1E79G 3G4SV 4FJCC 2OCCC 2K1EA 2WAMA 1JVMA 2EZOA 5B1AB 5HFMA 1Q86W 3CCQV 1RM1B 4R6ZA 1K5QA 3ZRVA 2Z5UA 3ZMZA 2BOBC 3TCUA 3K3WA 3W7XA 4TSFG 4CBCA 3SPCA 2YEVB 2F43G 4JTAB 3K04A 4BAYA 1GMGA 4R8CA 1LNQA 1K92A 1OCOC 3ASOC 3CCUV 1OZ0A 3X2QC 2AHYA 2R9IA 4UV9A 2PI5A 2IJKA 1FXKA 1K7DA 5BZBA 5L3GA 1GM8A 3AG1B 5EBWC 3OM3B 1YJ9V 1ROPA 1Q7YW 1S5HC 5IDJA 3I56V 1SERA 1M90W 2WLKA 5CN0A 2IJIA 4X88A 2BOCC 5DM6V 1HWYA 1CPYA 4QPJA 3OEHG 4P9PA 1AROP 3ZCCA 3CCRV 3CCEV 4WFEA 1K4DC 2W0FC 1GM9A 4MVQA 4PELA 1KQSU 1M9NA 1S3JA 1YHQV 2XOKG 3K08A 1YJWV 2ITDC 2XAGA 2P67A 4WCEV 2ZD9A 1F4MA 5B1OA 1QR8A 2LFRA 4ZBMA 3ZRWA 3JYCA 4PDVA 5CBFA 4TWKA 4UVCA 2XAQA 1R6NA 4DO2A 2DQ3A 3E83A 3I55V 3CC4V 4GX0A 1B6QA 2IJJA 3LSSA 3QO8A 3W7WA 2WLHA 4MTFA 1AI6A 3OR6C 4HYOA 1PL0A 1FXKC 1VQNV 2Y48A 5L3BA 1KP3A 1I5YA 4MTGA 3E89A 1BHAA 2DW4A 2JK5C 1DLBA 1Y4MA 3CYOA 3CXCU 3SYAA 1IXMA 2Q6AA 1EFRG 3EHBB 4MW8A 1WPXA 4BIUA 4JGSA 3JD3A 1KKDA 1KC8W 5KA5A 5CA3A 3AG4C 3ASNB 2GSMB 4KFMA 5IY5C 2V1DA 3SYOA 5FL7G 3G6EV 1V54C 4FMTA 4UUJC 1M57B 2JJ1G 5EBMC 1YTFB 3VOUA 2WLMA 3QNEA 4PA4A 3FYEB 5L3FA 2R9RB 3B8NA 3FB5C 3F5WC 1AJPA 5LGNA 3DTUB 1KP2A 1H8HG 4J9YB 4UXNA 1NBMG 2YSUB 4J9ZB 5B1AC 3ZRSA 4WFAV 2QA4V 1RM1C 2UXNA 4N23A 1JPXA 1BMFG 1K73W 1K33A 3E8BA 4KUMA 5IYDO 3CCSV 4OXSA 4ZKIA 3CP1A 4MVOA 5IYBO 3FB8C 3CCMV 1VQ8V 1OCCB 3SPGA 2EIJB 2WPDG 4PA7A 4G2KA 2A79B 4MVZA 1NJIW 1M56B 4GX2A 2Y69B 4P30A 3AG1C 4RAIA 3RW0A 3E8HA 4KP4A 2OTLV 2DQ0A 1ORQC 1SETA 2DYSB 2A0LA 3ABMB 3ZIAG 1YTFD 1PD3A 3ZRWB 5B1BB 3OE7G 2HR3A 3ABTA 3CC2V 3K9AA 1YI2V 1XL6A 5DN6G 1AI5A 4PDMA 2AHZA 1RPOA 2JIZG 2XASA 3DGEA 3QO5A 4H33A 1S77D 1FXVA 1K4CC 1SRYA 5H6QA 4RQEA 1R73A 2X7RB 2M7WA 4CZZA 1DF4A 4QE7A 1BHBA 3ETGA 3E8GA 3RBZA 2IU3A 3CD6V 1SZTA 4MSWC 5GW7A 4MT8A 4GT1A 1H38A 5IYCO 1F4NA 3T4ZA 1GTOA 3P32A 3SYCA 2JJ2G 2QKSA 1NH2D 1QLEB 3SYQA 5LHHA 5LGUA 2KB1A 1Y66A 3AG3B 1K5SA 2HJFC 1VQ6V 2MK3A 2X6AA 2WSSG 3AG2B 2ZR2A 1E1QG 1R6KA 4R50A 4LCUC 3OFNG 3WG7B 1SESA 2LP7A 5EC2C 1W0JG 1ZWIC 3OMAB 4TT3G 3SPIA 3ABLB 1QVGU 3HB3B 1J95A 5KA6A 3IGAC 4G28B 3F7VC 2WWWA 2QE7G 1AI4A 2WLIB 1DF5A 3ASNC 1VQLV 5EC1C 3QO7A 3SPJA 4PDRA 4BIZA 3OUFA 5L3DA 1R3IC 2EIKB 1COWG 4JYBA 3STZC 1GKFA 1M57C 4WFFA 5CMUA 3OW2U 3JD0A 3LNMB 2Z3YA 1VQ9V 3ETEA 5EBLC 3ETDA 2EILB 1CP9A 3W7UA 3SPHA 1K9MW 3E8FA 3ZMTA 4HZ3A 4F4LA 3FKSG 1R3LC 4X89A 4XDLA 1AI7A 1QCEA 5B1NA 2EBOA 5LBQA 1WLEA 3OAAG 2ITCC 4UV8A 1V55B 4JTCB 4UVAA 1RPRA 4UVBA 1F23A 4GX5A 1VQKV 3T4DA 3UM7A 2HLDG 1OCCC 1FFTB 2EIJC 4RO2A 4P2ZA 1TUEB 3K0GA 1JJ2U 3ZJZA 1M56C 2EIMB 1PNMA 2EINB 1L1FA 1G8MA 2Y69C 3GWOA 2JEUA 3WFVA 1NVPB 2ZXWB 3JCZA 2JDIG 4PA9A 4I9WA 4YXWG 3CCVV 4WFGA 2DYSC 4H37A 3ABMC 1KD1W 5KUMA 5B1BC 2XNDG 4MS2A 4U7OA 3ZMSA 5LHGA 5LHIA 1JQ0A 4XBFA 4R7CA 3OR7C 4LC1A 2UXXA 3JD2A 4PA6A 4HAMA 3SYPA 1P7BA 4QE9A 2WLIA 4L87A 1MOFA 1F51A 1THZA 3GB7C 3LDDA 3OMIB 5HFLA 2D3OW 2C2AA 2Q69A 3M99B 1NH2B 3E86A 4MVMA 2OT5A 1EZJA 3MD0A 3OMNB 4JAUA 4MTXA 3NXSA 4N21A 4QJFB 4MVRA 2GHYA 1G4YB 1S72V 3VBBA 1OCRB 1YIJV 1MG1A 4PDLA 2V7QG 1QLEC 1NVPD 1QBZA 2X6BA 1MABG 2WLJA 3AG3C 1Q81W 2EJRA 2HFEC 5B3SB 1UJWB 5L3EA 2CK3G 3AG2C 1NQTA 1GK9A 1OCZB 2JEXA 3WG7C 1H8EG 2NNUA 4MVSA 2HKOA 4XDJA 1AJNA 3LDEA 3K06A 1VQ5V 3ABLC 3AEIA 1FS0G 2HVKC 2H8PC 2X0LA 3ABUA 1KECA 1PNLA 4EKWA 2W6JG 4DXWA 3BEHA 4I5SA 2B1GA 1JOYA 2EIKC 4QPKA 3SJQC 2IW5A 3B8MA 4MW3A 1Q82W 1NKDA 2EILC 2HVJC 3K03A 5H6RA 1OHHG 1PKXA 2ZQMA 1BL8A 2B1IA 2ZDIA 3CPWU 2DWEC 2W6IG 1QR9A 1CEZA 2X6CA 2WLNA 1NR1A 3JD1A 3ABKB 1AJQA 2DYRB 2FTKA 3B77A 3T1CA 1VQPV 2LFSA 1GO3F 1V55C 4RQFA 1YJNV 3MHSC 2B5UA 3T2MA 4WF9V 2EZPA 1YITV 1DTOA 2OCCB 1S0VA 5EK0A 1R3KC 1VQMV 4P9OA 4RUEA 1M1KW 2EINC 2EIMC 3CCLV 3OUSA 2ZXWC 1W2BU 4FK5C 5E1AC 3ZMVA 2ATKC 2WLLB 2PI4A 4Q20A 3FYIB 3RVYA 3LDCA 1OCOB 3ASOB 4JASA 4JTDB 5H9CA 3X2QB 5J9PC 1MSWD 3K79A 3PJSK 3HPLC 3ML0A 4WFBV 5CBGA 2IH1C 3TETA 3OGCC 4RUFA 3G71V 4FPPA 2ZDIC 1K97A 2P7TC 3A0RA 1FXHA 4BW5A 2NLJC 4Z1MG 3E2EA 3FB7C 1N8RW 4GX1A 3ZN1A 1VQOV 1VQ7V 1JX9A 2YEVA 2XAHA 3D3IA 1OCRC 3IFXA 4U7NA 4MTOA 1K8AW 3D36A 2QM7A 1PNKA 2QTOA 4FIPC 1QLNA 4PA3A 2IH3C 4E2LA 2IJHA 5B3SC 3E35A 3ZMUA 1OCZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKM A;  2KB1 A;  2HFE C;  3E83 A;  3AG2 C;  1XL4 A;  4GX0 A;  2HJF C;  3RVZ A;  3STL C;  2X6A A;  2WLH A;  4MTF A;  3OR6 C;  4HYO A;  3WG7 C;  5CBH A;  4R50 A;  3FB6 C;  3K0D A;  4MVS A;  4LCU C;  4XDJ A;  3LDE A;  3K06 A;  5EC2 C;  4LBE C;  3ABL C;  2Q68 A;  2HVK C;  1ZWI C;  4QNH B;  2H8P C;  4MTG A;  3E89 A;  3SPI A;  4XDK A;  2A9H A;  2JK5 C;  5KUK A;  2WLL A;  1J95 A;  3R65 A;  3SYA A;  3LUT B;  2Q6A A;  4EKW A;  3IGA C;  4DXW A;  3BEH A;  4LP8 A;  4G28 B;  2HG5 C;  3F7V C;  4MW8 A;  2WLI B;  3KG2 A;  1R3J C;  3ASN C;  2EIK C;  4X8A A;  5EC1 C;  3SPJ A;  4PDR A;  1KKD A;  3SJQ C;  2Q67 A;  3AG4 C;  3OUF A;  2DWD C;  1R3I C;  4KFM A;  4MW3 A;  3STZ C;  5IY5 C;  1M57 C;  4WFF A;  4G27 B;  3SYO A;  2EIL C;  2HVJ C;  1V54 C;  3K03 A;  3LNM B;  3EFF K;  4UUJ C;  5EBM C;  1BL8 A;  3VOU A;  5EBL C;  2DWE C;  2WLM A;  4PA4 A;  4MVU A;  3SPH A;  2R9R B;  2X6C A;  3ABK C;  3E8F A;  2DYR C;  2WLN A;  4HZ3 A;  3F7Y C;  3FB5 C;  3F5W C;  4F4L A;  3X2Q C;  3T1C A;  1R3L C;  4X89 A;  4XDL A;  4WFH A;  4J9Y B;  1V55 C;  4J9Z B;  5B1A C;  3ZRS A;  2OCC C;  2K1E A;  3T2M A;  2ITC C;  4JTC B;  1JVM A;  3E8B A;  4GX5 A;  4R6Z A;  5EK0 A;  1R3K C;  4P9O A;  3T4D A;  3UM7 A;  4OXS A;  4RUE A;  4MVO A;  1OCC C;  2EIJ C;  2BOB C;  2EIN C;  2EIM C;  3FB8 C;  4RO2 A;  3TCU A;  4P2Z A;  3OUS A;  3K0G A;  2ZXW C;  3ZJZ A;  3SPG A;  3SPC A;  4PA7 A;  1M56 C;  4CBC A;  5E1A C;  2Y69 C;  2A79 B;  4JTA B;  3K04 A;  4MVZ A;  4R8C A;  1LNQ A;  2ATK C;  4PA9 A;  4I9W A;  1OCO C;  3ASO C;  2WLL B;  4GX2 A;  4P30 A;  4WFG A;  2AHY A;  2DYS C;  3AG1 C;  4H37 A;  3E8H A;  4RAI A;  3ABM C;  3RW0 A;  3RVY A;  3LDC A;  1ORQ C;  4JTD B;  5KUM A;  5B1B C;  5BZB A;  5EBW C;  5J9P C;  4MS2 A;  2A0L A;  3PJS K;  3HPL C;  4R7C A;  1S5H C;  5CBG A;  2IH1 C;  3OR7 C;  3TET A;  2WLK A;  1XL6 A;  3OGC C;  4RUF A;  4PDM A;  4PA6 A;  2AHZ A;  4X88 A;  2BOC C;  3SYP A;  1P7B A;  2P7T C;  4H33 A;  4QE9 A;  4BW5 A;  2NLJ C;  1K4C C;  2WLI A;  4P9P A;  3FB7 C;  3GB7 C;  4WFE A;  3LDD A;  1K4D C;  2W0F C;  4GX1 A;  2Q69 A;  4QE7 A;  4MVQ A;  2YEV A;  3E8G A;  3E86 A;  4MVM A;  3RBZ A;  3K08 A;  2ITD C;  1OCR C;  4MSW C;  3IFX A;  4MTO A;  4MVR A;  1G4Y B;  3T4Z A;  4PDL A;  1QLE C;  2ZD9 A;  2QTO A;  3SYC A;  4PA3 A;  2IH3 C;  2X6B A;  2QKS A;  4ZBM A;  3AG3 C;  2WLJ A;  3JYC A;  4PDV A;  3SYQ A;  5B3S C;  5CBF A;  4TWK A;  1OCZ C; 
#chains in the Genus database with same CATH topology
 1AB3 A;  2P90 A;  4DRX A;  3RYF B;  1BQ0 A;  3BFR A;  3P30 A;  1N36 O;  4LFA B;  1S76 D;  2Q68 A;  1VQ4 V;  2ZR3 A;  1XHX A;  3JD4 A;  2A9H A;  5KUK A;  3R65 A;  3LUT B;  4X20 A;  2Y4T A;  1K34 A;  1R3J C;  1KUQ A;  2QWN B;  2YUA A;  4DR3 O;  5IWA B;  3CCJ V;  4DR5 O;  3CC7 V;  5LGT A;  2LJ2 A;  4YJ3 B;  4TQD A;  2OTJ V;  1XNQ B;  4B3R O;  4WFH A;  1E79 G;  2A06 H;  3TJT A;  1BQZ A;  2K1E A;  5JJJ B;  1JVM A;  5HFM A;  5BR8 O;  2ZIO A;  3B4S A;  1VIB A;  2CE4 A;  4UCV A;  3ZRV A;  2Z5U A;  4JI3 B;  1HNZ B;  3TCU A;  2UXD B;  4TSF G;  2VQF O;  3SPC A;  2YEV B;  5KMG B;  1URF A;  1F7Y A;  1OCO C;  1I08 A;  1OZ0 A;  1H2K A;  1AP6 A;  3M8A A;  4TV9 B;  2PYJ A;  2IJK A;  1GM8 A;  3OM3 B;  1TA8 A;  4FM2 A;  5CB4 B;  2WLK A;  5DM6 V;  4DR4 O;  1IBM B;  2QSA A;  1XMQ B;  1CPY A;  3J7A U;  3CCR V;  2BTO A;  5FNV B;  1LR1 A;  1K4D C;  2W0F C;  5LMU B;  2JGD B;  5KHG A;  5K1X A;  1KQS U;  1M9N A;  2XT9 A;  1MMM A;  3A0H Z;  4PHZ A;  1SQG A;  1Q6H A;  5LP6 A;  4YHH O;  4FLV A;  4LWS A;  1F4M A;  1JFF B;  4X62 B;  4YY3 O;  3Q4H B;  3JYC A;  4DO2 A;  2DQ3 A;  3E83 A;  3I55 V;  1A32 A;  2JVD A;  4O2A B;  3QO8 A;  2WLH A;  1AR5 A;  4MTF A;  5GON B;  1AI6 A;  1AP5 A;  1PL0 A;  3BAA A;  1VQN V;  3CRQ A;  5L3B A;  4IGG A;  1I5Y A;  4MTG A;  3CYO A;  3CXC U;  5JVD B;  2E5L O;  3JD3 A;  4DR3 B;  4KFM A;  1AIL A;  5LXT A;  4DR5 B;  2JJ1 G;  3BA8 A;  5EBM C;  3VOU A;  3QNE A;  1SQX H;  3B8N A;  4YIO A;  1D2D A;  2OCH A;  3F5W C;  1EN5 A;  1R6T A;  4UXN A;  4ZI7 B;  2HEP A;  2QKA A;  3ZHS A;  1NBM G;  2UUC O;  1Y76 B;  4B3R B;  3HKD A;  5J2T B;  5BR8 B;  3E8B A;  3CCS V;  4B08 A;  4ZKI A;  4JI6 O;  3CCM V;  4X64 O;  4A5U B;  2VQF B;  4G2K A;  2A79 B;  4MVZ A;  4FFB A;  5JH7 B;  3RW0 A;  1SET A;  5BY1 A;  4IHJ A;  3ZRW B;  1ZUQ A;  2F4V O;  3N2G B;  3K9A A;  5DN6 G;  2XAS A;  3DGE A;  4DR4 B;  1R73 A;  1WAZ A;  4CZZ A;  1TUB B;  4JZG A;  4JI0 B;  2CTQ A;  2E74 B;  3RBZ A;  3DC6 A;  1H38 A;  2CH7 A;  4YHH B;  2ZE6 A;  3SYQ A;  4YY3 B;  4I0X B;  1Y66 A;  3AG3 B;  1K5S A;  2HJF C;  2ZNI A;  2WSS G;  3JAS B;  3BVO A;  4FVM A;  1E1Q G;  1R6K A;  4LF7 O;  3H1K H;  2Q5Z A;  4AI8 A;  3OFN G;  2LP7 A;  5EC2 C;  1W0J G;  4TT3 G;  2Q73 A;  4Z1V A;  2DMX A;  2VWJ A;  3DXR B;  1XNR O;  1J95 A;  3WB0 A;  4DV2 O;  2WWW A;  2RN9 A;  2CUG A;  5LYJ B;  2E5L B;  4U3J A;  3SPJ A;  4TV8 A;  4PDR A;  3BA9 A;  2GTS A;  2EIK B;  2ZM6 O;  5D5P A;  1Z2G A;  2Z3Y A;  3ETD A;  2EIL B;  4FLW A;  5IYZ A;  3E8F A;  3FKS G;  1R3L C;  1YEW A;  2EBO A;  2UUC B;  5EIB D;  1V55 B;  4JTC B;  5EZY B;  1RPR A;  4UVB A;  1F23 A;  4JI6 B;  4D7S A;  3K0G A;  4X64 B;  3ZJZ A;  2EIN B;  2EIM B;  3FAV A;  4DUZ O;  3G6B A;  1G8M A;  3GWO A;  1NVP B;  3CCV V;  4WFG A;  4W4L A;  1KD1 W;  5KUM A;  4U7O A;  3OTO O;  3JCU Z;  1JQ0 A;  2F4V B;  3OR7 C;  4PA6 A;  4J11 A;  3SYP A;  4X1I B;  4L87 A;  1PP9 H;  3GB7 C;  4FZ0 A;  3LDD A;  2Q69 A;  3M7M X;  4LFC O;  2YI8 A;  1NH2 B;  3NXS A;  4PI0 A;  3VBB A;  3E22 B;  5EYP B;  1NVP D;  2X6B A;  1MAB G;  2P4K A;  3AG3 C;  4FZ1 A;  1Y6X A;  1UJW B;  2HFE C;  4FM0 A;  2CK3 G;  1NQT A;  3ZS8 C;  4PD4 F;  2EUL A;  1H8E G;  5EIB C;  4LF7 B;  3OTF A;  3LDE A;  3R66 A;  1MNG A;  1FS0 G;  3ABU A;  3NR7 A;  2Q0O C;  4O4J B;  2L35 A;  3D8C A;  3JAK B;  2W6J G;  1XNR B;  2O57 A;  4DXW A;  1Q90 D;  2EJ7 A;  4DV2 B;  4CH6 A;  1IDS A;  2EIK C;  1BSM A;  3RFR A;  3B8M A;  2ZM6 B;  2EIL C;  1OV9 A;  3D3Q A;  2HVJ C;  2YXH A;  1BS3 A;  2W6I G;  4PI2 A;  2HJD A;  2WLN A;  1KU9 A;  3JD1 A;  1AJQ A;  2NN4 A;  3T1C A;  3B77 A;  2LFS A;  3RYH A;  5A9G A;  1V55 C;  1YJN V;  3MHS C;  1DK1 A;  3P3P A;  1S0V A;  4NVP A;  4P9O A;  2QDO A;  1M1K W;  2EIN C;  2EIM C;  4K35 A;  3CCL V;  1M4U A;  5E1A C;  4DUZ B;  4DV1 O;  5LMN O;  1O9H A;  4Q20 A;  3B2E E;  3L9D A;  4LFB O;  4JAS A;  3ASO B;  4X20 B;  4FLZ A;  3K79 A;  5GTH Z;  3OTO B;  3RN4 A;  3S3X A;  2BTQ B;  1BE3 H;  4X65 O;  3TET A;  2ADQ B;  2UUB O;  1FXH A;  3CS5 A;  2KSD A;  3E2E A;  1N8R W;  3T1Y O;  3RT3 C;  1IX9 A;  2LGW A;  1AVM A;  1JX9 A;  4LFC B;  2KKW A;  4EFB A;  3D3I A;  4HNA B;  1PNK A;  4DV0 O;  5C8Y A;  4PA3 A;  2IH3 C;  3SGI A;  3CSX A;  1JA8 A;  3BPZ A;  2FML A;  3UKM A;  4JYY A;  4IYH A;  3AK2 A;  2YIA A;  4J7J A;  2P06 A;  5CA1 A;  3FB6 C;  2OYQ A;  1VF5 B;  3H9V A;  5IJ0 A;  2XAJ A;  4LF4 B;  1YZB A;  4JYC A;  4ZOL A;  3W7S A;  4LP8 A;  5C93 A;  3TK1 A;  3KG2 A;  4ASU G;  4X8A A;  3HKC A;  1EBO A;  4O4H A;  1G1X B;  2Q67 A;  3BY6 A;  1YSC A;  2RQ6 A;  3SR2 C;  4ZIB A;  4G27 B;  2CDY A;  3AG4 B;  1E1R G;  2VS0 A;  5IY5 B;  2JS5 A;  3HR0 A;  5H5N A;  1QVF U;  3F7Y C;  5L3C A;  2QM4 A;  3L71 H;  3CHX A;  1PM9 A;  2QWR B;  2XAF A;  5J2U A;  2EZO A;  4GKK O;  4IIJ A;  3JAT B;  4O4I A;  4JAA A;  4FM1 A;  2F43 G;  4X1K B;  1MZE A;  1GMG A;  4DV1 B;  3ASO C;  4TUY A;  5LMN B;  4OX9 O;  2AHY A;  4UV9 A;  1VF6 A;  2FYU H;  2PI5 A;  4LFB B;  1FXK A;  5L3G A;  1YJ9 V;  1Q7Y W;  2UU9 O;  2ILM A;  3JSN A;  2UUA O;  3I56 V;  1SER A;  3UO3 A;  1GN6 A;  4X65 B;  2IJI A;  3I5D A;  5CA0 A;  2BOC C;  1HWY A;  2UUB B;  5LXT B;  3ZCC A;  4O2B A;  4WFE A;  2PZS A;  4JYA O;  3T1Y B;  4TQF A;  1GM9 A;  2LW1 A;  1GRJ A;  1IBK O;  4PEL A;  1RFY A;  3J81 N;  1HNW B;  3K08 A;  1YJW V;  2ITD C;  3HKD B;  2P67 A;  4B3T O;  2ZD9 A;  4DV0 B;  2LFR A;  4ZBM A;  2XAQ A;  2ZT9 B;  1QQC A;  3VQV A;  3CC4 V;  2IJJ A;  1OJH A;  4FFB B;  3OR6 C;  1WPB A;  2UXC O;  2UXB O;  2GUZ A;  3N2K A;  1T5E A;  1KP3 A;  1NTM H;  4JI5 O;  1BHA A;  2JK5 C;  1DLB A;  4DR2 O;  3SYA A;  2Q6A A;  1Q5O A;  4JI1 O;  4JGS A;  4DR1 O;  5KAI Z;  1KC8 W;  3AG4 C;  4J7K A;  2Y4U A;  3ASN B;  2GSM B;  1H2M A;  5IY5 C;  5FL7 G;  3JAL B;  4LF8 O;  1VMG A;  1N0N A;  2WLM A;  4PA4 A;  3FYE B;  4LNU B;  1P49 A;  3RYC B;  2CH7 B;  3FB5 C;  5AG2 A;  1FPO A;  4DV6 O;  1H8H G;  2YSU B;  4WFA V;  2QA4 V;  1N32 O;  1WA8 B;  4N23 A;  4GKK B;  1K33 A;  4I55 A;  4KUM A;  4LH7 A;  2BSK A;  4F6R A;  1FJG O;  4I9Q A;  4D7T A;  1IVS A;  5B66 Z;  3K5M A;  3SPG A;  2EIJ B;  2WPD G;  2Q8V A;  1M56 B;  4OX9 B;  3KKY A;  1MA1 A;  2DYS B;  1XQ8 A;  3WB2 A;  1PD3 A;  2UU9 B;  1Y67 A;  5B1B B;  4U3J B;  3ZED A;  2HR3 A;  3ABT A;  3CX5 F;  4DK1 A;  2UUA B;  1YI2 V;  1XL6 A;  1AI5 A;  1XEQ A;  2BE3 A;  4PDM A;  1RPO A;  4UCS A;  2YIB A;  4H33 A;  4I50 B;  1S77 D;  5H6Q A;  1VF7 A;  5IYZ B;  4JYA B;  1DF4 A;  4QE7 A;  1IBK B;  4DV3 O;  1WP8 A;  1I0H A;  1BHB A;  4Z2W A;  2Y0P A;  4GT1 A;  3RGB A;  4B3T B;  4ICG A;  3VQY A;  1QLE B;  4PV1 B;  4JV5 O;  1ZSP A;  3HKE A;  5D5Q A;  2MK3 A;  3PN1 A;  3AG2 B;  3CB2 A;  2UXC B;  1NTK H;  2UXB B;  3TXS A;  4LCU C;  1US6 A;  1SES A;  4KXR A;  1TAE A;  4JI0 O;  4O4L B;  5KX5 B;  2N74 A;  1HP8 A;  4UCO A;  2LW7 A;  4JI5 B;  3ABL B;  4U3F H;  4DR2 B;  1LUW A;  5TIS Z;  3QVN A;  3F7V C;  1XMO O;  4JI1 B;  2QE7 G;  3ASN C;  1VQL V;  3QO7 A;  3ZHU A;  4BIZ A;  4DR1 B;  3STZ C;  4LF8 B;  3LNM B;  3ZHT A;  2YS8 A;  1GAX A;  2AXT Z;  1CP9 A;  1K9M W;  3ZMT A;  4F4L A;  4ZHQ A;  4DV6 B;  1ZX3 A;  1AI7 A;  3C3S A;  1N32 B;  3G80 A;  5LBQ A;  1WLE A;  4UV8 A;  4GX5 A;  4I4T A;  2Q7G A;  3CRR A;  3T4D A;  1FJG B;  2EIJ C;  4RO2 A;  1TUE B;  1M56 C;  2ADP A;  1L1F A;  4K8X A;  4K8Z A;  3WFV A;  1EN4 A;  2ZXW B;  1SKV A;  2DYS C;  5KLV H;  5B1B C;  3ZMS A;  3ZHQ A;  4JI2 O;  2M6Y A;  3SJC C;  4HAM A;  1XI1 A;  4QE9 A;  1F51 A;  1L0N H;  1ZTE A;  2D3O W;  2C2A A;  3CRC A;  4DV3 B;  4MVM A;  2OT5 A;  3MD0 A;  3OMN B;  4JAU A;  4NB5 A;  4QJF B;  1G4Y B;  4LF9 O;  1OCR B;  2ODM A;  1MG1 A;  2Q9L A;  4X1Y A;  1QLE C;  1QBZ A;  1I94 O;  1YVW A;  4D6T H;  2AZ2 A;  1SC5 B;  4JV5 B;  3AG2 C;  1M5I A;  1GK9 A;  3CJH A;  2LQT A;  2Q0A A;  1RSO A;  4YJ2 A;  3K06 A;  1VQ5 V;  3ABL C;  3AEI A;  2HVK C;  2H8P C;  1KEC A;  1PNL A;  1O9G A;  2QWP B;  3BEH A;  1XBL A;  1XMO B;  4UFZ A;  3K03 A;  5H6R A;  1OHH G;  1PKX A;  1BL8 A;  3P3N A;  3VQW A;  2VWK A;  2X6C A;  1H2L A;  3DC5 A;  4AQY O;  1QNM A;  3ABK B;  2DYR B;  2FTK A;  4UB6 Z;  1VQP V;  5C8Y B;  1SS3 A;  3FD9 A;  2N05 A;  2B5U A;  4DUY O;  4WF9 V;  2EZP A;  2OCC B;  2QGN A;  1R3K C;  1VQM V;  5CA1 B;  4JZ2 A;  3K58 A;  2ZXW C;  5IJ0 B;  3ZMV A;  1H2S B;  2P5O A;  5K1P A;  2ATK C;  1XOU A;  3FYI B;  3LDC A;  5H9C A;  3X2Q B;  4YJ3 A;  1X4T A;  1MSD A;  4JI2 B;  3HKC B;  5JJN B;  5CBG A;  1N4C A;  4O4H B;  2IH1 C;  3ZBH A;  1Q43 A;  1K97 A;  3A0R A;  5BMV A;  1IZ3 A;  2YIC A;  1XDC A;  2YEV A;  4E4E A;  3CEI A;  1OCR C;  2KG7 A;  2LO1 A;  4U7N A;  4MTO A;  1EM1 A;  4J41 A;  5J2U B;  1K8A W;  4LF9 B;  1NS1 A;  3D36 A;  1QLN A;  1I94 B;  2IJH A;  4O4I B;  1MZF A;  4LR3 A;  5LA6 B;  2P4V A;  4NTX A;  3H1L H;  1FFX B;  1XL4 A;  2A7W A;  3CE2 A;  2CTR A;  4TUY B;  5FNV A;  3ZN0 A;  1FXK B;  1XIL A;  4J7Z A;  4LBE C;  5JQG B;  3IC7 A;  3H01 A;  4JPR A;  2JGD A;  1ZL8 A;  1VAR A;  1HNX O;  3W7T A;  5CA0 B;  5JJE B;  2HG5 C;  2RNB A;  4ABM A;  4H0L B;  2QEX V;  1K3E A;  1JFF A;  3Q4H A;  2PTM A;  2DWD C;  4WBN A;  2NR5 A;  3MHH C;  1SZX A;  1XHZ A;  1GN4 A;  3L73 H;  2IU0 A;  3ZRX A;  1V54 B;  1IXB A;  1VEW A;  3ABK C;  4DR6 O;  2DYR C;  4GCZ A;  4LF4 O;  4AQY B;  4JF3 A;  2P6J A;  1NR7 A;  4F6E A;  1AR1 B;  1W0K G;  3G4S V;  1J5E O;  4X9Q A;  2OCC C;  2F23 A;  4DUY B;  5B1A B;  2N04 A;  4R6Z A;  2OIG A;  1K5Q A;  4GUN A;  3K3W A;  5ITZ B;  1TVK A;  2AGA A;  4JTA B;  4R8C A;  4CS2 A;  2QTS A;  1Z5W A;  3CCU V;  3X2Q C;  3FX7 A;  3A8T A;  3K5O A;  2G38 A;  2JS3 A;  1ROP A;  2R72 A;  1S5H C;  2B9Z A;  5CN0 A;  4NTY A;  5J2T A;  2MW2 B;  4DRX B;  4QPJ A;  3OEH G;  1ARO P;  3CCE V;  1WJZ A;  1Q6I A;  4K0K O;  1Y74 A;  2CTP A;  3L75 H;  1S3J A;  2XOK G;  1YXB A;  4UCU A;  2XAG A;  5JH7 A;  2E76 B;  3CRA A;  4I55 B;  5B1O A;  1QR8 A;  2BSK B;  3ZRW A;  4F6R B;  4TWK A;  1R6N A;  4GX0 A;  1B6Q A;  3LSS A;  1VF6 C;  1FXK C;  3APQ A;  1HNW O;  3OGI B;  3E89 A;  2DW4 A;  1RP3 B;  1HNX B;  1Y4M A;  1IXM A;  1XUQ A;  2XHB A;  1EFR G;  3EHB B;  3ETQ A;  4MW8 A;  1WPX A;  1IBL O;  3T1H O;  2RJZ A;  5KA5 A;  2Q7H A;  4I0X A;  3SYO A;  1IUR A;  1V54 C;  4FMT A;  1WN7 A;  4UUJ C;  1SQQ H;  3UT5 A;  3JAS A;  3C3T A;  1Q6U A;  2R9R B;  4GKJ O;  4DR6 B;  1AJP A;  3DTU B;  2YI9 A;  1KP2 A;  2FKX A;  4J9Y B;  5B1A C;  3ZRS A;  1J5E B;  1WB8 A;  2QJ1 A;  1K73 W;  2L6L A;  5IYD O;  3H1J H;  5LYJ A;  4MVO A;  3FB8 C;  1VQ8 V;  5IE9 A;  5JCO C;  2YIB D;  1WB7 A;  4CH3 A;  4PA7 A;  4NR1 A;  1NJI W;  3TGU H;  4GX2 A;  2Y69 B;  4RAI A;  1FKA O;  3E8H A;  5LP6 B;  3U0Z A;  2RCV A;  3K59 A;  4LWS B;  1B04 A;  4X66 O;  2A0L A;  3ABM B;  3ZIA G;  2QKC A;  4CS4 A;  1JJO A;  5KHI A;  3QO5 A;  4KHP O;  2DE0 X;  1FXV A;  1K4C C;  1SRY A;  3KZI Z;  2M7W A;  2DOS A;  1LUV A;  4RWU A;  4K0K B;  4ZHQ B;  2IU3 A;  4TOI A;  3CD6 V;  4MSW C;  5GW7 A;  4IT5 A;  3JAR A;  5IYC O;  1F4N A;  3T4Z A;  3WB1 A;  4DV4 O;  2PUS A;  3P32 A;  3SYC A;  1HDJ A;  4AHC A;  2DN9 A;  2HHH O;  1VQ6 V;  1SQV H;  1WNS A;  1P84 F;  4R50 A;  2QWO B;  1X59 A;  3WG7 B;  2CGO A;  4CC6 A;  2E3C A;  3HKB A;  3SPI A;  1QVG U;  3ZX6 A;  2AZ0 A;  2OWO A;  3F5T A;  2ZE7 A;  4G28 B;  1Q3E A;  4LF6 O;  1IBL B;  1AI4 A;  1DF5 A;  1FAF A;  3T1H B;  1Z5V A;  3OUF A;  5L3D A;  1COW G;  4JYB A;  1GKF A;  3U11 A;  5E79 Z;  4WFF A;  5CMU A;  3OW2 U;  3JD0 A;  2F66 C;  2CAZ C;  1VQ9 V;  3ETE A;  5EBL C;  4GKJ B;  4HBN A;  2D2C B;  4IHJ B;  4EFE A;  2GV9 A;  2OIE A;  1KBH A;  4XDL A;  3OAA G;  2ZIM A;  3LNN A;  3WU2 Z;  2QR4 A;  1RSO B;  2HLD G;  1FFT B;  4P2Z A;  2GBO A;  1SQP H;  1PNM A;  4KL1 A;  2Y69 C;  3O9O A;  3L72 H;  3A2F A;  5LP6 C;  2A3Q A;  2JDI G;  4I9W A;  4PA9 A;  4YXW G;  3ABM C;  1UPG A;  4X66 B;  5LHG A;  5LHI A;  2ETN A;  1SQB H;  4R7C A;  4BWA A;  2UXX A;  3JD2 A;  4KHP B;  2WLI A;  3K9S A;  2IBZ H;  1THZ A;  3OMI B;  3O65 A;  3KCX A;  1B06 A;  3H1H H;  4JI4 B;  1SF9 A;  4NYK A;  1KMI Z;  1VP7 A;  4MTX A;  4N21 A;  4MVR A;  2GHY A;  2V7Q G;  4DV4 B;  2CTW A;  5IJ9 A;  4TV8 B;  1Q81 W;  2BTQ A;  2GDS A;  2HHH B;  3C90 A;  3RYI A;  3FFQ A;  2YXY A;  3JSL A;  2JEX A;  3OT7 A;  3JAM N;  2K9P A;  3WG7 C;  2NNU A;  4MVS A;  5KHK A;  4BIO A;  2X0L A;  2Q4P A;  2F93 B;  4I5S A;  2B1G A;  4HNA A;  1JOY A;  4LF6 B;  4CH5 A;  4QPK A;  5BMV B;  3RWR D;  1PL4 A;  4MW3 A;  1Q82 W;  3FAV B;  4FFK A;  1NU1 H;  1WP7 A;  1HW7 A;  2ZQM A;  2B1I A;  2ZDI A;  3CPW U;  2DWE C;  1QR9 A;  1QU7 A;  2KG7 B;  1CEZ A;  1UFI A;  3AK1 A;  4OGQ B;  1D5A A;  3K5L A;  3IC9 A;  4YIP A;  4RQF A;  3H1I H;  3T2M A;  1YIT V;  3CXH F;  4B3M O;  5EK0 A;  2Y0I A;  4FK5 C;  1EN6 A;  1ZL8 B;  3U10 A;  3JAW A;  3GVM A;  3RVY A;  4BW9 A;  4DR7 O;  1MSW D;  3KCY A;  3HPL C;  4WFB V;  2YDE A;  4EB6 A;  4WBN B;  3BAB A;  2PY5 A;  3ICX A;  3JAT A;  4DW0 A;  3B09 A;  1NZ6 A;  2LGQ A;  1N36 B;  4X1K A;  4FLT A;  2ZCE A;  3IFX A;  2PF4 E;  2QTO A;  1BGY H;  4DV7 O;  4E2L A;  1SA0 A;  2AW9 A;  4UCR A;  3A0B Z;  5H2F Z;  3ZMU A;  5IT9 N;  2WA3 A;  1TVK B;  2E75 B;  1I5X A;  4QIW F;  3RVZ A;  3STL C;  3BCC H;  2H94 A;  5CBH A;  5LOV A;  3MAQ A;  1GM7 A;  3K0D A;  4EEQ A;  2YID A;  5LL6 Y;  1ENV A;  3RYH B;  4QNH B;  4XDK A;  1DGS A;  2WLL A;  4IL6 Z;  3L70 H;  3LSQ A;  1U97 A;  3CME V;  1CXZ B;  4B7E A;  3OD4 A;  4FLX A;  1Y74 B;  4J10 A;  3EFF K;  1H2G A;  5DEC A;  5FPO A;  4JAV A;  2QM8 A;  1FD9 A;  4MVU A;  4FLY A;  2KQX A;  3D36 C;  2ZE5 A;  5KAF Z;  3CMA V;  4PJ0 Z;  3OEE G;  1P4R A;  1JCH A;  1NT2 B;  5JWP A;  3CWB H;  4FJC C;  2WAM A;  5B5E Z;  2W0X A;  1I7F A;  1SQF A;  2EX3 A;  1Q86 W;  3CCQ V;  1RM1 B;  4B3M B;  3AK3 A;  3ZMZ A;  2BOB C;  3W7X A;  4CBC A;  3B40 A;  3JAL A;  3RYF A;  3K04 A;  4BAY A;  4NXM O;  1LNQ A;  1K92 A;  5F2V O;  4LNU A;  2R9I A;  1S5L Z;  3RYC A;  1K7D A;  5BZB A;  4DR7 B;  3AG1 B;  5EBW C;  1EZV H;  2FB5 A;  5IDJ A;  1M90 W;  3CRM A;  1WA8 A;  4X88 A;  2GTA A;  2YXL A;  4P9P A;  3UT5 B;  1L8D A;  1YDX A;  5FPR A;  4MVQ A;  1YHQ V;  4ZOL B;  2BCC H;  3SDL A;  4WCE V;  1Q8I A;  4DV7 B;  4PDV A;  2H3O A;  5CBF A;  2PYL A;  4H44 B;  4UVC A;  3N27 A;  3W7W A;  4I50 A;  4HYO A;  1N33 O;  1HR0 O;  4W4K A;  4B3S O;  2Y48 A;  5KMG A;  4K3A A;  3VQX A;  4TV9 A;  1QHT A;  4IIJ B;  4BIU A;  5CB4 A;  4FLU A;  1KKD A;  5CA3 A;  2V1D A;  3G6E V;  1M57 B;  1YTF B;  4J80 A;  5L3F A;  1BZK A;  2R9A A;  3JAR B;  3K5N A;  5LGN A;  4O4L A;  5KX5 A;  2WA4 A;  1NI8 A;  3BRC A;  4J9Z B;  1U96 A;  1RM1 C;  2UXN A;  1ZAU A;  4CC5 A;  1JPX A;  1BMF G;  4O2B B;  4OXS A;  3CP1 A;  1JR9 A;  4DK0 A;  5IYB O;  4DV5 O;  1OCC B;  4O2A A;  3K57 A;  2Q7E A;  3HKB B;  3EXA A;  5GON A;  4NXM B;  4P30 A;  3AG1 C;  4KP4 A;  2ZKO A;  4Q6G A;  2OTL V;  1N0J A;  1ORQ C;  2DQ0 A;  2XTA A;  2VRZ A;  1YTF D;  2FL4 A;  3OE7 G;  3CC2 V;  3J80 N;  2AHZ A;  2JIZ G;  2QWQ B;  3GWK C;  4CH4 A;  4QGP A;  4LF5 O;  5JVD A;  3ZHR A;  4RQE A;  2HP8 A;  2GUZ B;  4NXN O;  2X7R B;  3N2K B;  1GH6 A;  3DSQ A;  1B3Q A;  3ETG A;  3E8G A;  5KHH A;  1SZT A;  4MT8 A;  3AG7 A;  1GTO A;  2JJ2 G;  2QKS A;  1NH2 D;  4DW1 A;  1YCI A;  4ZI7 A;  4IYI A;  1Y76 A;  4L8J A;  5LHH A;  4GZR B;  5LGU A;  3TXQ A;  2KB1 A;  2X6A A;  4J42 A;  2ZR2 A;  1N33 B;  1HR0 B;  2V4D A;  4B3S B;  4JI8 O;  4AIL C;  2ZNJ A;  1ZWI C;  3OMA B;  3HB3 B;  4OPH A;  5KA6 A;  3IGA C;  2WLI B;  4BR6 A;  5EC1 C;  3G67 A;  3N2G A;  5GTI Z;  1R3I C;  2VQE O;  2JGU A;  1M57 C;  1R1B A;  5DED A;  1PV0 A;  3THO A;  3W7U A;  3SPH A;  4I7Z B;  4HZ3 A;  1TUB A;  5IJ9 B;  1BCC H;  4X89 A;  1QCE A;  1FYJ A;  4JI7 O;  5B1N A;  2ITC C;  4UVA A;  1L0L H;  3RYI B;  1H2N A;  4UCT A;  3UO2 A;  3IJ4 A;  1VQK V;  3UM7 A;  1OCC C;  1XRE A;  4DV5 B;  1JJ2 U;  2JEU A;  3JCZ A;  1N34 O;  4H37 A;  1W59 A;  3S3W A;  1JMK C;  2RDC A;  2XND G;  4MS2 A;  2JRI A;  2RMK B;  4GLX A;  3BHP A;  4XBF A;  3ZHV A;  4LC1 A;  3DXR A;  2ZIN A;  3HKE B;  3UCS C;  1P7B A;  2F95 B;  1PPJ H;  4LF5 B;  2XUM A;  1MOF A;  4DYL A;  4NXN B;  3QF7 A;  5HFL A;  3QTC A;  3M99 B;  3E86 A;  1V9P A;  1EZJ A;  5KHJ A;  1S72 V;  1YIJ V;  5A2Q N;  4PDL A;  2P22 C;  2WLJ A;  4NKG B;  3MDS A;  2EJR A;  5B3S B;  5EZY A;  5L3E A;  1OCZ B;  1P7G A;  1GN2 A;  4H13 B;  1KYO F;  4LFA O;  2HKO A;  4JI4 O;  3JAW B;  3LSU A;  4XDJ A;  3SJB C;  1AJN A;  4JI8 B;  2R70 A;  3SJA C;  4EB6 B;  4EKW A;  4I4T B;  1ZLZ A;  5FLX N;  5BXZ A;  1TGO A;  5LA6 A;  3SJQ C;  2IW5 A;  5IWA O;  3L74 H;  1YF2 A;  4OPA A;  2VQE B;  1NKD A;  1FFX A;  2Z0A A;  3IAY A;  4C7U A;  4X1I A;  2CGN A;  2ARH A;  1XNQ O;  1NR1 A;  1D5N A;  5JQG A;  1SA0 B;  1GO3 F;  4LH6 A;  1BT8 A;  4JI7 B;  1G6U A;  3APO A;  1AR4 A;  1KB9 F;  3E22 A;  3EVK A;  1DTO A;  5EYP A;  2DJV A;  4NTW A;  5LOV B;  4RUE A;  4JI3 O;  4GYC B;  1HNZ O;  1GN3 A;  2UXD O;  3OUS A;  1W2B U;  1N34 B;  2WLL B;  2PI4 A;  2PGG A;  4X1Y B;  1OCO B;  4JTD B;  4B7K A;  5J9P C;  1S5J A;  3PJS K;  1KKC A;  3ML0 A;  4O4J A;  3JAK A;  3OGC C;  4RUF A;  3G71 V;  4FPP A;  3CJH B;  2ZDI C;  1IBM O;  2P7T C;  3UQ8 A;  1XMQ O;  4BW5 A;  2NLJ C;  4Z1M G;  3FB7 C;  4YJ2 B;  5LMU O;  2F1M A;  4GX1 A;  4UB8 Z;  3ZN1 A;  1M93 A;  1VQO V;  5ITZ A;  1VQ7 V;  4CS3 A;  2ZE8 A;  5JCO A;  2IM9 A;  2XAH A;  3QG5 A;  2YC0 A;  4FIP C;  2QM7 A;  4X62 O;  5B3S C;  1NTZ H;  3E35 A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 3UKM A;  1XL4 A;  1I5X A;  2P90 A;  4QIW F;  3RVZ A;  3STL C;  5CBH A;  2H94 A;  3FB6 C;  1GM7 A;  3K0D A;  3P30 A;  3ZN0 A;  1S76 D;  1FXK B;  4LBE C;  2XAJ A;  2Q68 A;  1ENV A;  1VQ4 V;  3IC7 A;  2ZR3 A;  3H01 A;  4JPR A;  4QNH B;  4XDK A;  3JD4 A;  2A9H A;  5KUK A;  3W7T A;  2WLL A;  3R65 A;  4JYC A;  3LUT B;  3W7S A;  3LSQ A;  4LP8 A;  2HG5 C;  5C93 A;  3CME V;  3TK1 A;  1K34 A;  2QEX V;  3KG2 A;  1K3E A;  1R3J C;  4X8A A;  4ASU G;  1EBO A;  2Q67 A;  3CCJ V;  2DWD C;  3BY6 A;  1YSC A;  3MHH C;  4G27 B;  3AG4 B;  1E1R G;  3EFF K;  5IY5 B;  1H2G A;  2IU0 A;  3CC7 V;  4JAV A;  3ZRX A;  1QVF U;  2QM8 A;  5LGT A;  1V54 B;  4MVU A;  3ABK C;  2DYR C;  4GCZ A;  3CMA V;  3F7Y C;  5L3C A;  2OTJ V;  3OEE G;  1P4R A;  4JF3 A;  2P6J A;  1JCH A;  1NR7 A;  2XAF A;  1AR1 B;  1W0K G;  4WFH A;  1E79 G;  3G4S V;  4FJC C;  2OCC C;  2K1E A;  2WAM A;  1JVM A;  2EZO A;  5B1A B;  5HFM A;  1Q86 W;  3CCQ V;  1RM1 B;  4R6Z A;  1K5Q A;  3ZRV A;  2Z5U A;  3ZMZ A;  2BOB C;  3TCU A;  3K3W A;  3W7X A;  4TSF G;  4CBC A;  3SPC A;  2YEV B;  2F43 G;  4JTA B;  3K04 A;  4BAY A;  1GMG A;  4R8C A;  1LNQ A;  1K92 A;  1OCO C;  3ASO C;  3CCU V;  1OZ0 A;  3X2Q C;  2AHY A;  2R9I A;  4UV9 A;  2PI5 A;  2IJK A;  1FXK A;  1K7D A;  5BZB A;  5L3G A;  1GM8 A;  3AG1 B;  5EBW C;  3OM3 B;  1YJ9 V;  1ROP A;  1Q7Y W;  1S5H C;  5IDJ A;  3I56 V;  1SER A;  1M90 W;  2WLK A;  5CN0 A;  2IJI A;  4X88 A;  2BOC C;  5DM6 V;  1HWY A;  1CPY A;  4QPJ A;  3OEH G;  4P9P A;  1ARO P;  3ZCC A;  3CCR V;  3CCE V;  4WFE A;  1K4D C;  2W0F C;  1GM9 A;  4MVQ A;  4PEL A;  1KQS U;  1M9N A;  1S3J A;  1YHQ V;  2XOK G;  3K08 A;  1YJW V;  2ITD C;  2XAG A;  2P67 A;  4WCE V;  2ZD9 A;  1F4M A;  5B1O A;  1QR8 A;  2LFR A;  4ZBM A;  3ZRW A;  3JYC A;  4PDV A;  5CBF A;  4TWK A;  4UVC A;  2XAQ A;  1R6N A;  4DO2 A;  2DQ3 A;  3E83 A;  3I55 V;  3CC4 V;  4GX0 A;  1B6Q A;  2IJJ A;  3LSS A;  3QO8 A;  3W7W A;  2WLH A;  4MTF A;  1AI6 A;  3OR6 C;  4HYO A;  1PL0 A;  1FXK C;  1VQN V;  2Y48 A;  5L3B A;  1KP3 A;  1I5Y A;  4MTG A;  3E89 A;  1BHA A;  2DW4 A;  2JK5 C;  1DLB A;  1Y4M A;  3CYO A;  3CXC U;  3SYA A;  1IXM A;  2Q6A A;  1EFR G;  3EHB B;  4MW8 A;  1WPX A;  4BIU A;  4JGS A;  3JD3 A;  1KKD A;  1KC8 W;  5KA5 A;  5CA3 A;  3AG4 C;  3ASN B;  2GSM B;  4KFM A;  5IY5 C;  2V1D A;  3SYO A;  5FL7 G;  3G6E V;  1V54 C;  4FMT A;  4UUJ C;  1M57 B;  2JJ1 G;  5EBM C;  1YTF B;  3VOU A;  2WLM A;  3QNE A;  4PA4 A;  3FYE B;  5L3F A;  2R9R B;  3B8N A;  3FB5 C;  3F5W C;  1AJP A;  5LGN A;  3DTU B;  1KP2 A;  1H8H G;  4J9Y B;  4UXN A;  1NBM G;  2YSU B;  4J9Z B;  5B1A C;  3ZRS A;  4WFA V;  2QA4 V;  1RM1 C;  2UXN A;  4N23 A;  1JPX A;  1BMF G;  1K73 W;  1K33 A;  3E8B A;  4KUM A;  5IYD O;  3CCS V;  4OXS A;  4ZKI A;  3CP1 A;  4MVO A;  5IYB O;  3FB8 C;  3CCM V;  1VQ8 V;  1OCC B;  3SPG A;  2EIJ B;  2WPD G;  4PA7 A;  4G2K A;  2A79 B;  4MVZ A;  1NJI W;  1M56 B;  4GX2 A;  2Y69 B;  4P30 A;  3AG1 C;  4RAI A;  3RW0 A;  3E8H A;  4KP4 A;  2OTL V;  2DQ0 A;  1ORQ C;  1SET A;  2DYS B;  2A0L A;  3ABM B;  3ZIA G;  1YTF D;  1PD3 A;  3ZRW B;  5B1B B;  3OE7 G;  2HR3 A;  3ABT A;  3CC2 V;  3K9A A;  1YI2 V;  1XL6 A;  5DN6 G;  1AI5 A;  4PDM A;  2AHZ A;  1RPO A;  2JIZ G;  2XAS A;  3DGE A;  3QO5 A;  4H33 A;  1S77 D;  1FXV A;  1K4C C;  1SRY A;  5H6Q A;  4RQE A;  1R73 A;  2X7R B;  2M7W A;  4CZZ A;  1DF4 A;  4QE7 A;  1BHB A;  3ETG A;  3E8G A;  3RBZ A;  2IU3 A;  3CD6 V;  1SZT A;  4MSW C;  5GW7 A;  4MT8 A;  4GT1 A;  1H38 A;  5IYC O;  1F4N A;  3T4Z A;  1GTO A;  3P32 A;  3SYC A;  2JJ2 G;  2QKS A;  1NH2 D;  1QLE B;  3SYQ A;  5LHH A;  5LGU A;  2KB1 A;  1Y66 A;  3AG3 B;  1K5S A;  2HJF C;  1VQ6 V;  2MK3 A;  2X6A A;  2WSS G;  3AG2 B;  2ZR2 A;  1E1Q G;  1R6K A;  4R50 A;  4LCU C;  3OFN G;  3WG7 B;  1SES A;  2LP7 A;  5EC2 C;  1W0J G;  1ZWI C;  3OMA B;  4TT3 G;  3SPI A;  3ABL B;  1QVG U;  3HB3 B;  1J95 A;  5KA6 A;  3IGA C;  4G28 B;  3F7V C;  2WWW A;  2QE7 G;  1AI4 A;  2WLI B;  1DF5 A;  3ASN C;  1VQL V;  5EC1 C;  3QO7 A;  3SPJ A;  4PDR A;  4BIZ A;  3OUF A;  5L3D A;  1R3I C;  2EIK B;  1COW G;  4JYB A;  3STZ C;  1GKF A;  1M57 C;  4WFF A;  5CMU A;  3OW2 U;  3JD0 A;  3LNM B;  2Z3Y A;  1VQ9 V;  3ETE A;  5EBL C;  3ETD A;  2EIL B;  1CP9 A;  3W7U A;  3SPH A;  1K9M W;  3E8F A;  3ZMT A;  4HZ3 A;  4F4L A;  3FKS G;  1R3L C;  4X89 A;  4XDL A;  1AI7 A;  1QCE A;  5B1N A;  2EBO A;  5LBQ A;  1WLE A;  3OAA G;  2ITC C;  4UV8 A;  1V55 B;  4JTC B;  4UVA A;  1RPR A;  4UVB A;  1F23 A;  4GX5 A;  1VQK V;  3T4D A;  3UM7 A;  2HLD G;  1OCC C;  1FFT B;  2EIJ C;  4RO2 A;  4P2Z A;  1TUE B;  3K0G A;  1JJ2 U;  3ZJZ A;  1M56 C;  2EIM B;  1PNM A;  2EIN B;  1L1F A;  1G8M A;  2Y69 C;  3GWO A;  2JEU A;  3WFV A;  1NVP B;  2ZXW B;  3JCZ A;  2JDI G;  4PA9 A;  4I9W A;  4YXW G;  3CCV V;  4WFG A;  2DYS C;  4H37 A;  3ABM C;  1KD1 W;  5KUM A;  5B1B C;  2XND G;  4MS2 A;  4U7O A;  3ZMS A;  5LHG A;  5LHI A;  1JQ0 A;  4XBF A;  4R7C A;  3OR7 C;  4LC1 A;  2UXX A;  3JD2 A;  4PA6 A;  4HAM A;  3SYP A;  1P7B A;  4QE9 A;  2WLI A;  4L87 A;  1MOF A;  1F51 A;  1THZ A;  3GB7 C;  3LDD A;  3OMI B;  5HFL A;  2D3O W;  2C2A A;  2Q69 A;  3M99 B;  1NH2 B;  3E86 A;  4MVM A;  2OT5 A;  1EZJ A;  3MD0 A;  3OMN B;  4JAU A;  4MTX A;  3NXS A;  4N21 A;  4QJF B;  4MVR A;  2GHY A;  1G4Y B;  1S72 V;  3VBB A;  1OCR B;  1YIJ V;  1MG1 A;  4PDL A;  2V7Q G;  1QLE C;  1NVP D;  1QBZ A;  2X6B A;  1MAB G;  2WLJ A;  3AG3 C;  1Q81 W;  2EJR A;  2HFE C;  5B3S B;  1UJW B;  5L3E A;  2CK3 G;  3AG2 C;  1NQT A;  1GK9 A;  1OCZ B;  2JEX A;  3WG7 C;  1H8E G;  2NNU A;  4MVS A;  2HKO A;  4XDJ A;  1AJN A;  3LDE A;  3K06 A;  1VQ5 V;  3ABL C;  3AEI A;  1FS0 G;  2HVK C;  2H8P C;  2X0L A;  3ABU A;  1KEC A;  1PNL A;  4EKW A;  2W6J G;  4DXW A;  3BEH A;  4I5S A;  2B1G A;  1JOY A;  2EIK C;  4QPK A;  3SJQ C;  2IW5 A;  3B8M A;  4MW3 A;  1Q82 W;  1NKD A;  2EIL C;  2HVJ C;  3K03 A;  5H6R A;  1OHH G;  1PKX A;  2ZQM A;  1BL8 A;  2B1I A;  2ZDI A;  3CPW U;  2DWE C;  2W6I G;  1QR9 A;  1CEZ A;  2X6C A;  2WLN A;  1NR1 A;  3JD1 A;  3ABK B;  1AJQ A;  2DYR B;  2FTK A;  3B77 A;  3T1C A;  1VQP V;  2LFS A;  1GO3 F;  1V55 C;  4RQF A;  1YJN V;  3MHS C;  2B5U A;  3T2M A;  4WF9 V;  2EZP A;  1YIT V;  1DTO A;  2OCC B;  1S0V A;  5EK0 A;  1R3K C;  1VQM V;  4P9O A;  4RUE A;  1M1K W;  2EIN C;  2EIM C;  3CCL V;  3OUS A;  2ZXW C;  1W2B U;  4FK5 C;  5E1A C;  3ZMV A;  2ATK C;  2WLL B;  2PI4 A;  4Q20 A;  3FYI B;  3RVY A;  3LDC A;  1OCO B;  3ASO B;  4JAS A;  4JTD B;  5H9C A;  3X2Q B;  5J9P C;  1MSW D;  3K79 A;  3PJS K;  3HPL C;  3ML0 A;  4WFB V;  5CBG A;  2IH1 C;  3TET A;  3OGC C;  4RUF A;  3G71 V;  4FPP A;  2ZDI C;  1K97 A;  2P7T C;  3A0R A;  1FXH A;  4BW5 A;  2NLJ C;  4Z1M G;  3E2E A;  3FB7 C;  1N8R W;  4GX1 A;  3ZN1 A;  1VQO V;  1VQ7 V;  1JX9 A;  2YEV A;  2XAH A;  3D3I A;  1OCR C;  3IFX A;  4U7N A;  4MTO A;  1K8A W;  3D36 A;  2QM7 A;  1PNK A;  2QTO A;  4FIP C;  1QLN A;  4PA3 A;  2IH3 C;  4E2L A;  2IJH A;  5B3S C;  3E35 A;  3ZMU A;  1OCZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...