3ZJZA

Open-form navms sodium channel pore (with c-terminal domain)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ION TRANSPORT PROTEIN
publication title Role of the C-Terminal Domain in the Structure and Function of Tetrameric Sodium Channels.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zjzA00
2X6BA 4PDRA 1M57C 2BOCC 2DYSC 4J9YB 4XDKA 4QNHB 2WLLA 1JVMA 4WFFA 3AG4C 4PA7A 2A0LA 4RUEA 2QTOA 4LP8A 4PA4A 2Q6AA 3SPHA 4LCUC 3ABKC 3LNMB 3ZJZA 2JK5C 4PA6A 4LBEC 4XDJA 4R50A 5EBLC 3UM7A 2KB1A 2IH1C 3OR6C 3OUFA 4GX1A 4ZBMA 2WLJA 4P2ZA 3F5WC 1K4CC 3HPLC 4KFMA 3SYAA 2ZXWC 4MVZA 2BOBC 1ORQC 3AG1C 4R6ZA 4PDVA 2X6CA 1V54C 4QE7A 4RAIA 2AHZA 3SYQA 4RUFA 4BW5A 4UUJC 5B1AC 3ABMC 2IH3C 2A9HA 2K1EA 4X89A 3FB7C 3T4DA 4MW8A 3UKMA 3E86A 3RVYA 5EK0A 3K08A 4G28B 1P7BA 4GX0A 2HG5C 4J9ZB 3OGCC 4P9OA 2A79B 4DXWA 3K04A 3STLC 3FB6C 3LDEA 4PDMA 3LDDA 2YEVA 4XDLA 4HYOA 4H37A 2NLJC 2EIKC 4P9PA 3SPCA 5B3SC 4RO2A 4MVUA 3SPGA 2HVKC 4QE9A 4WFGA 3WG7C 2R9RB 1BL8A 4WFEA 4MTFA 4PA9A 3F7VC 4I9WA 1R3LC 2W0FC 3E89A 5EC1C 4G27B 3ABLC 2WLNA 1R3JC 3R65A 4MSWC 1J95A 5B1BC 2ZD9A 3E8GA 2Q68A 1S5HC 3ZRSA 1G4YB 1OCRC 3LUTB 3SYOA 2EIMC 1OCZC 4R8CA 3T4ZA 2WLMA 2DYRC 3E8FA 4MTGA 3IGAC 3ASOC 3SPJA 4PA3A 5CBHA 3TETA 5E1AC 4CBCA 1LNQA 2Q69A 4EKWA 1V55C 2P7TC 2EINC 2WLHA 4MTOA 3EFFK 4MW3A 3OUSA 4TWKA 3RW0A 1ZWIC 3T1CA 2HJFC 2H8PC 4JTAB 4WFHA 1OCCC 3BEHA 4P30A 4GX5A 4JTCB 3VOUA 3RVZA 3T2MA 3OR7C 3SJQC 2DWEC 3K03A 4F4LA 2Q67A 5EC2C 1OCOC 1XL4A 4MVSA 4MVMA 2DWDC 2ITCC 4X88A 2WLKA 3PJSK 5EBMC 3SYPA 3AG2C 2ITDC 4H33A 3ASNC 3FB8C 2HFEC 2OCCC 2QKSA 3E8HA 3GB7C 5BZBA 2WLIB 1M56C 4MVRA 3STZC 3K0DA 4R7CA 3SPIA 5J9PC 1KKDA 5CBGA 1R3IC 2ATKC 3KG2A 4GX2A 3F7YC 3RBZA 2WLLB 1XL6A 5IY5C 2X6AA 2Y69C 3E8BA 3E83A 2EIJC 4X8AA 1R3KC 4MVOA 4PDLA 2EILC 3X2QC 5CBFA 2HVJC 3AG3C 5KUMA 3SYCA 4JTDB 3TCUA 4MVQA 3IFXA 3LDCA 4MS2A 2WLIA 1K4DC 3FB5C 3K06A 5EBWC 2AHYA 3JYCA 3K0GA 4HZ3A 5KUKA 1QLEC 4OXSA
chains in the Genus database with same CATH superfamily
4XDKA 1ZSPA 2WLLA 3AG2B 4IIJB 4RUEA 4LH7A 2UXBO 2QTOA 1Q6HA 4D7TA 5LOVB 2CK3G 1HP8A 1Q43A 4RWUA 4H13B 4E2LA 5EBLC 5J2TA 2ZE6A 1PKXA 4BWAA 3H1IH 3FAVA 4FZ1A 4XBFA 2IU3A 3OMIB 1M1KW 4DYLA 2RNBA 1R6NA 3FB7C 3T4DA 2ZNIA 2B1GA 3B8NA 5BY1A 1PL0A 1HR0B 1P7BA 4GX0A 1P49A 4J9ZB 2DYSB 3J7AU 1JQ0A 2WPDG 3CRQA 3K59A 1FAFA 1DF5A 4KUMA 3ZRWB 3NR7A 3ABKB 1TUEB 4DW1A 1VQKV 1M4UA 1FXHA 1G6UA 4MTFA 4LNUA 3U10A 5B1BC 1HNXB 1N32O 5LYJB 4WCEV 2QJ1A 1BCCH 3DGEA 1JOYA 3OUSA 4RQFA 4X1KB 4WFHA 5LA6B 1EN5A 5GTHZ 3AEIA 4OX9O 3OR7C 1XMQB 5LYJA 1F7YA 3ML0A 3MDSA 3G6BA 4MVMA 1K5SA 2PZSA 2WLKA 4K0KB 3SYPA 1S3JA 4X1KA 2F66C 5LA6A 1LUVA 1WA8B 5B1AB 1QR9A 3TGUH 3K0DA 1IXBA 4JI6B 4JYAO 4DV6B 3KG2A 5J2UA 3E8BA 4X8AA 4PDLA 4TV9B 5LP6B 4AQYB 1NH2B 1WA8A 2F1MA 4NKGB 5EBWC 4JI5B 1OCOB 3LUTB 2KKWA 5IWAO 2R9AA 2RN9A 4WFFA 1BZKA 2QKCA 2XOKG 2A0LA 1YI2V 4YJ2B 4JI8B 1EBOA 5KMGB 4TV9A 1ZAUA 4LBEC 5ITZB 1SS3A 2PGGA 1VQ5V 1I0HA 4FIPC 4ZI7B 2F4VB 2BTQB 5LMNO 4OPHA 2EILB 4YJ2A 5KMGA 2KQXA 1RM1C 3CMEV 5EIBD 3O65A 2O57A 4D7SA 1HNZB 3LDEA 4ZI7A 5LGNA 2PUSA 2XNDG 2N04A 1L0LH 2QWOB 1AB3A 3AK2A 1I7FA 1H8EG 1N8RW 5DECA 4DV1O 3JSNA 3CRCA 1FJGO 2XAHA 2KG7B 2Q5ZA 4NTXA 3ABMB 4NVPA 3RW0A 1Q81W 2Q9LA 5KAIZ 3T1CA 4LF7B 4ZOLB 3ZN1A 3ZS8C 5B3SB 1EM1A 2KG7A 5BR8B 4LFCB 4H0LB 3JCZA 1H2KA 3AG2C 2P06A 2YXYA 3RYHB 4F6RB 4DV5B 3A0RA 3RYCB 2MK3A 3TK1A 1Q7YW 1GM7A 1JA8A 1R3IC 1ZL8B 1FD9A 1H2LA 3JAWB 2ZE7A 1N0JA 2LJ2A 5IJ0B 3RYFB 4PI0A 1R3KC 4MVOA 3RYHA 4DR3O 5IYZA 3TCUA 3RYCA 3LDCA 4FLYA 3FB5C 1G1XB 4J9YB 1AI5A 2ETNA 3RYIB 2DYSC 3JAWA 5IE9A 1OCRB 2HJDA 5IJ0A 2Q6AA 4LCUC 3ABKC 4PV1B 4KP4A 3RYFA 4JI0B 1BGYH 2LP7A 2IBZH 4UVBA 1AJNA 1W0KG 1DGSA 4KFMA 1H2MA 1AJQA 1D2DA 1Z2GA 3RYIA 2X6CA 2A7WA 2PYLA 4Z1VA 4DV2B 2VRZA 5JCOA 5H9CA 1NS1A 2PI5A 3KCXA 2PYJA 2JDIG 2CGOA 1VF5B 2E5LB 2Y0PA 2BTOA 5E79Z 4RO2A 4I5SA 1VQ4V 2BE3A 3WG7C 4C7UA 3H1LH 4PA9A 2W0FC 3QO8A 1JPXA 4NR1A 5LBQA 1QNMA 1YJNV 1FFXB 3IGAC 1DTOA 4U3JA 3ASOC 1SETA 1R6KA 1S5LZ 1QLEB 5C8YB 1ZWIC 2W0XA 3CB2A 3VOUA 5LP6C 3SJQC 3FYEB 4GT1A 4JI5O 3AK3A 1FFXA 4Z1MG 1OCOC 1P4RA 4AI8A 1U96A 3CCMV 5C8YA 5LMUB 2ITDC 4H33A 3OMNB 3FB8C 3NXSA 4JI8O 1V54B 1OCZB 5IT9N 1FYJA 3ZCCA 2P22C 1AVMA 4I55B 2EILC 3EVKA 3E22B 4MT8A 1GH6A 4MVQA 2CUGA 4FVMA 1N34B 1VQMV 5TISZ 4KL1A 1FPOA 1EN4A 3BA8A 2X6BA 1N33B 5L3BA 4UXNA 3CRMA 4FFKA 1WB8A 2OCHA 4EB6A 4LF4O 1M56B 2JS5A 3E22A 3JSLA 4J42A 1D5AA 3M7MX 4ZBMA 3W7XA 4X64B 2CAZC 3CMAV 1SQGA 2JGUA 4FJCC 2YIDA 4TUYB 4JAAA 3BY6A 1RPOA 4RUFA 4ZKIA 4DV3O 2XT9A 5B5EZ 3ABMC 2M6YA 3E86A 4G28B 1I08A 5A2QN 3CCVV 1AR5A 3AG4B 3APQA 4TUYA 1JFFB 4H37A 4LFCO 4DK1A 5B3SC 2Y0IA 4RQEA 4B3MO 1XBLA 4TQFA 5BMVB 3JALB 2WLNA 1R3JC 5IYBO 3CCUV 1W0JG 2EIJB 1FS0G 5H5NA 3BPZA 2GHYA 4UVAA 4NXNB 1HWYA 2ODMA 4R8CA 3T4ZA 1I94O 1K3EA 1VMGA 4JI1O 1JFFA 1WB7A 3CCJV 1IBLB 4I4TB 3UO3A 2VQFB 5BMVA 3JALA 1RSOA 1GN4A 4JTCB 1MZFA 3T2MA 1MSWD 2OIEA 3G67A 1YDXA 4F4LA 2ADQB 4GKKB 4MVSA 1HDJA 4LFBB 3L70H 1PV0A 2AZ0A 2EIMB 4YHHB 3FD9A 5GW7A 1S77D 2XAJA 2EINB 3ICXA 1VEWA 1MSDA 4B7KA 5IYDO 5LXTB 4U7NA 3C3SA 1IBMO 1S0VA 3JYCA 3JCUZ 4UCTA 2LQTA 4DR1B 2MW2B 2GBOA 4WFAV 2E5LO 5KHJA 4J11A 2GUZA 3ASNB 1IVSA 5LGTA 4LWSB 1X59A 5LXTA 5LHGA 1VF7A 3LNMB 1SF9A 1LR1A 1TGOA 1E79G 2IH1C 2P4KA 5HFLA 2GSMB 3SGIA 3ZN0A 5L3GA 1NR1A 4RAIA 2VWJA 1AR4A 4O4IB 3G6EV 2QM4A 4ZHQA 2YXHA 1KQSU 3RVYA 1H8HG 4LF6B 3STLC 3CE2A 1KECA 3LSSA 1RP3B 4O4HB 4O4IA 4JV5O 4FLUA 3VQYA 3HKEB 4L87A 5FPRA 3R65A 1ZUQA 4DR6B 4O2BB 1YZBA 2RMKB 3AG1B 3THOA 3K3WA 5IYCO 2JRIA 2JGDB 1OCZC 2Q69A 2YI8A 3AK1A 4O4HA 5CMUA 1MZEA 3HKEA 1BQZA 1WJZA 2GDSA 4FLVA 3BRCA 5L3CA 2JGDA 2W6IG 3D8CA 3CJHB 4I7ZB 1ENVA 3WU2Z 3ZMZA 1DK1A 3RWRD 2HFEC 3LSUA 4X20A 2ARHA 1M56C 4JI7B 1FFTB 5GONB 4MVRA 4JYBA 5JH7A 1KKDA 1GN2A 4UB6Z 3WB1A 1XL6A 3CJHA 2X6AA 2Y69C 1Q5OA 4GLXA 3HKBB 3W7SA 3JD1A 4LH6A 4LF8O 2PTMA 2E76B 4TT3G 1J5EB 2XAGA 3IFXA 1K4DC 5HFMA 4P30A 2B1IA 2BOCC 1XREA 3AG4C 4JI4O 4UV9A 1MA1A 4IGGA 3CCLV 4K8XA 2ZE5A 4TSFG 4XDJA 4DR7B 2UUBO 1WP8A 3FYIB 4P2ZA 3F5WC 3CEIA 4IHJB 4MVZA 1P84F 1KU9A 2WA3A 1R73A 4HAMA 1XMOB 4B3SB 3K57A 1MG1A 1QHTA 1SQPH 3W7WA 1YITV 3CXHF 5KLVH 5EK0A 4NTYA 3OGCC 1M5IA 4IHJA 4GKKO 1YXBA 4WF9V 3JATA 4LFBO 4WFEA 4JYYA 4YY3B 4LF5O 3VQWA 4X1IA 2ILMA 3HB3B 1YTFD 1Q90D 2EIMC 3SJBC 4LNUB 4DR4O 4EKWA 2EINC 4CS4A 1XOUA 1H2SB 4AHCA 3ZMTA 4LF9O 3BEHA 4GX5A 2VQEO 2ZR2A 5CA0B 1SQVH 4DR1O 5EC2C 5EBMC 3ASNC 2IU0A 1NTMH 2CGNA 1V9PA 1L0NH 4O4JB 1TA8A 5CA0A 4B7EA 5J9PC 2ATKC 4MTXA 4G2KA 3RBZA 4CH6A 1H38A 1WPXA 1JR9A 4OPAA 2E3CA 3QF7A 1GM8A 1PM9A 3CWBH 1NZ6A 3HR0A 3JAMN 2YICA 5LHHA 3WG7B 4DR5B 5J2UB 4X66B 1D5NA 1XNQB 1NT2B 4O4JA 4B08A 5AG2A 1VQPV 4PDRA 3BA9A 1K34A 3EXAA 1MABG 1GK9A 2IJJA 1NR7A 3ASOB 2KB1A 4DR6O 3OW2U 4JI2B 2UUAB 2AW9A 2YSUB 3AG1C 3GWKC 1YF2A 1YSCA 4NXMB 5JQGB 4DV4B 2IH3C 1JJ2U 3T1HB 1AI4A 1PNKA 4O4LB 3B4SA 2UUCB 2A79B 4J7KA 2HP8A 4DV7B 1N36O 5B66Z 5L3EA 3QTCA 1Q82W 5JQGA 4I9WA 1R3LC 5EC1C 3C90A 2PI4A 2IW5A 3N2KA 4O4LA 3ETEA 3SYOA 1R6TA 3CC2V 3H1JH 3S3WA 1L1FA 1VF6A 5CN0A 1TVKA 2P6JA 3A8TA 3CRRA 4EFBA 1WAZA 4DUYB 3ZHVA 2H8PC 1K7DA 1B3QA 2LFRA 1QVFU 1K8AW 4BIUA 4B3TB 5EYPB 2GTAA 1NVPB 5CB4A 2DQ3A 1VQLV 4PI2A 4U3FH 2QKSA 4DUZB 3UQ8A 4TV8A 3OEEG 1SC5B 1F23A 4IT5A 3SPIA 1IZ3A 2FKXA 2WWWA 4IYHA 5EYPA 3N27A 1SA0B 5F2VO 1Y67A 3ZMSA 3M99B 1GO3F 2VWKA 3W7UA 3CCQV 4TOIA 2CTWA 3K5LA 1SA0A 5IYZB 5D5QA 1SZTA 5EIBC 2V1DA 3ABTA 1K92A 3SPHA 1XI1A 3GWOA 4CH4A 4CS3A 1PNMA 1K4CC 2BOBC 1GTOA 4KHPB 1HNWB 4GKJB 2AHZA 3SYQA 2Q7GA 2NN4A 1W59A 1HR0O 4FK5C 3AG3B 3MHSC 2A9HA 3UKMA 1IURA 3OTOB 1IBKB 1BHBA 1VQOV 3ABUA 3K04A 2UXCB 3ZMUA 2NLJC 4JZ2A 1HNXO 5H2FZ 1YIJV 2R9RB 3BHPA 2DJVA 4LR3A 4G27B 4E4EA 5DEDA 1L8DA 1Y4MA 4GUNA 3E8FA 4MTGA 4KXRA 3WB0A 4I9QA 3EFFK 5EZYB 1XMQO 2Q8VA 3ETDA 4JTAB 1BHAA 4U3JB 4X66O 4F6EA 2AZ2A 3TXSA 4K0KO 3H1HH 4CH5A 5EZYA 1N4CA 3ZX6A 4FM1A 2Y48A 4JI6O 3QNEA 1QLNA 4DV6O 3GB7C 1OV9A 4B3RB 3U0ZA 5BZBA 4DW0A 3CSXA 3G4SV 5H6QA 4UCUA 4LFAB 3CPWU 4AQYO 1NVPD 2HHHB 1FKAO 4DV4O 1N0NA 2Z3YA 1DLBA 4WBNA 4I0XA 4UCRA 2H3OA 1K73W 1O9HA 3CCRV 1VF6C 4CH3A 3J80N 3IAYA 2F4VO 2X7RB 1QU7A 5L3DA 2W6JG 4PD4F 1JCHA 2WLJA 3JARA 2RDCA 1VIBA 1XUQA 4EB6B 5IY5B 1AI7A 1AP5A 2IM9A 1S5JA 2FB5A 1AILA 2DMXA 5JVDB 4YIPA 1HNZO 4JI3B 3GVMA 3CCSV 1KKCA 4U7OA 4DXWA 4BAYA 1AR1B 4HYOA 4X62B 4CC5A 3OD4A 4LC1A 3I5DA 5JVDA 3E89A 1SRYA 2D3OW 2Y69B 4DR2B 3CC4V 4GCZA 3B2EE 4FFBB 3ETGA 4Q6GA 2DYRC 4LF7O 1I5XA 3OEHG 3W7TA 4TWKA 3AG7A 1PD3A 1Q3EA 4BW9A 2E75B 5BR8O 2OT5A 3CC7V 2ZT9B 3J81N 1KYOF 1BE3H 3LSQA 1SQBH 4FFBA 3OAAG 1RSOB 4DV5O 2UXXA 1JMKC 2JJ1G 2YIBA 2UXDB 2B5UA 3IC7A 4PELA 4DRXB 3BABA 1Y66A 2R9IA 3DC5A 2CTRA 2ZE8A 2WLIB 1DF4A 3HKDA 1HNWO 4GKJO 1RPRA 3A2FA 5KA5A 1CPYA 1M9NA 1SQQH 4FLXA 4DRXA 3T1YB 4I50A 3AG3C 1TUBA 5KUMA 1AROP 1XHZA 2WLIA 1VQ9V 2AHYA 2RJZA 4BIOA 2UXCO 4HBNA 3JASB 2QE7G 4JI0O 3TXQA 2BSKB 3ZIAG 4LP8A 1K33A 2ZQMA 5JCOC 3K79A 2GUZB 2UXBB 2FL4A 3HPLC 2FYUH 2HR3A 3HKCA 4FMTA 3JASA 3O9OA 2HEPA 2BSKA 4DV2O 1JJOA 2EX3A 5CA1A 1KUQA 1B04A 1WP7A 1SKVA 4ZHQB 3P30A 4XDLA 3TJTA 5JJNB 4JAVA 3BFRA 4MVUA 5DM6V 4WFGA 1KC8W 5FPOA 1KMIZ 4MSWC 1QR8A 3ZHUA 3E8GA 4B3RO 2Q68A 4TQDA 2F43G 4LFAO 3DSQA 5KA6A 2WLMA 1E1RG 2F23A 1Y76B 2F93B 3MHHC 5B1OA 1YTFB 4X65B 2LGQA 4ZIBA 3VBBA 3RVZA 2P67A 1S72V 2EIKB 3P32A 5LMUO 2WSSG 4D6TH 1O9GA 1VARA 4UVCA 4OX9B 1Y76A 2ZIOA 2EZOA 5JJJB 3PJSK 2Q73A 2YIBD 4JGSA 5K1PA 2ZM6B 2NR5A 5KHKA 2AGAA 3STZC 4R7CA 1AJPA 2P4VA 2YC0A 3CRAA 5FL7G 5IY5C 4X20B 2GTSA 1N34O 5L3FA 1OCCB 5JH7B 2ZKOA 5CBFA 3WB2A 1N33O 4JTDB 1BQ0A 1CEZA 3CHXA 4GYCB 1XILA 2N74A 2QGNA 1F51A 4X62O 1PL4A 2CE4A 1JVMA 2QWQB 3B40A 4X64O 3H1KH 4DO2A 1VP7A 3BAAA 1UPGA 2R72A 2YEVB 1ORQC 1R1BA 3I55V 2QR4A 1TAEA 4BW5A 4JYCA 5LMNB 4HNAA 1WLEA 4P9OA 3DXRB 1COWG 2BCCH 2YEVA 1VQ7V 2UXDO 4NXNO 2QM7A 2RQ6A 1WN7A 1YHQV 1IBLO 3JATB 3H01A 1G4YB 3DXRA 3CD6V 3UT5B 4J10A 3L72H 2VQFO 2DW4A 2QA4V 4X1IB 1GAXA 1SESA 1V55C 4MTOA 4DV1B 1OZ0A 1NKDA 1FJGB 2ZR3A 1K5QA 2ZNJA 5KHGA 5LL6Y 1VQ6V 3VQVA 3CS5A 3K03A 3UT5A 4J41A 4QGPA 2JEXA 1XL4A 2KSDA 4YHHO 2QWNB 5B1NA 2JVDA 1LUWA 4JASA 3OM3B 2Z0AA 3FX7A 2QEXV 2LW1A 4YIOA 4UB8Z 3Q4HA 5KAFZ 1M90W 3KCYA 4IIJA 3L74H 4Q20A 3K06A 1I5YA 5LOVA 2WA4A 4DR3B 3CP1A 3A0BZ 2Q0AA 1MOFA 3A0HZ 3E2EA 4K35A 2DN9A 1OHHG 2Z5UA 5H6RA 2ZINA 1ZTEA 3K5OA 5GTIZ 4UCOA 1FXKB 3BCCH 4W4LA 4QPJA 1M93A 2EBOA 4X89A 4X65O 4LF6O 1E1QG 3ZRWA 2DOSA 1B6QA 3U11A 1M57B 2ADPA 1FXKA 1X4TA 2EIKC 2LFSA 2FTKA 3KKYA 2EJ7A 3B8MA 1Q8IA 1BL8A 1AP6A 4J80A 2ZM6O 2ZXWB 3ZBHA 1KBHA 1RFYA 1VQNV 1P7GA 3TETA 1XEQA 4FLTA 3N2KB 4FZ0A 3QG5A 1JX9A 1QCEA 5KHHA 3L71H 2EZPA 1OCCC 4GZRB 3G80A 1NQTA 3M8AA 1TVKB 5DN6G 1SQFA 2OYQA 2A06H 3K5MA 2XTAA 2P90A 4UV8A 4X88A 2PY5A 1BS3A 4JI7O 5CB4B 2LGWA 4N21A 5LP6A 2A3QA 4IYIA 1UJWB 1PPJH 2Q0OC 3OT7A 1J5EO 1KB9F 4TV8B 3DC6A 5ITZA 4JAUA 4UCSA 1U97A 4DR7O 1XHXA 2H94A 2DYRB 2BTQA 4AILC 3ETQA 1XMOO 4LF4B 2Q7HA 3ZEDA 3SYAA 4QJFB 4B3SO 2IJIA 2QM8A 3ZMVA 4J7ZA 2C2AA 4DV3B 1Z5VA 2HG5C 1PP9H 1XQ8A 3FB6C 5IDJA 1IDSA 4YY3O 4H44B 3SPCA 2LW7A 1BT8A 3SJAC 4QE9A 4BIZA 2M7WA 3F7VC 3QVNA 4CC6A 3D36A 4ABMA 1W2BU 4UFZA 4B3MB 4ZOLA 4MW3A 4BR6A 1I94B 1THZA 4JI1B 5D5PA 3C3TA 2JJ2G 4PJ0Z 1VQ8V 4Z2WA 2Q67A 4F6RA 4QPKA 3ABLB 2XASA 3RGBA 1MMMA 1ZL8A 3ZHQA 4IL6Z 2QKAA 3E8HA 3ZRXA 3I56V 1WNSA 2Y4TA 2UXNA 1H2NA 1NJIW 2IJKA 3F7YC 4EEQA 1FXKC 1NH2D 4DR5O 3E83A 1XNQO 1ZLZA 3PN1A 3RFRA 2QDOA 1QBZA 4NB5A 1EFRG 1EZJA 1M57C 1IBMB 5A9GA 4PA7A 4JI2O 2UUAO 1BMFG 4EFEA 1Y6XA 4PA4A 4WBNB 3FFQA 3OTFA 3ZJZA 4PA6A 2QWPB 4I0XB 3OUFA 4GX1A 2ZXWC 5C93A 3K58A 4NXMO 4J7JA 4QE7A 3T1HO 3X2QB 3JARB 2UUCO 5B1AC 4X9QA 4FM2A 4K8ZA 4DV7O 4O2AB 3UO2A 3MAQA 4PDMA 5KX5B 1KP2A 1Q86W 2XHBA 2L6LA 2ZIMA 2JIZG 1CXZB 1YJ9V 3SDLA 1J95A 2D2CB 1EN6A 4ICGA 4JV5B 3ZRSA 5BXZA 4O2AA 1GRJA 2YXLA 4DUYO 5KX5A 3IJ4A 2E74B 3SR2C 2WLHA 2XUMA 1US6A 4DV0B 1S76D 5FLXN 1Z5WA 4OGQB 4B3TO 1EZVH 3CX5F 1XNRB 2DWEC 2OWOA 3VQXA 2YDEA 3E35A 2RCVA 5IJ9B 3F5TA 1GMGA 4DUZO 2DWDC 4NYKA 4WFBV 2OTLV 2Q4PA 2JS3A 1BSMA 4CS2A 4I55A 4FLZA 3JD0A 2Y4UA 5CBGA 5IJ9A 2EULA 3JD2A 3RN4A 2VS0A 3HKDB 3K9AA 3EHBB 5CA3A 1F4NA 2V4DA 3K5NA 2K9PA 4FLWA 3D36C 2N05A 3L75H 4LF8B 1WPBA 1GN6A 4I50B 1TUBB 3S3XA 2UU9B 1Q6UA 1KD1W 2OCCB 3L73H 4QIWF 2JK5C 4JPRA 2CDYA 4R50A 1V55B 4KHPO 2F95B 1PNLA 4JI4B 3APOA 4YJ3B 2UUBB 4R6ZA 1NU1H 3OTOO 1IBKO 2LO1A 1ROPA 4UUJC 3B09A 3ZHRA 3HKCB 3R66A 2EJRA 4A5UB 3K08A 4JF3A 2DQ0A 2ZDIA 1GN3A 1IXMA 5CA1B 4YJ3A 3LDDA 2B9ZA 3SPGA 2HVKC 4YXWG 1OJHA 2R70A 3ABLC 1FXVA 1B06A 1AI6A 2Q7EA 2G38A 1OCRC 4I4TA 2L35A 4LF5B 5LGUA 2FMLA 4W4KA 1GM9A 4PA3A 2XAFA 4CBCA 1LNQA 3WFVA 2P7TC 1NI8A 1ZX3A 2XAQA 4DR4B 1NBMG 1UFIA 3CCEV 4L8JA 3KZIZ 4FM0A 4LF9B 3MD0A 1K9MW 2VQEB 3SJCC 2QSAA 3G71V 2ZCEA 5B1BB 3OGIB 4ASUG 5JJEB 3DTUB 1SZXA 5K1XA 1F4MA 2HHHO 1N32B 2CTPA 1A32A 4GX2A 3IC9A 3CYOA 3OMAB 4X1YB 2YS8A 3X2QC 3ZHTA 2HKOA 2CH7B 3CXCU 4LWSA 3JAKB 3RT3C 1YCIA 3K0GA 4HZ3A 5KUKA 1QLEC 1GKFA 4QNHB 1G8MA 2QWRB 2YUAA 1QVGU 2YIAA 3ZRVA 1YEWA 4X1YA 4JZGA 3UM7A 1Q6IA 2CH7A 3OR6C 3H9VA 3JAKA 3L9DA 4UCVA 4JYAB 3JD3A 4PDVA 1V54C 4JI3O 2HLDG 3JD4A 3LNNA 4DV0O 3ZHSA 2K1EA 4MW8A 3P3NA 5KHIA 1XNRO 3D3IA 5FNVB 2WAMA 1HW7A 2GV9A 5IWAB 4O2BA 4P9PA 1NTKH 4DR2O 4HNAB 2PF4E 3B77A 4NTWA 3UCSC 3OFNG 1IX9A 2ZD9A 1K97A 1N36B 1MNGA 1S5HC 4FPPA 2YI9A 2P5OA 5FNVA 3OE7G 4DK0A 1NTZH 2AXTZ 2V7QG 3SPJA 5CBHA 1T5EA 3QO5A 5E1AC 1YVWA 3K9SA 2OIGA 2NNUA 1RM1B 3N2GB 2DE0X 2HJFC 5JWPA 3BVOA 2QTSA 1XDCA 1H2GA 1Y74B 1URFA 2UU9O 2X0LA 1KP3A 2ITCC 5GONA 3N2GA 2OCCC 3FKSG 1YJWV 4K3AA 4PHZA 5LHIA 2OTJV 1SQXH 3HKBA 2ZDIC 1CP9A 3QO7A 3T1YO 2WLLB 1Y74A 2CTQA 1QQCA 2EIJC 2IJHA 3D3QA 2HVJC 5J2TB 3SYCA 2JEUA 3FAVB 4CZZA 4N23A 1SERA 3P3PA 4MS2A 3Q4HB 4OXSA
chains in the Genus database with same CATH topology
4JAUA 4WFAV 4XDKA 2WLLA 3AG2B 1K73W 3ASNB 5LGTA 4RUEA 2H94A 2QTOA 3CCRV 2DYRB 5LHGA 2CK3G 3LNMB 4E2LA 2X7RB 5EBLC 5L3DA 2W6JG 1PKXA 1E79G 2IH1C 1JCHA 2WLJA 4XBFA 3SYAA 4QJFB 5HFLA 5IY5B 2GSMB 3ZN0A 5L3GA 2IU3A 1NR1A 2IJIA 1AI7A 3OMIB 2QM8A 4RAIA 1M1KW 3G6EV 3ZMVA 2C2AA 1R6NA 3FB7C 3T4DA 1KQSU 3RVYA 2B1GA 3B8NA 3CCSV 1PL0A 1P7BA 4U7OA 1H8HG 4GX0A 2HG5C 4J9ZB 2DYSB 4BAYA 4DXWA 1JQ0A 2WPDG 1AR1B 3STLC 3FB6C 5IDJA 1DF5A 4HYOA 1KECA 3LSSA 4KUMA 3ZRWB 3SPCA 3ABKB 1TUEB 4LC1A 1VQKV 4QE9A 1FXHA 4BIZA 2M7WA 4MTFA 3F7VC 3E89A 1SRYA 4L87A 2D3OW 3R65A 2Y69B 5B1BC 3D36A 1W2BU 3AG1B 3CC4V 3K3WA 4GCZA 5IYCO 1OCZC 4WCEV 3ETGA 2DYRC 3DGEA 2Q69A 1I5XA 3OEHG 1JOYA 4MW3A 3W7TA 4TWKA 3OUSA 4RQFA 5CMUA 1PD3A 1THZA 2JJ2G 4WFHA 3AEIA 1VQ8V 2OT5A 3OR7C 3CC7V 5L3CA 2Q67A 3LSQA 3ML0A 2W6IG 3OAAG 1ENVA 4MVMA 1K5SA 2UXXA 4QPKA 2JJ1G 3ZMZA 2WLKA 2B5UA 3ABLB 3IC7A 4PELA 2XASA 3SYPA 1S3JA 2HFEC 1Y66A 2R9IA 3E8HA 3ZRXA 3I56V 5B1AB 2WLIB 1M56C 1DF4A 1FFTB 2UXNA 4MVRA 1QR9A 3K0DA 4JYBA 1NJIW 1KKDA 2IJKA 3KG2A 3F7YC 1RPRA 1XL6A 2X6AA 5KA5A 1FXKC 1NH2D 2Y69C 1CPYA 3E8BA 3E83A 1M9NA 4X8AA 3W7SA 3JD1A 4PDLA 3AG3C 4TT3G 5KUMA 1NH2B 2XAGA 1AROP 3IFXA 1QBZA 2WLIA 1K4DC 1VQ9V 5EBWC 5HFMA 2AHYA 1OCOB 1EFRG 3LUTB 4P30A 1EZJA 1M57C 2B1IA 2BOCC 2QE7G 4WFFA 3AG4C 2XOKG 4PA7A 2A0LA 1YI2V 4UV9A 1BMFG 3ZIAG 3CCLV 4LP8A 4PA4A 1K33A 1EBOA 3ZJZA 2ZQMA 4PA6A 4LBEC 4TSFG 4XDJA 1VQ5V 3OUFA 3K79A 4GX1A 4FIPC 3FYIB 4P2ZA 3F5WC 3HPLC 2ZXWC 4MVZA 2HR3A 5C93A 4FMTA 1R73A 4HAMA 4QE7A 2EILB 3X2QB 5B1AC 1MG1A 3W7WA 1YITV 5EK0A 1RM1C 3CMEV 3OGCC 3LDEA 4PDMA 5LGNA 3P30A 4XDLA 1KP2A 4WF9V 1Q86W 2XNDG 4JAVA 2JIZG 4MVUA 5DM6V 4WFGA 4WFEA 1KC8W 1YJ9V 1H8EG 4MSWC 1QR8A 1J95A 3E8GA 1N8RW 2Q68A 3ZRSA 3HB3B 2F43G 1YTFD 2EIMC 5KA6A 2WLMA 1E1RG 2XAHA 4EKWA 3ABMB 3MHHC 2WLHA 3RW0A 2EINC 5B1OA 1YTFB 1Q81W 1S76D 3T1CA 3ZMTA 3BEHA 3VBBA 4GX5A 3RVZA 2ZR2A 3ZN1A 2P67A 1S72V 2DWEC 2EIKB 3P32A 3E35A 2WSSG 5B3SB 5EC2C 4UVCA 1GMGA 2DWDC 2EZOA 3JCZA 3PJSK 5EBMC 3AG2C 4WFBV 2OTLV 3ASNC 4JGSA 2IU0A 3A0RA 3STZC 2MK3A 4R7CA 1AJPA 3TK1A 1Q7YW 1GM7A 5J9PC 3JD0A 5CBGA 1R3IC 2ATKC 4MTXA 4G2KA 5FL7G 3RBZA 1H38A 1WPXA 5IY5C 3JD2A 5L3FA 1OCCB 1R3KC 3K9AA 4MVOA 3EHBB 5CBFA 1GM8A 5LHHA 4JTDB 3TCUA 3WG7B 5CA3A 1F4NA 3LDCA 1CEZA 3FB5C 1VQPV 1F51A 4J9YB 4PDRA 1AI5A 2DYSC 1JVMA 1OCRB 1K34A 1KD1W 2OCCB 1MABG 1GK9A 2Q6AA 2IJJA 3ABKC 1NR7A 3ASOB 4KP4A 2JK5C 4JPRA 4LCUC 4QIWF 2LP7A 4R50A 1V55B 2KB1A 4UVBA 1PNLA 3OW2U 4DO2A 1AJNA 1W0KG 4KFMA 2YSUB 1AJQA 2YEVB 1ORQC 3AG1C 3I55V 4R6ZA 2X6CA 1YSCA 1ROPA 4UUJC 4BW5A 2IH3C 4JYCA 2EJRA 1JJ2U 1AI4A 1PNKA 3K08A 4JF3A 2DQ0A 2ZDIA 5H9CA 2PI5A 1WLEA 4P9OA 2A79B 1IXMA 1COWG 2JDIG 3LDDA 2YEVA 1VQ7V 4RO2A 4I5SA 3SPGA 1VQ4V 2HVKC 4YXWG 5L3EA 3WG7C 1Q82W 4PA9A 2QM7A 4I9WA 1R3LC 2W0FC 3QO8A 5EC1C 3ABLC 1FXVA 1JPXA 2PI4A 2IW5A 5LBQA 1YHQV 1AI6A 3H01A 3ETEA 1G4YB 1OCRC 3CD6V 3SYOA 1YJNV 3CC2V 5LGUA 2DW4A 2QA4V 1L1FA 3IGAC 1DTOA 1GM9A 3ASOC 1SESA 2XAFA 4PA3A 1SETA 1R6KA 1LNQA 5CN0A 3WFVA 1V55C 2P7TC 2P6JA 4MTOA 4CBCA 1QLEB 1OZ0A 1NKDA 1ZWIC 2XAQA 2H8PC 2ZR3A 1K5QA 1NBMG 3CCEV 1K7DA 3VOUA 1VQ6V 2LFRA 3SJQC 3FYEB 4GT1A 1K8AW 3K03A 4BIUA 1QVFU 3MD0A 1NVPB 2JEXA 4Z1MG 1K9MW 2DQ3A 1OCOC 1P4RA 1XL4A 3G71V 5B1NA 3CCMV 1VQLV 2ITDC 4H33A 3OMNB 3FB8C 3NXSA 5B1BB 1V54B 4ASUG 2QKSA 3DTUB 1F4MA 1OCZB 4JASA 3OEEG 3OM3B 1F23A 3SPIA 3ZCCA 2WWWA 4GX2A 3CYOA 3OMAB 2QEXV 2EILC 4MT8A 3X2QC 1M90W 2HKOA 3ZMSA 4MVQA 3CXCU 1VQMV 4Q20A 3K06A 3M99B 1GO3F 1I5YA 3K0GA 4HZ3A 5KUKA 1QLEC 3W7UA 3CCQV 1GKFA 2X6BA 3CP1A 4QNHB 1G8MA 5L3BA 1QVGU 4UXNA 1MOFA 1SZTA 3ZRVA 3E2EA 2V1DA 3ABTA 1K92A 3SPHA 1OHHG 2Z5UA 1M56B 3GWOA 3UM7A 3OR6C 1PNMA 5H6RA 4ZBMA 3W7XA 3CMAV 1K4CC 4FJCC 2BOBC 1FXKB 1GTOA 3JD3A 4PDVA 1V54C 2HLDG 3JD4A 2AHZA 3SYQA 3BY6A 1RPOA 4QPJA 4RUFA 4ZKIA 4FK5C 3AG3B 2EBOA 3ABMC 2A9HA 3MHSC 2K1EA 1E1QG 4X89A 3UKMA 4MW8A 3E86A 3ZRWA 4G28B 1B6QA 3D3IA 1BHBA 3CCVV 1M57B 1VQOV 3ABUA 3K04A 2WAMA 3AG4B 1FXKA 4H37A 3ZMUA 2NLJC 2EIKC 4P9PA 5B3SC 2LFSA 2FTKA 1YIJV 4RQEA 3B8MA 2R9RB 1BL8A 3B77A 4G27B 2WLNA 1R3JC 3OFNG 5IYBO 2ZD9A 2ZXWB 3CCUV 1K97A 1W0JG 2EIJB 1S5HC 1FS0G 4FPPA 2GHYA 4UVAA 1VQNV 1HWYA 3OE7G 4R8CA 3T4ZA 1K3EA 1Y4MA 3E8FA 4MTGA 2V7QG 3CCJV 3SPJA 5CBHA 3TETA 3QO5A 5E1AC 3EFFK 1JX9A 2NNUA 1RM1B 1QCEA 3ETDA 2HJFC 4JTAB 2EZPA 1OCCC 4JTCB 1BHAA 3T2MA 1MSWD 1NQTA 5DN6G 4F4LA 1H2GA 4MVSA 2X0LA 1KP3A 2ITCC 2P90A 4UV8A 4X88A 2Y48A 1QLNA 2OCCC 3QNEA 3GB7C 3FKSG 1YJWV 2EIMB 5BZBA 5LHIA 2OTJV 3G4SV 5H6QA 5GW7A 2ZDIC 4N21A 1S77D 1CP9A 2XAJA 3CPWU 2EINB 3QO7A 1UJWB 2WLLB 1NVPD 5IYDO 2EIJC 2IJHA 4U7NA 2HVJC 3SYCA 2JEUA 4CZZA 2Z3YA 4N23A 1SERA 1DLBA 4MS2A 1S0VA 3JYCA 4OXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6B A;  4PDR A;  1M57 C;  2BOC C;  2DYS C;  4J9Y B;  4XDK A;  4QNH B;  2WLL A;  1JVM A;  4WFF A;  3AG4 C;  4PA7 A;  2A0L A;  4RUE A;  2QTO A;  4LP8 A;  4PA4 A;  2Q6A A;  3SPH A;  4LCU C;  3ABK C;  3LNM B;  3ZJZ A;  2JK5 C;  4PA6 A;  4LBE C;  4XDJ A;  4R50 A;  5EBL C;  3UM7 A;  2KB1 A;  2IH1 C;  3OR6 C;  3OUF A;  4GX1 A;  4ZBM A;  2WLJ A;  4P2Z A;  3F5W C;  1K4C C;  3HPL C;  4KFM A;  3SYA A;  2ZXW C;  4MVZ A;  2BOB C;  1ORQ C;  3AG1 C;  4R6Z A;  4PDV A;  2X6C A;  1V54 C;  4QE7 A;  4RAI A;  2AHZ A;  3SYQ A;  4RUF A;  4BW5 A;  4UUJ C;  5B1A C;  3ABM C;  2IH3 C;  2A9H A;  2K1E A;  4X89 A;  3FB7 C;  3T4D A;  4MW8 A;  3UKM A;  3E86 A;  3RVY A;  5EK0 A;  3K08 A;  4G28 B;  1P7B A;  4GX0 A;  2HG5 C;  4J9Z B;  3OGC C;  4P9O A;  2A79 B;  4DXW A;  3K04 A;  3STL C;  3FB6 C;  3LDE A;  4PDM A;  3LDD A;  2YEV A;  4XDL A;  4HYO A;  4H37 A;  2NLJ C;  2EIK C;  4P9P A;  3SPC A;  5B3S C;  4RO2 A;  4MVU A;  3SPG A;  2HVK C;  4QE9 A;  4WFG A;  3WG7 C;  2R9R B;  1BL8 A;  4WFE A;  4MTF A;  4PA9 A;  3F7V C;  4I9W A;  1R3L C;  2W0F C;  3E89 A;  5EC1 C;  4G27 B;  3ABL C;  2WLN A;  1R3J C;  3R65 A;  4MSW C;  1J95 A;  5B1B C;  2ZD9 A;  3E8G A;  2Q68 A;  1S5H C;  3ZRS A;  1G4Y B;  1OCR C;  3LUT B;  3SYO A;  2EIM C;  1OCZ C;  4R8C A;  3T4Z A;  2WLM A;  2DYR C;  3E8F A;  4MTG A;  3IGA C;  3ASO C;  3SPJ A;  4PA3 A;  5CBH A;  3TET A;  5E1A C;  4CBC A;  1LNQ A;  2Q69 A;  4EKW A;  1V55 C;  2P7T C;  2EIN C;  2WLH A;  4MTO A;  3EFF K;  4MW3 A;  3OUS A;  4TWK A;  3RW0 A;  1ZWI C;  3T1C A;  2HJF C;  2H8P C;  4JTA B;  4WFH A;  1OCC C;  3BEH A;  4P30 A;  4GX5 A;  4JTC B;  3VOU A;  3RVZ A;  3T2M A;  3OR7 C;  3SJQ C;  2DWE C;  3K03 A;  4F4L A;  2Q67 A;  5EC2 C;  1OCO C;  1XL4 A;  4MVS A;  4MVM A;  2DWD C;  2ITC C;  4X88 A;  2WLK A;  3PJS K;  5EBM C;  3SYP A;  3AG2 C;  2ITD C;  4H33 A;  3ASN C;  3FB8 C;  2HFE C;  2OCC C;  2QKS A;  3E8H A;  3GB7 C;  5BZB A;  2WLI B;  1M56 C;  4MVR A;  3STZ C;  3K0D A;  4R7C A;  3SPI A;  5J9P C;  1KKD A;  5CBG A;  1R3I C;  2ATK C;  3KG2 A;  4GX2 A;  3F7Y C;  3RBZ A;  2WLL B;  1XL6 A;  5IY5 C;  2X6A A;  2Y69 C;  3E8B A;  3E83 A;  2EIJ C;  4X8A A;  1R3K C;  4MVO A;  4PDL A;  2EIL C;  3X2Q C;  5CBF A;  2HVJ C;  3AG3 C;  5KUM A;  3SYC A;  4JTD B;  3TCU A;  4MVQ A;  3IFX A;  3LDC A;  4MS2 A;  2WLI A;  1K4D C;  3FB5 C;  3K06 A;  5EBW C;  2AHY A;  3JYC A;  3K0G A;  4HZ3 A;  5KUK A;  1QLE C;  4OXS A; 
#chains in the Genus database with same CATH topology
 4XDK A;  1ZSP A;  2WLL A;  3AG2 B;  4IIJ B;  4RUE A;  4LH7 A;  2UXB O;  2QTO A;  1Q6H A;  4D7T A;  5LOV B;  2CK3 G;  1HP8 A;  1Q43 A;  4RWU A;  4H13 B;  4E2L A;  5EBL C;  5J2T A;  2ZE6 A;  1PKX A;  4BWA A;  3H1I H;  3FAV A;  4FZ1 A;  4XBF A;  2IU3 A;  3OMI B;  1M1K W;  4DYL A;  2RNB A;  1R6N A;  3FB7 C;  3T4D A;  2ZNI A;  2B1G A;  3B8N A;  5BY1 A;  1PL0 A;  1HR0 B;  1P7B A;  4GX0 A;  1P49 A;  4J9Z B;  2DYS B;  3J7A U;  1JQ0 A;  2WPD G;  3CRQ A;  3K59 A;  1FAF A;  1DF5 A;  4KUM A;  3ZRW B;  3NR7 A;  3ABK B;  1TUE B;  4DW1 A;  1VQK V;  1M4U A;  1FXH A;  1G6U A;  4MTF A;  4LNU A;  3U10 A;  5B1B C;  1HNX B;  1N32 O;  5LYJ B;  4WCE V;  2QJ1 A;  1BCC H;  3DGE A;  1JOY A;  3OUS A;  4RQF A;  4X1K B;  4WFH A;  5LA6 B;  1EN5 A;  5GTH Z;  3AEI A;  4OX9 O;  3OR7 C;  1XMQ B;  5LYJ A;  1F7Y A;  3ML0 A;  3MDS A;  3G6B A;  4MVM A;  1K5S A;  2PZS A;  2WLK A;  4K0K B;  3SYP A;  1S3J A;  4X1K A;  2F66 C;  5LA6 A;  1LUV A;  1WA8 B;  5B1A B;  1QR9 A;  3TGU H;  3K0D A;  1IXB A;  4JI6 B;  4JYA O;  4DV6 B;  3KG2 A;  5J2U A;  3E8B A;  4X8A A;  4PDL A;  4TV9 B;  5LP6 B;  4AQY B;  1NH2 B;  1WA8 A;  2F1M A;  4NKG B;  5EBW C;  4JI5 B;  1OCO B;  3LUT B;  2KKW A;  5IWA O;  2R9A A;  2RN9 A;  4WFF A;  1BZK A;  2QKC A;  2XOK G;  2A0L A;  1YI2 V;  4YJ2 B;  4JI8 B;  1EBO A;  5KMG B;  4TV9 A;  1ZAU A;  4LBE C;  5ITZ B;  1SS3 A;  2PGG A;  1VQ5 V;  1I0H A;  4FIP C;  4ZI7 B;  2F4V B;  2BTQ B;  5LMN O;  4OPH A;  2EIL B;  4YJ2 A;  5KMG A;  2KQX A;  1RM1 C;  3CME V;  5EIB D;  3O65 A;  2O57 A;  4D7S A;  1HNZ B;  3LDE A;  4ZI7 A;  5LGN A;  2PUS A;  2XND G;  2N04 A;  1L0L H;  2QWO B;  1AB3 A;  3AK2 A;  1I7F A;  1H8E G;  1N8R W;  5DEC A;  4DV1 O;  3JSN A;  3CRC A;  1FJG O;  2XAH A;  2KG7 B;  2Q5Z A;  4NTX A;  3ABM B;  4NVP A;  3RW0 A;  1Q81 W;  2Q9L A;  5KAI Z;  3T1C A;  4LF7 B;  4ZOL B;  3ZN1 A;  3ZS8 C;  5B3S B;  1EM1 A;  2KG7 A;  5BR8 B;  4LFC B;  4H0L B;  3JCZ A;  1H2K A;  3AG2 C;  2P06 A;  2YXY A;  3RYH B;  4F6R B;  4DV5 B;  3A0R A;  3RYC B;  2MK3 A;  3TK1 A;  1Q7Y W;  1GM7 A;  1JA8 A;  1R3I C;  1ZL8 B;  1FD9 A;  1H2L A;  3JAW B;  2ZE7 A;  1N0J A;  2LJ2 A;  5IJ0 B;  3RYF B;  4PI0 A;  1R3K C;  4MVO A;  3RYH A;  4DR3 O;  5IYZ A;  3TCU A;  3RYC A;  3LDC A;  4FLY A;  3FB5 C;  1G1X B;  4J9Y B;  1AI5 A;  2ETN A;  3RYI B;  2DYS C;  3JAW A;  5IE9 A;  1OCR B;  2HJD A;  5IJ0 A;  2Q6A A;  4LCU C;  3ABK C;  4PV1 B;  4KP4 A;  3RYF A;  4JI0 B;  1BGY H;  2LP7 A;  2IBZ H;  4UVB A;  1AJN A;  1W0K G;  1DGS A;  4KFM A;  1H2M A;  1AJQ A;  1D2D A;  1Z2G A;  3RYI A;  2X6C A;  2A7W A;  2PYL A;  4Z1V A;  4DV2 B;  2VRZ A;  5JCO A;  5H9C A;  1NS1 A;  2PI5 A;  3KCX A;  2PYJ A;  2JDI G;  2CGO A;  1VF5 B;  2E5L B;  2Y0P A;  2BTO A;  5E79 Z;  4RO2 A;  4I5S A;  1VQ4 V;  2BE3 A;  3WG7 C;  4C7U A;  3H1L H;  4PA9 A;  2W0F C;  3QO8 A;  1JPX A;  4NR1 A;  5LBQ A;  1QNM A;  1YJN V;  1FFX B;  3IGA C;  1DTO A;  4U3J A;  3ASO C;  1SET A;  1R6K A;  1S5L Z;  1QLE B;  5C8Y B;  1ZWI C;  2W0X A;  3CB2 A;  3VOU A;  5LP6 C;  3SJQ C;  3FYE B;  4GT1 A;  4JI5 O;  3AK3 A;  1FFX A;  4Z1M G;  1OCO C;  1P4R A;  4AI8 A;  1U96 A;  3CCM V;  5C8Y A;  5LMU B;  2ITD C;  4H33 A;  3OMN B;  3FB8 C;  3NXS A;  4JI8 O;  1V54 B;  1OCZ B;  5IT9 N;  1FYJ A;  3ZCC A;  2P22 C;  1AVM A;  4I55 B;  2EIL C;  3EVK A;  3E22 B;  4MT8 A;  1GH6 A;  4MVQ A;  2CUG A;  4FVM A;  1N34 B;  1VQM V;  5TIS Z;  4KL1 A;  1FPO A;  1EN4 A;  3BA8 A;  2X6B A;  1N33 B;  5L3B A;  4UXN A;  3CRM A;  4FFK A;  1WB8 A;  2OCH A;  4EB6 A;  4LF4 O;  1M56 B;  2JS5 A;  3E22 A;  3JSL A;  4J42 A;  1D5A A;  3M7M X;  4ZBM A;  3W7X A;  4X64 B;  2CAZ C;  3CMA V;  1SQG A;  2JGU A;  4FJC C;  2YID A;  4TUY B;  4JAA A;  3BY6 A;  1RPO A;  4RUF A;  4ZKI A;  4DV3 O;  2XT9 A;  5B5E Z;  3ABM C;  2M6Y A;  3E86 A;  4G28 B;  1I08 A;  5A2Q N;  3CCV V;  1AR5 A;  3AG4 B;  3APQ A;  4TUY A;  1JFF B;  4H37 A;  4LFC O;  4DK1 A;  5B3S C;  2Y0I A;  4RQE A;  4B3M O;  1XBL A;  4TQF A;  5BMV B;  3JAL B;  2WLN A;  1R3J C;  5IYB O;  3CCU V;  1W0J G;  2EIJ B;  1FS0 G;  5H5N A;  3BPZ A;  2GHY A;  4UVA A;  4NXN B;  1HWY A;  2ODM A;  4R8C A;  3T4Z A;  1I94 O;  1K3E A;  1VMG A;  4JI1 O;  1JFF A;  1WB7 A;  3CCJ V;  1IBL B;  4I4T B;  3UO3 A;  2VQF B;  5BMV A;  3JAL A;  1RSO A;  1GN4 A;  4JTC B;  1MZF A;  3T2M A;  1MSW D;  2OIE A;  3G67 A;  1YDX A;  4F4L A;  2ADQ B;  4GKK B;  4MVS A;  1HDJ A;  4LFB B;  3L70 H;  1PV0 A;  2AZ0 A;  2EIM B;  4YHH B;  3FD9 A;  5GW7 A;  1S77 D;  2XAJ A;  2EIN B;  3ICX A;  1VEW A;  1MSD A;  4B7K A;  5IYD O;  5LXT B;  4U7N A;  3C3S A;  1IBM O;  1S0V A;  3JYC A;  3JCU Z;  4UCT A;  2LQT A;  4DR1 B;  2MW2 B;  2GBO A;  4WFA V;  2E5L O;  5KHJ A;  4J11 A;  2GUZ A;  3ASN B;  1IVS A;  5LGT A;  4LWS B;  1X59 A;  5LXT A;  5LHG A;  1VF7 A;  3LNM B;  1SF9 A;  1LR1 A;  1TGO A;  1E79 G;  2IH1 C;  2P4K A;  5HFL A;  2GSM B;  3SGI A;  3ZN0 A;  5L3G A;  1NR1 A;  4RAI A;  2VWJ A;  1AR4 A;  4O4I B;  3G6E V;  2QM4 A;  4ZHQ A;  2YXH A;  1KQS U;  3RVY A;  1H8H G;  4LF6 B;  3STL C;  3CE2 A;  1KEC A;  3LSS A;  1RP3 B;  4O4H B;  4O4I A;  4JV5 O;  4FLU A;  3VQY A;  3HKE B;  4L87 A;  5FPR A;  3R65 A;  1ZUQ A;  4DR6 B;  4O2B B;  1YZB A;  2RMK B;  3AG1 B;  3THO A;  3K3W A;  5IYC O;  2JRI A;  2JGD B;  1OCZ C;  2Q69 A;  2YI8 A;  3AK1 A;  4O4H A;  5CMU A;  1MZE A;  3HKE A;  1BQZ A;  1WJZ A;  2GDS A;  4FLV A;  3BRC A;  5L3C A;  2JGD A;  2W6I G;  3D8C A;  3CJH B;  4I7Z B;  1ENV A;  3WU2 Z;  3ZMZ A;  1DK1 A;  3RWR D;  2HFE C;  3LSU A;  4X20 A;  2ARH A;  1M56 C;  4JI7 B;  1FFT B;  5GON B;  4MVR A;  4JYB A;  5JH7 A;  1KKD A;  1GN2 A;  4UB6 Z;  3WB1 A;  1XL6 A;  3CJH A;  2X6A A;  2Y69 C;  1Q5O A;  4GLX A;  3HKB B;  3W7S A;  3JD1 A;  4LH6 A;  4LF8 O;  2PTM A;  2E76 B;  4TT3 G;  1J5E B;  2XAG A;  3IFX A;  1K4D C;  5HFM A;  4P30 A;  2B1I A;  2BOC C;  1XRE A;  3AG4 C;  4JI4 O;  4UV9 A;  1MA1 A;  4IGG A;  3CCL V;  4K8X A;  2ZE5 A;  4TSF G;  4XDJ A;  4DR7 B;  2UUB O;  1WP8 A;  3FYI B;  4P2Z A;  3F5W C;  3CEI A;  4IHJ B;  4MVZ A;  1P84 F;  1KU9 A;  2WA3 A;  1R73 A;  4HAM A;  1XMO B;  4B3S B;  3K57 A;  1MG1 A;  1QHT A;  1SQP H;  3W7W A;  1YIT V;  3CXH F;  5KLV H;  5EK0 A;  4NTY A;  3OGC C;  1M5I A;  4IHJ A;  4GKK O;  1YXB A;  4WF9 V;  3JAT A;  4LFB O;  4WFE A;  4JYY A;  4YY3 B;  4LF5 O;  3VQW A;  4X1I A;  2ILM A;  3HB3 B;  1YTF D;  1Q90 D;  2EIM C;  3SJB C;  4LNU B;  4DR4 O;  4EKW A;  2EIN C;  4CS4 A;  1XOU A;  1H2S B;  4AHC A;  3ZMT A;  4LF9 O;  3BEH A;  4GX5 A;  2VQE O;  2ZR2 A;  5CA0 B;  1SQV H;  4DR1 O;  5EC2 C;  5EBM C;  3ASN C;  2IU0 A;  1NTM H;  2CGN A;  1V9P A;  1L0N H;  4O4J B;  1TA8 A;  5CA0 A;  4B7E A;  5J9P C;  2ATK C;  4MTX A;  4G2K A;  3RBZ A;  4CH6 A;  1H38 A;  1WPX A;  1JR9 A;  4OPA A;  2E3C A;  3QF7 A;  1GM8 A;  1PM9 A;  3CWB H;  1NZ6 A;  3HR0 A;  3JAM N;  2YIC A;  5LHH A;  3WG7 B;  4DR5 B;  5J2U B;  4X66 B;  1D5N A;  1XNQ B;  1NT2 B;  4O4J A;  4B08 A;  5AG2 A;  1VQP V;  4PDR A;  3BA9 A;  1K34 A;  3EXA A;  1MAB G;  1GK9 A;  2IJJ A;  1NR7 A;  3ASO B;  2KB1 A;  4DR6 O;  3OW2 U;  4JI2 B;  2UUA B;  2AW9 A;  2YSU B;  3AG1 C;  3GWK C;  1YF2 A;  1YSC A;  4NXM B;  5JQG B;  4DV4 B;  2IH3 C;  1JJ2 U;  3T1H B;  1AI4 A;  1PNK A;  4O4L B;  3B4S A;  2UUC B;  2A79 B;  4J7K A;  2HP8 A;  4DV7 B;  1N36 O;  5B66 Z;  5L3E A;  3QTC A;  1Q82 W;  5JQG A;  4I9W A;  1R3L C;  5EC1 C;  3C90 A;  2PI4 A;  2IW5 A;  3N2K A;  4O4L A;  3ETE A;  3SYO A;  1R6T A;  3CC2 V;  3H1J H;  3S3W A;  1L1F A;  1VF6 A;  5CN0 A;  1TVK A;  2P6J A;  3A8T A;  3CRR A;  4EFB A;  1WAZ A;  4DUY B;  3ZHV A;  2H8P C;  1K7D A;  1B3Q A;  2LFR A;  1QVF U;  1K8A W;  4BIU A;  4B3T B;  5EYP B;  2GTA A;  1NVP B;  5CB4 A;  2DQ3 A;  1VQL V;  4PI2 A;  4U3F H;  2QKS A;  4DUZ B;  3UQ8 A;  4TV8 A;  3OEE G;  1SC5 B;  1F23 A;  4IT5 A;  3SPI A;  1IZ3 A;  2FKX A;  2WWW A;  4IYH A;  5EYP A;  3N27 A;  1SA0 B;  5F2V O;  1Y67 A;  3ZMS A;  3M99 B;  1GO3 F;  2VWK A;  3W7U A;  3CCQ V;  4TOI A;  2CTW A;  3K5L A;  1SA0 A;  5IYZ B;  5D5Q A;  1SZT A;  5EIB C;  2V1D A;  3ABT A;  1K92 A;  3SPH A;  1XI1 A;  3GWO A;  4CH4 A;  4CS3 A;  1PNM A;  1K4C C;  2BOB C;  1GTO A;  4KHP B;  1HNW B;  4GKJ B;  2AHZ A;  3SYQ A;  2Q7G A;  2NN4 A;  1W59 A;  1HR0 O;  4FK5 C;  3AG3 B;  3MHS C;  2A9H A;  3UKM A;  1IUR A;  3OTO B;  1IBK B;  1BHB A;  1VQO V;  3ABU A;  3K04 A;  2UXC B;  3ZMU A;  2NLJ C;  4JZ2 A;  1HNX O;  5H2F Z;  1YIJ V;  2R9R B;  3BHP A;  2DJV A;  4LR3 A;  4G27 B;  4E4E A;  5DED A;  1L8D A;  1Y4M A;  4GUN A;  3E8F A;  4MTG A;  4KXR A;  3WB0 A;  4I9Q A;  3EFF K;  5EZY B;  1XMQ O;  2Q8V A;  3ETD A;  4JTA B;  1BHA A;  4U3J B;  4X66 O;  4F6E A;  2AZ2 A;  3TXS A;  4K0K O;  3H1H H;  4CH5 A;  5EZY A;  1N4C A;  3ZX6 A;  4FM1 A;  2Y48 A;  4JI6 O;  3QNE A;  1QLN A;  4DV6 O;  3GB7 C;  1OV9 A;  4B3R B;  3U0Z A;  5BZB A;  4DW0 A;  3CSX A;  3G4S V;  5H6Q A;  4UCU A;  4LFA B;  3CPW U;  4AQY O;  1NVP D;  2HHH B;  1FKA O;  4DV4 O;  1N0N A;  2Z3Y A;  1DLB A;  4WBN A;  4I0X A;  4UCR A;  2H3O A;  1K73 W;  1O9H A;  3CCR V;  1VF6 C;  4CH3 A;  3J80 N;  3IAY A;  2F4V O;  2X7R B;  1QU7 A;  5L3D A;  2W6J G;  4PD4 F;  1JCH A;  2WLJ A;  3JAR A;  2RDC A;  1VIB A;  1XUQ A;  4EB6 B;  5IY5 B;  1AI7 A;  1AP5 A;  2IM9 A;  1S5J A;  2FB5 A;  1AIL A;  2DMX A;  5JVD B;  4YIP A;  1HNZ O;  4JI3 B;  3GVM A;  3CCS V;  1KKC A;  4U7O A;  4DXW A;  4BAY A;  1AR1 B;  4HYO A;  4X62 B;  4CC5 A;  3OD4 A;  4LC1 A;  3I5D A;  5JVD A;  3E89 A;  1SRY A;  2D3O W;  2Y69 B;  4DR2 B;  3CC4 V;  4GCZ A;  3B2E E;  4FFB B;  3ETG A;  4Q6G A;  2DYR C;  4LF7 O;  1I5X A;  3OEH G;  3W7T A;  4TWK A;  3AG7 A;  1PD3 A;  1Q3E A;  4BW9 A;  2E75 B;  5BR8 O;  2OT5 A;  3CC7 V;  2ZT9 B;  3J81 N;  1KYO F;  1BE3 H;  3LSQ A;  1SQB H;  4FFB A;  3OAA G;  1RSO B;  4DV5 O;  2UXX A;  1JMK C;  2JJ1 G;  2YIB A;  2UXD B;  2B5U A;  3IC7 A;  4PEL A;  4DRX B;  3BAB A;  1Y66 A;  2R9I A;  3DC5 A;  2CTR A;  2ZE8 A;  2WLI B;  1DF4 A;  3HKD A;  1HNW O;  4GKJ O;  1RPR A;  3A2F A;  5KA5 A;  1CPY A;  1M9N A;  1SQQ H;  4FLX A;  4DRX A;  3T1Y B;  4I50 A;  3AG3 C;  1TUB A;  5KUM A;  1ARO P;  1XHZ A;  2WLI A;  1VQ9 V;  2AHY A;  2RJZ A;  4BIO A;  2UXC O;  4HBN A;  3JAS B;  2QE7 G;  4JI0 O;  3TXQ A;  2BSK B;  3ZIA G;  4LP8 A;  1K33 A;  2ZQM A;  5JCO C;  3K79 A;  2GUZ B;  2UXB B;  2FL4 A;  3HPL C;  2FYU H;  2HR3 A;  3HKC A;  4FMT A;  3JAS A;  3O9O A;  2HEP A;  2BSK A;  4DV2 O;  1JJO A;  2EX3 A;  5CA1 A;  1KUQ A;  1B04 A;  1WP7 A;  1SKV A;  4ZHQ B;  3P30 A;  4XDL A;  3TJT A;  5JJN B;  4JAV A;  3BFR A;  4MVU A;  5DM6 V;  4WFG A;  1KC8 W;  5FPO A;  1KMI Z;  4MSW C;  1QR8 A;  3ZHU A;  3E8G A;  4B3R O;  2Q68 A;  4TQD A;  2F43 G;  4LFA O;  3DSQ A;  5KA6 A;  2WLM A;  1E1R G;  2F23 A;  1Y76 B;  2F93 B;  3MHH C;  5B1O A;  1YTF B;  4X65 B;  2LGQ A;  4ZIB A;  3VBB A;  3RVZ A;  2P67 A;  1S72 V;  2EIK B;  3P32 A;  5LMU O;  2WSS G;  4D6T H;  1O9G A;  1VAR A;  4UVC A;  4OX9 B;  1Y76 A;  2ZIO A;  2EZO A;  5JJJ B;  3PJS K;  2Q73 A;  2YIB D;  4JGS A;  5K1P A;  2ZM6 B;  2NR5 A;  5KHK A;  2AGA A;  3STZ C;  4R7C A;  1AJP A;  2P4V A;  2YC0 A;  3CRA A;  5FL7 G;  5IY5 C;  4X20 B;  2GTS A;  1N34 O;  5L3F A;  1OCC B;  5JH7 B;  2ZKO A;  5CBF A;  3WB2 A;  1N33 O;  4JTD B;  1BQ0 A;  1CEZ A;  3CHX A;  4GYC B;  1XIL A;  2N74 A;  2QGN A;  1F51 A;  4X62 O;  1PL4 A;  2CE4 A;  1JVM A;  2QWQ B;  3B40 A;  4X64 O;  3H1K H;  4DO2 A;  1VP7 A;  3BAA A;  1UPG A;  2R72 A;  2YEV B;  1ORQ C;  1R1B A;  3I55 V;  2QR4 A;  1TAE A;  4BW5 A;  4JYC A;  5LMN B;  4HNA A;  1WLE A;  4P9O A;  3DXR B;  1COW G;  2BCC H;  2YEV A;  1VQ7 V;  2UXD O;  4NXN O;  2QM7 A;  2RQ6 A;  1WN7 A;  1YHQ V;  1IBL O;  3JAT B;  3H01 A;  1G4Y B;  3DXR A;  3CD6 V;  3UT5 B;  4J10 A;  3L72 H;  2VQF O;  2DW4 A;  2QA4 V;  4X1I B;  1GAX A;  1SES A;  1V55 C;  4MTO A;  4DV1 B;  1OZ0 A;  1NKD A;  1FJG B;  2ZR3 A;  1K5Q A;  2ZNJ A;  5KHG A;  5LL6 Y;  1VQ6 V;  3VQV A;  3CS5 A;  3K03 A;  3UT5 A;  4J41 A;  4QGP A;  2JEX A;  1XL4 A;  2KSD A;  4YHH O;  2QWN B;  5B1N A;  2JVD A;  1LUW A;  4JAS A;  3OM3 B;  2Z0A A;  3FX7 A;  2QEX V;  2LW1 A;  4YIO A;  4UB8 Z;  3Q4H A;  5KAF Z;  1M90 W;  3KCY A;  4IIJ A;  3L74 H;  4Q20 A;  3K06 A;  1I5Y A;  5LOV A;  2WA4 A;  4DR3 B;  3CP1 A;  3A0B Z;  2Q0A A;  1MOF A;  3A0H Z;  3E2E A;  4K35 A;  2DN9 A;  1OHH G;  2Z5U A;  5H6R A;  2ZIN A;  1ZTE A;  3K5O A;  5GTI Z;  4UCO A;  1FXK B;  3BCC H;  4W4L A;  4QPJ A;  1M93 A;  2EBO A;  4X89 A;  4X65 O;  4LF6 O;  1E1Q G;  3ZRW A;  2DOS A;  1B6Q A;  3U11 A;  1M57 B;  2ADP A;  1FXK A;  1X4T A;  2EIK C;  2LFS A;  2FTK A;  3KKY A;  2EJ7 A;  3B8M A;  1Q8I A;  1BL8 A;  1AP6 A;  4J80 A;  2ZM6 O;  2ZXW B;  3ZBH A;  1KBH A;  1RFY A;  1VQN V;  1P7G A;  3TET A;  1XEQ A;  4FLT A;  3N2K B;  4FZ0 A;  3QG5 A;  1JX9 A;  1QCE A;  5KHH A;  3L71 H;  2EZP A;  1OCC C;  4GZR B;  3G80 A;  1NQT A;  3M8A A;  1TVK B;  5DN6 G;  1SQF A;  2OYQ A;  2A06 H;  3K5M A;  2XTA A;  2P90 A;  4UV8 A;  4X88 A;  2PY5 A;  1BS3 A;  4JI7 O;  5CB4 B;  2LGW A;  4N21 A;  5LP6 A;  2A3Q A;  4IYI A;  1UJW B;  1PPJ H;  2Q0O C;  3OT7 A;  1J5E O;  1KB9 F;  4TV8 B;  3DC6 A;  5ITZ A;  4JAU A;  4UCS A;  1U97 A;  4DR7 O;  1XHX A;  2H94 A;  2DYR B;  2BTQ A;  4AIL C;  3ETQ A;  1XMO O;  4LF4 B;  2Q7H A;  3ZED A;  3SYA A;  4QJF B;  4B3S O;  2IJI A;  2QM8 A;  3ZMV A;  4J7Z A;  2C2A A;  4DV3 B;  1Z5V A;  2HG5 C;  1PP9 H;  1XQ8 A;  3FB6 C;  5IDJ A;  1IDS A;  4YY3 O;  4H44 B;  3SPC A;  2LW7 A;  1BT8 A;  3SJA C;  4QE9 A;  4BIZ A;  2M7W A;  3F7V C;  3QVN A;  4CC6 A;  3D36 A;  4ABM A;  1W2B U;  4UFZ A;  4B3M B;  4ZOL A;  4MW3 A;  4BR6 A;  1I94 B;  1THZ A;  4JI1 B;  5D5P A;  3C3T A;  2JJ2 G;  4PJ0 Z;  1VQ8 V;  4Z2W A;  2Q67 A;  4F6R A;  4QPK A;  3ABL B;  2XAS A;  3RGB A;  1MMM A;  1ZL8 A;  3ZHQ A;  4IL6 Z;  2QKA A;  3E8H A;  3ZRX A;  3I56 V;  1WNS A;  2Y4T A;  2UXN A;  1H2N A;  1NJI W;  2IJK A;  3F7Y C;  4EEQ A;  1FXK C;  1NH2 D;  4DR5 O;  3E83 A;  1XNQ O;  1ZLZ A;  3PN1 A;  3RFR A;  2QDO A;  1QBZ A;  4NB5 A;  1EFR G;  1EZJ A;  1M57 C;  1IBM B;  5A9G A;  4PA7 A;  4JI2 O;  2UUA O;  1BMF G;  4EFE A;  1Y6X A;  4PA4 A;  4WBN B;  3FFQ A;  3OTF A;  3ZJZ A;  4PA6 A;  2QWP B;  4I0X B;  3OUF A;  4GX1 A;  2ZXW C;  5C93 A;  3K58 A;  4NXM O;  4J7J A;  4QE7 A;  3T1H O;  3X2Q B;  3JAR B;  2UUC O;  5B1A C;  4X9Q A;  4FM2 A;  4K8Z A;  4DV7 O;  4O2A B;  3UO2 A;  3MAQ A;  4PDM A;  5KX5 B;  1KP2 A;  1Q86 W;  2XHB A;  2L6L A;  2ZIM A;  2JIZ G;  1CXZ B;  1YJ9 V;  3SDL A;  1J95 A;  2D2C B;  1EN6 A;  4ICG A;  4JV5 B;  3ZRS A;  5BXZ A;  4O2A A;  1GRJ A;  2YXL A;  4DUY O;  5KX5 A;  3IJ4 A;  2E74 B;  3SR2 C;  2WLH A;  2XUM A;  1US6 A;  4DV0 B;  1S76 D;  5FLX N;  1Z5W A;  4OGQ B;  4B3T O;  1EZV H;  3CX5 F;  1XNR B;  2DWE C;  2OWO A;  3VQX A;  2YDE A;  3E35 A;  2RCV A;  5IJ9 B;  3F5T A;  1GMG A;  4DUZ O;  2DWD C;  4NYK A;  4WFB V;  2OTL V;  2Q4P A;  2JS3 A;  1BSM A;  4CS2 A;  4I55 A;  4FLZ A;  3JD0 A;  2Y4U A;  5CBG A;  5IJ9 A;  2EUL A;  3JD2 A;  3RN4 A;  2VS0 A;  3HKD B;  3K9A A;  3EHB B;  5CA3 A;  1F4N A;  2V4D A;  3K5N A;  2K9P A;  4FLW A;  3D36 C;  2N05 A;  3L75 H;  4LF8 B;  1WPB A;  1GN6 A;  4I50 B;  1TUB B;  3S3X A;  2UU9 B;  1Q6U A;  1KD1 W;  2OCC B;  3L73 H;  4QIW F;  2JK5 C;  4JPR A;  2CDY A;  4R50 A;  1V55 B;  4KHP O;  2F95 B;  1PNL A;  4JI4 B;  3APO A;  4YJ3 B;  2UUB B;  4R6Z A;  1NU1 H;  3OTO O;  1IBK O;  2LO1 A;  1ROP A;  4UUJ C;  3B09 A;  3ZHR A;  3HKC B;  3R66 A;  2EJR A;  4A5U B;  3K08 A;  4JF3 A;  2DQ0 A;  2ZDI A;  1GN3 A;  1IXM A;  5CA1 B;  4YJ3 A;  3LDD A;  2B9Z A;  3SPG A;  2HVK C;  4YXW G;  1OJH A;  2R70 A;  3ABL C;  1FXV A;  1B06 A;  1AI6 A;  2Q7E A;  2G38 A;  1OCR C;  4I4T A;  2L35 A;  4LF5 B;  5LGU A;  2FML A;  4W4K A;  1GM9 A;  4PA3 A;  2XAF A;  4CBC A;  1LNQ A;  3WFV A;  2P7T C;  1NI8 A;  1ZX3 A;  2XAQ A;  4DR4 B;  1NBM G;  1UFI A;  3CCE V;  4L8J A;  3KZI Z;  4FM0 A;  4LF9 B;  3MD0 A;  1K9M W;  2VQE B;  3SJC C;  2QSA A;  3G71 V;  2ZCE A;  5B1B B;  3OGI B;  4ASU G;  5JJE B;  3DTU B;  1SZX A;  5K1X A;  1F4M A;  2HHH O;  1N32 B;  2CTP A;  1A32 A;  4GX2 A;  3IC9 A;  3CYO A;  3OMA B;  4X1Y B;  2YS8 A;  3X2Q C;  3ZHT A;  2HKO A;  2CH7 B;  3CXC U;  4LWS A;  3JAK B;  3RT3 C;  1YCI A;  3K0G A;  4HZ3 A;  5KUK A;  1QLE C;  1GKF A;  4QNH B;  1G8M A;  2QWR B;  2YUA A;  1QVG U;  2YIA A;  3ZRV A;  1YEW A;  4X1Y A;  4JZG A;  3UM7 A;  1Q6I A;  2CH7 A;  3OR6 C;  3H9V A;  3JAK A;  3L9D A;  4UCV A;  4JYA B;  3JD3 A;  4PDV A;  1V54 C;  4JI3 O;  2HLD G;  3JD4 A;  3LNN A;  4DV0 O;  3ZHS A;  2K1E A;  4MW8 A;  3P3N A;  5KHI A;  1XNR O;  3D3I A;  5FNV B;  2WAM A;  1HW7 A;  2GV9 A;  5IWA B;  4O2B A;  4P9P A;  1NTK H;  4DR2 O;  4HNA B;  2PF4 E;  3B77 A;  4NTW A;  3UCS C;  3OFN G;  1IX9 A;  2ZD9 A;  1K97 A;  1N36 B;  1MNG A;  1S5H C;  4FPP A;  2YI9 A;  2P5O A;  5FNV A;  3OE7 G;  4DK0 A;  1NTZ H;  2AXT Z;  2V7Q G;  3SPJ A;  5CBH A;  1T5E A;  3QO5 A;  5E1A C;  1YVW A;  3K9S A;  2OIG A;  2NNU A;  1RM1 B;  3N2G B;  2DE0 X;  2HJF C;  5JWP A;  3BVO A;  2QTS A;  1XDC A;  1H2G A;  1Y74 B;  1URF A;  2UU9 O;  2X0L A;  1KP3 A;  2ITC C;  5GON A;  3N2G A;  2OCC C;  3FKS G;  1YJW V;  4K3A A;  4PHZ A;  5LHI A;  2OTJ V;  1SQX H;  3HKB A;  2ZDI C;  1CP9 A;  3QO7 A;  3T1Y O;  2WLL B;  1Y74 A;  2CTQ A;  1QQC A;  2EIJ C;  2IJH A;  3D3Q A;  2HVJ C;  5J2T B;  3SYC A;  2JEU A;  3FAV B;  4CZZ A;  4N23 A;  1SER A;  3P3P A;  4MS2 A;  3Q4H B;  4OXS A; 
#chains in the Genus database with same CATH homology
 4JAU A;  4WFA V;  4XDK A;  2WLL A;  3AG2 B;  1K73 W;  3ASN B;  5LGT A;  4RUE A;  2H94 A;  2QTO A;  3CCR V;  2DYR B;  5LHG A;  2CK3 G;  3LNM B;  4E2L A;  2X7R B;  5EBL C;  5L3D A;  2W6J G;  1PKX A;  1E79 G;  2IH1 C;  1JCH A;  2WLJ A;  4XBF A;  3SYA A;  4QJF B;  5HFL A;  5IY5 B;  2GSM B;  3ZN0 A;  5L3G A;  2IU3 A;  1NR1 A;  2IJI A;  1AI7 A;  3OMI B;  2QM8 A;  4RAI A;  1M1K W;  3G6E V;  3ZMV A;  2C2A A;  1R6N A;  3FB7 C;  3T4D A;  1KQS U;  3RVY A;  2B1G A;  3B8N A;  3CCS V;  1PL0 A;  1P7B A;  4U7O A;  1H8H G;  4GX0 A;  2HG5 C;  4J9Z B;  2DYS B;  4BAY A;  4DXW A;  1JQ0 A;  2WPD G;  1AR1 B;  3STL C;  3FB6 C;  5IDJ A;  1DF5 A;  4HYO A;  1KEC A;  3LSS A;  4KUM A;  3ZRW B;  3SPC A;  3ABK B;  1TUE B;  4LC1 A;  1VQK V;  4QE9 A;  1FXH A;  4BIZ A;  2M7W A;  4MTF A;  3F7V C;  3E89 A;  1SRY A;  4L87 A;  2D3O W;  3R65 A;  2Y69 B;  5B1B C;  3D36 A;  1W2B U;  3AG1 B;  3CC4 V;  3K3W A;  4GCZ A;  5IYC O;  1OCZ C;  4WCE V;  3ETG A;  2DYR C;  3DGE A;  2Q69 A;  1I5X A;  3OEH G;  1JOY A;  4MW3 A;  3W7T A;  4TWK A;  3OUS A;  4RQF A;  5CMU A;  1PD3 A;  1THZ A;  2JJ2 G;  4WFH A;  3AEI A;  1VQ8 V;  2OT5 A;  3OR7 C;  3CC7 V;  5L3C A;  2Q67 A;  3LSQ A;  3ML0 A;  2W6I G;  3OAA G;  1ENV A;  4MVM A;  1K5S A;  2UXX A;  4QPK A;  2JJ1 G;  3ZMZ A;  2WLK A;  2B5U A;  3ABL B;  3IC7 A;  4PEL A;  2XAS A;  3SYP A;  1S3J A;  2HFE C;  1Y66 A;  2R9I A;  3E8H A;  3ZRX A;  3I56 V;  5B1A B;  2WLI B;  1M56 C;  1DF4 A;  1FFT B;  2UXN A;  4MVR A;  1QR9 A;  3K0D A;  4JYB A;  1NJI W;  1KKD A;  2IJK A;  3KG2 A;  3F7Y C;  1RPR A;  1XL6 A;  2X6A A;  5KA5 A;  1FXK C;  1NH2 D;  2Y69 C;  1CPY A;  3E8B A;  3E83 A;  1M9N A;  4X8A A;  3W7S A;  3JD1 A;  4PDL A;  3AG3 C;  4TT3 G;  5KUM A;  1NH2 B;  2XAG A;  1ARO P;  3IFX A;  1QBZ A;  2WLI A;  1K4D C;  1VQ9 V;  5EBW C;  5HFM A;  2AHY A;  1OCO B;  1EFR G;  3LUT B;  4P30 A;  1EZJ A;  1M57 C;  2B1I A;  2BOC C;  2QE7 G;  4WFF A;  3AG4 C;  2XOK G;  4PA7 A;  2A0L A;  1YI2 V;  4UV9 A;  1BMF G;  3ZIA G;  3CCL V;  4LP8 A;  4PA4 A;  1K33 A;  1EBO A;  3ZJZ A;  2ZQM A;  4PA6 A;  4LBE C;  4TSF G;  4XDJ A;  1VQ5 V;  3OUF A;  3K79 A;  4GX1 A;  4FIP C;  3FYI B;  4P2Z A;  3F5W C;  3HPL C;  2ZXW C;  4MVZ A;  2HR3 A;  5C93 A;  4FMT A;  1R73 A;  4HAM A;  4QE7 A;  2EIL B;  3X2Q B;  5B1A C;  1MG1 A;  3W7W A;  1YIT V;  5EK0 A;  1RM1 C;  3CME V;  3OGC C;  3LDE A;  4PDM A;  5LGN A;  3P30 A;  4XDL A;  1KP2 A;  4WF9 V;  1Q86 W;  2XND G;  4JAV A;  2JIZ G;  4MVU A;  5DM6 V;  4WFG A;  4WFE A;  1KC8 W;  1YJ9 V;  1H8E G;  4MSW C;  1QR8 A;  1J95 A;  3E8G A;  1N8R W;  2Q68 A;  3ZRS A;  3HB3 B;  2F43 G;  1YTF D;  2EIM C;  5KA6 A;  2WLM A;  1E1R G;  2XAH A;  4EKW A;  3ABM B;  3MHH C;  2WLH A;  3RW0 A;  2EIN C;  5B1O A;  1YTF B;  1Q81 W;  1S76 D;  3T1C A;  3ZMT A;  3BEH A;  3VBB A;  4GX5 A;  3RVZ A;  2ZR2 A;  3ZN1 A;  2P67 A;  1S72 V;  2DWE C;  2EIK B;  3P32 A;  3E35 A;  2WSS G;  5B3S B;  5EC2 C;  4UVC A;  1GMG A;  2DWD C;  2EZO A;  3JCZ A;  3PJS K;  5EBM C;  3AG2 C;  4WFB V;  2OTL V;  3ASN C;  4JGS A;  2IU0 A;  3A0R A;  3STZ C;  2MK3 A;  4R7C A;  1AJP A;  3TK1 A;  1Q7Y W;  1GM7 A;  5J9P C;  3JD0 A;  5CBG A;  1R3I C;  2ATK C;  4MTX A;  4G2K A;  5FL7 G;  3RBZ A;  1H38 A;  1WPX A;  5IY5 C;  3JD2 A;  5L3F A;  1OCC B;  1R3K C;  3K9A A;  4MVO A;  3EHB B;  5CBF A;  1GM8 A;  5LHH A;  4JTD B;  3TCU A;  3WG7 B;  5CA3 A;  1F4N A;  3LDC A;  1CEZ A;  3FB5 C;  1VQP V;  1F51 A;  4J9Y B;  4PDR A;  1AI5 A;  2DYS C;  1JVM A;  1OCR B;  1K34 A;  1KD1 W;  2OCC B;  1MAB G;  1GK9 A;  2Q6A A;  2IJJ A;  3ABK C;  1NR7 A;  3ASO B;  4KP4 A;  2JK5 C;  4JPR A;  4LCU C;  4QIW F;  2LP7 A;  4R50 A;  1V55 B;  2KB1 A;  4UVB A;  1PNL A;  3OW2 U;  4DO2 A;  1AJN A;  1W0K G;  4KFM A;  2YSU B;  1AJQ A;  2YEV B;  1ORQ C;  3AG1 C;  3I55 V;  4R6Z A;  2X6C A;  1YSC A;  1ROP A;  4UUJ C;  4BW5 A;  2IH3 C;  4JYC A;  2EJR A;  1JJ2 U;  1AI4 A;  1PNK A;  3K08 A;  4JF3 A;  2DQ0 A;  2ZDI A;  5H9C A;  2PI5 A;  1WLE A;  4P9O A;  2A79 B;  1IXM A;  1COW G;  2JDI G;  3LDD A;  2YEV A;  1VQ7 V;  4RO2 A;  4I5S A;  3SPG A;  1VQ4 V;  2HVK C;  4YXW G;  5L3E A;  3WG7 C;  1Q82 W;  4PA9 A;  2QM7 A;  4I9W A;  1R3L C;  2W0F C;  3QO8 A;  5EC1 C;  3ABL C;  1FXV A;  1JPX A;  2PI4 A;  2IW5 A;  5LBQ A;  1YHQ V;  1AI6 A;  3H01 A;  3ETE A;  1G4Y B;  1OCR C;  3CD6 V;  3SYO A;  1YJN V;  3CC2 V;  5LGU A;  2DW4 A;  2QA4 V;  1L1F A;  3IGA C;  1DTO A;  1GM9 A;  3ASO C;  1SES A;  2XAF A;  4PA3 A;  1SET A;  1R6K A;  1LNQ A;  5CN0 A;  3WFV A;  1V55 C;  2P7T C;  2P6J A;  4MTO A;  4CBC A;  1QLE B;  1OZ0 A;  1NKD A;  1ZWI C;  2XAQ A;  2H8P C;  2ZR3 A;  1K5Q A;  1NBM G;  3CCE V;  1K7D A;  3VOU A;  1VQ6 V;  2LFR A;  3SJQ C;  3FYE B;  4GT1 A;  1K8A W;  3K03 A;  4BIU A;  1QVF U;  3MD0 A;  1NVP B;  2JEX A;  4Z1M G;  1K9M W;  2DQ3 A;  1OCO C;  1P4R A;  1XL4 A;  3G71 V;  5B1N A;  3CCM V;  1VQL V;  2ITD C;  4H33 A;  3OMN B;  3FB8 C;  3NXS A;  5B1B B;  1V54 B;  4ASU G;  2QKS A;  3DTU B;  1F4M A;  1OCZ B;  4JAS A;  3OEE G;  3OM3 B;  1F23 A;  3SPI A;  3ZCC A;  2WWW A;  4GX2 A;  3CYO A;  3OMA B;  2QEX V;  2EIL C;  4MT8 A;  3X2Q C;  1M90 W;  2HKO A;  3ZMS A;  4MVQ A;  3CXC U;  1VQM V;  4Q20 A;  3K06 A;  3M99 B;  1GO3 F;  1I5Y A;  3K0G A;  4HZ3 A;  5KUK A;  1QLE C;  3W7U A;  3CCQ V;  1GKF A;  2X6B A;  3CP1 A;  4QNH B;  1G8M A;  5L3B A;  1QVG U;  4UXN A;  1MOF A;  1SZT A;  3ZRV A;  3E2E A;  2V1D A;  3ABT A;  1K92 A;  3SPH A;  1OHH G;  2Z5U A;  1M56 B;  3GWO A;  3UM7 A;  3OR6 C;  1PNM A;  5H6R A;  4ZBM A;  3W7X A;  3CMA V;  1K4C C;  4FJC C;  2BOB C;  1FXK B;  1GTO A;  3JD3 A;  4PDV A;  1V54 C;  2HLD G;  3JD4 A;  2AHZ A;  3SYQ A;  3BY6 A;  1RPO A;  4QPJ A;  4RUF A;  4ZKI A;  4FK5 C;  3AG3 B;  2EBO A;  3ABM C;  2A9H A;  3MHS C;  2K1E A;  1E1Q G;  4X89 A;  3UKM A;  4MW8 A;  3E86 A;  3ZRW A;  4G28 B;  1B6Q A;  3D3I A;  1BHB A;  3CCV V;  1M57 B;  1VQO V;  3ABU A;  3K04 A;  2WAM A;  3AG4 B;  1FXK A;  4H37 A;  3ZMU A;  2NLJ C;  2EIK C;  4P9P A;  5B3S C;  2LFS A;  2FTK A;  1YIJ V;  4RQE A;  3B8M A;  2R9R B;  1BL8 A;  3B77 A;  4G27 B;  2WLN A;  1R3J C;  3OFN G;  5IYB O;  2ZD9 A;  2ZXW B;  3CCU V;  1K97 A;  1W0J G;  2EIJ B;  1S5H C;  1FS0 G;  4FPP A;  2GHY A;  4UVA A;  1VQN V;  1HWY A;  3OE7 G;  4R8C A;  3T4Z A;  1K3E A;  1Y4M A;  3E8F A;  4MTG A;  2V7Q G;  3CCJ V;  3SPJ A;  5CBH A;  3TET A;  3QO5 A;  5E1A C;  3EFF K;  1JX9 A;  2NNU A;  1RM1 B;  1QCE A;  3ETD A;  2HJF C;  4JTA B;  2EZP A;  1OCC C;  4JTC B;  1BHA A;  3T2M A;  1MSW D;  1NQT A;  5DN6 G;  4F4L A;  1H2G A;  4MVS A;  2X0L A;  1KP3 A;  2ITC C;  2P90 A;  4UV8 A;  4X88 A;  2Y48 A;  1QLN A;  2OCC C;  3QNE A;  3GB7 C;  3FKS G;  1YJW V;  2EIM B;  5BZB A;  5LHI A;  2OTJ V;  3G4S V;  5H6Q A;  5GW7 A;  2ZDI C;  4N21 A;  1S77 D;  1CP9 A;  2XAJ A;  3CPW U;  2EIN B;  3QO7 A;  1UJW B;  2WLL B;  1NVP D;  5IYD O;  2EIJ C;  2IJH A;  4U7N A;  2HVJ C;  3SYC A;  2JEU A;  4CZZ A;  2Z3Y A;  4N23 A;  1SER A;  1DLB A;  4MS2 A;  1S0V A;  3JYC A;  4OXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...