3ZJZA

Open-form navms sodium channel pore (with c-terminal domain)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ION TRANSPORT PROTEIN
publication title Role of the C-Terminal Domain in the Structure and Function of Tetrameric Sodium Channels.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zjzA00
5EC1C 1J95A 4GX0A 5EK0A 2ITDC 3LDDA 2DWDC 4XDKA 2K1EA 4CBCA 3E8FA 2A0LA 1OCCC 4J9YB 3E8HA 4RUFA 3LNMB 4MTFA 4H37A 4I9WA 1ZWIC 4P30A 4QNHB 4HYOA 2EIJC 4P2ZA 3RVYA 3SJQC 3VOUA 2DWEC 1K4DC 4GX1A 2Q67A 2Y69C 4R6ZA 1R3IC 2HVJC 2WLJA 3EFFK 3SPHA 4MVOA 3BEHA 3OR6C 2A9HA 4JTDB 3ZRSA 4UUJC 4X88A 1S5HC 2YEVA 2EILC 3K0DA 3SPCA 3SYAA 4MVZA 1V54C 3IGAC 4MSWC 2AHYA 3F5WC 3OUSA 2DYSC 3JYCA 5EC2C 4MTGA 3RVZA 1M57C 5EBLC 5E1AC 2ZXWC 2R9RB 4X89A 3ABMC 4MVSA 3E83A 3OGCC 3SYPA 2EINC 3SPGA 2QKSA 1ORQC 2WLLA 2NLJC 3LDCA 4PA9A 3FB8C 4J9ZB 4MTOA 4MVQA 3F7YC 1V55C 3FB7C 4GX5A 4PDRA 4WFFA 4LBEC 4PA6A 4MVRA 2ITCC 2P7TC 2Q6AA 3E8GA 1G4YB 1R3LC 4G27B 3AG1C 3RW0A 2HVKC 3K03A 3K04A 3OUFA 2HG5C 1M56C 2W0FC 4WFGA 3E89A 4EKWA 3STLC 4JTAB 4P9PA 5EBWC 4MW3A 2Q69A 3AG2C 1QLEC 2OCCC 2Q68A 3UM7A 1LNQA 2WLIA 3ZJZA 3K0GA 2JK5C 4PA4A 3SPIA 2BOBC 3LDEA 5B1AC 3UKMA 2X6BA 3SYCA 4XDLA 4HZ3A 3SYQA 5B1BC 3T1CA 2HJFC 3T4DA 4ZBMA 2X6AA 4RO2A 4LP8A 2KB1A 3HPLC 1K4CC 3AG3C 3FB5C 5EBMC 4MVUA 3RBZA 3TETA 3T2MA 3AG4C 4MW8A 4DXWA 5CBHA 2IH1C 4TWKA 1R3JC 2H8PC 2AHZA 5IY5C 1XL4A 3K08A 4WFEA 2BOCC 4JTCB 1R3KC 3IFXA 2WLIB 4X8AA 5KUKA 5CBFA 3FB6C 4QE7A 2A79B 3TCUA 4H33A 2WLMA 3KG2A 3K06A 2ZD9A 4GX2A 4R8CA 3ABLC 3ASNC 5BZBA 4XDJA 3E86A 5B3SC 1OCRC 2IH3C 3ASOC 2WLNA 3ABKC 1OCOC 3PJSK 2WLLB 3SYOA 2WLKA 4P9OA 1JVMA 2DYRC 4OXSA 4PDMA 3R65A 2QTOA 4PDLA 3GB7C 3SPJA 3WG7C 3E8BA 1P7BA 4PA7A 4R7CA 2ATKC 4BW5A 3F7VC 3LUTB 2EIKC 5KUMA 4KFMA 3X2QC 2WLHA 3OR7C 4RUEA 2EIMC 1KKDA 4LCUC 2X6CA 4MS2A 4G28B 4PA3A 4PDVA 4WFHA 2HFEC 3T4ZA 1XL6A 5J9PC 3STZC 5CBGA 4QE9A 4RAIA 1OCZC 4MVMA 1BL8A 4R50A 4F4LA
chains in the Genus database with same CATH superfamily
4N21A 3ZHQA 3ETDA 3GVMA 2P6JA 1HR0O 1I5XA 4ABMA 4PI2A 2D2CB 1W0KG 2WLJA 2A9HA 4UVCA 4LWSA 1NH2B 4O4JA 1MNGA 1Q43A 5EBLC 3CPWU 3S3XA 4HNAB 3OE7G 4NXNO 5J2UB 4GZRB 3DC6A 1DF5A 4YIOA 4NXMB 2E5LB 3C3TA 1AILA 3AG1C 4LF9B 4TQDA 3STLC 3RYFA 4MW3A 3ZMUA 3CE2A 4DV4B 2XAQA 2Q7GA 4X1YA 1XNRB 4JI2O 4JV5O 2VQFO 3CP1A 3AG1B 2YUAA 5B1BC 3T1CA 2ZE5A 1J5EO 4Q20A 2P4KA 4U3JA 2KB1A 1NT2B 3CRMA 3RBZA 4F6RB 1H2GA 4K0KO 4FM2A 5B1BB 1VF5B 1FFXA 4DW0A 1HW7A 1WA8A 1N4CA 1RSOB 4QE7A 4R8CA 1ZX3A 4FIPC 1RM1C 4ZI7B 5GTIZ 1OCRC 1FD9A 3PJSK 4IL6Z 3CC2V 1HNXB 1U96A 4JYAO 2QWNB 1RM1B 4YJ3B 4TUYA 1VF6A 3P3PA 4U7NA 5KUMA 1FYJA 4LCUC 4WFHA 3HKDA 3T4ZA 3K5MA 1JFFB 4O2BB 2FYUH 2DWDC 3CJHA 1JCHA 4I9WA 2XAJA 1SA0B 4TV8B 1IDSA 1KU9A 4IIJA 2Q67A 3EFFK 4FLVA 4JI8O 1S5HC 3SPCA 1H8EG 1AJPA 3B8MA 1FXKA 4UVAA 1N32O 4UXNA 1M90W 4PD4F 2HHHB 1VQ9V 4J7KA 2UUAB 2QEXV 1Z5VA 3M99B 4PA6A 2CAZC 2Z5UA 4ZKIA 3ZS8C 1GN6A 2YS8A 4LF8B 1JA8A 3JASB 3NXSA 2E5LO 1S72V 2P06A 3ZJZA 2OTJV 1HWYA 1BQ0A 3SPIA 5B1AC 4LF9O 3BPZA 4D7SA 4K35A 2VWJA 2W6IG 1NI8A 1R1BA 1XNRO 5IYZA 5B1AB 3MAQA 1R3JC 5IY5C 4YY3B 4X1KA 2BOCC 2V4DA 2Q0AA 3QNEA 4EB6B 4LF7B 3JCZA 5BZBA 2E76B 4XDJA 5IY5B 4DV3B 3L9DA 2WLLB 4U3FH 4GUNA 4K8ZA 3QO5A 1KBHA 2VS0A 1GN4A 2GV9A 4DR4O 4L87A 3IC7A 5KHGA 2HLDG 4KL1A 4YXWG 4WFAV 1HNXO 1YF2A 3BY6A 3CEIA 1K8AW 1BZKA 2K9PA 4H44B 2UXDB 2F43G 1BL8A 4GX0A 2QTSA 3CMEV 4XDKA 2K1EA 3JCUZ 2IBZH 4DK1A 3UQ8A 5L3EA 4RUFA 4MTFA 1PD3A 3PN1A 1N33B 3N2GA 4QPJA 2XASA 1WP7A 3OR6C 1S0VA 3ZRSA 3K79A 1LUWA 3ICXA 2XNDG 5C93A 1F4NA 3CCRV 4X66B 4YJ2A 4X1IB 1M57C 3VBBA 3CXHF 1RFYA 4GT1A 4PA9A 3DSQA 4DR7B 1AI6A 1V55C 3FB7C 1M57B 4DR5B 4LNUA 5C8YB 2HHHO 3QF7A 1YVWA 1P84F 1GM7A 3OW2U 2Q69A 3ZCCA 1QLEC 4BR6A 1V55B 2GUZB 5B1NA 2JK5C 3ZN0A 3CCUV 3ETQA 4J41A 4LF8O 3EHBB 1WN7A 1QLEB 3ETGA 3CSXA 2BSKB 2WWWA 5LL6Y 2OIGA 3IJ4A 1TVKB 2IH1C 3SR2C 1M5IA 2XUMA 5CA3A 4K3AA 3IFXA 4LF4O 4UB8Z 5GONA 5CBFA 3CCLV 2OCHA 3HKEA 2V1DA 4I5SA 4J42A 5JQGB 3G4SV 1VIBA 2WLKA 5ITZA 1RPRA 1IX9A 4CH5A 4LF7O 4I9QA 2BE3A 2YDEA 1PP9H 1NH2D 4DV3O 5KLVH 2Q0OC 2RDCA 3X2QC 3S3WA 2EIMC 2JEUA 1VEWA 4I55A 5LOVB 4CS2A 1SQGA 5JH7A 2HJDA 3I56V 4AHCA 3X2QB 4LF6B 3J80N 2EIMB 4X20A 4IGGA 2UXBO 4FVMA 1ZWIC 2UXDO 4EFEA 2QM8A 3JAWA 1SQVH 3VOUA 2DWEC 3Q4HB 1JX9A 2XAFA 2CH7A 4R6ZA 2R9AA 1T5EA 4KXRA 3SPHA 2P5OA 4UUJC 3JAKA 1YJWV 2Q9LA 2QM4A 3RYHA 2ZM6B 4O4IA 3F5TA 4X89A 3ABMC 4DO2A 1H2LA 3MDSA 5JJNB 2EINC 5H6RA 1YEWA 2Z3YA 4PI0A 1Y76B 1IURA 4MTOA 4FZ1A 4ZOLA 4X66O 3B77A 2GDSA 5LA6A 3E22B 4NR1A 2NN4A 3U11A 1M4UA 1QU7A 1Z2GA 3ABMB 4LFCB 4H13B 2EINB 1N34O 3TXSA 1WB8A 1FPOA 3WB1A 1H2NA 1XMOO 1H2MA 3G71V 1AJNA 1VQ6V 3K5NA 1IBKB 4HZ3A 2HJFC 1NTMH 3N2KB 3JSNA 3NR7A 3HPLC 4I4TB 5KMGA 4DV6O 2IJJA 3AG4C 1H2KA 5IJ9A 3ZHSA 3RYCA 2H8PC 4GKKB 3B2EE 2DJVA 4TQFA 1R3KC 3CX5F 4NKGB 3SJAC 1QVGU 5LHHA 2A3QA 3AG4B 5DECA 1NR7A 3E86A 5LMNO 2PGGA 1TA8A 3K5LA 2LGQA 2UXCB 2DN9A 4GKJB 3GB7C 1Y74B 2F1MA 5K1XA 1HNWB 3D36C 3F7VC 3ZN1A 3LUTB 1ZUQA 3FYIB 3OR7C 2A7WA 4KHPB 2DMXA 3I5DA 1Q5OA 3RGBA 4PA3A 4RAIA 1OCZC 4JI1O 2C2AA 1L0NH 5EK0A 3CRCA 3JD4A 1WJZA 5JCOA 3QG5A 3LNMB 4D7TA 3KCYA 1SQQH 1XOUA 1UPGA 1OCZB 2G38A 1A32A 3VQVA 1SQXH 4LH7A 1YXBA 4X88A 3QVNA 2QM7A 4DV7O 5LYJA 3WFVA 1M1KW 1SZTA 2LP7A 2FTKA 4N23A 5E1AC 1ZAUA 2R9RB 1DTOA 2ZXWC 2QSAA 4AILC 3KKYA 5L3BA 1BHBA 3OM3B 3C3SA 4GX5A 1W59A 2ZM6O 2ZXWB 3JALA 1SESA 2W0FC 1VQMV 4WFGA 4EKWA 1B06A 3T1YB 3W7WA 2HKOA 4W4KA 2CDYA 3JD1A 5CMUA 2WLIA 1Q81W 1N0JA 4LFCO 1XNQB 4UFZA 4PV1B 2QWRB 5HFLA 4JI7B 1RPOA 3ML0A 2JVDA 4JZGA 3JAMN 1N36B 2Y0PA 1IBKO 2Q73A 1GN3A 1FKAO 3DTUB 1XMQO 4X8AA 4TV9A 1K5SA 2RNBA 4X64O 3C90A 4GKKO 1W2BU 1ZL8B 4P9OA 3JSLA 2DW4A 4EFBA 3B4SA 4JAAA 2F23A 1FS0G 3R65A 3CCQV 2IU3A 1NTKH 5L3DA 4X65B 2KG7B 3A0BZ 3CRRA 3CWBH 2MK3A 3EXAA 4CC6A 5KHHA 5IT9N 2UXCO 3DXRA 4GKJO 4O4LB 1F51A 4QE9A 4O4HA 3TGUH 4FLZA 1U97A 4LF5B 2Y4UA 2JGDA 3LSQA 2WPDG 5IJ0A 4DRXB 3ZHRA 1OCCC 3E8HA 1D5NA 4I0XA 1L0LH 1H38A 2P67A 1OZ0A 3FAVA 1LR1A 2UXXA 3BEHA 1OCCB 1TAEA 2ILMA 4FJCC 5H2FZ 4JI0B 2IJHA 3H1KH 3VQXA 1Q8IA 1N8RW 1YCIA 4Z1VA 5KHJA 1Q82W 5D5QA 1KQSU 4LWSB 3CXCU 3H1JH 4O4JB 2GBOA 2W0XA 4B3MO 4JTAB 5IE9A 1WAZA 3SGIA 1DGSA 2FL4A 2LW1A 4ZBMA 3LSSA 2QKCA 2KQXA 4IT5A 4X9QA 5EBMC 1PL0A 5IDJA 3RYFB 2IW5A 4WFEA 4X1YB 4JI7O 2JRIA 3JD3A 3I55V 2ZD9A 1OCOC 4U3JB 4J7JA 3QO7A 1SETA 1NR1A 3ZX6A 1BE3H 1FFXB 1OCOB 4YIPA 2FKXA 2WLHA 2GSMB 4X65O 4CS3A 1VF6C 5KX5B 1VQNV 1WPBA 4J80A 3LDDA 4NVPA 1BSMA 1QR9A 3A0RA 3P30A 4J9YB 2P90A 5B1OA 4QJFB 2EIJC 3RVYA 3ZHTA 4TUYB 4LF5O 2RN9A 2JGUA 3JARA 2UU9O 4MVOA 1ZSPA 1OCRB 1SKVA 2IJKA 1AR1B 3HKDB 3OUSA 1F23A 1FAFA 2CUGA 2L35A 2QE7G 2DYSC 4JYCA 1KMIZ 1RSOA 1TUEB 5JJJB 3CJHB 2QR4A 3E83A 4QPKA 1FXKC 3LDCA 4IIJB 2EZPA 2QWQB 1HNZO 2DYSB 4FMTA 1YI2V 4DUZO 2Q6AA 3BABA 1SS3A 2L6LA 4DV2B 4B7EA 1US6A 1AP6A 4XBFA 2OYQA 4IYIA 4FFKA 5KAIZ 4FZ0A 2RQ6A 1URFA 1EBOA 2ZINA 1VQ8V 1Y6XA 3ZMZA 1GK9A 1B3QA 5DEDA 3TETA 4BIUA 1K3EA 3ETEA 5H6QA 5LHGA 4NXMO 3T1HB 3FB6C 1QBZA 4H33A 2WLMA 1EFRG 4CC5A 3ASNC 4PJ0Z 2ZQMA 4OPHA 1EZJA 4UCOA 5IYZB 4HAMA 4DV4O 1BGYH 1WLEA 4DV0B 3ASNB 1PL4A 3WG7C 2AXTZ 3CHXA 3E8BA 4X1KB 5AG2A 1P7BA 3QO8A 4ZHQA 1G1XB 4FPPA 3IAYA 4UVBA 5FNVA 1WB7A 4MS2A 2X6CA 4RQEA 1IXBA 2MW2B 3QTCA 5IYCO 3B09A 3JD0A 2LO1A 3O65A 1JPXA 1IVSA 1BMFG 3R66A 3CCMV 1WP8A 4DR2B 3VQWA 2EILC 3D3QA 5LGTA 2Q7HA 1NJIW 1VMGA 4EB6A 1GM8A 1XILA 2EILB 2EBOA 1PV0A 2WLLA 1GAXA 1KP3A 1Q90D 3N2GB 1I5YA 4E2LA 2DQ3A 1YTFB 3HKCA 1NS1A 2CTWA 1JJ2U 2HVKC 3ZMSA 4NTYA 4D6TH 3E2EA 5EBWC 1XI1A 2ZT9B 4YJ2B 4AI8A 1YHQV 3U10A 2Q8VA 2OIEA 4DV2O 3UKMA 4GCZA 4XDLA 2CE4A 5IYDO 1E79G 3FX7A 3O9OA 2ODMA 4LNUB 2E3CA 1BHAA 3MHHC 1F4MA 1K4CC 2YIDA 5LP6A 2QJ1A 3W7XA 4LFBB 1KUQA 2YIAA 1WNSA 4DXWA 4TWKA 2YI8A 1WPXA 1XL4A 2CGNA 4FK5C 1XHZA 2P22C 2HR3A 3AK1A 5FPRA 5KUKA 2ZNJA 3TCUA 2UUAO 4DYLA 3L73H 5LXTA 1TGOA 4FM0A 2XAGA 3L74H 5IWAB 2HEPA 1H2SB 1GM9A 1MABG 1P4RA 4J11A 5CA0A 4PA7A 4OPAA 5C8YA 4BW5A 5EYPA 4W4LA 5GONB 4RUEA 5CN0A 5LBQA 4DV0O 2PI4A 2QWOB 1N0NA 1SRYA 5J9PC 2DQ0A 5CA1A 1GKFA 3CB2A 4YY3O 2ZIOA 2PYLA 2VWKA 3A2FA 3APOA 4KUMA 1R6NA 4P30A 5B5EZ 1ZTEA 3G6EV 2YICA 1S77D 4GX1A 4DR6B 1MZFA 2B1GA 3G67A 1TVKA 2YEVA 1ROPA 3K0DA 1K5QA 3VQYA 1GMGA 4IHJA 5JH7B 2QGNA 2AW9A 4X20B 3SPGA 5JQGA 3JAWB 2NLJC 3FKSG 2CH7B 2GTSA 4UV8A 1BS3A 5L3CA 1K97A 2XOKG 3RW0A 2EJRA 4WBNA 2Q4PA 3APQA 4DV5B 1VQPV 5EIBC 3B8NA 4F6EA 2WA3A 3BHPA 3RYHB 4GYCB 1N33O 1KB9F 1Q86W 1RP3B 1VQLV 4CZZA 4ZOLB 1MOFA 2H3OA 2UUBB 5LA6B 4JASA 3OMIB 3T2MA 1I94B 1G8MA 2ZR3A 4FFBA 5TISZ 1R6KA 3H1HH 4JTCB 3G6BA 3UT5B 4BIOA 2UUCB 4DR7O 3M8AA 4DR5O 4LFBO 1GO3F 2A06H 4YHHB 2B1IA 4I50B 2IH3C 3ZHUA 1VQOV 3SDLA 1YDXA 2YXHA 1Q7YW 5IJ9B 2JJ2G 2W6JG 3RYCB 1MA1A 1K9MW 1PPJH 5KHKA 1MMMA 4PDVA 3ZMVA 1FJGB 2E74B 5LGNA 5B66Z 3BRCA 5BMVB 1FXVA 2ITDC 2A0LA 4H37A 4QNHB 2IJIA 2Y48A 1ENVA 2CGOA 4I4TA 3BVOA 4DR3B 2ZE7A 3AK2A 5JCOC 1HDJA 1MSDA 1AB3A 1F7YA 1KECA 3SYPA 2PF4E 1SQBH 2PUSA 3K59A 2ZR2A 3L72H 4CS4A 3CMAV 2AZ0A 2LJ2A 4MVQA 3CCVV 1I0HA 4MVRA 2P7TC 2X0LA 1D5AA 1R3LC 1Y74A 3WU2Z 3K04A 3OUFA 5LYJB 4LF6O 1XEQA 5BXZA 1OJHA 4UCUA 4IYHA 4DV5O 3ZMTA 1Q6UA 2PI5A 3D36A 3EVKA 1NU1H 3HR0A 2QDOA 3L75H 3SJCC 3JALB 3ZRWA 1O9GA 1QR8A 3JATA 2UUBO 4JI4B 1SQFA 3J81N 2WLIB 1PNKA 1HR0B 2ARHA 5F2VO 2A79B 1I94O 4B3RB 4BWAA 3CC4V 4FLXA 4C7UA 3IC9A 1GN2A 1FXHA 4OXSA 3HKBA 3KCXA 4PDMA 1I08A 1XREA 1MZEA 2RMKB 4YHHO 3SPJA 2ZE6A 1NTZH 5J2TA 3OAAG 3OTOB 4CH6A 3GWOA 4NXNB 3ABUA 4TV9B 2PYJA 2R72A 1AR5A 1VF7A 3AEIA 3STZC 4MVMA 1YTFD 4CBCA 4U7OA 4TOIA 1JQ0A 2XT9A 4Z1MG 4HYOA 4QGPA 1K92A 4JV5B 1K33A 1R3IC 2HVJC 3DXRB 1S5JA 5LGUA 1XQ8A 2B5UA 2DE0X 3MHSC 3JYCA 2JGDB 2BTQA 2YSUB 4DR3O 4K0KB 1IZ3A 4MVSA 1HNWO 3ABTA 3U0ZA 3OGCC 1ZL8A 4KHPO 3FAVB 2ZDIA 4GLXA 5JVDA 2KG7A 1M9NA 1TUBA 2HG5C 1M56C 2LGWA 4O2AA 3E89A 5JWPA 4Q6GA 1UJWB 2OCCC 4JYAB 2YI9A 1VQ5V 2BOBC 1XBLA 5EZYA 5CB4A 1M56B 4ZIBA 3M7MX 4DRXA 4RO2A 5LHIA 4JYYA 4JI5B 2ADPA 2OCCB 1MSWD 3A0HZ 4B3TB 2KSDA 3DGEA 3RYIA 2QKAA 2AHZA 5KA6A 1X59A 1SERA 3TJTA 1Y4MA 3ABLC 3P32A 5DM6V 3ZEDA 4J7ZA 1IBLB 4JI4O 2XHBA 4JI8B 4JGSA 3T1YO 1AR4A 3L71H 1YITV 1CPYA 2JEXA 4B3RO 3ABLB 3P3NA 1N32B 1XNQO 1EN5A 2CTQA 1YIJV 3D8CA 1KKDA 2EZOA 4DW1A 3CC7V 3OMNB 4BAYA 4UCRA 2ZIMA 1N36O 5EC1C 3OTOO 3E8FA 4HNAA 4J10A 3CYOA 4RQFA 1GTOA 4P2ZA 1EZVH 4WFBV 3BFRA 2Q7EA 5J2UA 3GWKC 2Y69C 2D3OW 4JTDB 1QQCA 1Q6IA 2B9ZA 1WA8B 2AHYA 1PKXA 2EJ7A 5EIBD 2F66C 2Y69B 3RVZA 1BCCH 1Z5WA 2JS3A 1JR9A 3K3WA 1SZXA 1JJOA 1KD1W 3DC5A 3JARB 1L8DA 3E8GA 4OX9B 4F6RA 2VRZA 4P9PA 3W7UA 1E1RG 1NQTA 2LFRA 3CS5A 4DUYB 2Q68A 3L70H 2EIJB 5FLXN 4PA4A 4UB6Z 4DR4B 5KX5A 2LW7A 1VP7A 4ZI7A 1AP5A 3T4DA 5A2QN 1OV9A 1UFIA 5LMUB 4CH3A 1X4TA 4JI0O 5CBHA 2Y0IA 4YJ3A 2LQTA 1ZLZA 4JI5O 1FXKB 1JMKC 1VARA 4B3TO 3K5OA 3ZRVA 2NR5A 3OEEG 4UCTA 2WLNA 1JFFA 4O2BA 4PDLA 1XUQA 4ICGA 1SA0A 1IBLO 4TV8A 5KHIA 3SJBC 1QLNA 3CCSV 2R9IA 2ETNA 3BA8A 3LNNA 5KAFZ 3H01A 1XDCA 2UXNA 2F4VB 1NBMG 5L3GA 3CRAA 4L8JA 1Y67A 3OMAB 3HB3B 1Q3EA 3AG7A 3OTFA 4E4EA 3B40A 4ZHQB 3ZHVA 1S3JA 1QCEA 1BT8A 4DV1B 4UCVA 5FNVB 2CTRA 2X7RB 2EULA 3N27A 3SYAA 1KP2A 3IGAC 4MVZA 3F5WC 3OEHG 3JASA 5H9CA 2XTAA 5EC2C 3WG7B 4A5UB 2QKSA 4B3SB 4LF4B 3E35A 1THZA 4TT3G 4AQYB 1OHHG 1AI7A 3K03A 2AZ2A 1K73W 4UV9A 1W0JG 1KC8W 1AJQA 2RCVA 5JJEB 1LNQA 1XHXA 4OX9O 4X62B 3SYCA 2QWPB 1MG1A 4I7ZB 3HKCB 4DUYO 4BW9A 2YIBD 1JOYA 3H9VA 4JYBA 4MW8A 2OWOA 4DR1B 2YXLA 4JI6B 2JS5A 2UXBB 5LP6C 5LMUO 4NYKA 1CP9A 1AI5A 2O57A 2PY5A 1JVMA 2DYRC 5LP6B 3FD9A 2WAMA 1HP8A 1QHTA 1NVPB 2OTLV 2IM9A 3ZIAG 4QIWF 2DYRB 2ZKOA 2H94A 1PM9A 2HFEC 4DK0A 5D5PA 5LXTB 3UCSC 1K34A 4R50A 5BR8B 1J95A 4X1IA 1N34B 4LH6A 4LC1A 3H1LH 4B08A 1P49A 4NB5A 4K8XA 5CA0B 3T1HO 2F4VO 3ZBHA 2DOSA 3SJQC 1XMOB 1YZBA 4NTWA 3J7AU 1S5LZ 5EYPB 4LR3A 1R6TA 1BQZA 5BY1A 2CK3G 1O9HA 1V54C 4MSWC 4LFAB 2BCCH 3MD0A 3HKEB 4MTGA 4MT8A 5CA1B 4DV6B 4DV1O 2GUZA 1B04A 2PTMA 5ITZB 2EX3A 1V54B 1ORQC 4MTXA 4JPRA 1YJNV 3TK1A 4J9ZB 2N04A 2JDIG 3F7YC 4WFFA 3FFQA 2ITCC 2YEVB 5LMNB 2BSKA 4BIZA 1COWG 4B3SO 4IHJB 3AG2C 4I55B 2GHYA 5IYBO 4AQYO 2HP8A 4WCEV 3LDEA 4JF3A 4DR2O 1S76D 2FB5A 2X6AA 3AG2B 3OGIB 4WBNB 2PZSA 4JI1B 4X62O 2Z0AA 3JAKB 1E1QG 4FLWA 2ZE8A 2F95B 1GRJA 3G80A 4O4IB 5GTHZ 4DR1O 5B3SC 1K7DA 1VQ4V 2GTAA 3UO3A 5LOVA 4JI6O 1EN4A 2BTOA 4DV7B 1DF4A 4FFBB 1EN6A 5B3SB 4R7CA 3Q4HA 1AI4A 2EIKC 3A8TA 4G28B 3CCEV 1EM1A 1XL6A 5CBGA 5H5NA 2V7QG 2QA4V 4JZ2A 2LFSA 2EIKB 4TSFG 3FYEB 4WF9V 2ZCEA 5KMGB 5L3FA 1KKCA 3WB2A 1K4DC 1Y76A 2E75B 5BR8O 2Y4TA 1NKDA 3E22A 1B6QA 1QNMA 2IU0A 2NNUA 5IWAO 3UT5A 3CRQA 3CCJV 2F93B 3K58A 4FLTA 4I50A 3OFNG 2R70A 2VQEB 4LFAO 1XMQB 3FB8C 1L1FA 1IBMB 3N2KA 4NTXA 2Q5ZA 4ASUG 2ZNIA 4X64B 4G27B 3H1IH 1PNLA 1AROP 3UM7A 1FFTB 4DR6O 5KA5A 3K0GA 2WA4A 2P4VA 2X6BA 3SYQA 1DLBA 3OD4A 1V9PA 5BMVA 4FM1A 4EEQA 4JAUA 2M6YA 4LP8A 1PNMA 3AG3C 3BAAA 2RJZA 2YC0A 3WB0A 1AVMA 4JI3B 2AGAA 3D3IA 4RWUA 3AG3B 1SC5B 4JAVA 3K06A 4GX2A 1VQKV 1H8HG 3ABKC 1IXMA 5DN6G 3ZRWB 5K1PA 2QTOA 3JATB 1VQ7V 1SF9A 1G6UA 3ABKB 2ATKC 1R73A 4KFMA 3RT3C 1SQPH 1YJ9V 3BA9A 1NZ6A 3K57A 4B7KA 4F4LA 5FL7G 4FLYA 4B3MB 3HKBB 3ZRXA 4CH4A 5J2TB 3W7TA 2UUCO 3K9SA 2FMLA 1LUVA 3LSUA 1GH6A 1Y66A 1YSCA 4OGQB 2KKWA 4PELA 1Q6HA 5GW7A 1FJGO 4PDRA 3UO2A 4LBEC 4JI2B 3THOA 4HBNA 4G2KA 1G4YB 2VQFB 2N05A 2M7WA 2YXYA 2N74A 4Z2WA 3RWRD 2VQEO 2YIBA 3KZIZ 1QVFU 3CD6V 3OT7A 1J5EB 2BTQB 1I7FA 3JD2A 1IBMO 2ZDIC 4PHZA 4O4HB 2WSSG 4KP4A 5FPOA 2OT5A 3TXQA 1M93A 5IJ0B 3RN4A 4I0XB 2JJ1G 1NVPD 5JVDB 3FB5C 4MVUA 4O2AB 1TUBB 2XAHA 3K9AA 3K08A 1D2DA 3AK3A 2CTPA 4H0LB 2ADQB 4UCSA 1P7GA 1KYOF 3KG2A 5EZYB 5CB4B 4FLUA 4O4LA 2UU9B 3ASOC 4JI3O 1CXZB 3SYOA 1DK1A 1CEZA 3RYIB 5E79Z 3ASOB 5HFMA 5A9GA 3W7SA 3RFRA 2JIZG 1HNZB 3BCCH 4DUZB
chains in the Genus database with same CATH topology
5EK0A 3JD4A 1GKFA 4N21A 4KUMA 3OMAB 3HB3B 3ETDA 1R6NA 3LNMB 2P6JA 4P30A 3G6EV 1I5XA 1S77D 1S3JA 1OCZB 4GX1A 1QCEA 2B1GA 1W0KG 2WLJA 2A9HA 4X88A 4UVCA 2YEVA 1ROPA 2X7RB 3K0DA 2QM7A 3SYAA 1KP2A 3IGAC 4MVZA 1NH2B 1K5QA 3F5WC 3OEHG 3WFVA 1GMGA 1M1KW 5H9CA 5EC2C 1SZTA 3WG7B 5EBLC 2LP7A 3CPWU 2FTKA 4N23A 5E1AC 2ZXWC 2R9RB 1DTOA 5L3BA 1BHBA 3SPGA 3OM3B 2QKSA 3OE7G 2NLJC 3FKSG 3E35A 1DF5A 1THZA 4TT3G 4UV8A 4GX5A 5L3CA 1OHHG 1K97A 2ZXWB 2XOKG 3RW0A 3AG1C 1AI7A 2EJRA 3K03A 1K73W 1SESA 1VQPV 4UV9A 2W0FC 1W0JG 4WFGA 4EKWA 1VQMV 3STLC 1KC8W 3B8NA 1AJQA 3W7WA 2HKOA 4MW3A 3ZMUA 2XAQA 3JD1A 5CMUA 1LNQA 2WLIA 1Q81W 1Q86W 3CP1A 3AG1B 3SYCA 5HFLA 1VQLV 1MG1A 5B1BC 3T1CA 4CZZA 1MOFA 4Q20A 1RPOA 3ML0A 1JOYA 2KB1A 3RBZA 4JASA 4JYBA 3OMIB 3T2MA 1G8MA 1H2GA 2ZR3A 4MW8A 5B1BB 1R6KA 3DTUB 4JTCB 4X8AA 4QE7A 1CP9A 4R8CA 1GO3F 1K5SA 2B1IA 4FIPC 1RM1C 1OCRC 2IH3C 1W2BU 3PJSK 3CC2V 4P9OA 1AI5A 1JVMA 2DW4A 1VQOV 2DYRC 1Q7YW 3R65A 1FS0G 3CCQV 2IU3A 2JJ2G 2W6JG 2WAMA 5L3DA 1K9MW 1RM1B 2MK3A 1NVPB 2OTLV 4U7NA 5KUMA 3ZIAG 4QIWF 2DYRB 2H94A 4LCUC 4PDVA 4WFHA 2HFEC 1F51A 3ZMVA 5LGNA 3T4ZA 4QE9A 1K34A 4R50A 3LSQA 1J95A 1FXVA 2ITDC 2DWDC 2WPDG 2A0LA 4LC1A 1JCHA 1OCCC 3E8HA 4H37A 4I9WA 2IJIA 4QNHB 1H38A 2XAJA 2Y48A 3SJQC 1ENVA 2Q67A 2P67A 1OZ0A 3EFFK 2UXXA 3BEHA 1S5HC 1OCCB 1H8EG 3SPCA 2CK3G 1V54C 4MSWC 1AJPA 3B8MA 3MD0A 1FXKA 4UVAA 4FJCC 4MTGA 4MT8A 4UXNA 1M90W 2IJHA 1KECA 3SYPA 1VQ9V 1V54B 1ORQC 1N8RW 4MTXA 2ZR2A 4JPRA 1YJNV 3TK1A 3CMAV 4J9ZB 2JDIG 1Q82W 4MVQA 3F7YC 4WFFA 3CCVV 1KQSU 2QEXV 3M99B 4PA6A 4MVRA 2ITCC 2P7TC 2X0LA 2YEVB 1R3LC 2Z5UA 4ZKIA 4BIZA 3CXCU 1COWG 3K04A 3OUFA 4JTAB 3NXSA 3AG2C 2GHYA 5IYBO 1S72V 3ZJZA 2OTJV 1HWYA 3SPIA 4WCEV 3LDEA 5B1AC 3ZMTA 2PI5A 4JF3A 3D36A 1S76D 4ZBMA 2W6IG 2X6AA 3LSSA 3AG2B 5EBMC 3ZRWA 1PL0A 5IDJA 5B1AB 1QR8A 1R3JC 1E1QG 5IY5C 2IW5A 4WFEA 2BOCC 2WLIB 1PNKA 3QNEA 2A79B 3JD3A 3JCZA 5BZBA 3I55V 2ZD9A 4XDJA 5B3SC 1K7DA 1VQ4V 5IY5B 3CC4V 1OCOC 2WLLB 3QO7A 1SETA 1DF4A 1FXHA 4OXSA 4PDMA 3QO5A 3SPJA 1NR1A 5B3SB 4L87A 4R7CA 1OCOB 3OAAG 3IC7A 1AI4A 2HLDG 2EIKC 3GWOA 2WLHA 4YXWG 4WFAV 3ABUA 2GSMB 3BY6A 4G28B 3CCEV 1K8AW 2F43G 1XL6A 3AEIA 3STZC 5CBGA 1VQNV 4MVMA 2V7QG 1BL8A 4GX0A 2QA4V 3LDDA 3CMEV 4XDKA 4CBCA 2K1EA 2EIKB 2LFSA 4U7OA 1YTFD 3P30A 1JQ0A 1QR9A 3A0RA 5L3EA 4TSFG 4J9YB 2P90A 4RUFA 5B1OA 4MTFA 1PD3A 3FYEB 4QJFB 4WF9V 4Z1MG 5L3FA 4HYOA 2EIJC 3RVYA 1K92A 1K4DC 1K33A 4QPJA 2XASA 1NKDA 1R3IC 2HVJC 4MVOA 1OCRB 1B6QA 3OR6C 2IU0A 3ZRSA 1S0VA 3K79A 2IJKA 2XNDG 5LGUA 5C93A 1AR1B 1F4NA 2B5UA 1F23A 3OUSA 3MHSC 2QE7G 2NNUA 2DYSC 3JYCA 4JYCA 3CCRV 1M57C 2YSUB 1TUEB 3VBBA 3CCJV 4MVSA 3ABTA 3E83A 3OGCC 4QPKA 3OFNG 1FXKC 3LDCA 4GT1A 2EZPA 4PA9A 2DYSB 3FB8C 4FMTA 1L1FA 1AI6A 1V55C 3FB7C 1M57B 1YI2V 2ZDIA 4ASUG 2Q6AA 4G27B 1M9NA 2HG5C 1M56C 3E89A 1GM7A 1PNLA 3OW2U 1UJWB 1AROP 2Q69A 3ZCCA 1QLEC 4XBFA 2OCCC 1V55B 3UM7A 1FFTB 5B1NA 5KA5A 3K0GA 2JK5C 3ZN0A 3CCUV 1VQ5V 2BOBC 2X6BA 1M56B 3SYQA 1DLBA 1EBOA 3EHBB 1VQ8V 4JAUA 5LHIA 4RO2A 1QLEB 2OCCB 1GK9A 3ETGA 4LP8A 3ZMZA 1PNMA 1MSWD 3AG3C 3TETA 2WWWA 3DGEA 2IH1C 4BIUA 2AHZA 5KA6A 5CA3A 1K3EA 3ETEA 5H6QA 1SERA 3IFXA 3D3IA 5LHGA 5CBFA 3AG3B 3FB6C 3CCLV 1QBZA 4H33A 2WLMA 4JAVA 3K06A 1EFRG 4GX2A 1Y4MA 3ABLC 3ASNC 2ZQMA 3P32A 2V1DA 4I5SA 5DM6V 1VQKV 1EZJA 1H8HG 3ABKC 3G4SV 1IXMA 5DN6G 2WLKA 4JGSA 1RPRA 4HAMA 3ZRWB 1YITV 1CPYA 1WLEA 2QTOA 2JEXA 3ABLB 3ASNB 3WG7C 3E8BA 1VQ7V 1NH2D 1P7BA 3QO8A 3ABKB 2ATKC 4FPPA 1R73A 4KFMA 3X2QC 4UVBA 1YIJV 2EIMC 1KKDA 2EZOA 4MS2A 2JEUA 2X6CA 3CC7V 1YJ9V 3OMNB 4BAYA 4RQEA 4F4LA 5EC1C 3I56V 5IYCO 5FL7G 3E8FA 3JD0A 3X2QB 1JPXA 2EIMB 3ZRXA 1BMFG 3CYOA 1ZWIC 3W7TA 4RQFA 1GTOA 4P2ZA 2QM8A 3CCMV 3VOUA 4WFBV 2DWEC 1JX9A 2XAFA 2Y69C 4R6ZA 3SPHA 2D3OW 4JTDB 4UUJC 1Y66A 2EILC 5LGTA 1YJWV 2AHYA 1YSCA 1PKXA 1NJIW 2Y69B 3RVZA 4PELA 4X89A 3ABMC 4DO2A 1GM8A 3K3WA 2EINC 5H6RA 2EILB 1KD1W 2EBOA 2Z3YA 2WLLA 1KP3A 1I5YA 5GW7A 4E2LA 4MTOA 2DQ3A 1YTFB 3B77A 4PDRA 4LBEC 4G2KA 3E8GA 1G4YB 3ABMB 1JJ2U 2HVKC 2M7WA 2EINB 3ZMSA 1QVFU 3CD6V 3E2EA 4P9PA 3W7UA 1E1RG 1NQTA 5EBWC 2LFRA 1YHQV 3JD2A 2ZDIC 2Q68A 2EIJB 2WSSG 4KP4A 2OT5A 4PA4A 3G71V 1AJNA 1VQ6V 3UKMA 4GCZA 4XDLA 4HZ3A 5IYDO 2HJFC 3T4DA 1E79G 2JJ1G 1NVPD 1BHAA 3MHHC 1F4MA 3HPLC 1K4CC 3FB5C 4MVUA 2IJJA 2XAHA 3AG4C 3W7XA 3K9AA 4DXWA 5CBHA 4TWKA 2H8PC 1WPXA 1XL4A 4FK5C 3K08A 1R3KC 2HR3A 1FXKB 5KUKA 3TCUA 3ZRVA 5LHHA 3KG2A 1QVGU 3AG4B 1NR7A 3E86A 3OEEG 3ASOC 2WLNA 3SYOA 2XAGA 4PDLA 3GB7C 1CEZA 1GM9A 1MABG 1P4RA 4PA7A 3ASOB 4BW5A 5HFMA 3W7SA 3F7VC 1QLNA 3ZN1A 3LUTB 2R9IA 3CCSV 2JIZG 3FYIB 3OR7C 4RUEA 5CN0A 5LBQA 2PI4A 3H01A 4PA3A 2UXNA 1SRYA 5J9PC 1NBMG 1OCZC 4RAIA 5L3GA 2C2AA 2DQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC1 C;  1J95 A;  4GX0 A;  5EK0 A;  2ITD C;  3LDD A;  2DWD C;  4XDK A;  2K1E A;  4CBC A;  3E8F A;  2A0L A;  1OCC C;  4J9Y B;  3E8H A;  4RUF A;  3LNM B;  4MTF A;  4H37 A;  4I9W A;  1ZWI C;  4P30 A;  4QNH B;  4HYO A;  2EIJ C;  4P2Z A;  3RVY A;  3SJQ C;  3VOU A;  2DWE C;  1K4D C;  4GX1 A;  2Q67 A;  2Y69 C;  4R6Z A;  1R3I C;  2HVJ C;  2WLJ A;  3EFF K;  3SPH A;  4MVO A;  3BEH A;  3OR6 C;  2A9H A;  4JTD B;  3ZRS A;  4UUJ C;  4X88 A;  1S5H C;  2YEV A;  2EIL C;  3K0D A;  3SPC A;  3SYA A;  4MVZ A;  1V54 C;  3IGA C;  4MSW C;  2AHY A;  3F5W C;  3OUS A;  2DYS C;  3JYC A;  5EC2 C;  4MTG A;  3RVZ A;  1M57 C;  5EBL C;  5E1A C;  2ZXW C;  2R9R B;  4X89 A;  3ABM C;  4MVS A;  3E83 A;  3OGC C;  3SYP A;  2EIN C;  3SPG A;  2QKS A;  1ORQ C;  2WLL A;  2NLJ C;  3LDC A;  4PA9 A;  3FB8 C;  4J9Z B;  4MTO A;  4MVQ A;  3F7Y C;  1V55 C;  3FB7 C;  4GX5 A;  4PDR A;  4WFF A;  4LBE C;  4PA6 A;  4MVR A;  2ITC C;  2P7T C;  2Q6A A;  3E8G A;  1G4Y B;  1R3L C;  4G27 B;  3AG1 C;  3RW0 A;  2HVK C;  3K03 A;  3K04 A;  3OUF A;  2HG5 C;  1M56 C;  2W0F C;  4WFG A;  3E89 A;  4EKW A;  3STL C;  4JTA B;  4P9P A;  5EBW C;  4MW3 A;  2Q69 A;  3AG2 C;  1QLE C;  2OCC C;  2Q68 A;  3UM7 A;  1LNQ A;  2WLI A;  3ZJZ A;  3K0G A;  2JK5 C;  4PA4 A;  3SPI A;  2BOB C;  3LDE A;  5B1A C;  3UKM A;  2X6B A;  3SYC A;  4XDL A;  4HZ3 A;  3SYQ A;  5B1B C;  3T1C A;  2HJF C;  3T4D A;  4ZBM A;  2X6A A;  4RO2 A;  4LP8 A;  2KB1 A;  3HPL C;  1K4C C;  3AG3 C;  3FB5 C;  5EBM C;  4MVU A;  3RBZ A;  3TET A;  3T2M A;  3AG4 C;  4MW8 A;  4DXW A;  5CBH A;  2IH1 C;  4TWK A;  1R3J C;  2H8P C;  2AHZ A;  5IY5 C;  1XL4 A;  3K08 A;  4WFE A;  2BOC C;  4JTC B;  1R3K C;  3IFX A;  2WLI B;  4X8A A;  5KUK A;  5CBF A;  3FB6 C;  4QE7 A;  2A79 B;  3TCU A;  4H33 A;  2WLM A;  3KG2 A;  3K06 A;  2ZD9 A;  4GX2 A;  4R8C A;  3ABL C;  3ASN C;  5BZB A;  4XDJ A;  3E86 A;  5B3S C;  1OCR C;  2IH3 C;  3ASO C;  2WLN A;  3ABK C;  1OCO C;  3PJS K;  2WLL B;  3SYO A;  2WLK A;  4P9O A;  1JVM A;  2DYR C;  4OXS A;  4PDM A;  3R65 A;  2QTO A;  4PDL A;  3GB7 C;  3SPJ A;  3WG7 C;  3E8B A;  1P7B A;  4PA7 A;  4R7C A;  2ATK C;  4BW5 A;  3F7V C;  3LUT B;  2EIK C;  5KUM A;  4KFM A;  3X2Q C;  2WLH A;  3OR7 C;  4RUE A;  2EIM C;  1KKD A;  4LCU C;  2X6C A;  4MS2 A;  4G28 B;  4PA3 A;  4PDV A;  4WFH A;  2HFE C;  3T4Z A;  1XL6 A;  5J9P C;  3STZ C;  5CBG A;  4QE9 A;  4RAI A;  1OCZ C;  4MVM A;  1BL8 A;  4R50 A;  4F4L A; 
#chains in the Genus database with same CATH topology
 4N21 A;  3ZHQ A;  3ETD A;  3GVM A;  2P6J A;  1HR0 O;  1I5X A;  4ABM A;  4PI2 A;  2D2C B;  1W0K G;  2WLJ A;  2A9H A;  4UVC A;  4LWS A;  1NH2 B;  4O4J A;  1MNG A;  1Q43 A;  5EBL C;  3CPW U;  3S3X A;  4HNA B;  3OE7 G;  4NXN O;  5J2U B;  4GZR B;  3DC6 A;  1DF5 A;  4YIO A;  4NXM B;  2E5L B;  3C3T A;  1AIL A;  3AG1 C;  4LF9 B;  4TQD A;  3STL C;  3RYF A;  4MW3 A;  3ZMU A;  3CE2 A;  4DV4 B;  2XAQ A;  2Q7G A;  4X1Y A;  1XNR B;  4JI2 O;  4JV5 O;  2VQF O;  3CP1 A;  3AG1 B;  2YUA A;  5B1B C;  3T1C A;  2ZE5 A;  1J5E O;  4Q20 A;  2P4K A;  4U3J A;  2KB1 A;  1NT2 B;  3CRM A;  3RBZ A;  4F6R B;  1H2G A;  4K0K O;  4FM2 A;  5B1B B;  1VF5 B;  1FFX A;  4DW0 A;  1HW7 A;  1WA8 A;  1N4C A;  1RSO B;  4QE7 A;  4R8C A;  1ZX3 A;  4FIP C;  1RM1 C;  4ZI7 B;  5GTI Z;  1OCR C;  1FD9 A;  3PJS K;  4IL6 Z;  3CC2 V;  1HNX B;  1U96 A;  4JYA O;  2QWN B;  1RM1 B;  4YJ3 B;  4TUY A;  1VF6 A;  3P3P A;  4U7N A;  5KUM A;  1FYJ A;  4LCU C;  4WFH A;  3HKD A;  3T4Z A;  3K5M A;  1JFF B;  4O2B B;  2FYU H;  2DWD C;  3CJH A;  1JCH A;  4I9W A;  2XAJ A;  1SA0 B;  4TV8 B;  1IDS A;  1KU9 A;  4IIJ A;  2Q67 A;  3EFF K;  4FLV A;  4JI8 O;  1S5H C;  3SPC A;  1H8E G;  1AJP A;  3B8M A;  1FXK A;  4UVA A;  1N32 O;  4UXN A;  1M90 W;  4PD4 F;  2HHH B;  1VQ9 V;  4J7K A;  2UUA B;  2QEX V;  1Z5V A;  3M99 B;  4PA6 A;  2CAZ C;  2Z5U A;  4ZKI A;  3ZS8 C;  1GN6 A;  2YS8 A;  4LF8 B;  1JA8 A;  3JAS B;  3NXS A;  2E5L O;  1S72 V;  2P06 A;  3ZJZ A;  2OTJ V;  1HWY A;  1BQ0 A;  3SPI A;  5B1A C;  4LF9 O;  3BPZ A;  4D7S A;  4K35 A;  2VWJ A;  2W6I G;  1NI8 A;  1R1B A;  1XNR O;  5IYZ A;  5B1A B;  3MAQ A;  1R3J C;  5IY5 C;  4YY3 B;  4X1K A;  2BOC C;  2V4D A;  2Q0A A;  3QNE A;  4EB6 B;  4LF7 B;  3JCZ A;  5BZB A;  2E76 B;  4XDJ A;  5IY5 B;  4DV3 B;  3L9D A;  2WLL B;  4U3F H;  4GUN A;  4K8Z A;  3QO5 A;  1KBH A;  2VS0 A;  1GN4 A;  2GV9 A;  4DR4 O;  4L87 A;  3IC7 A;  5KHG A;  2HLD G;  4KL1 A;  4YXW G;  4WFA V;  1HNX O;  1YF2 A;  3BY6 A;  3CEI A;  1K8A W;  1BZK A;  2K9P A;  4H44 B;  2UXD B;  2F43 G;  1BL8 A;  4GX0 A;  2QTS A;  3CME V;  4XDK A;  2K1E A;  3JCU Z;  2IBZ H;  4DK1 A;  3UQ8 A;  5L3E A;  4RUF A;  4MTF A;  1PD3 A;  3PN1 A;  1N33 B;  3N2G A;  4QPJ A;  2XAS A;  1WP7 A;  3OR6 C;  1S0V A;  3ZRS A;  3K79 A;  1LUW A;  3ICX A;  2XND G;  5C93 A;  1F4N A;  3CCR V;  4X66 B;  4YJ2 A;  4X1I B;  1M57 C;  3VBB A;  3CXH F;  1RFY A;  4GT1 A;  4PA9 A;  3DSQ A;  4DR7 B;  1AI6 A;  1V55 C;  3FB7 C;  1M57 B;  4DR5 B;  4LNU A;  5C8Y B;  2HHH O;  3QF7 A;  1YVW A;  1P84 F;  1GM7 A;  3OW2 U;  2Q69 A;  3ZCC A;  1QLE C;  4BR6 A;  1V55 B;  2GUZ B;  5B1N A;  2JK5 C;  3ZN0 A;  3CCU V;  3ETQ A;  4J41 A;  4LF8 O;  3EHB B;  1WN7 A;  1QLE B;  3ETG A;  3CSX A;  2BSK B;  2WWW A;  5LL6 Y;  2OIG A;  3IJ4 A;  1TVK B;  2IH1 C;  3SR2 C;  1M5I A;  2XUM A;  5CA3 A;  4K3A A;  3IFX A;  4LF4 O;  4UB8 Z;  5GON A;  5CBF A;  3CCL V;  2OCH A;  3HKE A;  2V1D A;  4I5S A;  4J42 A;  5JQG B;  3G4S V;  1VIB A;  2WLK A;  5ITZ A;  1RPR A;  1IX9 A;  4CH5 A;  4LF7 O;  4I9Q A;  2BE3 A;  2YDE A;  1PP9 H;  1NH2 D;  4DV3 O;  5KLV H;  2Q0O C;  2RDC A;  3X2Q C;  3S3W A;  2EIM C;  2JEU A;  1VEW A;  4I55 A;  5LOV B;  4CS2 A;  1SQG A;  5JH7 A;  2HJD A;  3I56 V;  4AHC A;  3X2Q B;  4LF6 B;  3J80 N;  2EIM B;  4X20 A;  4IGG A;  2UXB O;  4FVM A;  1ZWI C;  2UXD O;  4EFE A;  2QM8 A;  3JAW A;  1SQV H;  3VOU A;  2DWE C;  3Q4H B;  1JX9 A;  2XAF A;  2CH7 A;  4R6Z A;  2R9A A;  1T5E A;  4KXR A;  3SPH A;  2P5O A;  4UUJ C;  3JAK A;  1YJW V;  2Q9L A;  2QM4 A;  3RYH A;  2ZM6 B;  4O4I A;  3F5T A;  4X89 A;  3ABM C;  4DO2 A;  1H2L A;  3MDS A;  5JJN B;  2EIN C;  5H6R A;  1YEW A;  2Z3Y A;  4PI0 A;  1Y76 B;  1IUR A;  4MTO A;  4FZ1 A;  4ZOL A;  4X66 O;  3B77 A;  2GDS A;  5LA6 A;  3E22 B;  4NR1 A;  2NN4 A;  3U11 A;  1M4U A;  1QU7 A;  1Z2G A;  3ABM B;  4LFC B;  4H13 B;  2EIN B;  1N34 O;  3TXS A;  1WB8 A;  1FPO A;  3WB1 A;  1H2N A;  1XMO O;  1H2M A;  3G71 V;  1AJN A;  1VQ6 V;  3K5N A;  1IBK B;  4HZ3 A;  2HJF C;  1NTM H;  3N2K B;  3JSN A;  3NR7 A;  3HPL C;  4I4T B;  5KMG A;  4DV6 O;  2IJJ A;  3AG4 C;  1H2K A;  5IJ9 A;  3ZHS A;  3RYC A;  2H8P C;  4GKK B;  3B2E E;  2DJV A;  4TQF A;  1R3K C;  3CX5 F;  4NKG B;  3SJA C;  1QVG U;  5LHH A;  2A3Q A;  3AG4 B;  5DEC A;  1NR7 A;  3E86 A;  5LMN O;  2PGG A;  1TA8 A;  3K5L A;  2LGQ A;  2UXC B;  2DN9 A;  4GKJ B;  3GB7 C;  1Y74 B;  2F1M A;  5K1X A;  1HNW B;  3D36 C;  3F7V C;  3ZN1 A;  3LUT B;  1ZUQ A;  3FYI B;  3OR7 C;  2A7W A;  4KHP B;  2DMX A;  3I5D A;  1Q5O A;  3RGB A;  4PA3 A;  4RAI A;  1OCZ C;  4JI1 O;  2C2A A;  1L0N H;  5EK0 A;  3CRC A;  3JD4 A;  1WJZ A;  5JCO A;  3QG5 A;  3LNM B;  4D7T A;  3KCY A;  1SQQ H;  1XOU A;  1UPG A;  1OCZ B;  2G38 A;  1A32 A;  3VQV A;  1SQX H;  4LH7 A;  1YXB A;  4X88 A;  3QVN A;  2QM7 A;  4DV7 O;  5LYJ A;  3WFV A;  1M1K W;  1SZT A;  2LP7 A;  2FTK A;  4N23 A;  5E1A C;  1ZAU A;  2R9R B;  1DTO A;  2ZXW C;  2QSA A;  4AIL C;  3KKY A;  5L3B A;  1BHB A;  3OM3 B;  3C3S A;  4GX5 A;  1W59 A;  2ZM6 O;  2ZXW B;  3JAL A;  1SES A;  2W0F C;  1VQM V;  4WFG A;  4EKW A;  1B06 A;  3T1Y B;  3W7W A;  2HKO A;  4W4K A;  2CDY A;  3JD1 A;  5CMU A;  2WLI A;  1Q81 W;  1N0J A;  4LFC O;  1XNQ B;  4UFZ A;  4PV1 B;  2QWR B;  5HFL A;  4JI7 B;  1RPO A;  3ML0 A;  2JVD A;  4JZG A;  3JAM N;  1N36 B;  2Y0P A;  1IBK O;  2Q73 A;  1GN3 A;  1FKA O;  3DTU B;  1XMQ O;  4X8A A;  4TV9 A;  1K5S A;  2RNB A;  4X64 O;  3C90 A;  4GKK O;  1W2B U;  1ZL8 B;  4P9O A;  3JSL A;  2DW4 A;  4EFB A;  3B4S A;  4JAA A;  2F23 A;  1FS0 G;  3R65 A;  3CCQ V;  2IU3 A;  1NTK H;  5L3D A;  4X65 B;  2KG7 B;  3A0B Z;  3CRR A;  3CWB H;  2MK3 A;  3EXA A;  4CC6 A;  5KHH A;  5IT9 N;  2UXC O;  3DXR A;  4GKJ O;  4O4L B;  1F51 A;  4QE9 A;  4O4H A;  3TGU H;  4FLZ A;  1U97 A;  4LF5 B;  2Y4U A;  2JGD A;  3LSQ A;  2WPD G;  5IJ0 A;  4DRX B;  3ZHR A;  1OCC C;  3E8H A;  1D5N A;  4I0X A;  1L0L H;  1H38 A;  2P67 A;  1OZ0 A;  3FAV A;  1LR1 A;  2UXX A;  3BEH A;  1OCC B;  1TAE A;  2ILM A;  4FJC C;  5H2F Z;  4JI0 B;  2IJH A;  3H1K H;  3VQX A;  1Q8I A;  1N8R W;  1YCI A;  4Z1V A;  5KHJ A;  1Q82 W;  5D5Q A;  1KQS U;  4LWS B;  3CXC U;  3H1J H;  4O4J B;  2GBO A;  2W0X A;  4B3M O;  4JTA B;  5IE9 A;  1WAZ A;  3SGI A;  1DGS A;  2FL4 A;  2LW1 A;  4ZBM A;  3LSS A;  2QKC A;  2KQX A;  4IT5 A;  4X9Q A;  5EBM C;  1PL0 A;  5IDJ A;  3RYF B;  2IW5 A;  4WFE A;  4X1Y B;  4JI7 O;  2JRI A;  3JD3 A;  3I55 V;  2ZD9 A;  1OCO C;  4U3J B;  4J7J A;  3QO7 A;  1SET A;  1NR1 A;  3ZX6 A;  1BE3 H;  1FFX B;  1OCO B;  4YIP A;  2FKX A;  2WLH A;  2GSM B;  4X65 O;  4CS3 A;  1VF6 C;  5KX5 B;  1VQN V;  1WPB A;  4J80 A;  3LDD A;  4NVP A;  1BSM A;  1QR9 A;  3A0R A;  3P30 A;  4J9Y B;  2P90 A;  5B1O A;  4QJF B;  2EIJ C;  3RVY A;  3ZHT A;  4TUY B;  4LF5 O;  2RN9 A;  2JGU A;  3JAR A;  2UU9 O;  4MVO A;  1ZSP A;  1OCR B;  1SKV A;  2IJK A;  1AR1 B;  3HKD B;  3OUS A;  1F23 A;  1FAF A;  2CUG A;  2L35 A;  2QE7 G;  2DYS C;  4JYC A;  1KMI Z;  1RSO A;  1TUE B;  5JJJ B;  3CJH B;  2QR4 A;  3E83 A;  4QPK A;  1FXK C;  3LDC A;  4IIJ B;  2EZP A;  2QWQ B;  1HNZ O;  2DYS B;  4FMT A;  1YI2 V;  4DUZ O;  2Q6A A;  3BAB A;  1SS3 A;  2L6L A;  4DV2 B;  4B7E A;  1US6 A;  1AP6 A;  4XBF A;  2OYQ A;  4IYI A;  4FFK A;  5KAI Z;  4FZ0 A;  2RQ6 A;  1URF A;  1EBO A;  2ZIN A;  1VQ8 V;  1Y6X A;  3ZMZ A;  1GK9 A;  1B3Q A;  5DED A;  3TET A;  4BIU A;  1K3E A;  3ETE A;  5H6Q A;  5LHG A;  4NXM O;  3T1H B;  3FB6 C;  1QBZ A;  4H33 A;  2WLM A;  1EFR G;  4CC5 A;  3ASN C;  4PJ0 Z;  2ZQM A;  4OPH A;  1EZJ A;  4UCO A;  5IYZ B;  4HAM A;  4DV4 O;  1BGY H;  1WLE A;  4DV0 B;  3ASN B;  1PL4 A;  3WG7 C;  2AXT Z;  3CHX A;  3E8B A;  4X1K B;  5AG2 A;  1P7B A;  3QO8 A;  4ZHQ A;  1G1X B;  4FPP A;  3IAY A;  4UVB A;  5FNV A;  1WB7 A;  4MS2 A;  2X6C A;  4RQE A;  1IXB A;  2MW2 B;  3QTC A;  5IYC O;  3B09 A;  3JD0 A;  2LO1 A;  3O65 A;  1JPX A;  1IVS A;  1BMF G;  3R66 A;  3CCM V;  1WP8 A;  4DR2 B;  3VQW A;  2EIL C;  3D3Q A;  5LGT A;  2Q7H A;  1NJI W;  1VMG A;  4EB6 A;  1GM8 A;  1XIL A;  2EIL B;  2EBO A;  1PV0 A;  2WLL A;  1GAX A;  1KP3 A;  1Q90 D;  3N2G B;  1I5Y A;  4E2L A;  2DQ3 A;  1YTF B;  3HKC A;  1NS1 A;  2CTW A;  1JJ2 U;  2HVK C;  3ZMS A;  4NTY A;  4D6T H;  3E2E A;  5EBW C;  1XI1 A;  2ZT9 B;  4YJ2 B;  4AI8 A;  1YHQ V;  3U10 A;  2Q8V A;  2OIE A;  4DV2 O;  3UKM A;  4GCZ A;  4XDL A;  2CE4 A;  5IYD O;  1E79 G;  3FX7 A;  3O9O A;  2ODM A;  4LNU B;  2E3C A;  1BHA A;  3MHH C;  1F4M A;  1K4C C;  2YID A;  5LP6 A;  2QJ1 A;  3W7X A;  4LFB B;  1KUQ A;  2YIA A;  1WNS A;  4DXW A;  4TWK A;  2YI8 A;  1WPX A;  1XL4 A;  2CGN A;  4FK5 C;  1XHZ A;  2P22 C;  2HR3 A;  3AK1 A;  5FPR A;  5KUK A;  2ZNJ A;  3TCU A;  2UUA O;  4DYL A;  3L73 H;  5LXT A;  1TGO A;  4FM0 A;  2XAG A;  3L74 H;  5IWA B;  2HEP A;  1H2S B;  1GM9 A;  1MAB G;  1P4R A;  4J11 A;  5CA0 A;  4PA7 A;  4OPA A;  5C8Y A;  4BW5 A;  5EYP A;  4W4L A;  5GON B;  4RUE A;  5CN0 A;  5LBQ A;  4DV0 O;  2PI4 A;  2QWO B;  1N0N A;  1SRY A;  5J9P C;  2DQ0 A;  5CA1 A;  1GKF A;  3CB2 A;  4YY3 O;  2ZIO A;  2PYL A;  2VWK A;  3A2F A;  3APO A;  4KUM A;  1R6N A;  4P30 A;  5B5E Z;  1ZTE A;  3G6E V;  2YIC A;  1S77 D;  4GX1 A;  4DR6 B;  1MZF A;  2B1G A;  3G67 A;  1TVK A;  2YEV A;  1ROP A;  3K0D A;  1K5Q A;  3VQY A;  1GMG A;  4IHJ A;  5JH7 B;  2QGN A;  2AW9 A;  4X20 B;  3SPG A;  5JQG A;  3JAW B;  2NLJ C;  3FKS G;  2CH7 B;  2GTS A;  4UV8 A;  1BS3 A;  5L3C A;  1K97 A;  2XOK G;  3RW0 A;  2EJR A;  4WBN A;  2Q4P A;  3APQ A;  4DV5 B;  1VQP V;  5EIB C;  3B8N A;  4F6E A;  2WA3 A;  3BHP A;  3RYH B;  4GYC B;  1N33 O;  1KB9 F;  1Q86 W;  1RP3 B;  1VQL V;  4CZZ A;  4ZOL B;  1MOF A;  2H3O A;  2UUB B;  5LA6 B;  4JAS A;  3OMI B;  3T2M A;  1I94 B;  1G8M A;  2ZR3 A;  4FFB A;  5TIS Z;  1R6K A;  3H1H H;  4JTC B;  3G6B A;  3UT5 B;  4BIO A;  2UUC B;  4DR7 O;  3M8A A;  4DR5 O;  4LFB O;  1GO3 F;  2A06 H;  4YHH B;  2B1I A;  4I50 B;  2IH3 C;  3ZHU A;  1VQO V;  3SDL A;  1YDX A;  2YXH A;  1Q7Y W;  5IJ9 B;  2JJ2 G;  2W6J G;  3RYC B;  1MA1 A;  1K9M W;  1PPJ H;  5KHK A;  1MMM A;  4PDV A;  3ZMV A;  1FJG B;  2E74 B;  5LGN A;  5B66 Z;  3BRC A;  5BMV B;  1FXV A;  2ITD C;  2A0L A;  4H37 A;  4QNH B;  2IJI A;  2Y48 A;  1ENV A;  2CGO A;  4I4T A;  3BVO A;  4DR3 B;  2ZE7 A;  3AK2 A;  5JCO C;  1HDJ A;  1MSD A;  1AB3 A;  1F7Y A;  1KEC A;  3SYP A;  2PF4 E;  1SQB H;  2PUS A;  3K59 A;  2ZR2 A;  3L72 H;  4CS4 A;  3CMA V;  2AZ0 A;  2LJ2 A;  4MVQ A;  3CCV V;  1I0H A;  4MVR A;  2P7T C;  2X0L A;  1D5A A;  1R3L C;  1Y74 A;  3WU2 Z;  3K04 A;  3OUF A;  5LYJ B;  4LF6 O;  1XEQ A;  5BXZ A;  1OJH A;  4UCU A;  4IYH A;  4DV5 O;  3ZMT A;  1Q6U A;  2PI5 A;  3D36 A;  3EVK A;  1NU1 H;  3HR0 A;  2QDO A;  3L75 H;  3SJC C;  3JAL B;  3ZRW A;  1O9G A;  1QR8 A;  3JAT A;  2UUB O;  4JI4 B;  1SQF A;  3J81 N;  2WLI B;  1PNK A;  1HR0 B;  2ARH A;  5F2V O;  2A79 B;  1I94 O;  4B3R B;  4BWA A;  3CC4 V;  4FLX A;  4C7U A;  3IC9 A;  1GN2 A;  1FXH A;  4OXS A;  3HKB A;  3KCX A;  4PDM A;  1I08 A;  1XRE A;  1MZE A;  2RMK B;  4YHH O;  3SPJ A;  2ZE6 A;  1NTZ H;  5J2T A;  3OAA G;  3OTO B;  4CH6 A;  3GWO A;  4NXN B;  3ABU A;  4TV9 B;  2PYJ A;  2R72 A;  1AR5 A;  1VF7 A;  3AEI A;  3STZ C;  4MVM A;  1YTF D;  4CBC A;  4U7O A;  4TOI A;  1JQ0 A;  2XT9 A;  4Z1M G;  4HYO A;  4QGP A;  1K92 A;  4JV5 B;  1K33 A;  1R3I C;  2HVJ C;  3DXR B;  1S5J A;  5LGU A;  1XQ8 A;  2B5U A;  2DE0 X;  3MHS C;  3JYC A;  2JGD B;  2BTQ A;  2YSU B;  4DR3 O;  4K0K B;  1IZ3 A;  4MVS A;  1HNW O;  3ABT A;  3U0Z A;  3OGC C;  1ZL8 A;  4KHP O;  3FAV B;  2ZDI A;  4GLX A;  5JVD A;  2KG7 A;  1M9N A;  1TUB A;  2HG5 C;  1M56 C;  2LGW A;  4O2A A;  3E89 A;  5JWP A;  4Q6G A;  1UJW B;  2OCC C;  4JYA B;  2YI9 A;  1VQ5 V;  2BOB C;  1XBL A;  5EZY A;  5CB4 A;  1M56 B;  4ZIB A;  3M7M X;  4DRX A;  4RO2 A;  5LHI A;  4JYY A;  4JI5 B;  2ADP A;  2OCC B;  1MSW D;  3A0H Z;  4B3T B;  2KSD A;  3DGE A;  3RYI A;  2QKA A;  2AHZ A;  5KA6 A;  1X59 A;  1SER A;  3TJT A;  1Y4M A;  3ABL C;  3P32 A;  5DM6 V;  3ZED A;  4J7Z A;  1IBL B;  4JI4 O;  2XHB A;  4JI8 B;  4JGS A;  3T1Y O;  1AR4 A;  3L71 H;  1YIT V;  1CPY A;  2JEX A;  4B3R O;  3ABL B;  3P3N A;  1N32 B;  1XNQ O;  1EN5 A;  2CTQ A;  1YIJ V;  3D8C A;  1KKD A;  2EZO A;  4DW1 A;  3CC7 V;  3OMN B;  4BAY A;  4UCR A;  2ZIM A;  1N36 O;  5EC1 C;  3OTO O;  3E8F A;  4HNA A;  4J10 A;  3CYO A;  4RQF A;  1GTO A;  4P2Z A;  1EZV H;  4WFB V;  3BFR A;  2Q7E A;  5J2U A;  3GWK C;  2Y69 C;  2D3O W;  4JTD B;  1QQC A;  1Q6I A;  2B9Z A;  1WA8 B;  2AHY A;  1PKX A;  2EJ7 A;  5EIB D;  2F66 C;  2Y69 B;  3RVZ A;  1BCC H;  1Z5W A;  2JS3 A;  1JR9 A;  3K3W A;  1SZX A;  1JJO A;  1KD1 W;  3DC5 A;  3JAR B;  1L8D A;  3E8G A;  4OX9 B;  4F6R A;  2VRZ A;  4P9P A;  3W7U A;  1E1R G;  1NQT A;  2LFR A;  3CS5 A;  4DUY B;  2Q68 A;  3L70 H;  2EIJ B;  5FLX N;  4PA4 A;  4UB6 Z;  4DR4 B;  5KX5 A;  2LW7 A;  1VP7 A;  4ZI7 A;  1AP5 A;  3T4D A;  5A2Q N;  1OV9 A;  1UFI A;  5LMU B;  4CH3 A;  1X4T A;  4JI0 O;  5CBH A;  2Y0I A;  4YJ3 A;  2LQT A;  1ZLZ A;  4JI5 O;  1FXK B;  1JMK C;  1VAR A;  4B3T O;  3K5O A;  3ZRV A;  2NR5 A;  3OEE G;  4UCT A;  2WLN A;  1JFF A;  4O2B A;  4PDL A;  1XUQ A;  4ICG A;  1SA0 A;  1IBL O;  4TV8 A;  5KHI A;  3SJB C;  1QLN A;  3CCS V;  2R9I A;  2ETN A;  3BA8 A;  3LNN A;  5KAF Z;  3H01 A;  1XDC A;  2UXN A;  2F4V B;  1NBM G;  5L3G A;  3CRA A;  4L8J A;  1Y67 A;  3OMA B;  3HB3 B;  1Q3E A;  3AG7 A;  3OTF A;  4E4E A;  3B40 A;  4ZHQ B;  3ZHV A;  1S3J A;  1QCE A;  1BT8 A;  4DV1 B;  4UCV A;  5FNV B;  2CTR A;  2X7R B;  2EUL A;  3N27 A;  3SYA A;  1KP2 A;  3IGA C;  4MVZ A;  3F5W C;  3OEH G;  3JAS A;  5H9C A;  2XTA A;  5EC2 C;  3WG7 B;  4A5U B;  2QKS A;  4B3S B;  4LF4 B;  3E35 A;  1THZ A;  4TT3 G;  4AQY B;  1OHH G;  1AI7 A;  3K03 A;  2AZ2 A;  1K73 W;  4UV9 A;  1W0J G;  1KC8 W;  1AJQ A;  2RCV A;  5JJE B;  1LNQ A;  1XHX A;  4OX9 O;  4X62 B;  3SYC A;  2QWP B;  1MG1 A;  4I7Z B;  3HKC B;  4DUY O;  4BW9 A;  2YIB D;  1JOY A;  3H9V A;  4JYB A;  4MW8 A;  2OWO A;  4DR1 B;  2YXL A;  4JI6 B;  2JS5 A;  2UXB B;  5LP6 C;  5LMU O;  4NYK A;  1CP9 A;  1AI5 A;  2O57 A;  2PY5 A;  1JVM A;  2DYR C;  5LP6 B;  3FD9 A;  2WAM A;  1HP8 A;  1QHT A;  1NVP B;  2OTL V;  2IM9 A;  3ZIA G;  4QIW F;  2DYR B;  2ZKO A;  2H94 A;  1PM9 A;  2HFE C;  4DK0 A;  5D5P A;  5LXT B;  3UCS C;  1K34 A;  4R50 A;  5BR8 B;  1J95 A;  4X1I A;  1N34 B;  4LH6 A;  4LC1 A;  3H1L H;  4B08 A;  1P49 A;  4NB5 A;  4K8X A;  5CA0 B;  3T1H O;  2F4V O;  3ZBH A;  2DOS A;  3SJQ C;  1XMO B;  1YZB A;  4NTW A;  3J7A U;  1S5L Z;  5EYP B;  4LR3 A;  1R6T A;  1BQZ A;  5BY1 A;  2CK3 G;  1O9H A;  1V54 C;  4MSW C;  4LFA B;  2BCC H;  3MD0 A;  3HKE B;  4MTG A;  4MT8 A;  5CA1 B;  4DV6 B;  4DV1 O;  2GUZ A;  1B04 A;  2PTM A;  5ITZ B;  2EX3 A;  1V54 B;  1ORQ C;  4MTX A;  4JPR A;  1YJN V;  3TK1 A;  4J9Z B;  2N04 A;  2JDI G;  3F7Y C;  4WFF A;  3FFQ A;  2ITC C;  2YEV B;  5LMN B;  2BSK A;  4BIZ A;  1COW G;  4B3S O;  4IHJ B;  3AG2 C;  4I55 B;  2GHY A;  5IYB O;  4AQY O;  2HP8 A;  4WCE V;  3LDE A;  4JF3 A;  4DR2 O;  1S76 D;  2FB5 A;  2X6A A;  3AG2 B;  3OGI B;  4WBN B;  2PZS A;  4JI1 B;  4X62 O;  2Z0A A;  3JAK B;  1E1Q G;  4FLW A;  2ZE8 A;  2F95 B;  1GRJ A;  3G80 A;  4O4I B;  5GTH Z;  4DR1 O;  5B3S C;  1K7D A;  1VQ4 V;  2GTA A;  3UO3 A;  5LOV A;  4JI6 O;  1EN4 A;  2BTO A;  4DV7 B;  1DF4 A;  4FFB B;  1EN6 A;  5B3S B;  4R7C A;  3Q4H A;  1AI4 A;  2EIK C;  3A8T A;  4G28 B;  3CCE V;  1EM1 A;  1XL6 A;  5CBG A;  5H5N A;  2V7Q G;  2QA4 V;  4JZ2 A;  2LFS A;  2EIK B;  4TSF G;  3FYE B;  4WF9 V;  2ZCE A;  5KMG B;  5L3F A;  1KKC A;  3WB2 A;  1K4D C;  1Y76 A;  2E75 B;  5BR8 O;  2Y4T A;  1NKD A;  3E22 A;  1B6Q A;  1QNM A;  2IU0 A;  2NNU A;  5IWA O;  3UT5 A;  3CRQ A;  3CCJ V;  2F93 B;  3K58 A;  4FLT A;  4I50 A;  3OFN G;  2R70 A;  2VQE B;  4LFA O;  1XMQ B;  3FB8 C;  1L1F A;  1IBM B;  3N2K A;  4NTX A;  2Q5Z A;  4ASU G;  2ZNI A;  4X64 B;  4G27 B;  3H1I H;  1PNL A;  1ARO P;  3UM7 A;  1FFT B;  4DR6 O;  5KA5 A;  3K0G A;  2WA4 A;  2P4V A;  2X6B A;  3SYQ A;  1DLB A;  3OD4 A;  1V9P A;  5BMV A;  4FM1 A;  4EEQ A;  4JAU A;  2M6Y A;  4LP8 A;  1PNM A;  3AG3 C;  3BAA A;  2RJZ A;  2YC0 A;  3WB0 A;  1AVM A;  4JI3 B;  2AGA A;  3D3I A;  4RWU A;  3AG3 B;  1SC5 B;  4JAV A;  3K06 A;  4GX2 A;  1VQK V;  1H8H G;  3ABK C;  1IXM A;  5DN6 G;  3ZRW B;  5K1P A;  2QTO A;  3JAT B;  1VQ7 V;  1SF9 A;  1G6U A;  3ABK B;  2ATK C;  1R73 A;  4KFM A;  3RT3 C;  1SQP H;  1YJ9 V;  3BA9 A;  1NZ6 A;  3K57 A;  4B7K A;  4F4L A;  5FL7 G;  4FLY A;  4B3M B;  3HKB B;  3ZRX A;  4CH4 A;  5J2T B;  3W7T A;  2UUC O;  3K9S A;  2FML A;  1LUV A;  3LSU A;  1GH6 A;  1Y66 A;  1YSC A;  4OGQ B;  2KKW A;  4PEL A;  1Q6H A;  5GW7 A;  1FJG O;  4PDR A;  3UO2 A;  4LBE C;  4JI2 B;  3THO A;  4HBN A;  4G2K A;  1G4Y B;  2VQF B;  2N05 A;  2M7W A;  2YXY A;  2N74 A;  4Z2W A;  3RWR D;  2VQE O;  2YIB A;  3KZI Z;  1QVF U;  3CD6 V;  3OT7 A;  1J5E B;  2BTQ B;  1I7F A;  3JD2 A;  1IBM O;  2ZDI C;  4PHZ A;  4O4H B;  2WSS G;  4KP4 A;  5FPO A;  2OT5 A;  3TXQ A;  1M93 A;  5IJ0 B;  3RN4 A;  4I0X B;  2JJ1 G;  1NVP D;  5JVD B;  3FB5 C;  4MVU A;  4O2A B;  1TUB B;  2XAH A;  3K9A A;  3K08 A;  1D2D A;  3AK3 A;  2CTP A;  4H0L B;  2ADQ B;  4UCS A;  1P7G A;  1KYO F;  3KG2 A;  5EZY B;  5CB4 B;  4FLU A;  4O4L A;  2UU9 B;  3ASO C;  4JI3 O;  1CXZ B;  3SYO A;  1DK1 A;  1CEZ A;  3RYI B;  5E79 Z;  3ASO B;  5HFM A;  5A9G A;  3W7S A;  3RFR A;  2JIZ G;  1HNZ B;  3BCC H;  4DUZ B; 
#chains in the Genus database with same CATH homology
 5EK0 A;  3JD4 A;  1GKF A;  4N21 A;  4KUM A;  3OMA B;  3HB3 B;  3ETD A;  1R6N A;  3LNM B;  2P6J A;  4P30 A;  3G6E V;  1I5X A;  1S77 D;  1S3J A;  1OCZ B;  4GX1 A;  1QCE A;  2B1G A;  1W0K G;  2WLJ A;  2A9H A;  4X88 A;  4UVC A;  2YEV A;  1ROP A;  2X7R B;  3K0D A;  2QM7 A;  3SYA A;  1KP2 A;  3IGA C;  4MVZ A;  1NH2 B;  1K5Q A;  3F5W C;  3OEH G;  3WFV A;  1GMG A;  1M1K W;  5H9C A;  5EC2 C;  1SZT A;  3WG7 B;  5EBL C;  2LP7 A;  3CPW U;  2FTK A;  4N23 A;  5E1A C;  2ZXW C;  2R9R B;  1DTO A;  5L3B A;  1BHB A;  3SPG A;  3OM3 B;  2QKS A;  3OE7 G;  2NLJ C;  3FKS G;  3E35 A;  1DF5 A;  1THZ A;  4TT3 G;  4UV8 A;  4GX5 A;  5L3C A;  1OHH G;  1K97 A;  2ZXW B;  2XOK G;  3RW0 A;  3AG1 C;  1AI7 A;  2EJR A;  3K03 A;  1K73 W;  1SES A;  1VQP V;  4UV9 A;  2W0F C;  1W0J G;  4WFG A;  4EKW A;  1VQM V;  3STL C;  1KC8 W;  3B8N A;  1AJQ A;  3W7W A;  2HKO A;  4MW3 A;  3ZMU A;  2XAQ A;  3JD1 A;  5CMU A;  1LNQ A;  2WLI A;  1Q81 W;  1Q86 W;  3CP1 A;  3AG1 B;  3SYC A;  5HFL A;  1VQL V;  1MG1 A;  5B1B C;  3T1C A;  4CZZ A;  1MOF A;  4Q20 A;  1RPO A;  3ML0 A;  1JOY A;  2KB1 A;  3RBZ A;  4JAS A;  4JYB A;  3OMI B;  3T2M A;  1G8M A;  1H2G A;  2ZR3 A;  4MW8 A;  5B1B B;  1R6K A;  3DTU B;  4JTC B;  4X8A A;  4QE7 A;  1CP9 A;  4R8C A;  1GO3 F;  1K5S A;  2B1I A;  4FIP C;  1RM1 C;  1OCR C;  2IH3 C;  1W2B U;  3PJS K;  3CC2 V;  4P9O A;  1AI5 A;  1JVM A;  2DW4 A;  1VQO V;  2DYR C;  1Q7Y W;  3R65 A;  1FS0 G;  3CCQ V;  2IU3 A;  2JJ2 G;  2W6J G;  2WAM A;  5L3D A;  1K9M W;  1RM1 B;  2MK3 A;  1NVP B;  2OTL V;  4U7N A;  5KUM A;  3ZIA G;  4QIW F;  2DYR B;  2H94 A;  4LCU C;  4PDV A;  4WFH A;  2HFE C;  1F51 A;  3ZMV A;  5LGN A;  3T4Z A;  4QE9 A;  1K34 A;  4R50 A;  3LSQ A;  1J95 A;  1FXV A;  2ITD C;  2DWD C;  2WPD G;  2A0L A;  4LC1 A;  1JCH A;  1OCC C;  3E8H A;  4H37 A;  4I9W A;  2IJI A;  4QNH B;  1H38 A;  2XAJ A;  2Y48 A;  3SJQ C;  1ENV A;  2Q67 A;  2P67 A;  1OZ0 A;  3EFF K;  2UXX A;  3BEH A;  1S5H C;  1OCC B;  1H8E G;  3SPC A;  2CK3 G;  1V54 C;  4MSW C;  1AJP A;  3B8M A;  3MD0 A;  1FXK A;  4UVA A;  4FJC C;  4MTG A;  4MT8 A;  4UXN A;  1M90 W;  2IJH A;  1KEC A;  3SYP A;  1VQ9 V;  1V54 B;  1ORQ C;  1N8R W;  4MTX A;  2ZR2 A;  4JPR A;  1YJN V;  3TK1 A;  3CMA V;  4J9Z B;  2JDI G;  1Q82 W;  4MVQ A;  3F7Y C;  4WFF A;  3CCV V;  1KQS U;  2QEX V;  3M99 B;  4PA6 A;  4MVR A;  2ITC C;  2P7T C;  2X0L A;  2YEV B;  1R3L C;  2Z5U A;  4ZKI A;  4BIZ A;  3CXC U;  1COW G;  3K04 A;  3OUF A;  4JTA B;  3NXS A;  3AG2 C;  2GHY A;  5IYB O;  1S72 V;  3ZJZ A;  2OTJ V;  1HWY A;  3SPI A;  4WCE V;  3LDE A;  5B1A C;  3ZMT A;  2PI5 A;  4JF3 A;  3D36 A;  1S76 D;  4ZBM A;  2W6I G;  2X6A A;  3LSS A;  3AG2 B;  5EBM C;  3ZRW A;  1PL0 A;  5IDJ A;  5B1A B;  1QR8 A;  1R3J C;  1E1Q G;  5IY5 C;  2IW5 A;  4WFE A;  2BOC C;  2WLI B;  1PNK A;  3QNE A;  2A79 B;  3JD3 A;  3JCZ A;  5BZB A;  3I55 V;  2ZD9 A;  4XDJ A;  5B3S C;  1K7D A;  1VQ4 V;  5IY5 B;  3CC4 V;  1OCO C;  2WLL B;  3QO7 A;  1SET A;  1DF4 A;  1FXH A;  4OXS A;  4PDM A;  3QO5 A;  3SPJ A;  1NR1 A;  5B3S B;  4L87 A;  4R7C A;  1OCO B;  3OAA G;  3IC7 A;  1AI4 A;  2HLD G;  2EIK C;  3GWO A;  2WLH A;  4YXW G;  4WFA V;  3ABU A;  2GSM B;  3BY6 A;  4G28 B;  3CCE V;  1K8A W;  2F43 G;  1XL6 A;  3AEI A;  3STZ C;  5CBG A;  1VQN V;  4MVM A;  2V7Q G;  1BL8 A;  4GX0 A;  2QA4 V;  3LDD A;  3CME V;  4XDK A;  4CBC A;  2K1E A;  2EIK B;  2LFS A;  4U7O A;  1YTF D;  3P30 A;  1JQ0 A;  1QR9 A;  3A0R A;  5L3E A;  4TSF G;  4J9Y B;  2P90 A;  4RUF A;  5B1O A;  4MTF A;  1PD3 A;  3FYE B;  4QJF B;  4WF9 V;  4Z1M G;  5L3F A;  4HYO A;  2EIJ C;  3RVY A;  1K92 A;  1K4D C;  1K33 A;  4QPJ A;  2XAS A;  1NKD A;  1R3I C;  2HVJ C;  4MVO A;  1OCR B;  1B6Q A;  3OR6 C;  2IU0 A;  3ZRS A;  1S0V A;  3K79 A;  2IJK A;  2XND G;  5LGU A;  5C93 A;  1AR1 B;  1F4N A;  2B5U A;  1F23 A;  3OUS A;  3MHS C;  2QE7 G;  2NNU A;  2DYS C;  3JYC A;  4JYC A;  3CCR V;  1M57 C;  2YSU B;  1TUE B;  3VBB A;  3CCJ V;  4MVS A;  3ABT A;  3E83 A;  3OGC C;  4QPK A;  3OFN G;  1FXK C;  3LDC A;  4GT1 A;  2EZP A;  4PA9 A;  2DYS B;  3FB8 C;  4FMT A;  1L1F A;  1AI6 A;  1V55 C;  3FB7 C;  1M57 B;  1YI2 V;  2ZDI A;  4ASU G;  2Q6A A;  4G27 B;  1M9N A;  2HG5 C;  1M56 C;  3E89 A;  1GM7 A;  1PNL A;  3OW2 U;  1UJW B;  1ARO P;  2Q69 A;  3ZCC A;  1QLE C;  4XBF A;  2OCC C;  1V55 B;  3UM7 A;  1FFT B;  5B1N A;  5KA5 A;  3K0G A;  2JK5 C;  3ZN0 A;  3CCU V;  1VQ5 V;  2BOB C;  2X6B A;  1M56 B;  3SYQ A;  1DLB A;  1EBO A;  3EHB B;  1VQ8 V;  4JAU A;  5LHI A;  4RO2 A;  1QLE B;  2OCC B;  1GK9 A;  3ETG A;  4LP8 A;  3ZMZ A;  1PNM A;  1MSW D;  3AG3 C;  3TET A;  2WWW A;  3DGE A;  2IH1 C;  4BIU A;  2AHZ A;  5KA6 A;  5CA3 A;  1K3E A;  3ETE A;  5H6Q A;  1SER A;  3IFX A;  3D3I A;  5LHG A;  5CBF A;  3AG3 B;  3FB6 C;  3CCL V;  1QBZ A;  4H33 A;  2WLM A;  4JAV A;  3K06 A;  1EFR G;  4GX2 A;  1Y4M A;  3ABL C;  3ASN C;  2ZQM A;  3P32 A;  2V1D A;  4I5S A;  5DM6 V;  1VQK V;  1EZJ A;  1H8H G;  3ABK C;  3G4S V;  1IXM A;  5DN6 G;  2WLK A;  4JGS A;  1RPR A;  4HAM A;  3ZRW B;  1YIT V;  1CPY A;  1WLE A;  2QTO A;  2JEX A;  3ABL B;  3ASN B;  3WG7 C;  3E8B A;  1VQ7 V;  1NH2 D;  1P7B A;  3QO8 A;  3ABK B;  2ATK C;  4FPP A;  1R73 A;  4KFM A;  3X2Q C;  4UVB A;  1YIJ V;  2EIM C;  1KKD A;  2EZO A;  4MS2 A;  2JEU A;  2X6C A;  3CC7 V;  1YJ9 V;  3OMN B;  4BAY A;  4RQE A;  4F4L A;  5EC1 C;  3I56 V;  5IYC O;  5FL7 G;  3E8F A;  3JD0 A;  3X2Q B;  1JPX A;  2EIM B;  3ZRX A;  1BMF G;  3CYO A;  1ZWI C;  3W7T A;  4RQF A;  1GTO A;  4P2Z A;  2QM8 A;  3CCM V;  3VOU A;  4WFB V;  2DWE C;  1JX9 A;  2XAF A;  2Y69 C;  4R6Z A;  3SPH A;  2D3O W;  4JTD B;  4UUJ C;  1Y66 A;  2EIL C;  5LGT A;  1YJW V;  2AHY A;  1YSC A;  1PKX A;  1NJI W;  2Y69 B;  3RVZ A;  4PEL A;  4X89 A;  3ABM C;  4DO2 A;  1GM8 A;  3K3W A;  2EIN C;  5H6R A;  2EIL B;  1KD1 W;  2EBO A;  2Z3Y A;  2WLL A;  1KP3 A;  1I5Y A;  5GW7 A;  4E2L A;  4MTO A;  2DQ3 A;  1YTF B;  3B77 A;  4PDR A;  4LBE C;  4G2K A;  3E8G A;  1G4Y B;  3ABM B;  1JJ2 U;  2HVK C;  2M7W A;  2EIN B;  3ZMS A;  1QVF U;  3CD6 V;  3E2E A;  4P9P A;  3W7U A;  1E1R G;  1NQT A;  5EBW C;  2LFR A;  1YHQ V;  3JD2 A;  2ZDI C;  2Q68 A;  2EIJ B;  2WSS G;  4KP4 A;  2OT5 A;  4PA4 A;  3G71 V;  1AJN A;  1VQ6 V;  3UKM A;  4GCZ A;  4XDL A;  4HZ3 A;  5IYD O;  2HJF C;  3T4D A;  1E79 G;  2JJ1 G;  1NVP D;  1BHA A;  3MHH C;  1F4M A;  3HPL C;  1K4C C;  3FB5 C;  4MVU A;  2IJJ A;  2XAH A;  3AG4 C;  3W7X A;  3K9A A;  4DXW A;  5CBH A;  4TWK A;  2H8P C;  1WPX A;  1XL4 A;  4FK5 C;  3K08 A;  1R3K C;  2HR3 A;  1FXK B;  5KUK A;  3TCU A;  3ZRV A;  5LHH A;  3KG2 A;  1QVG U;  3AG4 B;  1NR7 A;  3E86 A;  3OEE G;  3ASO C;  2WLN A;  3SYO A;  2XAG A;  4PDL A;  3GB7 C;  1CEZ A;  1GM9 A;  1MAB G;  1P4R A;  4PA7 A;  3ASO B;  4BW5 A;  5HFM A;  3W7S A;  3F7V C;  1QLN A;  3ZN1 A;  3LUT B;  2R9I A;  3CCS V;  2JIZ G;  3FYI B;  3OR7 C;  4RUE A;  5CN0 A;  5LBQ A;  2PI4 A;  3H01 A;  4PA3 A;  2UXN A;  1SRY A;  5J9P C;  1NBM G;  1OCZ C;  4RAI A;  5L3G A;  2C2A A;  2DQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...