3ZK9A

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
278
structure length
278
Chain Sequence
b'KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
molecule tags Metal transport
source organism Streptococcus pneumoniae
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
total genus 104
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A01
2MINB 1N4AA 1M1YB 4NNOA 1KAEA 2Q8PA 3LI2A 3BE6A 3ZK8A 5BVGA 2OSVA 4GICA 3GI1A 1QH8A 5KOJB 5JJ5A 4UDOA 3ZK7A 1QH1B 4K3VA 4G09A 2XDQA 3HH8A 3HXPA 1XVLA 3ZTTA 2Q8QA 1N4DA 1N2CB 4OXQA 2OV3A 3PSHA 2PS9A 4OVKA 2M6LA 3HJTA 2AFIA 4WZAB 1QGUB 3AESB 2OGWA 1G20B 4WZBB 2O1EA 4INPA 2XUZA 2R79A 2YNMC 5AFSA 2RG7A 3AEQA 5BVHB 5BVGB 3CX3A 1FP4B 3PSAA 4N01A 2PS0A 4DBLE 2XH8A 5M2QA 4UTOA 2R7AA 4OXRA 5HDQA 3TLKA 4FILA 4MX8A 3AERA 3MINA 1EFDN 1TOAA 4WESA 1M1NA 4HN9A 4IRMA 3ZK9A 5KOHB 5GGXA 2PRSA 3U7QB 3AEQB 4CL2A 2WI8A 4MDYA 3TNYA 1N2CA 2XV1A 2PHZA 1K2VN 2XDQB 1KARA 4WN9A 3AEUB 1M34A 3NU1A 4TKUA 2XQVA 5B58T 4WZAA 5JG7A 4M7OA 4PM4A 3R5TA 5CR9A 5GGYA 5CX1A 5CX1B 3UJPA 4H0FA 1FP4A 3K1AB 5FLYA 4HMPA 2AFHB 1K7SN 3AEKA 4LS3A 5HX7A 5M29A 3BE5A 4BBPA 2M6KA 1KAHA 4WESB 3EIWA 1L5HA 3U7QA 4G07A 1G21B 4ND8A 3PDIB 1QH1A 1MIOA 1PSZA 4FKMA 3LHSA 3ZKAA 4MLZA 4XPIA 4WNAB 1N2ZA 2XY4A 4UTPA 3EIXA 5KOHA 4WNAA 5JPDA 1ESZA 4INOA 2MINA 3PDIA 1MIOB 2ETVA 3MWFA 1G20A 1H1LB 2WHYA 5BVHA 5M34A 1H1LA 2X4LA 3MD9A 4TKUB 1QH8B 5KOJA 3R5SA 4WN9B 2YNMD 4H59A 4HMOA 1L5HB 1M1YA 4UDNA 5JOQA 1G21A 2OV1A 4ND8B 1PQ4A 3AEKB 3MWGA 2AFIB 3K1AA 4FI3F 3AETA 1M1NB 3AEUA 3AERB 3TEFA 1M34B 3MFQA 1K75A 3G9QA 4PAGA 2QI9F 4TKVA 1K0FA 4NNPA 5I4KA 5KHLB 4TKVB 4B8YA 4MO9A 4HMQA 3AETB 1QGUA 3AESA 4LJSA 4WZBA 2AFHA 4XPIB 2PS3A 5M3BA 3MINB 4FNAA
chains in the Genus database with same CATH superfamily
2Z4RA 4ZIRB 3FN4A 5FI3A 1ZY2A 3EEIA 3UKJA 4BLQA 1K66A 1GILA 4UW9A 1L4HA 3TD9A 4FMCB 1AZTA 3V4RA 3T7CA 4M83A 2Z9CA 4PTZA 1ZOLA 1E2JA 3I2YX 1DWQA 3JW8A 4TM7A 2BLNA 4BMPB 2XAAA 4UE6A 4YP1A 4TUYB 4EHKA 4MVJP 5CU7A 3ZDZB 1KO1A 1SRQA 3NTQA 3VBEA 1P9OA 1I01A 2Q5CA 3GLRA 5EZ6B 4A03A 3WGIA 3UYLA 2BHNA 2HCTA 2VSOA 2Z95A 4S1WA 3ZDEA 4TMYA 3DONA 4UPVA 4FM9A 3N59A 4O5OA 4QDZA 3FTQA 1G0NA 3QXHA 2IXDA 2CLSA 3QJ5A 4WXYB 2WHQA 5CA0A 3GZTB 4ZVMA 1OGJA 5DH9A 4A2PA 2UVPA 2ZTHA 3L43A 4V02A 5AFSA 1JDJA 4U5XA 4OBXA 5EWMB 1WCWA 2XH8A 3G2PA 4OKSA 5LWQA 1QKKA 4OJNA 4L8LA 1KQFA 1IZZA 1QPZA 2Q4DA 4X1KB 1MFPA 2EC5A 1X39A 1FU7A 1OHHA 2K7ZA 3FPHA 3M4JA 3R0IA 1T6ZA 1VMDA 2SKDA 3K9CA 5KNBH 1CJBA 3OQVA 2QENA 2VLIA 5CJJA 1O1YA 5I4IA 4IDDA 2UXDB 2CK3D 5EJMA 2H59A 3SKXA 2V1XA 1XPRA 2I2BA 2YJNA 1RFLA 3DMTC 3IMCA 1YBVA 4HSGA 3WWOA 2X13A 1O54A 2BT4A 3AVPA 1ZXXA 3H4TA 1KI2A 5IWAB 4RMJA 1O97C 3C7CB 3VTKA 1ZIYA 3ZS8A 4C7MA 5JH7F 2V5UA 4G0MA 3OUUA 5I8WA 1PGOA 4N5IX 1NYQA 2BMWA 2XX3A 2D5CA 4Z4EA 2IYEA 3DBRB 3K4QA 5F7ZA 4IKEA 4KJXA 1WSWA 2DKOA 4R0MA 4J0CA 4JX9A 4C6TB 4KZPA 2G1JA 3EFHA 3G9XA 3ONVA 4KXUA 1J8FA 3UJ9A 4ER3A 3CNNA 2YVAA 1ND6A 5DN6D 1CZUA 2JANA 4WK0B 2VUSA 4L02A 5BQOA 1KP3A 4MR9B 5ICCA 4DLAA 1FMJA 1NF2A 2I3GA 3EGOA 4M0FA 3S8EA 2XA9A 2HMTA 2MYUA 3OIUA 3URMA 5SICE 5LKRA 2ECOA 3VISA 2WHYA 4JLPA 3M1AA 2FU5C 4V0OA 5C37A 2UZ1B 2ZLBA 3HZHA 4LYYA 5AT1A 1XPOA 4YFVA 2ZS7A 1QHGA 1T4MA 4J94A 2AN1A 3NBFA 4C43A 3IEVA 3MVEA 1ZUHA 2J8ZA 1SU7A 2WFLA 3DB2A 1VSVA 1QZZA 4EL5A 1H2YA 3DLAA 4G1UC 4QQNA 3KTAB 4YNBA 3IELA 2QQFA 1WE2A 2WM8A 3PUZA 1Z0FA 2ORIA 4M9QA 4BE4A 1P7ZA 4RD3A 3SR0A 2EHDA 2J30A 3NGMA 4OB7A 1GDHA 1ABFA 3WDSA 2V96A 2K5UA 3AERB 5ALJA 4HO1X 3FSJX 3HBLA 3WQBA 3LUJA 3F6EX 5CNMA 4PZUA 2VWQA 3GVPA 4XLTA 5CIWA 4Z7JA 2QUIA 4JCCA 2OY0A 4KZKA 5KOYA 3FOFC 4G1EB 5AVYA 4NX2A 1W0KD 3VYRB 1T8UA 2FSUA 2CNLA 2X1LA 1U7TA 2QTWB 1G8HA 3H13A 3KYIB 2LXNA 4US2R 3NTUA 1RBQA 1UDWA 2VH5R 3F47A 3R23A 4TVKA 1K88A 4BWGA 4BNGA 9LDBA 3X1DA 3DPSA 5JCXA 3KAQA 4OP3A 4WXPA 5KDOA 2HQSA 5H80A 4CIYA 4GBGA 2XTAA 1KGDA 1K2WA 4EFKA 3OESA 5A3JA 1B6GA 1E98A 1Y3BE 2G8LA 2ZJ3A 3L1JA 4X95A 4BLWA 1H2HA 4YAUA 4YT4A 3TRKA 2JIRA 1SBQA 2C5FA 2IIPA 2VPPA 3TTSA 1PG0A 2QVXX 4GE0A 4EUSA 4NEGA 2GO1A 3B78A 5CNJA 2ZBQA 3H8SA 5HK8A 3GPLA 2JGNA 1OKKA 1NATA 4MUGA 4D3XA 1Z5OA 4KQJA 5HRCA 5HZKA 1OC2A 1R4MA 5EERA 1QIKA 4NENA 4OD0A 4E46A 3U4QB 1O4WA 3OUTA 5IULC 1IN7A 4LSWA 2BGRA 2QLMA 1J8QA 3H1GA 4PQFA 2OBXA 1NTOA 3FCAA 1YH3A 1NXVA 1OWPA 3CJTA 2O57A 3SX2A 1WXEA 2GK4A 4P3OA 1Y6FA 1K8XB 1P4AA 1PGNA 2GF9A 4L3OA 4WEQA 1AC5A 4BGIA 1Q11A 3D6FA 2X0KA 4HRAA 3KEGA 1OAKA 2BBWA 5CVCA 1SAYA 4RH0A 1ZONA 1N2CA 3N8KA 4R01A 4JB2A 2FPPB 1GAQA 3RHZA 5HDBB 1DINA 4PCLA 2IHUA 4YPOA 2IYWA 2UYHA 3ZHQA 2AC7A 5FNVA 1UBKS 3P2OA 4TSFD 2O8VA 3F49S 1PT6A 1AUPA 3IUPA 3T4UA 3ISVA 3GFBA 4DV4B 4HRYA 2RHOA 4CEIA 2B1JA 4DA7A 1UPFA 2QDXA 1G18A 1KVRA 2AK2A 3LJKA 4AKIA 4DUPA 4TL9A 3HZOA 3IJPA 1V3QE 4YRLA 1GTJ1 3KJNA 3HP1A 5GY7A 5BUSA 4CDMA 4I3HA 2VXBA 2Y77A 4IGFA 5C0OE 1JR2A 3KFXA 1J90A 1WXHA 2Q5HA 1L4NA 1MAUA 2QTBA 1US8A 1H9CA 3PD1A 4JH0A 3ED5A 3N87A 1O9HA 2B98A 2E7ZA 3MRTA 4I46A 4BLUA 1H2XA 5LB2A 4MW2A 5JH7B 4YXFA 3V4LA 1U90A 2HIAA 5ALHA 2NNLD 5KC9A 5G0UA 4CL8A 4F4IA 1H5NA 3KR2A 4HH1A 2A78A 2KHZA 3CSDA 1IBLB 4EYSA 3F4BA 4KE9A 3BAZA 2AEEA 2N75A 1I7QB 2EJTA 1EFPA 1YXMA 1UL1X 2H48A 2QGNA 1IZYA 2QVLA 2XITA 2YS7A 4PLHA 2OK8A 1M2NA 2C4KA 1XF9A 1HDXA 2J9YB 3RSFA 2I2FA 2JVKA 4EPRA 3LPAA 4J16C 4XYGA 5TQVA 4U9IS 4E7OA 5JSZB 2H11A 4F4HA 2NAPA 4XM1A 3VH4A 4ZT2A 3DFKA 3QWFA 3HCCA 1V5WA 1W8IA 5T7BA 5F7OA 1GO2A 1IDN1 4DV6B 2CDAA 2G04A 3M33A 2DTDA 4NI5A 4TKVA 4QJ5A 1GTG1 1FMTA 1DXQA 1PSDA 3CZ4A 3IKVA 2FFAA 1J8MF 1C14A 3E8SA 3VAYA 2X41A 1EXMA 1NDHA 2CNWA 2O3JA 2Y4OA 3ESRA 4EVRA 3QNMA 3FGNA 1KA9H 2YBEA 1BJTA 2V6BA 1AKNA 1JSZA 3C3PA 3PQ4A 3ELYA 1HT3A 2D0OB 5EIAA 4FYJA 2Q7DA 4DCSA 3ZVMA 2VDKB 1V3TA 2YZ7A 3OIWA 1UOQA 2O2YA 4RIFA 2I91A 3Q3EA 3WDMA 1HOXA 3EXG2 1ZNYA 2N1BA 1SVUA 2R60A 3GGOA 4O59O 4EUHA 5ICGA 3DDHA 3O4FA 2V9PA 4GIBA 1MNAA 3ZU6A 1KDZA 3M1YA 2WJGA 4OH7A 4IQFA 1I4WA 1KY4A 5CBPB 3PFCA 4ZO8A 5DWQA 5JW6A 4OA8A 1KYQA 2NO4A 3U3JA 2A59A 3WB2A 5ED0A 4KFSA 5EWMA 2CB9A 2BRUA 3QENA 2Y2VA 1WP9A 2XYHA 1CRPA 2PX4A 3JAMA 1ULBA 4BV9A 4MEJA 1JHPA 4UDXX 1EIWA 1NP7A 4DUYB 1T8SA 2W2LA 1XZCA 1Z8FA 3EZYA 5LU9A 2IYQA 5LD2C 5D3QA 1R3UA 2AB0A 2JAWA 5JALA 1I10A 1FYWA 1RJ9A 1CRWG 4M1QA 1FPQA 1VFPA 4IEEA 1TQ2A 2YWBA 3K6KA 4LF5B 3V4SA 1EWRA 1SOWA 1U0RA 5IARA 5B4TA 1CQJA 2ZKLA 3CUYA 5JNTA 5AKXA 3IQWA 1GR0A 5FJJA 1NZDA 2X9LA 1WPGA 2IIBA 2Y67A 3HBNA 1PJ2A 2D4AA 1K08A 4OYLA 4QYIB 3ROEA 1LWOA 3QUQA 2ZZNA 2OLKA 2PEYA 2Q0XA 5JISA 3NDIA 1UOOA 4W6QA 1P2BA 2CFCA 1S8OA 3GJ7A 1NU6A 2GN4A 1EK1A 3NKFA 3LBYA 2X23A 3W9BA 4DRYA 4JASB 1H4SA 2A67A 4U7TB 3RJMA 1FFBA 5K51A 2QX8A 3GEHA 4G81A 5TT0A 3NC4A 1G8SA 4P4LA 2FR8A 5GADl 1X1QA 4JGBA 3QEMA 2BFWA 2Z8YA 1CFJA 3A6KA 3CG4A 3O84A 3SHOA 3VR4D 1RMYA 3OC6A 5HFAA 2ZZKA 2EL7A 4QICA 2LZ0A 3RFXA 4BV3A 3DQQA 4ZWNA 1WWKA 1G3RA 1J24A 4Y3UA 1X38A 4LOIA 2ZM6B 3IVXA 1FW6A 3NC0C 3S2EA 3HCPA 5JU6A 4MIOA 2IU4A 2KM1A 1E94E 2CNBA 4LUCA 4QRDA 4RPCA 1ND5A 4UHBA 3S3TA 4RTLA 4W5RA 2O05A 3G1WA 3ZHRA 2C94A 1X7XA 1X80A 2RGYA 2VDVE 3H1FA 5DRTA 4XB1A 3STYA 4NZOA 3IHWA 1MH1A 4YJGA 3GZNB 2J87A 3H7IA 5COBA 1U8ZA 1OLSA 5DOVA 2X2OA 1XELA 4OJTA 1NQWA 5J59A 3ZI7A 1UJNA 4CMJA 4DLSA 2JLUA 1OYOA 1F2TA 4GF5A 4X61A 2FZCA 4ND1A 1CT9A 1QO0D 4MJ3A 1R8QA 4XFDA 1XTVA 4PYOA 1YZUA 2WQ6A 4ERNA 3T4PA 4RF2A 4LVOA 3JD0A 4BKUA 2W98A 5C8VA 5LLTA 4EA8A 5IUJC 1SQGA 1V8BA 3GU3A 5BQFA 4GQIA 5L53A 1S89A 1J7KA 2DMRA 2JVIA 4LJSA 2Q6IA 2CYBA 4UZSA 3ZK8A 5I7SA 1VJRA 1YK1A 1APBA 5B6JA 4C76A 1NUHA 4JLWA 3RREA 3O93A 1N4AA 3B2EA 5CH5A 1CY0A 5AJTA 4AW9A 4ZDWA 5MF6A 2W2TA 3KHUA 4DIOA 5A4KA 1AF7A 1LTKA 3F4LA 1F0PA 2SKCA 3T5DA 3UUFA 3AHCA 4K46A 3ZWYA 4E2ZA 4ZQIA 2EF1A 1BOOA 2JGDA 3UK0A 3NHZA 4WLNA 1R4MB 4HDRA 2FJ0A 2A9QA 4OQQA 5T6MA 2ZSEA 3GCGA 3ZJTA 1DMSA 2DQSA 2E2WA 5NLLA 1DQNA 4WCFC 2ZU6A 3K0CA 3KL4A 4UUQA 2VJOA 2ID4A 3KLBA 1N2OA 3E7XA 4KQKA 1RP1A 2OGSA 2QUAA 2AXEA 2VQSA 1ZO8A 1YOBA 1MEEA 2QG6A 4ZPJA 5AW9A 4FC6A 5BOSB 1SU8A 3DE5X 4XA8A 2REXB 2ZIUB 1VHDA 3NFRA 1QHYA 1O0SA 2G9UA 3QVUA 1RABA 4QYWA 1KBZA 4MVJE 2IDZA 1JPJA 5E4TA 1SPXA 1TOAA 3CKMA 4Y1RB 1JYEA 4JITA 5E7QA 4LGCA 5JE8A 5KCMA 2G80A 5A1JA 4U7DA 2Q3CA 1ENOA 2I2AA 1ITZA 3KO8A 5L7YA 1DCFA 2FOIA 3AVUA 2NZYA 3EIQA 3PDUA 3U6BA 2RGWA 3QU2A 3K5PA 1RYHA 3TLAA 1RRKA 4F04A 4G63A 5B6IA 1R9JA 4A2CA 4C5BA 1TKCA 4F56A 3QXGA 1R50A 2GF2A 4BMSA 1C0IA 4B48A 2IHVA 3WB9A 1UXKA 1AHHA 5DW0A 1R5BA 1HY3A 2ECQA 4XCVA 4S3MA 1KC3A 5DTRA 5LA6A 1L7VC 4AZVA 3BIXA 1FC0A 1UJBA 3A1VA 3I6BA 4UCWA 5B5SA 2GYVA 3LQ1A 4J1TA 5KI6A 5DWDA 1ZMTA 4NCAA 3WKDA 4A5SA 5IAAA 2B3TA 1Q0QA 4JJGA 3RWMB 3H3XA 1YCHA 4FD3A 5DX0A 1TF7A 2EQAA 2A5JA 2Q5LA 5CT9A 3LO5A 3ICWA 3DULA 3EVDA 5DNEA 4ZAWA 2JFOA 2VDUE 3IOCA 4I9GA 5A71A 1JV2B 4HQ6A 5EZ5A 2JJ1D 3EQZA 1IMJA 4DYHA 2JIZD 4BYMA 1J5EB 2P9GA 1WQ3A 1QG0A 4RK6A 2DH5A 1K8RA 3VKGA 4UXJA 1LBEA 1TQ8A 1Z06A 2D1TA 2XWBF 3HVJA 5BV1A 1RPTA 4YMSA 1W29A 1MB3A 3ZD8A 3CWCA 4MA4A 2RBGA 2QPTA 4QQ8A 4C9BA 1TYAE 2VF4X 3ZDBA 3SBDA 1F0KA 1CEEA 1PBTA 3UFBA 1X8LA 4A6DA 2H6EA 3ER9A 3W5UA 2G06A 3LOUA 3RYIB 2ZYDA 5CLQA 4HAZA 1O5OA 1BAPA 5I7WA 1BFDA 3HHEA 4IMJB 2I29A 1TK2A 4ZO4A 1M1NB 5AJWA 5SY4A 4BC1A 4D82A 2C2ZA 5KAPA 2ATCA 5ADHA 4JELA 4LXXA 5KYTA 4PG7A 3BWMA 1CDZA 1RQRA 3B1VA 4ZV7A 2MCFA 5AXBA 2ZIAA 2O2DA 3NWOA 1ZN7A 1G3MA 1HT2E 3IV7A 3B8HA 4IG4A 3W2IA 4E3ZA 3BZUA 5TQJA 2PANA 4OB8A 3JX9A 5ALNA 1KOJA 1YC5A 2DT8A 5K0JA 3EB9A 3UK2A 3MB8A 1BE0A 2FSFA 3CRMA 3C43A 3KKZA 4D4HA 2ZM5A 3CLHA 3IMFA 3O3OB 5C7IO 3UMCA 2XT6A 5G3ZA 2FW6A 3DDNA 5D7NA 4DF3A 1TYDE 1WB5A 3NHYA 4CUZA 5EWLB 5IVPA 3GDHA 5KSWB 3JAWB 4IUDS 5IBCA 2HMUA 3DZJA 2YUTA 1Z6GA 1F51E 4B6RA 4BO9A 2YWXA 5MDHA 2PWBA 5JWOA 2DPXA 3FMPB 2P3LA 2R7NA 3E3OA 3H11A 1C0KA 5ALGA 2F6RA 2H4HA 3D8HA 1GWNA 1T6YA 3ZXIA 5J47A 3LMKA 3JQPA 1JHOA 4FINA 1ZJJA 4OGGA 2PLWA 3BFVA 3B6JA 5CRIA 4MQBA 5IUKC 1L6IA 3VQTA 2A5DA 3L4JA 2IVFA 1TB4A 3PEWA 3WVNA 2C5AA 4ME6A 3P9NA 5MN4A 2IEIA 3FVVA 2W93A 5FP0A 4YT8A 2HWYA 2OSBA 4OHUA 4E3WA 4JROA 2SKEA 1CUYA 1RI3A 1SHZA 4MARA 3REQB 5ALXA 2PHZA 3EZ7A 4ITRC 3KJXA 5LZ2A 2OYSA 1PVOA 3M6IA 1W76A 3DTTA 4PONA 4YACA 4EG6A 4QXMA 2RGNC 2XQVA 4Q7MB 4BTEA 4CT4B 2JFUA 3N05A 5AVZA 4DFDA 1ZSVA 4PM4A 4MYTA 4QGSA 5HOQA 1G42A 3ANNA 3CZMA 1Z26A 4XPZA 2BP7B 4F8EA 1YFZA 1YJBA 3H87A 3LUDA 4JSRA 4ZARA 2B25A 1IOVA 1L5OA 1BEZA 1H2AS 1AU9A 3H6KA 2MJLA 3C7TA 4UC0A 1W34A 4Z7QB 3J81A 1MD9A 4UBJA 3OH8A 5B58C 3W7BA 4DDUA 1GEGA 4OLAA 1HNZB 1JQEA 3EQ8A 2IV3A 4RHCA 1I8TA 3E0QA 4ZAZA 2SHKA 4IIHA 1QYRA 1VBNA 1XRMA 1OWOA 3JQ7B 3NQ41 4PLYA 1PFGA 2XF8A 5FQNA 2X9NA 3LDHA 3JPYA 2NADA 4O4JA 4X24A 4FB5A 2WWTA 3C5HA 5IM5A 2X4DA 5IC4A 3A6PC 3GXOA 1GYPA 1QIEA 3CVOA 4L28A 2J3MA 5HRUA 3I83A 4A7PA 2FXVA 5I7AA 3HZZA 3HADA 2O20A 3HJGA 3HJHA 4JSTA 3UEOA 3VNBA 4RCYA 4BNTA 1DEHA 2Z2KA 4X60A 2HRBA 2X5NA 5EWJA 1HYBA 1ISSA 3V1UA 1ZR2A 5KYWB 4H1HA 4OQEA 3IPLA 4MYDA 4YJ2A 4EVIA 2B6HA 4LVUA 4CEJB 3VR4A 1JDUA 1NYRA 2NX2A 2Y1DA 3BD6A 3PQ3A 4RENA 5FPQA 3VBCA 4TWZA 2R0QC 4FI3F 3V32A 4LI3X 2EJVA 2VT3A 3AEUA 4GNRA 2D8AA 3NTRA 4YJGB 1B76A 4C4OA 4FJ2A 2D1SA 2GN0A 3D6AA 1TJYA 3G9QA 3PQ2A 4FSDA 1AXGA 1SXGA 1E77A 3L79A 4JKIA 4QXAA 5JQGB 3PGMA 1E1DA 3L1KA 5KQPA 1CJMA 2ZJ5A 1G3IA 4U2GA 5LSAA 3ZNNA 5DSTA 3ZVNA 3ADDA 4G23A 1A9OA 2ATEA 2BM9A 2AMLA 2P9CA 4ROTA 3BIOA 1EJ0A 1SEPA 1Z5UA 2RONA 3ANXA 3RARA 5DGCA 1GTMA 1KMQA 2XT0A 3BXXA 3RQSA 3ZWBA 3D8SA 3U5ZB 4Z2AA 1USIA 2XOKA 3UUWA 3WWZA 2NXWA 3L06A 3R44A 2CT8A 2G7MC 3AONB 1C5KA 1RAEA 2UVQA 3JQ8A 3W3ZB 5GVSA 4M6WA 3W05A 3EUWA 3FTFA 4RU1A 1GA6A 1CQPA 1OE0A 2BONA 3LHKA 3WQHA 5CDSA 1ID1A 4RWZA 4ZO7A 4O63O 2X77A 5DM60 1CRLA 1KMHA 3DEZA 3EH2A 4RDIA 4M9CA 3SICE 1J5PA 4U7JA 4X1IA 5D1NA 1PWZA 1HRKA 2PUJA 4QEZA 2IYLD 1TFRA 2CWWA 3PXXA 1ENPA 3K6RA 5LLDA 2YDXA 1GUZA 1XD9A 2JA2A 5CA0B 1L4KA 3JATA 1XV5A 4PYQA 3ZNOA 1M0SA 1E1RA 3G0DA 4RUKA 2QT0A 5EP2A 3DE2X 4IV5A 3P2MA 2RIRA 3R2JA 2ZAOA 1OA1A 2GS9A 3DD1A 1CNMA 1PGPA 2BMEA 3HCRA 1M34E 2M1ZA 4HCJA 1MJGA 3GEBA 3TLGB 3VKVA 5AVSA 2QPLA 5ICEA 2ATXA 4PANA 1TKAA 3IMGA 3PI7A 3RANA 3PD0A 4L16A 3S2ZA 3DO5A 4KQXA 5CFPA 5I7OA 1NG9A 3M34A 1WDTA 2AZDA 3A3PA 4KV9A 1EM8A 5BP7A 2DFTA 3GLFB 2J9FB 3W3AH 1I14A 1K6MA 2Q6KA 3WLOA 1I7PA 5KKCA 3A7DA 1E3SA 4X6XA 1PEKE 3DXXA 1BC5A 3QNWA 5JEDA 1DEOA 3FPFA 4QHYA 1JEJA 3PPYA 5DGDA 3P8ZA 1XQXA 1J1IA 2JFQA 1QVZA 3DB1A 3PDHA 3HO1A 4PLCA 4JLMA 3QMWA 3QE0A 2QTVB 4RK5A 4CV2A 2JAOA 3HBMA 5JJIA 2W37A 2V4MA 3FMOB 4HWGA 3VO9A 1Y8RA 3H5VA 3DE6X 5T67A 2D2EA 3IPCA 3WC4A 5JUWA 1SOVA 2EL9A 2XKAA 1GGHA 4KO2S 2HIHA 5EUMA 4JYPA 1TJNA 3I5MA 2H57A 1UINA 1L8QA 3CF0A 3EXEA 5LZ7A 3G7NA 4L72A 2FN4A 4JT2A 3BJZA 1RW4A 4DJDC 3FHCB 3GGJA 4GLJA 1Q91A 3KXIA 4N8EA 3KQYA 4BNVA 1B3RA 1E9RA 3ASZA 3DTVA 2DETA 3T7RA 4ZEVA 4W1PA 1BHJA 1RCFA 5TJHA 4B7CA 3H42B 3O73A 4U39A 4JN6B 4HQOA 5EPUA 5AJYA 3S27A 1W4BA 2VTKA 1H0HA 3FDZA 5D3KA 3O8OA 3UB4A 3A2LA 3WYAA 4C7JA 1M1YA 5KQMA 1JNXX 4BNMA 3JR3A 1BS2A 5IBPA 2WPDD 4Z4FA 2XOEA 2H7XA 4HATA 4KMOA 1PTKA 2CHGA 4URHA 4ADSG 2DPGA 3L40A 5FULA 1MIHA 4HK4A 2AD1A 3CMCO 3B1XA 4LC0A 2VF5X 3PTZA 4W9NA 1M2GA 4YMLA 3D7KA 3VR6A 4KAFA 3E84A 2QRLA 4FYKA 4NLLA 1NVGA 3A36A 1ENYA 4GOMD 4NYJQ 2NPIA 4ACBA 4V0LA 4XIYA 5JJBA 3ZGOA 3TIGA 4TSRA 1V16B 4R7TA 3GG9A 3RHFA 1RAFA 1XFAA 3JQFC 3KCNA 2Z6UA 5JSKA 3OZVA 2CVZA 3HEBA 5I6DA 1N57A 4HDKB 4K6KA 2FFRA 4IBOA 3TFOA 4AXBA 2I7VA 4FOSA 3LRPA 3HUFA 4O4IB 4U0KA 5EAIA 4MRAA 4GX1A 4QELA 1Q0HA 1ZI9A 1PF7E 2OP1A 4R68A 2FLKA 5DBOA 2BI8A 1JDTA 3NZEA 4Q3NA 5DBGA 5GWXA 3DEAA 5IJXA 1WTAA 5K6TA 3ASVA 3I0MA 3ROKA 1QB7A 1MXHA 4Y2RA 3W6ZA 1E7QA 3U7GA 3OFVA 2HZBA 4B4WA 2PMKA 1VQ1A 4NMMA 3BUSA 5TX7A 4QECA 4QOJA 4ZJZA 5A04A 4EGJA 1IBKB 4X1OA 1YTUA 3BJIC 4AT1A 2R79A 4M7WA 5LB4A 3P9KA 1KR2A 3W6OA 1MVOA 1PK9A 4DG5A 4A27A 5IVKA 4JBIA 4LF4B 1FDTA 4KRXA 4GPEA 1YO6A 1E6LA 4NEHB 4CKEB 5JYDA 3EIEA 4XDYA 2X8BA 3FA2A 3REQA 1Z2CA 3ASUA 3L02A 3RTEA 5HQ3B 3BE4A 3ECCA 1ZM9A 4CL2A 1XN4A 2IP2A 3TCKA 1NSTA 1QJCA 3FRJA 1ISPA 4RMIA 2V4ZA 4U02A 5CW2A 4HEA6 3B60A 2ZBEA 4H17A 3SM3A 1Y3DE 2H2FA 1M7GA 2NO6A 4ZOBA 3WLEA 4L6CA 3UGKA 4J0JA 4GP7A 4L9AA 3VKUA 3P32A 2EATA 2H54A 4KW7A 1Y1LA 4RHFA 4HAUA 1NBMA 3MMNA 2NUBA 3R5TA 4FONA 5ADVA 4DQVA 1H1DA 2PLFA 3NAZA 1BYUA 5E6RB 2QX9A 2I3BA 1M66A 4I9HA 4F21A 4UXHA 3CTMA 3OCWA 5KYXB 3WAKA 1M83A 3EIWA 3L7JA 4Z9AA 1DXOA 3WO0A 3G85A 2O14A 1S2DA 3BXOA 4H0CA 5BSUA 1HYQA 1TO2E 3K7EA 3U4IA 4MLDA 4QG3A 3WIVA 2GRJA 5E9WA 1BH2A 3LHSA 1ZH2A 3KOWA 1T2CA 4F2HA 3CLUD 2H2IA 2JFVA 2P5UA 2WYUA 3H8VA 4NEQA 4BMZA 4PSDA 1QZUA 2VBFA 4AY6A 1OLXA 1ES9A 4ZQEA 3KTFA 2OV4A 3UGJA 3MPUA 5KNCD 4QJ3A 2DUMA 1EFPB 1L4BA 3I12A 3L0YA 4WN9B 5K0SA 4AXXA 1T2UA 3ZE0B 1SUPA 1ULSA 2V97A 5BSKA 1HFEL 4GPD1 2MT9A 2OILA 2OG2A 4NR0A 3LBIA 4YBRA 5A0TA 3TE7A 3BYZA 4I2VA 2J6HA 4YJ3F 3S5UA 5CXSA 4GVPA 4LPSA 3SKVA 1VE9A 3H17A 1YI0A 5H82A 1T13A 1AB6A 1GGKA 5AM0A 3GLFA 3KB6A 1P5RA 1NVXQ 1U3WA 4NNPA 5GJWC 1NF9A 1W5FA 2VWGA 2I78A 2BZGA 2HFKA 1FBTA 2YS6A 1XDDA 1Z8NA 3HR7A 3I1IA 2IODA 1SXJC 1V11B 2HA4A 1ODCA 4R1NA 1E8MA 1PUIA 1T8PA 1JP7A 3PC6A 4AZSA 4DDKA 2GYWA 2YVQA 1ESDA 4B2PA 4EFMA 3QVWA 1OXKB 2F3SA 4QREA 3MMPA 2Y1CA 4CKWB 2BFFA 2OVBA 2PSHA 3DZCA 4P6VF 4CF3A 4IIJA 1XZFA 1Q84A 2JBAA 2Y0BA 2ZSFA 3FPAA 4MA0A 3HB7A 1AX9A 2AL7A 4HAXA 4KR7A 1TW3A 3ECSA 1ZVMA 1Q74A 4RDCA 4XDHA 1SCKA 1HORA 2K2QB 2VG8A 4KBFA 2O8EA 3G0CA 2K2WA 4KN6A 4PU0A 1GAEO 4JUAA 2O0KA 1G2PA 2O9JA 4DR2B 4CEHA 1P0QA 1P5ZB 1WV0A 2WT9A 5DTEA 1TL7C 1Y5MA 3OBIA 3RFCA 3T0FA 2PMEA 5AKGA 4FT4A 5TF0A 4DMMA 2HJSA 1XMXA 3I42A 3PPXA 3TLMA 3NBAA 4R2XA 4KREA 3QUBA 4U2KA 1YR3A 3FNRA 4K9LA 1KJNA 4QDXA 2CSUA 1J0EA 3QFFA 4Q3CA 4ZYYA 1JALA 1NRJB 4UJ5A 4MPRA 1VSQA 3QYAA 2GYUA 2GDZA 2HRQA 5GZ3A 1P2VA 2H4ZA 2WKPA 1CHDA 4Q82A 2V54A 4TQAA 3DDUA 2ISCA 5EUQB 1GDTA 1GRCA 2V98A 1B1AA 2YVKA 3V34A 4ZCIA 5BNWA 1DL5A 2M98A 1RE1A 4KAAA 2XB4A 3RG2A 3QWBA 5DM0A 3K31A 2HAEA 2JIZA 1CCWA 3ZHBA 2ZT7A 2PBRA 1TAUA 4WCDA 1SCIA 4HGZA 8ATCA 1EJ6A 3OJFA 2XSZA 4WJZA 5IT4A 3ZIUA 3OE1A 4MUEA 4LMRA 1LS6A 2JFXA 3NT5A 3P94A 2Q7OE 4YJFA 4BATA 2PV0A 3H2HA 5BW8A 2ATIA 5HFNA 4HNAB 5JECA 1E4OA 2WHXA 4FHDA 4ENSA 1GNQA 3WMGA 4GR4A 2Y0DA 2XQGA 4Z1OA 5IT5A 1I36A 1JR3E 2D1RA 4DC1A 1FB5A 1X3LA 3Q15C 2AR7A 4IJ6A 2BHTA 3AR4A 3UANA 4C3ZA 3S1LA 3C85A 4FOPA 4KQWA 1ODKA 3T9EA 1KR5A 2VDJA 4PVDA 2PAAA 3S2GA 3E22B 4R51A 4QX6A 5L6MB 3WNBA 1QHHB 3HRHA 3M4YA 1I30A 2MINA 3GBSA 4JT4A 4OTZA 3RLFA 1WSAA 1F0NA 3IVMA 5FWYB 1QMPA 2FQYA 1GFSA 4BUZA 4UOEA 2H4FA 3LF2A 1D4ZA 2JDID 3WZMA 2W6ID 3RKSA 5KPJA 4QBHA 3NG1A 2FR8C 3EXIA 4S12A 1FQJA 1GNSA 1BKDR 5F5LA 3TR5A 5K0GA 3P45A 1HE4A 4JR2A 1E18A 4ZO9A 4E03A 3QIAA 3S1AB 1Y7HA 1E2GA 1VKNA 2F3UA 2I2DA 3SNHA 3VH2A 3KK0A 2ZUUA 5DHQA 2XHEA 3CRRA 4ZTBA 1CDEA 1LVUA 1Z5NA 4TVOA 3U1BA 2WYHA 1H94A 2CC2A 4FCWA 5K7SA 1P18A 2CN1A 3KHSA 1U7WA 4LZWA 2ZIZA 2C9BA 5I4KA 1AG9A 5E7JA 4R3NA 1GZVA 3DDSA 4Q9DA 4L9WA 1DJQA 2JLSA 3EIOA 3FJYA 3KR0A 5FD8A 4GRIA 4MV0A 4OGWA 4R2WA 3D3JA 4R7ZA 4QM6A 2CL0X 2PBZA 2ZE5A 5JMWA 2ODWA 4U2CA 2IOFA 1ZK4A 1Q7GA 5JLAA 3ZDDA 3T5CA 3EGEA 5JPIA 1AK9A 2CB0A 3DBOB 3PPVA 1KEVA 3CIFA 4G1CA 5A6SA 1P2DA 2NYRA 2NU7B 3GV0A 2IWHA 3ND8A 4N7JA 4WJLA 1W19A 3DFZA 3LI2A 4JQOA 2LV8A 4WUTA 5FV7A 5BV0A 1G6HA 1MAWA 1ULHA 2HTEA 2I6SA 3C7DB 5CFZA 1DTEA 3Q3JB 2Z08A 3IBTA 3AM4A 4JJKA 4XVHA 4IEFB 1WL8A 1BXGB 3RGGA 4BNYA 1GTZA 1KYVA 1HGXA 4JT8A 3E48A 4QG7A 1QFSA 2ZRDA 2ONJA 5K8JB 3PXDA 2XZOA 2ZU0C 3KKKA 3PUJA 4MV7A 1P5FA 3UH1A 4DILA 2HKIA 3S28A 1E6WA 3DZHA 4P81A 1TF5A 1J09A 4H7JA 4L2IA 1A97A 5FBVB 1K6JA 3RUEA 1HETA 2WFLB 5FI1B 4LJ5A 2YIMA 4XTRA 1I4DD 4B3GA 2VPWA 4RDXA 1ZIPA 2C9OA 3QVGB 2IH4A 4KO3S 2VJQA 1IYZA 2J3EA 4ZI3A 2BP7A 3O4IA 2O8DB 4DC9A 3RFVA 1SIOA 1JAIA 1FXUA 4ZMRA 5HSGA 2XYGA 2EFCB 4ABYA 3FM9A 2I66A 1XAGA 3A6JA 3SWWA 2DULA 2I67A 1T35A 2IPMA 4RXTA 4BP8A 4C6TA 4YRMA 5L3SB 3NIGB 2G4LA 1CUHA 1SD2A 2J0EA 3GJSA 3LUCA 4P7FA 2HPAA 4C30A 3R3ZA 1DJNA 1O6FA 1FXWA 2O2CA 5ICMA 2ZRAA 5GOZA 3OP1A 4QEDA 1TVKB 1X6VA 4DLNA 1DIAA 4GDFA 3GQBB 2FWIA 2FY8A 1ZD1A 5J4KA 1CZKA 4BV2A 4WPGA 1FYFA 1HDZA 2COKA 3ROPA 1DKQA 1H6BA 2XBUA 4N6OA 3BE5A 3U0BA 3AFIA 4V0ME 1EDZA 3LH5A 4IDPA 1SCBA 3DE3X 4PZYA 1SXQA 2X6RA 3WQQA 3SOZA 1CNEA 4RAQA 1F38A 2ETXA 4AKSA 1GCGA 1Y0BA 3LCMA 4W5NA 3LX8A 5HQJA 3K0BA 1K4KA 3Q7TA 3WSTA 1Q7BA 2P8JA 3R6TA 3VNRA 4G41A 4CLRA 2IP4A 3R3JA 1AUOA 1X2BA 3G0IA 3R09A 4MW0A 4YJKA 2JGEA 4AUKA 1JIVA 2C31A 2YV4A 3GXBA 4JHLA 1TUGA 4MQEA 4JI3B 2R6FA 2IA5A 3VJMA 1XK7A 4Q4HB 1NVEA 4WSOA 4ZAGA 1X8JA 1G8AA 1PNTA 1U9YA 4LZAA 4QGFA 4TXMA 5CJPA 1GSIA 2WMYA 4DWJA 3VR0A 3ELUA 2Q9AA 5E1DA 1UEIA 3VHLB 2XGOA 3A9CA 3WIEA 2O48X 3HNOA 3Q3HA 1P2TA 2RHWA 4O1MA 1XJCA 3OOHA 2PEZA 3UKDA 4D3ZA 1TJPB 2QGZA 1COWA 4D0GA 2IZ1A 4HZUA 3BL6A 3IBSA 3PR3A 4Q18A 2D0IA 1P62B 1Q7TA 1TECE 3KZ1E 2EZ9A 3MXTA 3NIBA 4JUDX 1JR3A 1ADJA 1YE8A 3IESA 1S9DA 1WXFA 3HN2A 3FDFA 3D2BA 4DM3A 4DLXA 3EZFA 4MO2A 3QKTA 3NBUA 1UJMA 5KYYA 1W9HA 1OFUX 4F8JA 4GOJA 4JLKA 3OOEA 1R8JA 1FDSA 2YQ5A 3LOPA 3OZIA 4RAOA 3RE1A 1M75A 3DBVO 2W6OA 2Q3LA 1XVIA 3HLTA 3QOYA 1G8FA 1M2VB 2MINB 2OD7A 2QN7A 5EIBC 3ULKA 4OJYA 3UJHA 3THYA 4A9AA 1Z2OX 1NQXA 1A2BA 4Y0AA 3A05A 4FTWA 5F35A 3CONA 4KIUA 1C8LA 3M70A 4I50A 5LA6F 2HXYA 2H1VA 1V25A 4RBNA 1ATIA 4IF4A 2V7TA 2PGAA 3HDTA 3Q5GA 2VRWA 1T4BA 3SF8A 1HE1C 4RLFA 3RVOA 4B0OA 3TJRA 1G8PA 3JQ6A 5IWCA 4QGBA 3EGXA 3LP6A 3MQ2A 1SOAA 3RBVA 4GKBA 3BDIA 4I6JA 4E5MA 2RGRA 1O6GA 2WHRA 4CUJA 5IKMA 4Y9UA 3K16A 4FHGA 2GXQA 3NYRA 1QR6A 1TZCA 4DA4A 2HOQA 1E7YA 3FDXA 1DAGA 1OU0A 2VQDA 5ILQA 4PO3X 5TGZA 3SS9X 1GRNA 2DKFA 1VHJA 3FYSA 3QGMA 5DCLA 5EIBD 5FA5A 4DV1B 1N5RA 1KYWA 4TWAA 1MKYA 5AXCA 5ENVA 2DLCX 3L07A 1P1HA 4C0SA 3HLYA 3QVMA 4G0UA 5GGXA 2XBLA 2QD4A 4JXKA 5JD5A 2CVFA 4EW3A 2IXFA 4Y6LA 1N5MA 2EJWA 3GA7A 3N8DA 4OXNA 4I66A 1RYYA 2IFTA 1QR2A 4D46A 5EXPA 3B6EA 3B9RA 1A8IA 1BDBA 1I7NA 4PG6A 1P2GA 2VHTA 1Z4KA 4IHAA 3GFSA 1LS1A 4WKNA 4CFZA 3U7HB 2HJWA 1NNUA 4K9OA 4GZ6A 4TZ0A 2GAAA 2PKYX 3EY9A 1M8KA 4LJKA 4AG3A 3A70A 5EL0A 3RJTA 1M2HA 1XDGA 4X45A 1L9XA 2OFPA 1HG1A 3P71T 1UBRS 1ZCJA 1MEOA 2GMWA 2IY8A 2XIQA 3BORA 4UAUA 5C1BA 1COZA 2FJPA 2V8OA 4RLHA 1PNOA 3ID6C 4HVAA 4D97A 3REGA 4WLEA 5JVDF 2RFLA 3JYOA 1C0EA 4PGAA 4B71A 2QQ5A 2JI4A 3TQOA 2BM0A 3JQBA 3L8DA 4Q6WA 3BN3A 5IH3A 1SQFA 1YJ8A 1FX0A 2A35A 1K3TA 2BTQB 2VRCA 5IN5A 1T0BA 3V8PA 3OX2A 4B09A 2Z09A 5TLSA 4B7ZA 1Z0AA 1E2EA 3EC1A 2RGUA 3WL7A 3E5NA 2AQKA 2YV5A 3T35A 4D9EA 3GNTA 5D3MB 2RGCA 1NT2A 2YJGA 2Y8EA 2OCGA 3JVVA 3MRSA 1UIRA 2E82A 1OXVA 4WKCA 2WD7B 3AX6A 4L4YA 1RJWA 1VE7A 1N5OX 1EFLA 5D85A 2RH5A 3OKAA 3CUKA 1YONA 2ZUCA 3QSGA 4Q21A 1Q0SA 1Q3HA 4AP9A 1YQEA 1Q21A 1RXEA 4YRFA 2Y66A 3COZA 1NBAA 1T3ZA 3ZG6A 2PZGA 1KO7A 3AFMA 3K32A 4PC3A 3M8KA 5ALMA 3OWOA 4P7KA 3ADKA 3UG7A 4EW1A 3IODA 5AXDA 1EUQA 3HSKA 2CVQA 2WINI 2XI4A 2A5LA 4ZDIA 2V59A 4W6ZA 4QUDA 4JI2B 4F9EA 1JJ7A 1QPBA 2H9YA 4B47A 3FHTA 4PLZA 3T7IA 5JRJA 2Y6VA 3BZWA 1M1YB 1VRWA 4BKMA 3KDAA 3KWFA 1H6AA 1P33A 4C4AA 1J22A 1SUBA 4GSKA 4OHXA 4YDHB 5DKFA 4EELA 1RRVA 5EJAA 2DFLA 2J9GA 2GK7A 1IOLA 4F3YA 5EJ4A 2ONCA 3AZPA 1IC6A 2RGXA 3RH0A 4G8CA 2YIJA 3G59A 4GT1A 3ILHA 1IHYA 2H1RA 2VF2A 2VYNA 3K9LA 1ADCA 3K9QO 1J9EA 3OICA 3HNRA 3VDXA 1UXGA 1VP3A 1VZ2A 3AZOA 2ZJOA 5ICSA 4YI3A 4EJ6A 2A3NA 3MWKA 1XX6A 5THKA 2D5BA 2BGIA 2Z83A 4CRWB 2WJZB 3A1WA 2H5EA 2PSEA 3WNCA 2FPUA 2PKQP 2PS0A 1KFBB 4JKOA 5L3VA 3L7NA 1NLZA 4MQLA 2GLTA 3VYTB 2Z4TA 4FQ5A 3RVNA 4R71A 4CQLB 4Y6GB 2HEGA 1S3IA 2F1OA 1AQYA 2VQ6A 4YRRA 5JRDS 2IF0A 3WLSA 3BAFA 1NX9A 3A9UA 3BQNB 1I5EA 3K8QA 3L8EA 3THXB 1QVAA 1DUVG 2FZ4A 3H8JA 3O5AA 3KYCB 5ALUA 3WGMA 3KC2A 3D8RA 4QPCA 2RKOA 1EX1A 5JYBA 2CNNA 2FMKA 2YMMA 1R5OA 2CNKA 4K1XA 3II6X 5F2NA 2CXHA 4RMHA 3MHTA 4ZVQA 3ONWA 4LBWA 1XRJA 2NO0A 2WHPA 3EVAA 3V6MA 3H2SA 2IOHA 4KBYA 4N18A 2NU8A 4OXXA 4EF6A 3M6VA 3P9QA 3WIUA 5F51A 2W6MA 4NU0A 5G41A 4Q4JB 3ITDA 3PPWA 4M9ZA 3R8FA 3WQRA 4FCVA 1QWOA 1TIKA 2FMXA 2H5IA 4NE7A 3RU9A 1KU6A 2ZATA 4PGGA 1SBHA 3ESAA 4XYBA 4GHWA 1GNPA 3DAPA 2VP5A 1V6SA 4HTFB 4KQMA 4IMPA 4KLZA 1NXSA 4LRUA 1E6EA 1YZHA 3T1TA 3KD3A 1OZAA 1W0KA 2OQRA 3GLFE 1N36B 3KUKA 2FPIA 4QOHA 1S1MA 4R05A 4H2DA 3R9IA 1II8B 1TM1E 1YKFA 1ZPDA 2QU7A 1P6QA 4J16A 1R4ZA 3PT5A 4MUNA 1PK8A 1C30B 1T0UA 5G0WA 3PGXA 2SBTA 1JEYA 3T7TA 5DN9A 3R4VA 3N5KA 4K1LA 5SY9A 4H0NA 1LZKA 1QCYA 1Q57A 1ADGA 3RVSA 4UUOA 4FEYA 3DQPA 3N7UA 4H1WA 3LW8A 4IILA 4QTUB 3E9CA 1JHXA 3EARA 4PW0A 3B7GA 1NJ1A 2ZAMA 1K5DA 5LFAA 4IKOA 3W8EA 2CUZA 1QF6A 1F5SA 3OFKA 2GEKA 1XMOB 3RABA 5JARA 4PO8A 1VMKA 3NWEA 4V0RA 2P5YA 5KJCA 1SGWA 3EIUA 2P6RA 1ORIA 2CGEA 2P30A 2RI0A 2WWHA 4I36A 4FW8A 2OZEA 5DCYA 2VJLA 4F3RA 2ZJBA 2X8LA 4YAFA 2ORWA 5LMNB 3PEYA 3QFTA 4R9NA 1C7FA 1IZ9A 1FPMA 2C2BA 3K0FB 2B7BA 2VTVA 1W85A 2DSNA 2PGOA 4HVLA 1SZCA 5ERYA 4EPWA 1BQ3A 4RQBA 4G6ZA 3FLAA 2VP4A 1QQTA 4R1QA 3LS2A 4ZOLA 5PNTA 4B40A 5IKXA 1E99A 13PKA 1JUDA 2YUIA 3L0IB 1JVBA 1M7BA 2WU8A 4L15A 3UPUA 1KEUA 1JILA 2XA2A 2BPOA 3HDJA 1YS7A 2IYYA 1Z0KA 2QV7A 4H08A 2NO5A 1A4UA 2ZSHA 4PFQA 1ZW6A 3V80A 4YV2A 1QF7A 4OATA 1ZIOA 1CV2A 1OI2A 4WRRA 2I3ZA 1DAPA 2AUMA 2DR0A 4ZA2A 1LBTA 1O08A 3EGXB 4RJJA 2B30A 3OSUA 3QPCA 1WXDA 4IO0A 4Q4DA 3CH5A 4RCZA 4OHFA 2VQEB 1MT0A 1EHYA 2NWQA 4HAIA 2Z04A 3HJNA 3T1YB 1IY2A 4ZAXA 4IZOA 3ACCA 2HU7A 1F9AA 2W8BA 5B1SA 3D3QA 1S5PA 4RIEA 4NDZA 1BKYA 4HLUC 4JWKA 5BYAA 1TGYA 2OCBA 2JGIA 3L0DA 3QJGA 4O2AF 4GOOD 3H9EO 5JMTA 3EE6A 2BF7A 2WUGA 2WMDA 4L0DA 2P62A 2VYVD 4ATNA 3N58A 2FG6C 1I9GA 4RL4A 3BPSA 2QJFA 5K3DA 4ZI5A 4BFXA 5BSFA 5TVGA 4YRKA 5JS1A 1E5DA 1U2PA 4WKGA 3WXBA 5AK0A 3MG9A 5AOVA 4QXQA 2YIDA 1EUZA 3X1WA 4B6OA 5A0VA 3DW3X 2Q1YA 3C3YA 1AKYA 3MWEA 1L5MA 3H6GA 3LQQA 4CF5A 3ICOA 5HJ5A 5K3OA 2CBZA 3L8MA 1RXCA 5AI8A 2E5LB 3KEOA 5DYGA 1K06A 1YBHA 3ON5A 3LK7A 2YYSA 3SR3A 3A3NA 2ZYHA 1PZEA 1OFVA 3NEYA 2GPJA 1V48A 3FPBA 1KDRA 5K0NA 2ZWIA 3HDHA 1PTJC 2PO5A 2XEDA 4QAQA 3RVRA 1QGYA 4YCDA 4HADA 5G40A 3ZCVA 1IWPB 3SVZA 4UM9B 1N75A 3WLRA 5T41A 4G1BA 1E32A 1C3OA 4G0QA 3M89A 4EY3A 2O5CA 1S4MA 5EGNA 4PRLA 1GARA 1DTWB 1J8VA 1KO8A 1E0SA 1MA3A 3DDZX 4R54A 5CDTA 2O54A 1YOVB 4HQFA 4X44A 1I2AA 1QYXA 3HRKA 1G8MA 1R16A 1G3QA 2DOKA 4KIFA 4L5CA 3MCZA 4RYLA 1SVWA 4Q9AA 4RVDA 4WLUA 2OD9A 3M7IA 3QVKA 1JQKA 4L4RA 4RHUA 4HDQB 1VLHA 4A1FA 8AT1A 1DSSG 2OAP1 1F7VA 3QI7A 4BX8A 2BVNA 2R7LA 4QDUA 2OHVA 1GGMA 2RH9B 2WD9A 3B48A 2DJ5A 4UM7A 2YMLA 1NMXA 1BQ4A 1TM2A 2BJWA 2CXTA 4MRMA 2YXDA 4KHPB 1A8QA 1IY9A 2O7NA 5C4MA 4JLBA 1JZQA 4MP6A 4HWTA 2V5AA 1IQ0A 1Q1GA 4L5BA 2I0FA 4Y2PA 1PQWA 5JR3A 3A0UA 3PNQA 4B9AA 2JLYA 1RAAA 1QM5A 2AXPA 3ILXA 3JXEA 4NBVA 3B3JA 1XF1A 3IQIX 3QXCA 4QODA 5EHGA 3R6GA 2H18A 4Q12A 5BVGA 3C3DA 3COVA 2O50A 3QNUA 1ABEA 2PZFA 1PS8A 5KO2A 1X74A 1PT8A 3I39X 3T38A 2XA1A 1FDWA 2NQ8A 3PJEA 1GCIA 3E3NA 3FHLA 1TUBB 5CFLA 1E2PA 4FC7A 4ARCA 3JSXA 4OVKA 2X5XA 2R6JA 4WXEA 4G5GA 5IH7A 1TJ5A 2VAPA 2FFQA 2FF5A 5DIFA 2JAQA 1F6BA 5KPDA 1TTQB 5JROA 1QLJA 4CM8A 2DFVA 1GGJA 2B34A 4RULA 4LYAA 4ND4A 2Q2NA 3TGWA 4AROA 1K6EA 3QG1A 1TVMA 2ZRFA 1EK5A 1UODA 5E4JA 4U6NA 5GV8A 4R6WA 2GKOA 4F4DA 4Z4GA 2FETA 3N75A 3ZTYA 5CM8B 4MP8A 1ZH8A 4G8BA 2FMFA 3AJAA 4G0NA 1XKTA 1A8SA 2XTJA 1XNGA 2XYVA 3VM6A 2FZ5A 2H92A 2OP0A 1H8HA 1FP6A 3TK1A 2HH9A 4AJKA 1OGIA 3K53A 2ET6A 3EGDB 5K05A 1OX5A 4CG1A 4HDMB 1JLSA 2DWUA 2R68A 1R5JA 4LEIA 3CF4A 3T0IA 2G4VA 4RK7A 2GR9A 1N7JA 4YRSA 1YCGA 1J8YF 3AM5A 3GUUA 4MGIR 4AECA 2CMDA 3G5AA 5LJLA 1V1RA 1Z3CA 2ID7A 1P9WA 3FNIA 1ST2A 4FE3A 4HHEA 4UEKA 4DSUA 1MH9A 1RBZA 2X9VA 2WZBA 4ER7A 2E4XA 4IXMA 1N0IA 5C3MA 1M67A 1NXQA 1FQOA 4I7EA 3U5TA 4UFOA 5H4GA 3D8NA 4CM7A 3K0HA 1P74A 1Z7BA 2GHIA 3GA5A 2XXAB 2QMOA 4A3SA 5F4BA 4JGGA 4MQFA 4EOGA 3BXFA 2ONZA 4JBHA 3A04A 3DBIA 2K87A 2QP3A 4ZYZA 4XVQA 5CJ2A 2FK8A 3HBFA 3HDVA 1ZL2A 4UULA 3FNEA 4Y6QA 1ONOA 1TPYA 1UWCA 3GUCA 3KZCA 4WNAA 1JMVA 1UIMA 5AI0A 3E2MA 4PZAA 1A76A 2EX0A 5G2OA 3ZWQA 1VZ3A 3DVSX 1MIOB 1PJ3A 4G84A 4M46A 4BO6A 4R5HA 4N47A 4QO7A 1GY8A 1KKUA 4OLHA 5HXAA 4RCVA 4I0WB 1YRAA 2J9RA 3IEUA 5FBWB 1G17A 2JGLA 1AN0A 2MSNA 2O06A 1V96A 3CZAA 4TS3A 3U37A 4FZVA 1J1ZA 2BEKA 1Q7RA 2ZUBA 3IOMA 2Z3WA 3NDJA 3OAAA 4IDHA 5K3FB 2ZANA 2AG1A 5CHYA 1ZXBA 2C8KA 3CH4B 1CUUA 3HSSA 4LTNA 3JQ7A 5HQTA 2AC4A 3OIDA 3JALB 5REQA 2F43A 3QLTA 4NBLA 2NU9A 4WFIA 3VUEA 4EQ6A 4YV7A 5KWIA 2B5VA 1DT3A 4AVYA 4B8YA 3C98A 2OO5C 4RY0A 4TV8B 5JXGA 3WR5A 1J6UA 4MULA 4TL8A 1JXOA 3MJFA 1XLTC 4FX5A 2XUAA 3SQMA 3PDJA 1EZ1A 1EUDA 1YIDA 2DVMA 2V7BA 4LW8A 2Q5QA 2BYTA 4XIGS 3GLIB 3BHJA 1CYEA 1UCFA 5D1HA 1SURA 3DMRA 2PH5A 4AN4A 2ENUA 4CMIB 1LFAA 1OX4A 4GM0A 4QA9A 4BNNA 4F9TA 3IURA 5JAMA 3DGEC 4I6GA 4OI1A 1QHSA 3CLTC 3DVRX 4CIBA 4KXYA 4OUDB 2WFAA 1ZNXA 2O6HA 3RPEA 3EPKA 4QO8A 1M72A 4ARBA 4LCBA 4F96A 1JFLA 4BECA 4F7DA 3QYJA 4M54A 4XLZA 2EZUA 4CIVA 4MNTA 3RS3A 4FMDF 2P91A 4LZJA 5FA8A 1T5DX 5I9IA 2X0DA 4DUGA 2FGJA 1DCTA 1CUCA 3ZGYA 1DIOB 3TDMA 5EIWA 3VU8A 3TSCA 3GELA 3GOQA 2QMYA 4PF1A 1DQYA 1GKLA 3MF4A 1MMFB 2P3QA 4ZCTA 1UOEA 3QUCA 1OFGA 1ECCA 1LX6A 3INRA 2XNDA 1ECLA 1W88B 4E33A 2IS2A 5IEBA 3QF7A 3QH4A 1WG8A 2NVUB 4JVOA 1QRDA 3OEHA 3AUXA 4L4ZA 1AGRA 1S3GA 2CLDX 2P9QA 2A3RA 3D02A 4YRZA 3GFQA 1ADBA 1W47A 4ZJYA 4FDAA 4HDSB 1A7KA 3F78A 2W42A 2P3OA 3LXRA 1ZK0A 3S99A 1KYYA 2P6MA 4F5ZA 4Z0NA 4MROA 3E4CA 3DOEA 3ZV6A 4RKFA 4B81A 1KQ3A 2GOYA 4IQ0A 3F1KA 2VRCD 5FTJA 4AP6A 5HR5A 2C5HA 4LRSB 1H65A 2BFOA 1V4VA 2P68A 3V55A 3QEJA 3NORA 1TQDA 3FXAA 2C0PA 3ANMA 1PUXA 2PXAA 1YT5A 4HAYA 5CX1A 3UICA 1CTQA 4YCMA 5MN5A 4A26A 5HBRA 2JGRA 4HMPA 3WWEA 2IP1A 3O4VA 1G1AA 1Y6QA 2ZBVA 4BO7A 3EULA 4KQ6A 4P4NA 2IW1A 5BQ5A 4I1IA 3N07A 5DOZA 1AMNA 1GJRA 2O0MA 3AHDA 2WD7A 4RA6A 4W5HA 5F21A 3B6MA 5L45A 3RSGA 4DM7A 2FEWB 2GN9A 3V2UA 3SG0A 2DQZA 3D3WB 4H6WA 2AQ8A 4LMAA 4OSEA 3LKDA 4P80A 5I7EA 3I05A 5EESA 3V8RA 1BWRA 4FW9A 1W5AA 3WYFA 5IC6A 2BJVA 4CF4A 5ELLA 1GZ7A 2X40A 5GPBA 4PSKA 3P9CA 2EGUA 1E2DA 1KRHA 2XMPA 4EJSB 4DN6A 3PX3A 4N5NA 3VKFA 2XB2A 1V8PA 3OZAA 5LZ4A 3K70D 1OFIA 2FPLA 4TV9B 1VYTA 1T9KA 4P4SB 4XWGA 4AB1A 3L5OA 4E32A 1A2OA 4ZZ3A 3LPLA 2HX1A 2HLDD 4BE7B 1YZNA 3B36A 3CR3C 4LXYA 2WE8A 3P0JA 2E21A 1GNVA 4BRZA 1OVGA 3DJFA 2CY0A 4NBKA 1T8TA 1QFYA 3NUGA 4GXTA 2QG4A 2B94A 3RUPA 4WMLA 1PVDA 3T1NA 3PJRA 4PAGA 1LBHA 1CF9A 3RROA 4HNQA 4XD7D 3TRJA 4MQFB 2QI9C 5EMNA 1R3DA 2X0IA 4LC1A 1NQTA 2PL9A 2B4QA 4MIEA 2IBTA 2BGUA 1IN6A 2DFKB 3KJQA 3L7LA 1OYWA 4ETMA 5ES4B 3GFTA 4Q1VA 2ACWA 3CVXA 4BFWA 2FSVA 1B4DA 4EPVA 4C78A 3CCBA 2PLRA 4AICA 1NBWB 1RRPA 2R8EA 4HH4A 5DM1A 1GLGA 2R6ZA 4RVSA 5C81A 4LSGA 1PFUA 5E95A 1U1IA 4P92A 2QTZA 5BN3A 3I3OA 2JFBA 4DMRA 5I47A 4G09A 5INTA 1FSZA 4RKYA 1UK7A 1GSHA 3DOFA 3SVLA 1Q1BA 3KQKA 1ZIXA 2AE1A 2CMFA 4UNQA 3K9BA 3WY9A 3VU9B 4NCNA 3ZD6A 2OKGA 3RAGA 3QPWA 1KO4A 4B3SB 1O95D 4FBGA 4MMYB 3FZGA 3TBFA 2EW2A 3TW8B 1PU2A 1TMOA 2BEUB 3IP9A 4O4HB 1DKPA 3KM0A 2R6GA 2GD6A 4RV4A 1J8DA 1CWUA 5BOSA 4N7MA 4D6YA 3HGTA 3STXA 3HP7A 3EZLA 4Q05A 4RO0A 1E92A 1Y8AA 2NUPA 3CFYA 4UBKA 3HKBB 5DLEA 5FAXA 1ZKMA 1LK5A 2UDPA 3D4BA 1UBFA 4EYEA 2QTLA 2JLWA 1YS1X 1HTTA 1OXBB 1EGMB 4URYR 2Q1XA 2GCPA 4PICA 3PLAE 1Z18A 3U7QB 1DRWA 1L5SA 4HAOA 2QNBA 1QAMA 4BFCA 1Q1ZA 3WHLA 1DXHA 3EDMA 3T5BA 4EJ2A 4K2AA 1LZLA 3O75A 3BMQB 3GRYA 3PQFA 4Y2JA 5I3CA 1UMCB 9LDTA 1PVVA 4L07A 1U6KA 1L8AA 2CEKA 2F9LA 2VWHA 3PDWA 5KWVA 1YDWA 1C9NA 5LUAA 3OZFA 5CK4A 2QD5A 3L1HA 1X14A 1A96A 1B26A 3UCXA 5CT5A 1A9ZA 3R7WA 3I52A 3G7SA 2HMAA 2DYKA 3LCVB 5IK2D 1RM3A 2WDPA 1MIOA 4BAZA 1F0YA 1RU3A 3I4FA 2ORVA 1AO0A 4MR7B 1E4YA 1NJSA 2SNIE 2OM6A 4HUQB 5CT8A 3UHJA 1W59A 4IZ6A 5FTMA 4B3IA 4JJ4A 1A9YA 1KFCB 2Q27A 1CPYA 3OBBA 2IV7A 1GPYA 5CB4F 2G1UA 3SNKA 4LF9B 4GZ3A 5D6NA 4Q6BA 3EVGA 5JD6A 2F48A 3M5CA 4OGFA 1UXOA 4HEQA 4TXHA 3W2FA 2NTNA 3VTAA 1FLAA 3LHFA 1XOIA 4L2IB 3CSUA 2BFEB 3CX4A 1WBBA 3HYSA 3OTWA 2D0PB 1CP2A 3EZGA 5KMGB 3O4HA 4KE7A 4BMNA 4YLYA 1JW9B 2WAAA 3KE8A 2ZDHA 3ZN2A 1X7GA 3FF4A 5IDYA 5C2JB 1NL3A 1P1KA 4BLVA 2EGGA 1XQ9A 4G97A 3I6ZA 1L5ZA 1EP1B 2O2SA 4ZOLB 3PQ8A 2J08A 1FNMA 1U9CA 1PW7A 2Z43A 1JWAB 4Z9FA 4YN3A 1VLZA 3VPHA 4AZ0B 3PZRA 4EHDA 3AVTA 5H1YA 2OB2A 1FFXA 5CTJA 5ADWA 1VB5A 3LGAA 4P4UA 2R1VA 4RNDB 2IUTA 3MJVA 2ASVA 4NYJR 1CEQA 5KWSA 1ZWLA 1POWA 1TA4A 5ALEA 4FFBA 2QM8A 2Z2IA 1IVNA 4MYSA 2C9ZA 2G8NA 4L4SA 4P3XA 1ULTA 4I4TF 4P53A 4WXMA 4Z8YA 5K03A 2AYZA 2ZSKA 5JY6A 3MEQA 3C8DA 1TMYA 3JS5A 3CURA 1FP7A 3FZYA 3CRW1 3DEYX 3FE2A 4RW0A 3PSHA 2HHLA 1R9GA 3QKWA 2VYCA 3PCRB 1CE8B 2DBVO 2OAGA 1X7WA 2RJ3A 2EEPA 3MMXA 1XCLA 4A10A 4G8DA 3J7AC 1J20A 1YNSA 1HE2A 2JI9A 1QIGA 5GJBA 4ESHA 1UOPA 5FPTA 3LFTA 2J85A 3QWIA 3UJCA 4IM7A 1TCUA 2OKCA 2B5WA 4NPAA 2VCYA 3CEMA 3V7YA 4A36A 3OM0A 3E1SA 3SFZA 3AEQA 3RYCA 2QN1A 4RD0A 4KK4A 1YZFA 3L6BA 5M2QA 4LHYA 4MYHA 1RVDA 5EYPA 3T1VA 2C4TA 1JAZA 5HDQA 2O8BA 4ICIA 2VPYA 2HFJA 3FR8A 2HXSA 4R9RA 1HA3A 3AOEC 1KP9A 1G38A 2LNDA 2QY6A 1TLTA 3P7MA 4GPBA 4PRZA 4Z5XA 3C7KA 3HRIA 4QJBA 1JIJA 1VMEA 2E48A 2GJAA 1DAHA 2B8WA 3GVXA 1P1JA 1SCUB 1ZLXA 3R6WA 4PZ0A 2XMQA 2BCGY 1Q0PA 1QV9A 3IXMA 3A3YA 3AF0A 3LZDA 1NW7A 4F84A 2LKCA 4EI7A 3O38A 3WL4A 4GDMA 1I51A 1TU0A 2WG2A 3WHKA 1U8YA 5KQLA 4F12A 3IVCA 1GZSA 1X15A 1I1OA 1K86A 5JG7A 1HKUA 1L7RA 2J9ZB 2NU7A 4DKXA 3K2IA 3B6IA 1JKIA 1C7QA 1K7SN 3DOOA 1WF3A 4C03A 2WPDA 2XW6A 1ZK2A 3SP1A 2R85A 1OXSC 1W9MA 2GEDA 3HR8A 3WL5A 2LW7A 1E9VA 2NUPB 2PMCA 4KXVA 1ORHA 4TKZA 4IRXA 3RCBA 3B9QA 3O8QA 1H2FA 4MB0A 2AOXA 4LDJA 1NJFA 4JKYA 5FPPA 1U31A 1HFWA 1XPUA 1L4GA 5FUXA 4A0GA 1T1GA 1PDOA 1N34B 1TMGE 3W5JA 4EUNA 2AYYA 4OMUA 3UW1A 3L9XA 1NJ2A 4Q9JA 1KK2A 3SXUA 4K9KA 5AUPB 4NYIQ 3GLGB 3C24A 1J56A 4AO8A 3RAEC 3RRXA 4WDQA 4C0QC 4YS6A 4EEKA 4TYWA 1BXKA 1TEXA 4R1MA 4P4TA 3CVUA 5A3SA 1SUSA 4B5LA 1AGPA 4D3YA 2G07A 2Z6VA 2OQIA 1PV4A 4YDQA 2C77A 1RBYA 3MYRA 3AINA 1Z0SA 3B13B 1MOQA 5YASA 1X1DA 1JE0A 2WQ7A 1TYEB 4Y1GA 3RD5A 5A9TA 1ZN2A 2GH1A 3P4XA 3CKKA 5B36A 1UMDB 1Z7GA 3RO7A 1GGNA 1JI0A 2Y1EA 4YLGA 4LJRA 5KX5B 4FN4A 2W6PA 4A8PA 1VLLA 3FNBA 3O6VA 3KSMA 4HEA1 4RA9B 1W46A 5IZCC 1G19A 3V1MA 3OZGA 3ZUGA 2HMYB 3MNFA 1CUBA 2QSZA 2BHRA 1Q0RA 1CJSA 2QKYA 4U9HS 1ZUIA 4FDUA 4N5MA 5LQJA 3IE2A 1KI4A 2FWJA 1GGVA 1LQ2A 2P4SA 2V65A 4LY9A 1RDFA 4CUKA 3FJOA 3ZTTA 1KJZA 3GT0A 3FPSA 3I9FA 2B82A 4M1SA 5IJWA 3NHPA 5C1OA 4RE6A 1KMHB 4L8YA 1R66A 2M6LA 1FFCA 3JZDA 3CB4A 3VC1A 3V3TA 2OFWA 2EQBA 5P8WA 5BMVA 1C4WA 4N0MA 5J4HA 4V39A 1FOEB 1I6MA 2FI1A 4IMRA 1V41E 1XMVA 5EJGA 1VL0A 2VJKA 1CUGA 5FJIA 3HXQA 5CBPA 1BW9B 4DCVA 1WRBA 4H9GA 1IJFA 3IP8A 3DMFA 3QV2A 1ONBA 5KYYB 3IL2A 3O7WA 2HY7A 3LPDA 3EPHA 2IIQA 3T9AA 4RA6B 1VYVA 4I5EA 4QLOA 4R8RA 1QLHA 1XMJA 1QKIA 1VRCA 3MT7A 1STOA 1RXIA 2FRXA 3JQFA 3QW2A 2RHJA 3TL6A 1O6CA 5IM4F 5A62A 2GX6A 3UWSA 3SJUA 1MHPA 3BIWA 2KQUA 3ENQA 4D99A 4Y1EA 1YS9A 4RFSB 2BGJA 2B4KA 4FGLA 1THMA 2OUKA 3IB3A 3TLCA 1D9XA 3RI3A 3AT1A 1S3SA 2ID8A 5EZYA 3PYMA 3RRNA 4JEIA 3SPXA 1BS1A 3GPIA 3GWZA 1LF5A 2J6BA 2RHCA 2I6XA 3M4XA 4LHWA 4O4IF 3BJEA 4XQ9A 3KT8A 5GV7A 1VBFA 4JDUA 4LGVA 3IUSA 1UDXA 1YJAA 1XEWY 3AEXA 3O31A 1UQUA 1MABA 3QTLA 3ORYA 3U3MA 1JNYA 4KFUA 3ZE6A 3DBHB 1DBIA 3LL4A 3H5AA 2JIMA 3F1LA 3RV4A 1KFKB 3GPCA 1NZFA 4GL4A 4DTIA 1XEAA 3R7DA 2Y2UA 4MQ4A 1NUSA 3TMYA 4XX0B 1PX0A 4K2HA 4BXOB 1EGHA 5BN1A 1FUEA 5JATA 2OBBA 1KOLA 3EK2A 1V26A 4KPUA 5IDVA 1IUOA 3JWGA 1ECJA 1H66A 2IW3A 4KXFB 4R0NA 4Q7EA 3RTDA 3RAFC 3M6UA 5DGXA 4HWKA 2IS1A 4MVYA 3ROMA 2RAVA 1Z39A 3IPYA 2XWQA 5IZCA 5J4LA 2PLNA 4CMIA 1GT6A 4GPTA 2C58A 4X94A 4YAWA 5DBIA 1TKBA 2CF5A 4C3OB 1RD4A 5FBHA 1J2UA 1H23A 3IO3A 4BFLA 4E5YA 3O8RA 3U2QA 1GTVA 4Q9IA 3EEOA 2COEA 2BEUA 2O2IA 2O7VA 4O4HA 4IDAA 3K6SB 1II9A 2YZKA 4CODB 1QVVA 2QRGA 4MO9A 5I8PA 2DZDA 2HTFA 2FP3A 3B51X 2JLRA 2QLJA 1RXWA 2VHJA 1IJKA 2YRFA 3NBYC 4PC7A 1N32B 3AL2A 1C2TA 1K8QA 2VYFA 4LJ4A 4XEUA 2GHTA 1R1DA 2WYIA 1CQIA 2B8TA 2XWJI 2PH7A 2ZBUA 3HFJA 2FOXA 3KQLA 4K28A 1YCDA 3HVIA 4C0JA 1FXWF 3KOUA 2H2GA 2OZLB 2ZRBA 1RAHA 2A5GA 3BF8A 3CF4G 1NI3A 3CEJA 4K3VA 2OXIA 1MLDA 3VDMA 4CM4A 1G1MA 1LSSA 2C3UA 4MCHA 3SXUB 4W8GA 4DOMA 1A27A 1RPNA 5ES3A 1N4DA 2FEMA 3TEJA 2VWPA 2F67A 2O6LA 2PKQO 3LHIA 4KKXB 3HDGA 4GG1A 3E9DA 4QOIA 4D56A 4CKZA 2J5BA 3FJ1A 3ZZNA 5CG2A 5AM2A 5DGTA 2ZBRA 1RWVA 4CV1A 4TSFA 4QGGA 3RS9A 4JEUA 3U0VA 3S1SA 2ZJ2A 3N0TA 4YJ3B 4BX0A 5TS3A 4MHSA 1PJQA 3JWHA 5CNIA 4UNRA 1WA5A 2C98A 3UB2A 4EB6B 1HR0B 2W83A 5H8WA 1ODIA 2PGLA 1RKVA 2CJXA 4CCSA 3AB7A 4FILA 5IW8A 1A7AA 1GQOA 1XYGA 5CLFA 1CUXA 2EJBA 2JGDB 1PD1A 4DGSA 1GN9A 4E5NA 4ENWA 4URXR 1JEYB 4J7UA 2V3CC 2W58A 3KT6A 4P58A 1Y8ZA 2JGFA 4KYTA 4TVBA 2XMRA 5EJFA 1UMDA 3HCOA 1K89A 4Z4IA 3WKBA 1PYGA 2GXSA 5HM8A 4I55F 4OV6B 4O2LA 3H3JA 4F11A 1U1FA 4RVOA 1T1RA 4HGRA 2IEDA 2IKQA 2NSLA 3GJZA 3HCNA 2HUNA 1L1RA 1VI5A 2VNIA 2C4HA 1N9GB 1E2FA 2Q3BA 2QHXA 5K3FA 4JIMA 3UXMA 3BQ9A 1OBOA 2CD7A 3BMNB 3RRMA 4ZI7F 1P0PA 3IAAA 2PYZA 3O3NB 5JT1A 1K7CA 2IQ5A 2XMZA 3H6HA 4B9EA 4MGYR 2PMFA 2TS1A 3T3NA 4IOKA 1XJQA 2VQFB 3GEPA 2YQZA 1H9BA 3CX8A 3C5WP 2ODBA 2OBNA 1D9ZA 3C97A 3NT2A 3O0DA 4G5XA 2B8NA 4OP1A 3KZNA 3MIIA 1GG8A 1QZ3A 4LMBA 2ZBFA 3G23A 3N2NA 3UY4A 2JIOA 1VHQA 3A9WA 3C8UA 3PHLA 4GZLA 5DP2A 4COOA 3AP2A 5EP4A 2C9YA 3ZPXA 4L4XA 2CW5A 1IQPA 1QV7A 1P77A 4UM8B 5TQ2B 1DOZA 1JTVA 3N2GA 1MTOA 1D1PA 1E1MA 2NXNA 2Q3MA 1DBVO 1PJTA 4C4XA 4RACA 1OA0A 1W88A 2H1HA 3O82A 3OCJA 3TTTA 4IH4A 1N8NA 2DQYA 4M9SA 1DPFA 2FDCA 4LF7B 3FRIA 4EATA 1CYDA 2RMKA 1U2DA 2VSXA 1IXZA 1UF9A 3RC7A 4DA9A 4ECEA 5HRAA 1KQOA 2XADA 3IQDB 1QE5A 2CFOA 4KQ2A 4ER5A 2Q4BA 4YAKA 1XFDA 3RSSA 5KHLB 1TC2A 3J7TA 4CTJA 2JIDA 5BWOA 3JYPA 4DW8A 3AL0C 1B8UA 4GP9A 4IGIA 3THRA 2WMNB 3PFWO 4R2KA 4ER0A 3NDPA 1VG8A 3M81A 5M5BA 4O2BB 4B3FX 2YJ5A 4QYSA 4BOYA 1H93A 4KL8S 3ZBQA 2DECA 2HI0A 1ZUNB 1W4CA 4HN2A 3QOXA 4TN5A 2YZ2A 4X8OA 4C6RA 3GJYA 4M1MA 5I7UA 3HACA 5K6RA 3JWEA 2B4TO 2Z58A 4ENUA 2XVYA 4MGKR 1UMBB 2ZP1A 5K1ZA 3RKRA 4EHFA 4XQGA 4XRRA 1PS9A 3C1OA 1MGOA 1GZ3A 2ZPUA 2E89A 1WDKA 3H1EA 3O83A 4ZAVA 5ALLA 3W4IA 3WGTA 3JVIA 3C16C 3PVSA 4MUHA 3TTWA 1O2DA 3OIGA 5KCZA 1WF6A 1BVYF 1KIMA 1NHWA 1AQUA 2A92A 4C21A 1LJ8A 2C7VA 3PNMA 1K7EB 2ZB3A 4OQLA 4URUR 4RH3A 3KLMX 5T4FA 4U00A 4Z9YA 4JS0A 1MAVA 3GRKA 1HYHA 1JHYA 3F6YA 3TSAA 4GWKA 5UKDA 2XDAA 1I33A 1GUFA 1KTVA 1OWLA 1V2HE 2CWDA 2BEVA 2W90A 4OHBA 3LD9A 3WRYC 3WRYA 1SBIA 1UP7A 4EHBA 1GKIA 3NYWA 2I4NA 5AM4A 4Z7OB 1NRWA 3BGOS 3M2TA 4HB4A 4UUMA 5C8XA 4QJ4A 5H9WA 1ORDA 1JIIA 1NBME 1ZHOA 2ERYA 3DBHA 3F74A 4OHOA 5BW5A 5CPFA 3NKVA 5DX1A 1JDSA 3LG2A 2XCRB 1I5RA 1A5SB 3GCWA 4K6FA 4LQLA 3FDJA 2UZIR 4B6JA 1NQAO 1NZJA 2DWPA 3D4NA 4IIBA 3QE9Y 4KDRA 4ZK2A 3I9LA 2ZIFA 1UC5B 4O4LB 1UMKA 2WBLC 1BVUA 1EPUA 2B35A 5EEGA 2HPVA 2PNFA 3NANA 1FNCA 3LU1A 5CX1B 1D4FA 1HDOA 3ZY2A 4BKPA 2PVSA 3D9QX 5IABA 3P9SA 3A2MA 2HYIC 2DU8A 3A1TA 4DCGA 2O8NA 2WVHA 2EAUA 5FO0A 4N8DA 5HILA 1PFVA 1P0FA 3Q0IA 4HI0E 2QD2A 4CKCB 2FW7A 5CEEA 3DV2A 3EDRA 4LNUB 1RYEA 1Z75A 3SMQA 3DE1X 3V42A 2BEJA 1U2GA 2JFWA 4INOA 4OSPA 3X44A 5A5GA 4D4IA 3KQMA 3GRFA 4F5DA 1Z37A 4FYVA 4NKRA 3WV5A 4KGDA 5HTKA 4DHEA 4NZPA 5CB8A 1NBMD 3BSFA 3CVJA 4M87A 3GP5A 1GPNA 2C7BA 4OKNA 4HGPA 1OI7A 2FG5A 2Q2QA 3NP9A 5C8YF 1F06A 2IXGA 4OY3A 3RC3A 5DGIA 3TLZA 3V2HA 5DHRA 1CR2A 1Z15A 3OCVA 3KWJA 1QX4A 5FR2A 5JFOA 4EY5A 2WJYA 1U2GC 3EDYA 4IIGA 4EECA 5ED4A 2ZJ7A 3GX1A 3ZU3A 4PWZA 5IFKA 3WBKA 3LNTA 3WIOA 4AP5A 4AYWA 2QBYB 4WUVA 2BTOA 3OF2A 3K8OE 3JYLA 1QP7A 4KWIA 4EX7A 3U44B 2IY7A 1E8DA 3IILA 4S1TA 3L6CA 1RR6A 1I6LA 2AFHE 3LYHA 1C3EA 2DLDA 3N7AA 3RU7A 3W5DA 4JFAA 3DP7A 4YUXA 2OBMA 2Y1LA 4P84A 3DT6A 2XF2A 4GU5A 4EHNA 3SLRA 4E14A 1G7CA 2PKCA 3S5JA 1PJ4A 1ADYA 4BNZA 3RYHA 5LYJA 1QH8A 1I7SB 2A9VA 1P0CA 2CNOA 3ZBUA 4ZZ0A 3WGNA 1AJEA 2GCNA 4P86A 1K92A 4ML3A 4O02B 4WFKA 3AHIA 3A1CA 1U9IC 2AYXA 3HYLA 1YMVA 3IVRA 3QKRB 3K9NA 4P31A 4V24A 1ACLA 3U9TA 2AJCA 5LKAA 3KBBA 4U7PB 5EC8A 2X2FA 2VHEA 4BNLA 4F45A 4DCNA 3I04A 3PC8C 4M1KA 2KI5A 4BNDB 4J2HA 3G3EA 3GQVA 3W3AD 1D7OA 2VTEA 4E31A 4GYJA 4ZYUA 3KPYA 3KG2A 5DNUA 5IJZA 5JIBA 2BKUA 4NICA 4QU0A 1XYYA 3RV3A 3LCJA 1ISJA 1NVKA 1Q44A 2OCLA 3A1SA 4ALIA 4LNHA 5DP1A 3IBFA 3FLMA 5BQPA 3QXSA 4BVLA 6REQB 1VYUA 1KSJA 2CJFA 1PJCA 2JGJA 1RWXA 2RKBA 4KYVA 3AJ8A 4Q3DA 4U2FA 5CVUA 5A6SB 3BM5A 3OX4A 621PA 4J1SA 2DXIA 5LQDA 4AG6A 3TM4A 4EB6A 3AY6A 4Q1DA 3ZV5A 1I1QB 1SUDA 3K0KA 1NNLA 2QN6A 3ZW9A 3WHIA 1VLQA 2IX9A 2Y76A 1X92A 4A6EA 1UMBA 2NUTB 4WKPA 1OTXA 2DBQA 3HYRA 6CHYA 3E9EA 2XTNA 1J23A 3CLSD 3KYBA 4M60A 4K7JA 2Z8ZA 1LPAB 2QTCA 3ISJA 4GI7A 4J8PA 1YRQA 2RI1A 4BO3A 4PYKA 3HMKA 4DMKA 1LI5A 2AW5A 4RZQA 1JSLA 4B5KA 5J9FA 3BXZA 1ZJZA 4K03A 3S40A 4OAOA 1CRQA 3QU9A 5FWDA 2Q0QA 1XQVA 3PE6A 2NGRA 1E3DA 3BF7A 4TLBA 4CPDA 1NM5A 2R1ZA 4BEVA 1MN6A 1QTRA 2IGTA 2H7CA 2PCJA 5BSVA 4YRQA 5JNWA 2J9XB 1XA0A 3DEFA 4TZTA 1WCIB 5CP8A 3TI9A 3RIEA 4II2A 5L95A 1IFXA 3KKNA 1XO1A 4QPDA 1KKMA 4FHEA 4MLZA 1UFVA 4MW7A 5F4ZA 1VKHA 3TUZC 2WUVA 3OE7A 4GRAA 3WDKA 2H07A 2FSGA 2QV0A 4H35A 4TVSA 3QVVA 2ESRA 1K0UA 3VGJA 3WRXC 4H3SA 1E6UA 3DE7X 5KVSA 1MPTA 2BEVB 1KMMA 2NT3A 5JSFA 1CIVA 1QTIA 3U7JA 4IHQA 2W0MA 1GZDA 1I2CA 1VJTA 2FVYA 3BQMB 3KSZO 5HW0A 1UPCA 1YZLA 4QBFA 3WKCA 3G8YA 2ECKA 3IMKA 1G291 5AI4A 5SZIA 1NBOA 1YSCA 2GCOB 4EYOA 2BSXA 4MITA 3AV0B 3CLUC 4ASUD 3WFZA 1MVNA 3A27A 1DAFA 1I94B 1EJ2A 3I09A 3SC6A 3GROA 1Z8DA 3JZIA 4R8LA 3TXAA 4BVGA 16PKA 3H86A 4L76A 4RESA 4E51A 2CMKA 1RWOA 1S2GA 3E8XA 4KQ9A 3NOQA 4I1VA 4O4JF 2IQIA 5C5CA 1OPRA 1IEWA 1SB9A 1U7ZA 4RIHA 3SLGA 4AWAA 4U7GA 1V47A 3BL5A 5AOCA 4L1KA 4NCKA 5ALYA 3ZIAA 1VL6A 4CKEA 1N2XA 5IFLA 3OLQA 1T1IA 3RVPA 5KBYA 3D0KA 3I9KA 4FFLA 1A8UA 4UM5A 2NZ8A 3MHPA 3DMGA 1ZH0A 2AKYA 4O2AA 1D1SA 3I2GA 4O4LF 5H0IA 4AMZA 5CEJA 2IEAA 1Z4LA 1IM2A 3Q5DA 4B80A 4XRGA 3C4JA 3WK7A 1W1UA 3ZC3A 3EOZA 4KRFA 3O3CA 3R7SA 2LCIA 1RQ2A 5L7TA 4BZPA 1EIZA 3LBNA 2CLHB 3A2NA 3E27A 1ML3A 4FYHA 4MUFA 4MWCA 3G2OA 3UENA 4CM6A 1TQ6A 1W2GA 2XVZA 5DI3B 5TPZD 3SQXA 5BWLA 2R5NA 4LMPA 1P9RA 2NZJA 2XUZA 3GRZA 4B3RB 1W8DA 2X5KO 3VVBA 2IXEA 4IJWA 3CZQA 1YA4A 2GO7A 4YRBA 3WMWA 3T5TA 4N48A 4JUCA 4GH5A 2OGZA 2GJSA 3DMTA 5F3DA 1BJKA 1KDVA 4TSKA 3SX4A 5JPCA 2MHCA 4W1QA 1U3CA 2IZOA 4YUAA 1WW2A 1Y4AE 4I9UA 4EY4A 4PGFA 1DBRA 3RT1A 4J2TA 1CSEE 3GAMA 3NW9A 3V97A 2JGMA 4N0EA 3BL8A 3TQQA 4CV3A 3P2EA 2GRAA 3LXUX 5KYGA 1RTTA 5IKOA 3H04A 4MWOA 3MWLA 4IR7A 3OJLA 4ENRA 4LVCA 5TMEA 3LWNA 4G0ZA 2X8JB 4NH4A 2JAHA 2Z2JA 1FYDA 1BIFA 5G4KB 2FF7A 2VOJA 4ZGBA 2LBPA 3V33A 4NBWA 2XMBA 5FUMA 2I76A 4EYKA 4GR9A 1RPAA 4RMNA 3GJTA 2V9CA 1MZPA 1GCAA 1WU8A 3OZSA 4IIVA 3GLVA 1JH8A 3OTGA 4N8SA 4RMGA 4W63A 1XTIA 2IGBA 5JFTA 2Z57A 5IBRA 1P39A 3I6IA 1DDOA 1WP4A 4YCBA 1TJ3A 2C57A 4UNIA 1AURA 3ZHYA 4MPDA 5E0KB 3PGKA 3M49A 3QLJA 3DCIA 2P4HX 2KYRA 1NURA 5F2EA 4M4SA 4JD5A 4KDCA 4D8YA 4KSCA 3H84A 4GLOA 4JI8B 3D2AA 2YN0A 3NVKI 2QRHA 4NH0A 4R1TA 4OREX 4R1SA 3F73A 2TECE 3LXMA 4L57A 3EVEA 4QRHA 4W7IA 1F20A 3SE7A 1XGKA 2ZWVA 2W8ZA 5EMLA 3VYVA 3MAGA 4UFPA 3OQBA 5LMCA 1Q17A 5HGJA 2C7RA 4MLPA 3WK6A 2IV2X 3RRZA 1FW8A 4BP3A 3IQHX 2NZWA 1U2QA 2YOGA</