3ZK9A

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 104
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A01
4WZBB 3AETA 1QGUB 2WI8A 5HX7A 5GGXA 3ZK9A 2YNMC 2PS0A 3AEUB 3AEUA 2OV1A 3LI2A 4M7OA 1QH8B 1QH8A 1QH1A 1KAHA 1M1YB 5M34A 1M1NA 4IRMA 5JG7A 2OSVA 1PQ4A 2ETVA 3R5SA 4WN9B 3LHSA 4MDYA 2XV1A 4XPIB 4MO9A 1K7SN 4MX8A 2XQVA 4N01A 5HDQA 4INOA 4NNPA 3ZKAA 5KHLB 4WNAB 1K0FA 4FKMA 3HH8A 3TEFA 3R5TA 3U7QB 4MLZA 4OXRA 1KARA 5BVHA 5BVGB 5BVGA 2PS3A 3HXPA 2RG7A 1G20B 5M29A 2Q8PA 4OXQA 3AETB 3K1AA 4INPA 1N4DA 4LJSA 4HMQA 3BE5A 3EIWA 2MINA 4LS3A 4HN9A 2R79A 4UDOA 5M3BA 3UJPA 5JOQA 5JPDA 2AFIB 4FNAA 2AFIA 2O1EA 2OGWA 4H0FA 4GICA 4OVKA 2PRSA 1QH1B 3MWFA 1M1NB 2OV3A 4PM4A 4UTOA 1N4AA 4B8YA 2YNMD 3AESA 5AFSA 2R7AA 3TNYA 4G09A 4WESB 1XVLA 4WESA 1ESZA 1KAEA 3EIXA 3ZK7A 4BBPA 3AEKA 1K75A 5B58T 1TOAA 3PDIA 4PAGA 4WZAA 3ZK8A 5FLYA 3NU1A 4ND8B 4ND8A 5CX1B 5CX1A 5BVHB 2Q8QA 2XY4A 4TKVA 3MFQA 1G21B 1G21A 3K1AB 4FILA 4G07A 2PHZA 1PSZA 2MINB 2XUZA 4UDNA 3BE6A 5I4KA 3PSHA 5CR9A 1K2VN 3AESB 5KOHA 5M2QA 3MD9A 4DBLE 1N2ZA 4HMOA 3AEKB 3ZTTA 3CX3A 3PDIB 2M6KA 1MIOA 2WHYA 4WZAB 5JJ5A 3G9QA 3AEQB 4WZBA 3AEQA 2QI9F 4FI3F 4TKUA 1QGUA 4TKUB 2XDQB 2XDQA 4TKVB 2PS9A 3PSAA 1EFDN 4UTPA 4CL2A 4HMPA 1M1YA 1M34B 1M34A 1N2CB 1N2CA 4NNOA 2AFHB 3MWGA 2AFHA 4WN9A 1FP4B 1FP4A 4XPIA 3MINB 2M6LA 3MINA 3HJTA 4K3VA 3AERB 3AERA 4WNAA 4H59A 5KOHB 2X4LA 1H1LB 1H1LA 5GGYA 3U7QA 3TLKA 1L5HB 2XH8A 1L5HA 5KOJB 5KOJA 1MIOB 1G20A 3GI1A
chains in the Genus database with same CATH superfamily
4EHIA 2GD0A 4OK3A 1GKLA 3AETA 2W98A 3GRVA 1Z68A 2VYQA 3B1XA 2EBWA 3HA7A 4WY2A 3WL5A 2BH2A 3ZGZA 5KNCD 2NYRA 3AFNA 4X7BA 4M9UA 2JAPA 5A4JA 3L8MA 1EK0A 1G41A 2FN3A 4Z2YA 5GIOE 1I3MA 3E9QA 3LNCA 5I5EA 3PD7A 3DPSA 3QLVC 2PYZA 1RYBA 1Z5NA 4P7BA 1S96A 3LQ4A 4QVKA 4OBXA 1E3WB 4BJHB 4EGAA 4KQIA 2V4UA 1E6LA 2BGMA 3V3TA 1DOAA 4BCCA 1V5IA 2B34A 2P1DA 3G9TA 1NUQA 3K1ZA 5E3HA 3P9QA 5KVCA 1K6XA 3M6FA 3NANA 1XZLA 1YFKA 4RV5A 3RS0A 1K9VF 1FYWA 2VDKB 2Q3CA 4RY0A 4WDQA 1CULC 1K63A 1PQYA 1NW8A 3E48A 4HMQA 4EJ6A 5A9RA 3L7OA 4F3RA 4GL4A 2OHHA 1QANA 4Z8YA 4BY9E 3OT5A 4DE5A 1FNMA 4Q9HA 4MLPA 1FXWA 1HZJA 4ZHSA 5A9SA 3THWB 3B2EA 5DNYB 1NAIA 1YZVA 1WM1A 1SKQA 3E9NA 3L8EA 1J0DA 1RWXA 2HREA 4HEA6 2X4IA 3I01A 3IULA 3HKCB 3P9PA 5TT1A 1EAYA 1UJ4A 2X9QA 4EFMA 3AU9A 3I0ZA 5FIUA 1TI7A 1QRUA 2IZ7A 3GB9A 1VLMA 4U7PB 1T6YA 1X80B 2NXNA 4ETNA 1LDMA 1V35A 3BMOA 2EXXA 3DBIA 3T7EA 3VR5H 4QU8A 4KE6A 1EUZA 5DHSA 3EX7C 1QVRA 3ZIAD 3V8VA 4UAJA 1UKAA 3TZLA 1F6WA 3ZH9B 4EHLA 1U28A 2VJBA 1NXWA 1BEEA 4PBRA 3QUCA 3MFYA 2WJWA 4II3A 4IQFA 4Q7LA 3G5UA 1G3UA 2F90A 4HX5A 1FP6A 1XEXB 4FGZA 2VHVA 2JRLA 5B6PA 3K8ZA 3FVRA 2GZ2A 2OPBA 3ABRB 3B3AA 3ESQA 1GUDA 5ALUA 4QT4A 2WYIA 2JLYA 3PJFA 3CW8X 5ARCA 2E37A 2YHSA 4N0MA 5L4LA 1WHTA 4HMOA 5AVOA 2CT8A 4WLUA 4K1LA 4D8UA 1QDUA 2PX8A 2XBLA 4OUKX 2FEKA 4R69A 4WCFB 1NJGA 1KS9A 1O6CA 3DHNA 2WHYA 4OJTA 3T5MA 4HC4A 4PE5B 3WIOA 4BXOA 2Q6IA 3SEZA 4URVR 3THYB 2UZ4A 5LA6F 3G9XA 5D7BA 3ELYA 4A1FA 2YH2A 1L7EA 1A0OA 3C5CA 3MEQA 1L5SA 4G4IA 4QL3A 5LMUB 3ZJVA 3W8FA 3V4RA 3CNOA 4FTWA 2DHCA 2GH1A 3C6BA 2YFKA 3Q5GA 3E9DA 2I2BA 4UM5A 5AJUA 3FVVA 3OEWA 4IHJB 5E4YA 4EB6A 1QIHA 2CJYA 2W4QA 4LQ4A 4E2XA 4EFLA 1WUIS 2PKQP 4H3KB 4F9EA 1FFYA 5JAIA 2CHEA 3UGTA 3O8CA 1J06A 2R7MA 3COSA 5FBKA 2EBHX 4J7XA 3T94A 4K28A 1XPRA 3AUFA 2V3VA 1JEJA 3QX8A 4J29A 1OX4B 2BM9A 1JDSA 3KKMA 4TV8A 4FZJA 4MV8A 1SEVA 1ACMA 1DJPA 4MK4A 5ALIA 4MGZR 5FBWB 1KK2A 1OZFA 1OOEA 1VG1A 3A4LA 2E5LB 2EZTA 1TGVA 2EYUA 3P71T 4Q03A 3LU1A 4TRRA 1UPUA 1ZM4A 4Z86A 1JKFA 2PANA 4DVJA 1NR7A 3PFGA 3QU5A 4YMWA 3SWWA 3VR6D 1RQRA 5DH9A 4QKQA 3ZZMA 2TMKA 1FNBA 1X19A 1N8SA 2D5LA 3LY9A 5F76A 1A4XA 5BOSA 3IAXA 1XJCA 3K5PA 4DJ5X 1AV7A 2FRDC 2V0CA 1EEXB 3LDUA 5ALEA 4EUFA 1JHAA 1L3IA 1HG1A 1MV5A 4AL4A 2ID7A 2ZVJA 5IN5A 2QPTA 2BTEA 3I72A 4R1OA 3PHIA 5ARBA 4YIHA 4P7GA 4RD0A 3D3WB 4C88A 1KEUA 1DEOA 1CUCA 4DV1B 1UBUS 4OBWA 4UNIA 3BHIA 4MKXA 2VK1A 2ZIAA 3KHUA 5F2NA 5IKPA 2ECPA 2J9FA 4UPEA 2ZJ7A 1EIWA 1IONA 2E5WA 1P7WA 2F3SA 3RQSA 2J5QA 4QYIB 5DNEA 4PQFA 4W6ZA 2O0KA 2AN1A 1UAGA 2OV3A 4QSMA 2FG7C 3AXTA 3WZ2A 5ALGA 4YAKA 4MHSA 1X7DA 3CE6A 3NM4A 1EE9A 1AQLA 3OF3A 3PEWA 3HSKA 3NT2A 4WESB 4JOCA 5FH9A 9ABPA 4MVJG 4HGYA 5KTRA 1RZ3A 4A5SA 4QUHA 1NT2A 4F21A 2AB0A 2CLEB 3O3NB 4QWWA 4LRSB 3HJHA 2XKAA 5GINE 1DB3A 2GZ3A 4FC7A 1FX1A 4LJLA 3H9GA 3TFOA 4DSAA 3VNVA 1NW7A 2DF8A 2J3IA 2JGLA 2REQB 2C5FA 3E2PA 3E84A 3REOA 5GONB 3V32A 1HFJA 4AUKA 3QUBA 3ETEA 1Z33A 4QBIA 3A31A 4L5YA 1LY1A 4I2VA 1SXIA 3TGLA 1K6MA 4U2GA 2VO1A 1ETHA 2WAYA 2Z9CA 3T1YB 3DPIA 3CN7A 4ARCA 4JXKA 4RD2A 4NPHA 4MIYA 1FSSA 2YZKA 4Q6BA 4FDUA 1PLJA 3UATA 2H4WA 4MTLA 4H1WA 1YHNA 4FFLA 3WWPA 3DB1A 3R8FA 3HTXA 3DE4X 4GMGA 1CB0A 2YVAA 2JLUA 1KVTA 1Q1AA 3MJRA 3ONNA 5DI9A 3JPYA 1PNRA 1KYTA 2YHBA 1BSVA 3ZCTA 3CLVA 2XQJA 3HV2A 2HBQA 3R7AA 4BNZA 3EFOA 3HEAA 1PJ4A 3T9CA 3CLTC 1F12A 2ENWA 3IOBA 4EDFA 1T9CA 3JZDA 4IKEA 3RT7A 3ZE0B 4MP6A 4BO2A 1O97D 4NG5A 1ZL2A 2QOEA 4GECA 1HX7A 3ZWKA 1C9YA 1ONNA 1XD8A 3BWXA 1G8YA 1BCSA 2AC2A 2P65A 2WJHA 2WKPA 3CLUD 2IU6A 3GGDA 3HU3A 5BOVA 3UCFA 2I3GA 4QGSA 2Q9AA 4GPEA 3PHLA 1GCAA 2PNFA 3I0NA 2Y0PA 4P58A 4QDXA 1VZ3A 3LBFA 4A2QA 4RDXA 1QC5B 1T5OA 4WN3A 3JATB 3CXRA 5K8VA 2K87A 5EIHA 1S3IA 2EKZA 5CLQA 5DMHA 4YWJA 2XYQA 1JW9B 3QBDA 3ZD9A 3ET5A 3VHQA 3PUZA 4JQCA 5JYCA 3QHPA 2QVBA 4PRLA 2QY6A 3QVGB 4YCMA 3AVOA 4LRXA 1R8JA 5AK0A 1FE8A 3VSBA 2O05A 4GZ5A 2HHHB 1Z6PA 2IRWA 4JJ6A 1R6BX 1JBKA 3NFYA 2CXNA 1H9CA 1EK2A 1ABFA 2OB1A 2VTDA 5T67A 3E15A 3ZU5A 2QVLA 1O6GA 3F47A 3FTNA 5IH3A 1FC0A 4LFAB 1E6EA 1VJTA 2NVOA 3D7NA 5B1EA 5I51A 2X4DA 3DXZA 4JIMA 1A88A 3A4MA 2Y1OA 3HBNA 2P9TA 1YF3A 2Q62A 4RS3A 4RTRA 2BRUA 1NMSA 4QQKA 1GEGA 2OENG 1CX9B 4WW0A 5BMVF 1W36C 4XIJA 3AR3A 2LGJA 3BRCA 3H2IA 4HZGA 1P9NA 3BSWA 4MO9A 5EWMA 5HF9A 4BO8A 3IEMA 4DBVO 2EF1A 2R1TB 1NSTA 2ZUBA 4PIPA 5JSKA 2O07A 4NFYA 3OC0A 1I14A 2Q0QA 1G0OA 3DVLA 4R05A 3TR0A 5LXTB 2ASVA 3CMCO 2C9YA 5KMGA 2ZSFA 3NALA 5LQRA 2G07A 5KQMA 2QMUA 2PLRA 3ZIUA 4ZYUA 4WKCA 4HLNA 5EA2A 1Y1RA 2WSLA 2R11A 2WPNA 2KE5A 2QGNA 4G56A 4DEYA 4HN9A 4YS6A 2OQRA 1DCMA 2G82A 1NPYA 1E89A 2I8CA 3MTEA 5C4IA 4P83A 3OCCA 3EIEA 2MU1A 1K08A 3WLAA 1A8UA 1P1IA 1YDFA 2GNAA 3PA8A 2Z6VA 5LDHA 3VNUA 2PXHA 1FTQA 1UK8A 4FMCF 4IOJA 4LYEA 3MRXA 3LMKA 1I1NA 1UM8A 1H5UA 1Y80A 2Q2OA 2QAGC 3LLVA 3HCRA 3PFIA 3PS9A 4IDPA 4KH0A 4W9RA 1M6EX 3GD7A 4Y1EA 3HXMA 5A7HA 1KBQA 2PGAA 1DFGA 3F2VA 9LDBA 5JTUA 3AK4A 4FSHA 1YNOA 3Q2KA 2QIOA 4CLXA 1NIJA 3PDJA 1EG7A 5CPBA 1UXIA 4KXXA 2VHXA 2O59A 3TX2A 2PZAA 1MT0A 2VN8A 4M6WB 5KDOA 3MW8A 5KJEA 2O4UX 1RWPA 1WU8A 1WZCA 2M98A 5BR1A 4AULA 2NT3A 3GGCA 2C5LA 5IDYA 3TTYA 2I6XA 3DXXA 3OJCA 5LR6A 3F6PA 2RSLA 5D5QA 2G88A 1T9GR 5ERXA 1SULA 4O2BA 1AQUA 2OZLA 4ZV4A 2VAVA 1Y5MA 3LDHA 3N75A 4TV9A 10MHA 2CZCA 5K4HA 1R9GA 4ZKEA 2BFDB 3U7EB 5ERGB 1EXVA 5AKEA 3DW3X 1GLNA 1RRGA 3LK6A 1YBAA 5K4AA 4ENPA 3RWBA 2HHJA 2GS9A 4XSHA 3HEMA 5CNJA 3LQ2A 4URHA 4NV3A 2IVFA 4GLOA 3A2LA 1RXSA 1N2GA 3IB3A 1HT0A 3V8NA 3CUTA 1FFEA 1JV2B 3EIHA 3H7AA 3QITA 4OQNA 3RC3A 4FDVA 4NYJQ 2I66A 2W6ZA 4RMNA 4HTAA 2QUBA 3Q3CA 4UTRA 3DMHA 5J2UA 5H4GA 2OBYA 4PLFA 5BN5A 4LHXA 4YYZA 4GI5A 3ROFA 4MW2A 1H1LA 1WW2A 2PGOA 2BFNA 2IYPA 4NECA 3ZXSA 4B44A 5BSFA 1MAWA 9GPBA 1W19A 3WADA 1XMSA 4TVSA 2GLXA 4MVXA 3UC5A 4LF9B 4D3DA 3C6KA 1JNYA 1XEAA 2NZYA 2QUKA 4RHYA 1K06A 1THTA 3H1BA 4NZNA 3M6AA 4DR2B 1RM0A 3RUHA 3OT4A 1L7BA 2C3MA 1QH8A 2ONYA 2AMJA 1P44A 4OXXA 1NQOA 4B81A 3KL4A 3DVAA 4F72A 1U3DA 2XT6A 2FEOA 5L51A 2HU2A 1ISSA 1E79A 4WK2B 2J9RA 1AQIA 3EQ6A 5DHUA 3RYFB 3G7NA 5FPQA 1EVLA 2PL9A 3NHRA 4FW9A 4ZDIA 4Y6PA 2EERA 1I0ZA 1TJNA 2D1FA 3F1KA 3R3VA 3O1IC 4KFSA 1QIGA 3AMVA 1JZTA 2QMQA 3DNMA 3QXSA 3AINA 2YXDA 4RJLA 3ZVKA 3A6ZA 1MG0A 2FQYA 2EW8A 5B1DA 1P2SA 1BGXT 5LLSA 1JDTA 2W8BA 3QI7A 1LK5A 2PUCA 1J25A 1SG6A 1Y3AA 1GZ3A 1YK0A 4LSMA 4NYMQ 3ILYA 3IMKA 4QXAA 1U0SY 1QK4A 2JJ1D 3V8MA 2CXSA 4MPJA 1F2DA 1EDEA 2AG8A 3TUJC 2PGLA 1U7HA 3A7DA 4B7AA 1Y7LA 3RPEA 1REQA 1W4CA 2XSZA 5H9WA 3PFHA 5LQDA 4INZA 3SKYA 1DS6A 3CQ9A 3H87A 4F93B 1VPEA 5IABA 2LVBA 4K9LA 4NK5A 3EVBA 1ZQ9A 1GTVA 521PA 2LD4A 3F96A 2HMUA 3OUUA 3S1SA 3VJRA 2HV8A 3GP3A 4UARA 5KC9A 1NVUQ 2UZ0A 3KOYA 3BL6A 2FGJA 2HUNA 4EI9A 5FBLB 5K6RA 4WAUA 1Y8ZA 3PIIA 1YD7A 4FC6A 1DO2A 1DUSA 3U3JA 3I9LA 1JFVA 5BV8A 2WFLB 4XARA 1PFUA 5CT5A 1JT9A 3W9BA 4IGKA 4TN1A 4KIGA 2WB4A 4FMPA 1GA4A 2CCJA 2WAMA 2CXHA 2MSDB 3GC6A 3C3EA 3VU8A 2GDJA 3OHMA 4TTAA 2J0UB 1NF3A 1X1CA 2E48A 5CITA 1KVQA 3LCCA 1Y9AA 4G1CA 5U4XA 4CQNA 1VE5A 3H8WA 3RLFA 1E0SA 2PRKA 2RHBA 3L49A 3QY0A 5DGCA 2IGTA 1YT5A 3EVNA 3H8JA 4KUEA 5T5QA 4E11A 2EZUA 5KSWB 1IUKA 3B5IA 5DTQA 1NF2A 2EGUA 2RGNC 2DUUA 5IJ9B 2Y2VA 3WMEA 1P4JA 3GNSA 2Y9PB 3PQCA 4G9BA 1S0UA 2DUJA 4LPKA 4Z7QB 2JLXA 4MV7A 2BDEA 3JRWA 4HDOB 2NO7A 3MCAA 4NENA 4M0EA 1NVFA 2R1VB 1G5QA 1JS1X 4J7UA 1JL3A 3WAGA 3GLFB 1AB6A 3M1YA 1X1QA 4MWEA 2QRQA 4YJ2F 4OB8A 2Q2VA 4MB6A 5LKRA 1JN0A 1AUPA 2WWHA 1YVDA 3KQHA 4D99A 2P8SA 4ACBA 4DW8A 4UDXX 1MW9X 2HWYA 2C99A 3EBPA 1JNXX 5AM1A 1Q0RA 2NZVG 1XXLA 1TM3E 2P78A 4M89A 4WACA 1Q0TA 2PSJA 3H13A 5H59A 4MGHA 3QIVA 5JW6A 1GG2A 2PK3A 1C4KA 3OZTA 4AF8A 5KOJB 2NG1A 5AVRA 2HYDA 4GYYA 1JQJC 4ZVUA 4BP8A 3K32A 2Z4SA 3TZHA 4OK6A 2ONCA 1MFPA 2AGVA 2PEZA 4GEGA 4R3UC 5JDCA 5JH7B 3ZHQA 1DWOA 1AQJA 1XMPA 4D3SA 1YCFA 3OX2A 2IZ6A 3TQHA 3PUWA 1Q2XA 4HYYA 2C2KA 1TC1A 5KWIA 4EG0A 1BMDA 1CY1A 5KNCA 1PFQA 2UXBB 3QKWA 3JRXA 3PVCA 4LDQA 4AJ2A 1PCXA 3R5KA 1OXSC 4YP1A 4PYRA 4UQLA 4A5OA 3GEBA 4JB3A 4DLVA 1I2DA 2HDNB 4Z51A 1ONBA 2OB2A 3DMTC 2B4QA 5BNZA 4ZHQB 2H5JA 4HPWA 5IXSA 3LOQA 1E2HA 1QVVA 4DQUA 2P27A 4Q4LA 3JQFC 3T1OA 5JZBA 3IKTA 3CRMA 3P8ZA 1DTSA 5E6RB 2QYOA 2VRCD 1S6YA 2JEOA 5AJHA 5LP6B 2WFZA 3P2JA 4LHEA 5CA1A 3QF7A 3L6RA 1HFKA 4PR0A 3GEMA 3WK4A 2MYPA 2FG6C 2FFRA 1C30B 3OMXA 4HS9A 4IP0A 4D98A 4DBZA 4QT0A 4FS8A 4JMPA 3HJAA 5CH5A 2C8KA 5FUMA 2XAUA 4KE7A 5HGXA 2EKBA 5AVJA 1TM7E 4MDHA 2W4IA 3ZOKA 2R0QC 1VIDA 3G6KA 3PI7A 2QTZA 1SU4A 3KWMA 2ZUEA 1H85A 3HCAA 4GAEA 3OO0A 4NQZA 3PJDA 1EX9A 4FZVA 1H2WA 3AI3A 2C96A 2FXIA 3M83A 2O52A 1J0BA 3DLPX 1FSFA 3REQB 2FP4A 1NVVR 1Z0JA 1RMYA 2YMMA 1ISIA 3D02A 4K9DA 3CUEF 1FUIA 2J0QA 1E5TA 3W7BA 3ACDA 1GZHB 1UIRA 3GDFA 1W0KD 4MVJF 2GI4A 4HXYA 3U13A 3KB8A 5JEEA 2VSFA 3I5MA 4CV1A 4DNXA 1TUEA 1NC1A 1IC6A 2BFMA 4U5XA 3ZIAA 1U9IA 3OO1A 2BGIA 3MGAA 4G23A 5P8WA 3M1IA 3PPWA 2JGMA 4BFTA 1ID8A 1TF5A 4EQZA 1FYFA 3OD1A 4DHWA 4EA6A 1E5VA 2I3DA 2V6IA 4TLMB 5CIQA 5AKLA 2QMOA 2DECA 4FJ1A 1M2EA 1VL8A 1O2DA 2YBEA 3GLTA 3S5JA 3LIPA 1N6HA 3CSSA 5I9BA 4KYUA 2QPAA 5D5PA 3T4UA 1WMAA 3A11A 3RI3A 2CLCX 2XMPA 5DP1A 3QPUA 4L73A 5DVZA 3GCWA 3OVMA 2BZ0A 1IEXA 4BNDB 1PL6A 4ZOAA 1ZMXA 4M1KA 3SIXA 4BHTA 4AY2A 1EFKA 2Q5FA 1T2FA 2X0RA 3X1DA 2J0VA 1D4ZA 1L6RA 3ZDAA 4L50A 3WO1A 5B7NA 2YJ6A 1TMKA 1RPNA 3RDPA 3B51X 2HJ9A 3PF8A 4CGYA 3PRJA 1ESDA 4BUZA 3V2HA 3RS9A 4FFDA 1OJ7A 2I78A 1LSOA 2X22A 2IELA 4G8DA 1NVXQ 3I8XA 3N3AC 3PNKA 4X7MA 1QDEA 2PGDA 5I9MA 1U2GA 2WYWA 4LI3X 4EZIA 3PNLA 4F45A 5CBPB 3WGGA 4GZLA 3V97A 4H08A 2WTNA 3CPJB 3OKPA 1Z6GA 2WC1A 4RE5A 3WMXA 3EC7A 3ANYB 4EZBA 1Z88A 3ROGA 4EYSA 1F20A 4B3CA 1Y48E 1O4WA 3JSAA 2PD6A 3U09A 1QYVA 4FMDB 4KI0A 4Q24A 1XXHE 3DE6X 3DL7A 6ADHA 2Q49A 3HDVA 2QMHA 1C4OA 3G0CA 3HYNA 5DIZA 2PG3A 2GOYA 1OFGA 2ECQA 3NWBA 3P20A 3UJCA 1D1PA 5DT2A 1DQYA 2G7ZA 1SUWA 1XCMA 2PFGA 4PTLA 3UXYA 2W2MA 3KPWA 4FONA 1XU4A 2YXEA 2HA0A 3KZVA 3CNBA 4C0SA 2CDRA 4JZKA 1PZGA 4EEZA 2L18A 3VR6A 1QO7A 5FI5A 2X7JA 1DBRA 3GPCA 3AFGA 3PKZA 3ZWAA 2CDNA 2EZ8A 2EHDA 3IS3A 4PX3A 4JV5B 1LEHA 2R68A 4BLWA 4G89A 5BVHA 1MX5A 2IYZA 3FPLA 3G79A 4O0MA 4G36A 5JD4A 1HF3A 3ICVA 5M29A 1DKLA 2XE6A 2VHWA 3RROA 3GJ7A 2QQEA 4R01A 1CVLA 1J2RA 1NBWB 1CUYA 3GUHA 4O8ZA 5FADA 3RLIA 5MGBA 3V4FA 2GJKA 3QPWA 1DIGA 1O8BA 4RC9A 1HORA 1X7ZB 4UTOA 1R5BA 5J47A 4XM2A 3RYCA 2YX1A 4G0MA 5EZYF 3N7UA 5FBQB 1AA9A 1YBMA 2X3FA 3F3YA 4S24A 1UIMA 4URWR 4CKYA 1B8NA 2XQIA 3E35A 2NP7A 5KNDH 3S1AB 1XRQA 5LQMA 2VZLA 4PYMA 1QYIA 3L9WA 1EHCA 1NXQA 4RV4A 3C3PA 2B4KA 4E09A 3JD1A 4EB3A 4BEJA 1WBBA 4TQUS 1N7GA 5HZHA 3G02A 4EX6A 4D44A 3INRA 1PV4A 4IJ5A 4R9NA 4XVQA 4ZO9A 4QOSA 1BDMA 2W90A 4UOZA 3UK2A 4M7RA 5H81A 3Q7QA 4CMEA 4HDSA 5ITVA 1D2NA 4GZMA 1W8IA 1LI5A 1YQWA 3MAJA 2ZJ8A 3TTSA 2A0WA 1RI1A 3C7CB 1M6VA 5FORA 5C8ZA 3N53A 4UBNA 1IY2A 2FOIA 2JCVA 3NGMA 1EWQA 2UZ1B 4ARAA 3DCYA 3M4JA 1Z8DA 4RIGA 3O73A 3SFZA 4QBTA 4B4WA 3PX2A 4BZQA 4DQ0A 1BJKA 1ZN8A 2A7XA 1MABA 3HFRA 4A8TA 4GBMA 2P0EA 5IC6A 3SLGA 3WNVA 4GWGA 2VQEB 3L5KA 5HEKA 2JCSA 1IZ7A 3B89A 4P82A 4Z8XA 4K6OA 1ORWA 4G9EA 1DGQA 3BXXA 2ATCA 1N2CB 2QUAA 1P8AA 3WL7A 3AHDA 1W30A 1KP9A 4XPIA 4YAFA 1CEYA 5EEHA 1LBSA 4DCMA 3N76A 1PNOA 2FHPA 1ZP6A 2G72A 4NCNA 4RMJA 1DZIA 1KMQA 1IOZA 2CV1A 1BMTA 1XG5A 2XKKA 3R7BA 1MA0A 1CHDA 5JFOA 1GU7A 4ZC8A 5ALNA 4DANA 2E21A 1ODKA 2G7MC 3JQAB 3AILA 1TK2A 3LFHA 4NE7A 4AN1A 5CAEA 4O4HA 4A4DA 2HBYA 1TVEA 1I4WA 5A7FA 5I9LA 3DAFA 1CJKC 1PUXA 2FF7A 3B5EA 3TSZA 1JAIA 2DCMA 2NVBA 5TMEA 2X42A 3EDYA 5CDGA 3IBSA 2ORIA 2MSCB 2ZWIA 2AG6A 3CEMA 3R0ZA 5AHKA 1NI4A 1CUFA 4CIXA 2PRJA 3AGPA 2JLRA 4N41A 1N92A 2XV1A 3IAHA 1CJBA 2NADA 3R7LA 2ODNA 3U3KA 2GGSA 4KMMA 4KMOA 4KV9A 2EW2A 1Q5PA 3CYFA 2OYCA 4DYHA 1QZXA 4EOGA 2EL7A 1XROA 4HWOA 4I4IA 4EM6A 3EUEA 1E1RD 3WQBA 5CRIA 2FUKA 3RNOA 3P94A 4CF7A 4IO1A 1TTHA 2FE4A 1O6FA 3L77A 4OHZA 1DSSG 1JFFA 3RJMA 3WP1B 3C7AA 3HCDA 1Q6YA 2H07A 4TUYB 4E88A 1YFJA 1U90A 5JANA 1EBBA 4TN5A 3EDQA 4G0XA 3P9ZA 2B69A 2AFIB 2I7CA 5BN4B 2JKYA 2PRSA 4HK4A 3TQTA 3R7WB 5LMZA 1SZPA 3V7NA 1UEIA 3ZLJA 3T9DA 2B4AA 4US1R 3NR2A 3H7IA 2ZJ1A 5J4HA 3TXAA 1NQWA 4ENUA 1GKIA 4QX6A 3TSAA 1RQLA 1PR0A 1CP2A 1MT3A 1OWLA 1R9NA 2BMDA 3BSSA 4MUKA 2RB4A 1ML3A 3A6PC 2QJOA 3OM9A 3RAEC 1YR6A 2Q4BA 5J1SB 2X9GA 3FNQA 2XZLA 1SBYA 3H2GA 2UUOA 2A9KA 2AYZA 3DZFA 3A6KA 3AVYA 4FP9A 3NEPX 2HPVA 1S9HA 1G9XA 3CX8A 3PXEA 5DZSA 3UT0A 4RPJA 3VMMA 3VM6A 3K6JA 1DRWA 1F48A 1XC7A 4I9UA 4ZYXA 5AW0A 3M1LA 3CZ5A 4ZOLA 2MINB 3DEHA 4I81A 3ELDA 4R41A 5FWXB 4LYJA 1C2YA 2YWRA 4B76A 3FRHA 3MTQA 3R8XA 2DEUA 1PJBA 4FGUA 4Q3EA 4BRUA 3RTBA 4CEIA 4RVHA 2XCQA 1WD5A 4FQ7A 4F3TA 4GC5A 3TCNA 2GBLC 5HRUA 3VTAA 2OY0A 1P81A 2H2DA 2TYSB 2QX7A 1IWOA 1T1SA 1H65A 1G8HA 4OQZA 1MA3A 2WWRA 5FEUA 2IWRA 4C04A 3ZNPA 5IZ4A 2GEVA 3AOEC 3WWOA 3EF1A 3C48A 3HG7A 421PA 1ONPA 4LDJA 1X3LA 4L9RA 4AP9A 1M67A 3GRYA 5KWSA 3ZU4A 5CVJA 1VLVA 1P6UA 2AW5A 1LPPA 3IE2A 3WK9A 1GU0A 1KI9A 2ORVA 3CHYA 3K2BA 2Y1XA 3SC2B 3I9JA 2FMXA 5KYUB 5F1YA 1CQZA 1ULZA 4ZCSA 4B35A 1I3CA 3AFOA 4WKBA 2XUKA 3GGOA 5BV7A 2IXBA 1YI8A 1ZH0A 4NOLA 1V8BA 2JKZA 4JR2A 2HX1A 4R2MA 3SS8A 2F8SA 2IYWA 3WV4A 4HP8A 5GIPE 2A92A 3T99A 3VPFA 2JGDB 2JFHA 4MULA 5FWDA 4XUGB 3IPXA 2AK2A 3E5HA 2HT6A 3LECA 2N46A 3NV9A 5KKAA 1AK1A 5HKBA 5K05A 2AQHA 2OQVA 5CXXA 1W7AA 3C7DB 5KSPA 1BWRA 3NHAA 4IXTA 5FOXA 1FVOA 4BDSA 1BEUB 1TDJA 4MINA 3DMDA 1EWTA 5CW1A 2QM0A 3IAEA 3M4YA 3U39A 2EG5A 2Q6LA 4OQFA 3THWA 2EWVA 2Q5JA 3T3OA 3TD6A 4C1NA 1IEWA 1HLDA 1RI4A 2HRBA 2W2OA 4MVJM 3PNMA 1T29A 3MS2A 1MO5A 2PUAA 5DSZA 3ZY3A 13PKA 4OU4A 4N6GA 3LD9A 1KYVA 4JBHA 1MJ5A 2D2FA 2J87A 2YWHA 3C3WA 5K0FA 3RGGA 5JNWA 3C3YA 1SIOA 3B60A 4DNQA 1IN1A 1X80A 2OESA 1N5MA 3AP3A 1BHQ1 3BIWA 3ODPA 4ZALA 2C4TA 2BFCB 3EBOA 3WY9A 1ZI9A 4G63A 1CUUA 2VHEA 1OH8A 3L1IA 2PXXA 4WQMA 4QATA 3CRRA 1V1JA 4MP3A 4JLMA 4NK4A 1QX3A 3RSZA 4DWJA 1VKOA 2NTYC 1OW3B 2H1HA 1KC1A 4D4IA 4KKXB 2JJ1A 5FTKA 3TX6A 4F96A 1LRJA 2H6EA 3HY6A 3T3PB 3HADA 2Q4OA 4XB1A 2HDHA 3MJHA 2BMJA 2ZRQA 4BDTA 1L4LA 3NTLA 3LBHA 4JGGA 4D2IA 5HF5A 4QUDA 1E3QA 5JARA 4LFBB 3DJFA 4WCFA 4DA6A 3FKQA 2G04A 3CRZA 3EQZA 4X24A 3NUGA 2FUEA 3P2MA 1GZ4A 1PYDA 3U5ZB 2JGKA 1RPZA 1CZUA 1ZBDA 2VNAA 3GPIA 4P86A 1MENA 2NN3C 2E4YA 3NBZC 3RU2A 2RGAA 3UAZA 3V4OA 1ZGJA 3AW8A 4GUAA 5G0VA 1HKHA 2RH8A 3MIZA 3WKDA 1CVIA 2H16A 4TMKA 1GKYA 4OX9Y 3BWYA 5HYVA 3KZ1E 5JQGF 3DP9A 1OTXA 3GH3A 4TOIA 4XWOA 4IHJA 5JAOA 1TO1E 1FQWA 1NOIA 3CB4A 3OA0A 1S5PA 5E7MA 4B4KA 4XQ9A 1YJQA 2CUNA 5M2QA 3PQEA 4QVIA 2VWHA 3QUQA 3TDKA 5BQ5A 2DZDA 2KSQA 5BSWA 3PC8A 2IC5A 1YQDA 5EZQA 3DD5A 2P4QA 2OUKA 2DFVA 1X9IA 3HKEB 3Q3HA 3H6KA 2WQ7A 1PG0A 3PI6A 1B4DA 1BDIA 3AC0A 5AVKA 1OX4A 1KS2A 1RD4A 4BKRA 1DXQA 2QMZA 2PUGA 4PANA 1DKRA 1SUFA 1Y8AA 2B4YA 2C59A 3EFEA 3L0ZA 3PQ2A 5CT4A 5G1OA 2G1JA 3RUEA 4EH1A 3ZKWA 4MW1A 1ML4A 5MN4A 3ENQA 3DE2X 3I12A 3PT9A 2ZZMA 3OQNA 1Y4DE 1H4VB 4M1MA 3D8RA 3R74A 1CQJB 1G21E 2FN4A 5E9AA 1C41A 2X13A 5AJWA 5G3ZA 4IJQA 5IK2D 5DBIA 2WD7B 2BN4A 3ORQA 3U26A 1T2AA 3W7VA 4YGYA 1NI5A 1GU1A 2DRIA 2VWQA 3WE7A 5BURA 3U4MA 4N3NA 2W70A 5TGZA 1IHXA 5DLEA 1PHPA 4YR9A 1UBEA 1VBFA 1XVIA 3AV3A 4ZMRA 2FW1A 2G09A 2V3CC 3T3HA 3OLVA 4M37A 3IL2A 2JFVA 5I7SA 3FWHA 1JA1A 3AEUA 4D9IA 2J85A 3MILA 4XH9B 1T4MA 1AMNA 1FDUA 3NRBA 1E4OA 1TRKA 2Q5OA 1T15A 1L5NA 1Z73A 4NR0A 2O2ZA 4UJ3A 5BO5A 2VZ8A 3DV2A 3TM5A 3PF9A 3JAKB 3TMYA 3P2EA 5FL7D 5CDSA 3THOA 2GPBA 1SEPA 3ZHBA 2W6CX 1S3SA 3KLOA 3Q2IA 2GK6A 1ZSYA 3LX5A 1DJQA 1R0XA 1YZUA 3WGOA 2V3WA 3K73O 3BHNA 4MIKA 2PH5A 4LYAA 5IKXA 1PD0A 4I6JA 2X58A 3SX2A 3C5WP 4MR8A 4TTTS 3ZY2A 4L5CA 1E1DA 3QKIA 4JELA 4UCFA 2HV9A 5A4FS 2D5IA 4P1ZA 2REQA 1XHFA 2WTMA 1LNQA 1H0HA 1QHYA 3IDZA 2DUMA 4RLQA 3EXHA 4F3KA 1CJMA 1Z12A 3UHAA 1GLVA 2HD4A 4OXKA 2H1WA 3ZV3A 3VYTB 3GN2A 3U9SA 4GRAA 3G68A 2OV8A 3AJDA 3BD8A 7GPBA 3MJFA 1CRWG 3OH8A 5EI5A 2JPDA 4HNGA 1KI3A 2C9OA 3N58A 3V1LA 4WBNF 4DV2B 1E5LA 1W5FA 3QBEA 2W2XA 4B2PA 2H4XA 1GL3A 4YT8A 1Y6JA 3IR6A 1Q44A 2M2IA 1CFJA 5JQWA 4OJYA 1QRRA 1NR1A 4ODIA 3I28A 4WV3A 3ANSA 1HPLA 4AWBA 1SUIA 3T9AA 1DU4A 4MQBA 4EEKA 2X2OA 4IH1A 1PDVA 3WG9A 6REQB 5AQ1A 1DJMA 3VH2A 1WQ1R 1CR6A 4R0VA 3P9IA 2COKA 3GYBA 1QCYA 2XECA 4P3NA 4PNZA 1WWKA 4KXVA 4RIHA 1E0KA 1J7KA 5EYPB 2KI5A 1W0KA 4P4TA 2J8ZA 3G2IA 1NHGA 3I4FA 4BMCA 3B9QA 2RKBA 4DZZA 1KH3A 1LI4A 1XZNA 4GF5A 3WGNA 3AI7A 2C8VA 2PWAA 1RXEA 4JEHA 5EIBD 1QC5A 3GJZA 4D96A 1J09A 2BC9A 2C95A 2DTEA 3KPVA 4OJKA 4QJ5A 3STXA 1NKVA 1G3RA 4G1BA 5HKLA 2IQIA 3JQAD 5C5DA 5BSMA 5CB6A 3VKHA 4UEQA 1NJ2A 2ZWAA 5D3QA 1CEXA 3NVDA 2G5GX 4P4LA 4TLDA 2WG1A 4G0UA 2I5PO 5JRJA 2ZJOA 5LYJB 4D56A 3AEQB 1ZIDA 3F6CA 2V97A 3P5SA 4IF6A 3DVRX 3RIEA 3SQNA 3IESA 1NG9A 4NXMB 2NP6A 3S29A 2J7PD 3N2YA 2DR2A 1U4SA 3IBTA 4XM1A 1KWGA 3OESA 3VUFA 1TTQB 2QNBA 5HTKA 4DIDA 2R4QA 4B3GA 3AY7A 4XCXA 2P2LA 4EO9A 4CL2A 4D92A 2O8FA 2W71A 3VPXA 3QV1A 2GM9A 5B3KA 2JLWA 3LT1A 3KZOA 1SU8A 1P1JA 1C1XB 5IH7A 4I08A 1QG4A 3I76A 2R1TA 4DCCA 1W2GA 1FBTA 4H59A 2FRVA 4KNVA 1TAHA 5J4KA 2Q3EA 3QKTA 4FYYA 4FZ3A 1YZNA 2X8BA 1KY4A 2CNDA 1JLHA 3IJ5A 3ISJA 1L3CA 3RTAA 1WY5A 3MF4A 5AUOB 1GG9A 1G18A 4LK2A 1UFKA 1MX9A 1RAGA 3UJBA 3MGGA 1RHUA 3BGWA 3KD3A 3TR5A 1QMGA 3VJLA 4P4NA 5IYZA 5FI1B 1TW2A 1T3TA 1UBHS 4LHYA 5DCLA 1KAHA 5FI3A 1WQ3A 2GVNA 2C0QA 4PZ0A 1QYDA 2FB9A 2Z5VA 4PCAA 1SVLA 1J0XO 2FLWA 2JG3A 1MNQA 2WJGA 5C34B 2V59A 3A9CA 1ES9A 1ZOIA 4H6VA 4UZFA 3CX7A 1OAKA 1VZ2A 4EHBA 3GAZA 8AT1A 2X4GA 5JO0A 2ECFA 1B73A 4V0MA 3T3IA 4XJTA 3AY0A 3HY4A 1IJBA 4M6WA 1EDOA 3JV7A 4MOWA 4I1OA 3RSGA 1T8PA 3KEFA 2NU6B 1WOYA 1V5WA 4IEEA 3K94A 4YV0A 4KDEA 3AVXA 3GAMA 2FY8A 2HDWA 4JYCA 1LJUA 1PFWA 2HB6A 2GN2A 1JXQA 4LHZA 2O5EA 3KQPA 2PWYA 4X95A 3PUYA 3PGKA 5FUVA 4ZEMA 2BFDA 2QDXA 4D8WA 4NHOA 1C3OA 5B58T 1JAYA 4OQXA 4TKMA 4G5RA 1UMCB 1SR8A 3JQ6A 1XCPA 3MCWA 2DT8A 3KTAB 1Z62A 5CXUA 1NY6A 1SCQA 1Y3HA 4OP2A 1Z0FA 3QPAA 5DX8A 1Q84A 4J91A 3BFKA 5K3AA 5A0VA 3K2QA 2VRNA 3NDIA 1SQ5A 4DM3A 5LVAA 5DYYA 1FU7A 4D82A 4EIWA 1A4IA 4YRFA 1W0CA 1PSZA 4YMIA 4HOYA 5GAJA 2OCBA 1T3LA 4OKSA 1KEEA 1EGVB 1AS0A 3A3KA 1NVMB 1P9RA 5A2GA 1PQUA 1ZK4A 4QHYA 3R2JA 3SSOA 4PS0A 3FROA 5KPJA 3WDKA 1YHYA 4PZUA 4XGIA 4Y9UA 3HMQA 1S4MA 4E33A 1V96A 3H8SA 4YJFA 3DM5A 2C82A 3JQRA 4NOKA 3FF4A 1H0SA 1WEKA 3GJSA 2ASEA 3U7GA 3O4VA 1N9GB 3MTAA 3E18A 4F2HA 5HIKA 4N49A 4F4IA 1OLOA 3ZHVA 1JQEA 3O5AA 3M6XA 3HL0A 3ORRA 1ECGA 3L84A 4HH4A 1ADBA 1T3HA 2MMGA 1UCFA 3D8SA 2BFFB 1XRNA 4FMBB 4X6YA 1R64A 4GVXA 3LRXA 1YVUA 4UXJA 4WOCA 3U4GA 1WVMA 4KLNA 3WLEA 3UA4A 2VLIA 3UTDA 2VJMA 5IBCA 3DBVO 4HTFB 3LW7A 1P0PA 4KN5A 4OXIA 1N8KA 5FLKA 5KTMA 2QN1A 1POXA 5EXDA 2C7QA 3ZE1B 3HYTA 1X2EA 1RHKA 2DR0A 1UDXA 4MYRA 2XUFA 4HYTA 5ENZA 3STUA 5IAOA 2W4MA 1UL1X 4ENVA 4DQXA 3WWZA 1M3SA 2P5TB 1I24A 1H3FA 3ES9A 2PXAA 4Q3NA 1KNQA 3RH0A 3HDJA 4WJLA 4EJFA 3GP8A 2O54A 2JJYA 2Y93A 3F1LA 1AIPA 3BMXA 4UUPA 1IQ0A 4MI6A 1A9PA 4H6WA 5IT5A 4Y2XA 4WMLA 1A69A 4X8OA 3OZFA 3EB9A 1IZZA 1VJDA 3LT2A 3LI2A 3EUFA 4HWSA 4KAFA 2MSWA 2FEXA 1BHJA 2HCFA 4YLEA 1R15A 3FCYA 4BO6A 2I03A 4J6FA 4BQNA 3HB9A 1KMMA 1ZVKA 4LSWA 1UF9A 3SDZA 1PQ4A 1MH9A 2E18A 3E7XA 4TS4A 2VG8A 1VE1A 1KI7A 2BLNA 3P97A 3QU7A 2XQVA 1U2PA 1Y81A 2C5SA 1IFXA 1SQGA 2W83A 4JOQA 1GD1O 2OCKA 4LWZA 3NUQA 3DL2A 1DIHA 2IEAA 2JVJA 4DQVA 4CEJA 3TJZA 1V37A 3IBFA 1T0JB 2OK7A 4K9SA 1ISGA 1VE7A 1R12A 1CPYA 3ZTYA 4AT1A 2JCYA 4J1SA 3RFFA 4JL6A 4YROA 4QPJC 2IBMA 5DASA 4EYQA 5JPDA 2JFYA 2JIDA 3ELUA 3OJWA 3DVQX 1NBAA 2HJHA 4AJEA 2BEVA 2MYUA 4YFYA 4Z0NA 3RVNA 2B3DA 2J0UA 1OGYA 3HS3A 4E5NA 3FHCB 2HRRA 4MWZA 1G5PA 3SN6A 2B5OA 1UPAA 2C20A 2MSKA 4L0DA 3RRNA 3SYRA 4N76A 1IRIA 1D5CA 1H94A 1XVLA 2C3UA 2Z83A 3MJDA 4Z9FA 3FSGD 2FSVA 5IBQA 3IMCA 3VPGA 3KR2A 2M9MA 3DKKA 5IJ9A 1ZVJA 2SCUB 1SUCA 3BRSA 3L92A 2Z09A 1N2SA 2HH9A 3S99A 4X1YA 4BNTA 1A7JA 5LUAA 1IHDA 1NNSA 2QW8A 5KU1A 3I73A 4Q3LA 3BGOS 1AUXA 3H97A 1OGJA 1AO3A 2IJGX 3MB8A 1NFFA 3GQBA 3PZBA 1SZCA 1L5VA 2I34A 2RJOA 2XDYA 2XYHA 2NQ8A 4LQLA 3UUEA 4W5OA 1MHTA 3D6VA 1V43A 2IZ1A 3A36A 3EGWA 1NATA 4ONEA 2W2LD 4G1FA 1EBFA 2JHPA 1IQRA 1LC0A 4Y2GA 1WUTA 3CF6R 3NC1C 5H02A 3QSYA 3EH1A 3QGMA 4R8SA 3PHBE 3OJEA 1A5BB 1Z9BA 3OQJA 1AGRA 1LBQA 2HY7A 2ZQ5A 4KBGA 1Z63A 2AJTA 2VHUA 3VV3A 2JGIA 1KYYA 3C3KA 1XLTA 3GZ4A 4I1YA 3ND9A 3TL3A 1QGDA 3N0XA 1JG7A 5HMMA 3VU1A 4JUAA 1P5HA 3E1GA 3PUJA 1H1TA 3URMA 3HP1A 4DLZA 1NUAA 2BR5A 4YRBA 2PSDA 1VPTA 2FXVA 3C6QA 3WP0A 1P7VA 1GUAA 3GZNB 4JNKA 4UUQA 4EZEA 1ZD1A 1ZMTA 2BZGA 3G8AA 1HLFA 1C3JA 1GZDA 1TE2A 1XQWA 2SBTA 1XYYA 5L95A 3INYA 4I50A 5TDHA 1D2GA 1LQUA 5TEVA 2XDWA 3R1IA 1NWCA 1S3FA 2XTMA 3LPMA 4PZCA 4WERA 5IF3A 1ZR4A 3I92A 2O8NA 3U3MA 1KFKB 1FFDA 1FLAA 1MIHA 3CB2A 4Q21A 4UVEA 2QAIA 2HWXA 1AQ6A 3HVIA 3JVEA 3U44B 5AUPB 2RBEA 2W48A 1OASA 4I36A 1TJ4A 3T9BA 4YRAA 2IT1A 4IZHA 4QUIA 2WI8A 1GA1A 1HOTA 1Z22A 3GCXA 4M1TA 4O4IA 4QDOA 1USKA 2Q3DA 1RQ7A 2ADFA 4HEHA 1HDCA 2JIOA 4KR0A 3S44A 1XKLA 5M34A 2OBBA 2PGJA 3CZMA 4LQCA 2WY2D 3UMGA 2OCGA 5I4BA 5K3OA 4V1CI 1WCYA 4B8WA 3ZDBA 2PX5A 4Q9NA 4WHMA 4YCBA 2QTFA 1PKEA 2I4OA 4NNPA 4Q34A 2IZ5A 3ZHZA 4RO0A 4ZOEA 4JI7B 3ZGNA 1OC4A 5I4CA 1M74A 3LG2A 1CUDA 4ZGBA 2ZWVA 4HJXA 2FR0A 1ZM7A 1WXIA 3MCVA 3BA1A 3ZZTA 2O20A 2RK3A 2AQ8A 1XPOA 4HLUC 1UOPA 5BVGB 5DTEA 5I01A 2Z2IA 1LV8A 3JQ9C 2FMHA 4RUKA 3SX0A 2ZREA 2B99A 3EIWA 1HFEL 4GYKA 4IDEA 1R16A 3BE8A 2XLCA 4IJMA 4M1ZA 4RH1A 4WVLA 2HA7A 4I19A 4O29A 2XLBA 4TS3A 5LDGA 3RVMA 1CNEA 1U1EA 2R5NA 3QHQA 4IDBA 4IW3B 4Y30A 3NAQA 4WE3A 2QW1A 4HDKB 2IV2X 4F3YA 2XF2A 4M7WA 3BG5A 1HC7A 1ODLA 2VTKA 2H52A 1KO8A 1ECBA 4PNHA 4EJ2A 3TNYA 1VMIA 4R16A 2HJVA 4EL5A 1N33B 1SNYA 2PAFA 3CF2A 1Y1KE 4LX0A 1WR8A 2GXQA 5A6VA 1ILWA 1DOZA 2VF7A 4OP3A 2H85A 1H2AS 1U0OC 3AIOA 3L7IA 3S8YA 1OILA 1AK9A 1NVBA 2FJ0A 3A4NA 3GNTA 3BXOA 3ABSB 1OBVA 3R3JA 4IIUA 3DUWA 3VR1A 1LDEA 1HQDA 5HHTA 1W2WB 4JP2A 1JDBB 2REOA 5LQAA 3BIOA 3L0CA 2DPMA 5LUBA 2RONA 2PZMA 5F5LA 4Z9BA 1ACLA 1RT9A 2NPFA 4QELA 1ZWKA 1WDKA 4RANA 4BFUA 3GT7A 4TTIA 1BXGA 3ETHA 2QL5A 3FCSB 1NV9A 3CVUA 3JQQA 4QASA 5HK8A 5I7RA 5C35A 2ZU0C 4QBHA 1RFLA 2WZCA 3OPXA 1A77A 1U81A 1YIDA 2O57A 1N2ZA 3FI0A 3V2IA 2V4ZA 4QUAA 4XWGA 1U2EA 2BMFA 1QM5A 1B2RA 4TVKA 3HYLA 2XB8A 1VL2A 2A9JA 5SY6A 3LBAA 4KH1A 2FX5A 2QJRA 5JVDA 3CKLA 1VIYA 1MJGA 5DSXA 4FI3F 2H9AA 2VPQA 2A94A 3EXG1 3EXG2 1DP4A 1G59A 1UWLA 5EKTA 4B32A 4LOKA 1TM5E 4YASA 4EJSA 2L42A 1NU6A 3KUCA 2G6TA 1YFLA 8MHTA 1JBQA 1X8LA 4RM2A 4UOQA 3UHFA 1XP5A 4ZVKA 4XFJA 2NUTA 4WGGA 4I50B 3TZQA 1YVPA 5T4EA 1HUQA 5HJ5A 1ZNXA 1U1IA 1IVNA 1QCDA 2P5UA 2AFHA 3ZGOA 2IA5A 4CM4B 1KR5A 4MUMA 1JQKA 1QIIA 2OV6A 3K70C 4JU8A 3ILVA 1DJOA 4XTCS 3AKZA 1G6OA 2BR3A 1A9YA 3ASUA 3NO4A 3LE8A 1IB0A 1V26A 2WVHA 3NHKA 4CI9A 5C8DA 5IK2A 2OEPA 2XCTB 2K2WA 2ZRHA 1GPDG 1U6IA 4NV0A 3PC6A 1F3OA 4Y67A 1SMKA 3O1JC 1H6CA 4FBMA 1DAEA 2X0JA 1ZUD1 3A1TA 5DJ5A 4DLLA 1L5FA 2Y1FA 4DQLA 3N1UA 3FPHA 1VP3A 4MNTA 2OO3A 5T4BA 2P6PA 3GRAA 4W8OA 5C7LO 1U02A 2B9VA 4HCJA 4ENQA 4RA6B 1TFUA 5BWMA 2ZU6A 4Q1DA 1E1MA 3HHEA 2VC2B 4D0RA 4JCOA 5TNXA 4G41A 2V7TA 3VDQA 1UBSB 3HBAA 2DHQA 4GX1A 4IGIA 4IIDA 3SHVA 3H2ZA 1TD1A 2LBPA 3IQEA 5LB4A 2WD9A 4L4UA 4RLHA 5FL7A 2I6UA 1JFRA 3ZDYB 4ESEA 4YXFA 1YAHA 1NLZA 4PZAA 1NASA 1JLRA 4XJVA 1I10A 3CLRD 1YC2A 2GBCA 3K09A 1HRDA 3LGSA 4H3HB 4C2TA 4FU0A 3GX1A 3G8CA 2YHUA 4XQCA 2QN6A 2PD4A 3CO0S 2F8LA 3TOSA 3ZYZA 5LBTA 1NRXA 1KYQA 3H9CA 5D3MB 1FJXA 2R79A 1NXPA 3QJYA 4G5YA 4UU0A 5BYAA 1RJDA 4QOGA 1SUPA 2QF7A 5JO9A 2A9PA 3DXFA 4ZYVA 5LOVF 3A1VA 2YIVX 4C0XA 4L78A 1E69A 5MN5A 3LUHA 1QWSA 5IVHA 2Z6UA 2VRBA 3VISA 1EX1A 1CDDA 1J70A 2QM7A 2W11A 1V1MB 4KO4S 4NWIA 4DC0A 3WNBA 2A9VA 4X64B 4EENA 3IAS1 1GZUA 3NIGB 4XYEA 3O4HA 3ZE6A 1IM8A 2UZ1A 3QG1A 2TECE 2CB9A 3BH7A 3H3XA 3ZDCA 2A0YA 2YVLA 3N70A 4W1RA 3N07A 3Q6NA 1I8TA 4Q5IA 4WRRA 3THXB 1Y42X 1WRBA 1CF9A 2XCUA 3OEED 5BSHA 5HJ7A 5GWXA 2B25A 5K3FA 2NVUB 3QW2A 5DM0A 4TGLA 1MQ8B 5J4YA 2CHQA 4OHUA 1YDGA 4ZK2A 4B6QA 4Q4JB 2HSEA 3N39C 3KOMA 4LTMA 1TGYA 2UYCA 3R3XA 5FDFA 2XVXA 1NUPA 3NJRA 1BQEA 1J33A 3BFXA 4QG3A 1TL7C 5A4MS 4MGIR 3WNCA 1CF2O 2BM1A 2VA9A 2VT2A 3OQIB 2PX3A 2MYNA 3DO6A 3SQMA 5ADVA 4B80A 1PX2A 3WKAA 2A4MA 3PGVA 1I4TD 1UEJA 2JCBA 3EGXA 5FFFA 3AEKB 5CJJA 5LC1A 3W2IA 8ABPA 2FEAA 2PXCA 2XIJA 3JQAA 4DKXA 4F6RB 1WNFA 4L4YA 3G1TA 1XF9A 1KMIY 3FI9A 4IIEA 5AJXA 3W5SA 2OFPA 2QU8A 1R4NA 4RCYA 1O0CA 3ORHA 4BAZA 4RW0A 1TEZA 4KXQA 3L2OB 1YMQA 5BW4A 4CF3A 1GGFA 3TSWA 3ZVRA 4AP6A 1Y63A 4WNIA 4PQGA 2J7PA 3GARA 1XVAA 2RHHA 4W63A 1B6GA 3OCWA 4BU0A 2XX3A 1SCUB 2EP5A 3L9XA 1TYCA 1VGQA 3AB7A 3B8EA 1NOKA 1ZJ6A 4IDNA 3LCVB 3FLEA 5D85A 3OKCA 3R7SA 2PH7A 3ZTWA 1DWPA 3SJBA 4QEDA 2TS1A 1FS5A 3JQ8B 3WMRA 3COYA 3B78A 1PD1A 3IP5A 3PVZA 4DCTA 3IVXA 3G2OA 4G86A 2J5BA 2JHCA 3P19A 3FXAA 4N03A 3H11B 2R7NA 3QU2A 2HF7A 3QA9A 4MYDA 1BGVA 1JTVA 1VJCA 3QP9A 2R1ZA 4TUYA 5CH8A 1N77A 4KVGA 3L7AA 4IIYA 2Z3WA 5C32A 1FUEA 3SM9A 3VKGA 2LDXA 1RYZA 1L4KA 5CHEA 3JAWA 5ESXA 3VKUA 2Q1UA 3QUTA 2VP6A 4NL4H 3B7WA 5AUQA 2JLVA 4IFBA 4KIWA 4N8SA 3R7WA 1Q0HA 4WZAE 3EEQA 4R8MA 3QYFA 2ZS8A 2ATIA 2ZWMA 1QO0D 3M6MD 3ANXA 1NBIA 4GZ6A 1G8KA 1M1XB 1DAFA 4HAVA 4MAAA 1ITZA 1UC8A 1UJMA 4PO8A 4FYJA 5E7JA 2I7TA 4GX5A 1BVHA 4W5QA 4E5KA 1XTTA 1LLQA 4DV6B 4EUSA 2FPWA 1F2TB 3OX4A 3SS9X 4BEWA 5LB2A 4KQJA 4S3MA 2P9QA 1LLFA 3M6WA 4JLDA 1K8QA 4OQ4A 2Q3JA 3PLNA 4X92A 1B3RA 4ER3A 3QYAA 3M3DA 1KRWA 1R00A 4AB1A 3WX0A 3DJYA 2POCA 2ZRJA 2AOWA 1CIPA 4YECA 2OUIA 1JE1A 2DPLA 2MINA 3NGXA 4QNNA 2YYSA 2ZEJA 4LCJA 1Y1PA 3BN3A 1UT8A 4JB8A 4UE6A 3B1KA 1F8YA 1SHZA 2IKSA 5IZCA 4HB0A 3HR4A 1FXSA 1E3IA 4Q7EA 1P3Y1 1S4QA 1ZCFA 3NNDA 4X71A 5LQUA 3AJEA 4HSEA 4H35A 1ARZA 2DPGA 3GL9A 4G25A 2BHRA 1NYRA 3SOZA 4A10A 2H48A 4MKFA 1X1BA 2A5YB 1WBJB 4G65A 1SKMA 1P1CA 5I48A 3FFWA 2NU8B 4FHGA 1PE0A 1Z13A 1YZYA 4M21A 5JFGA 4JLPA 2EDAA 3QKRB 4PHFA 4AZVA 3KELA 4NHEA 1TJ3A 1GPYA 2YZNA 3QBTA 3OZVA 2VP2A 4RPHA 2ZPUA 4GC9A 4YR7A 2DKNA 1VJ0A 5EHXA 1US8B 3AHJA 1I2AA 3D1LA 5IAGA 2Y2UA 4CODB 2R7LA 3VDMA 3JVIA 1R50A 2ZPTX 4HUQB 3KB6A 2YYAA 3T61A 2AIRA 1R88A 4EHJA 4S35A 2QX9A 4ME6A 4C6TB 2E5FA 1T8TA 4RADA 1MAVA 4IOLA 2JGDA 3HNRA 2JJ8A 4RQBA 2FSGA 1EQUA 2YWBA 3F7TA 3I04A 3JQCA 4JBLA 2NSHA 2Q8NA 1KEWA 3V7FA 3CE9A 1W581 3B20A 4HVAA 3HL4A 5AVQA 5EJMA 4TKVB 1N5KA 1MQAA 3SLKA 3N8HA 4MRMB 1JYFA 3OZCA 5CA0B 2ZQZA 1CY2A 3IAM1 3VHRA 3NW9A 4HMPA 1VMKA 2RAPA 4KOEC 1N0UA 1XE3A 2IHVA 4NZPA 5CJ2A 3VTFA 1TK3A 4JJZA 2QT1A 1N6KA 1R6DA 3SQOA 3FSEA 3CLSD 4REMA 4GFDA 4WLEA 4A2WA 4BUJA 3RD5A 1VSTA 3M2TA 2D5AA 3AERB 3Q1KA 1HDRA 2I76A 1ABEA 1OZGA 3IP7A 2CXOA 3NBAA 2IF0A 3TNJA 1PFYA 3K1YA 4FWIB 3TN7A 1LXCA 3U7FB 1UFOA 1XMIA 4DMLA 1A7KA 5K3SA 3DDZX 1X7XB 5ALSA 4ZI2A 3KVRA 3PXAA 4JBGA 5DSTA 2ZYIA 1UK6A 4LRTB 1WX1A 1X86B 1OJLA 1IIRA 3NKLA 3ICOA 4RTLA 1X39A 2VDMB 1IZ0A 3GT0A 1EVIA 4I1IA 4L8LA 1UJ5A 2NO5A 5KJFA 3PX7A 1BN6A 1RCTE 4RNCA 1CR2A 2LNDA 1E2FA 1HKUA 4MR7A 5HOEA 1OBHA 2OORC 2YV3A 1IATA 4Q01A 2O6LA 4L9AA 4E7PA 4EGJA 3QJGA 3ZGYA 3G13A 5CTJA 3T52A 3HSYA 4I9HA 1E7YA 2EJCA 5TS3A 5KYXB 1XHEA 4WEQA 2HPHA 1AKQA 4HGZA 1PEYA 1O1YA 2KBFA 5IUJC 1E6UA 4OGLA 2X8WA 2ZT7A 3HLTA 4ENWA 1RE1A 2XMRA 5LQKA 4DCNA 1C1YA 5BSTA 3AP2A 4A6XA 5F52A 3IEXA 4G2TA 1EX7A 1J6UA 4W9NA 4BLVA 2A5FA 4NH0A 2OGZA 2QTRA 1PL8A 3OSZA 4EQ6B 2QRZA 2VDNB 5LZ4A 2GZMA 1ZYUA 4HGRA 5CYPA 4ZU1X 5J43A 3USES 2BGWA 3FPFA 3IDSA 4N5NA 4MUIA 4R2XA 2VHYA 5IM4F 2O0LA 2PFKA 2Y0EA 4Y2QA 1DBPA 1U1FA 3HDYA 4KXNA 2LPMA 4UNNA 2Q0HA 2D59A 1QS0B 2PL1A 4L3WA 4WK0B 1N7HA 5FA5A 1V1RA 3F49S 2BKUA 2WUWE 3FSGA 2I3ZA 2C98A 2ZJ4A 1ZVVA 1F9AA 2ZBDA 3N6VA 1MOZA 4KR2A 4GSKA 3QLVA 4L4ZA 1NR5A 2WSBA 1DIRA 3NS7A 4QDUA 3W5VA 3LPCA 1V9CA 2MJLA 3UMBA 2GPTA 3OQ6A 5SYNA 4AF6A 1XJ0A 4ZMSA 1ZO8A 4ARIA 2PZJA 1MOQA 5C8YA 3VPHA 4ER6A 3AFMA 5MGNA 2H08A 4LSZA 1MDFA 4KSCA 5A4DA 2UZAA 4TMVA 4UAGA 3SEQA 4QOIA 2VAMA 4KO8A 1MRNA 3EQ9A 5EHNA 2VNJA 4B3HA 1P18A 2EBUA 2X9NA 2WJVA 3PR1A 3PX3A 3USZA 2W2LA 2LCIA 3PYLA 4IAOA 1J1IA 2HK6A 4HNUA 3VOAA 3ZHTA 4CM9D 1XELA 3K20A 2WD7A 4DNFA 2CY0A 1I6LA 5I4IA 1DEAA 4WDRA 2DTDA 2ATVA 2VKTA 2H4HA 2R44A 2D1QA 5D2CA 3N8NA 2JGRA 3QVWA 1NW9B 3HCWA 4YJGA 5FV4A 1KI8A 1KQ3A 1ZA2A 3GMSA 1M73E 4N8DA 2J5KA 1P77A 5EJ9A 2RGYA 4BP9A 4D9BA 4NCBA 2F9MA 2E0IA 3ME5A 5BSRA 4ZTZB 4EF4A 2JBHA 3DHVA 1NP6A 1NT4A 4ZIRA 4AMVA 1HZZC 2LP4Y 4TRMA 4US0R 4L74A 5B4UA 3IHWA 3K4QA 4LZJA 2PGXA 4NC9A 4TROA 4W8HA 2GDZA 3UEOA 3WYGA 4Y7DA 3JAKA 4HEA1 2KYRA 3DO5A 2QQGA 5ALRA 3BIFA 1XZKA 3I9OA 3R5JA 4FOPA 4ISBA 1UJ6A 1JH8A 1RRPA 3K8OE 2ACEA 3KB2A 3LF2A 1DKQA 2WT8A 2Y8EA 3FN4A 1FP2A 3IIJA 3KKNA 1DI0A 1E8MA 3RVPA 3ZOZA 4EHKA 4KDRA 4DPLA 3KYCB 4K88A 2FW7A 2R48A 4L5JA 4LISA 3W90A 3LLMA 1S89A 4XWKA 3PBKA 4CFZA 4DLTA 1USIA 1P0CA 1JT2A 1V3VA 4TMYA 2VLBA 2CDCA 3IVRA 3T5AA 2ZRGA 4DTIA 5KYNA 2IXEA 1SPXA 3N0TA 4U63A 3W3AD 5HMLA 3GLKA 1NTOA 3QK7A 1RXVA 1Y6RA 1J5PA 1UBJS 5B1SA 4WOJA 4EMSA 3C3XA 3IHKA 2R6AA 3G5TA 2EKLA 2FMUA 4K87A 8OHMA 3NWEA 1MN6A 4EWLA 3P96A 3FGZA 2IEDA 1T0IA 5AI8A 3ZWDA 5J2UF 3ZDZB 5K5EA 1F1BA 1KQOA 3L4EA 4KUGA 2FEWB 3R6LA 2CL5A 3HK2A 2IP4A 1N5OX 1XTJA 1Q83A 5IVIA 2X77A 5J5CA 5GM1A 1LLCA 1NF8A 3CKKA 4MLZA 4V0OA 1LVGA 4AWAA 6REQA 1D04A 4PO9A 1SCDA 1YCDA 3LLUA 1GNVA 4UUNA 3ZW7A 3IQGX 2NUAB 4KK3A 1QFJA 1Z45A 4FD2A 1JHPA 3VC3A 1Q1NA 2D0PB 3QH4A 2HSDA 3WRWA 3MT7A 4A91A 4CU5A 2A9RA 3GPLA 2AXEA 1HDYA 3GAFA 2AG0A 1M6NA 4I1PA 1GN8A 1YFZA 1I3OA 1C1HA 4LWPA 5BW6B 3D6AA 3WLLA 3EZ2A 4MMXB 4X44A 2QTHA 3H5RA 3TGPA 3DFKA 4HGPA 4R1TA 1ZW1A 4M0PA 3BTVA 4J1TC 4EBFA 1QRTA 4OLAA 1YZKA 4TWIA 1SKYB 3PQ7A 5LYJA 1HK7A 2QL9A 3ZWNA 3ZX4A 5JI2E 3DZBA 1GM5A 2DETA 4Y0VA 4C3OB 1KEZA 3K9QO 4I55A 5D3KA 4RF3A 1XZDA 5IMSA 3E81A 2BFOA 3E8SA 3FHLA 5L7YA 5K01A 3MWLA 1K89A 2FRDA 4F92B 4JLSA 1Z4NA 3STTA 1CDZA 3L8FA 4RSGA 4YJ3B 5IASA 5EHGA 2O0MA 3DW1X 3HCEA 3UF0A 1C1XA 2VDOB 2YV1A 3AJ9A 3M6IA 5CR9A 3STWA 3UMVA 4MZXA 1TUBB 2QI9C 4ZI7F 3EW7A 3QE4A 1XDZA 1E64A 1NQXA 3K92A 5HM8A 3L1UA 1AHHA 1JWBB 2CDBA 3PK0A 1JLMA 1U5BB 3DAGA 2B8EA 3WQQA 1OH5A 3OCVA 2QN7A 2C9BA 3FNRA 3O9ZA 5AW5A 1ZOSA 9LDTA 3R5XA 4YCAA 1EVEA 1JMYA 1KRXA 1EXWA 5E6SB 4LTNA 1RJGA 3DHYA 4HVCA 4KPEC 3KJFA 1Y5RA 3NC0C 4B3SB 1XEWY 4CV2A 2C54A 3GMDA 2CLKB 2O7RA 1KJZA 2WICA 3QBJA 4NNOA 2LKCA 1XMXA 1GQQA 2Q5QA 2XIQA 3A1SA 3OP1A 3SNKA 4RFVA 1OF1A 1A9TA 1OB2A 2XI4A 3VR4H 5AK6A 2A86A 2G0NA 2Z8XA 4KUHA 3GYGA 3ZV5A 4QTZA 2EARA 2I87A 4POOA 3V2GA 1VJ5A 2VJYA 4BO0A 2AK3A 2ZUCA 2ZVDA 3PCXA 1MHPA 4UBMA 2EYQA 3KJQA 2HRQA 1R7RA 1DCKA 1B00A 1GA6A 2OQ2A 3LYUA 2X14A 3W8DA 2VP0A 3FYUB 2J08A 4KWHA 4LN1A 3ZXUB 4B34A 4RTMA 5DTRA 4N3GA 2FDRA 1WEHA 3EVGA 3PYXA 2NU6A 3UO8B 1T9HA 3W6PA 1QGOA 3P0JA 4C7OB 1PZFA 3G3EA 3N05A 1LH0A 3SHFA 4M98A 3MSXA 3JR3A 3TE7A 1AO0A 3NTOA 2YIJA 1MJGM 3KKKA 2Q5HA 2E4ZA 2GRJA 2RJ3A 4D0NA 3J81A 1TEHA 2ZKIA 5DNCA 4TTPA 5LKAA 1DEXA 1WHSB 5ELMA 1I4LD 1ORHA 3FNHA 3JTEA 4REOA 2C7GA 1PIWA 3KPJA 1ZNZA 1GPWB 1M34E 2F1HA 2IHTA 3T0FA 1GUYA 3LWNA 2P0AA 1BA2A 3OI7A 4DJDC 4AJJA 1C0PA 1JIJA 3DFMA 3EMVA 3NRJA 3WL8A 3C7TA 3NM6B 4L16A 1DG1G 4KE8A 4DMFA 4N0PA 4Q9LA 3FBGA 1Z8NA 5EG5A 1AN9A 3GFBA 4JASB 2VHJA 3DONA 3OQHA 4IGFA 2K6GA 2HSGA 1YS7A 4GLJA 4ZYZA 2KWIA 4Y3UA 1Y1SA 5ALTA 5I47A 3I05A 3RSHA 4JC0A 1TM4E 4D26A 5JCXA 2I91A 2JAUA 3IOMA 1N9GA 1Q3HA 4YUXA 3NHWA 4X3PA 1SOAA 2F59A 3UJ6A 3SEFA 1GADO 1MKYA 3ZNOA 2P3LA 1DBQA 4POAA 2A67A 1KU0A 1OYYA 3NIWA 5CA1F 1ZUHA 1ZMRA 5C51B 3BZUA 1HYHA 2BFFA 4RENA 2QUHA 4PFSA 2C9ZA 2V8BA 2AN5A 3OEEA 1BQ3A 1LBHA 1TO6A 2VPXA 4KJZA 5IAKA 4ZTUB 5HE8A 1R4ZA 3BKXA 1PR3A 2GZRA 3BWEA 3DR3A 4C20A 3D8TA 2TRSB 1MPTA 4HTFA 4A6EA 3KKEA 4JT4A 2I4RA 3WLNA 3P2KA 4NP6A 3NGLA 4OFXA 4Q4DA 5JRZA 3HGQA 4JJFA 3ORYA 3AESB 4R1NA 4B7CA 5J5VA 1PVVA 1U8EA 4X3OA 3ROZA 4EABA 4QRDA 3HUEA 4D7AA 4A8JB 5IUNC 5K8UA 4OFWA 1V4VA 1R6TA 3BDVA 1CUEA 1C9NA 1TKAA 1FP1D 3I2GA 4N7MA 1OLUB 2VZEA 3LHKA 2Y4OA 2WT4A 1B2LA 1O7JA 2PS9A 1NM5A 2PH3A 4H1HA 4LY0A 4QFMA 2J5XA 4BO3A 2YZ2A 4TTQA 2GXSA 2FWBA 2HZ7A 3QEOA 3NOOA 2JFPA 4W8GA 2HXYA 3HXTA 1K1EA 5C8VA 2JFGA 3V1KA 3TLZA 4RIEA 5DNWA 5ALHA 2X3YA 3S2GA 1G5TA 5THQA 4C5AA 2CHVA 2RH4A 5J4LA 3I52A 3STHA 2FFAA 2KPOA 4AMGA 3ITDA 5D5HA 4BV3A 4YHBA 1Z4QA 3DDCA 4RVCA 3AP1A 3CCFA 3TMAA 4OD0A 4BMDA 2XE7A 1YRLA 3GXOA 3KJNA 2ORYA 3RSLA 4CPDA 1VSVA 1M0TA 3QW4B 2ICAA 3QFHA 2KJQA 3E0XA 2HC9A 2XYVA 4HDMA 4X41A 4KREA 2RBGA 1XO1A 2ZAYA 2V7BA 3LQKA 4D4MA 4DC9A 4OGGA 3KV3O 5HZKA 3FVQA 1YR2A 5T8KA 4Y1FA 2VUIB 3AVVA 4KDCA 2YY5A 3GUYA 2JLZA 3X2FA 3KQOA 2WSMA 3CRW1 4R2HA 5FYDA 2DKOA 3PXGA 1QAQA 3KZMA 4DV3B 2HK8A 1IQPA 2H0RA 1QO0A 3EG5A 3MWEB 4N0EA 4RX1A 3UJ3X 3L8GA 2D7CA 3U4IA 3GT3A 2SCUA 1QFSA 4LYFA 4O2AF 5JNSA 3C4VA 4AJHA 4QSHA 4PGMA 2J5RA 3AKYA 5JHGB 1K7FB 5ILQA 1KU6A 3EEOA 2ZT8A 4ZU3A 3AVWA 2PS3A 3FB4A 4M8KA 2CV2A 3AF0A 3PC4A 1A7UA 1YVEI 3C6ZA 2QGFA 3GDHA 1P19A 3JYOA 4W1PA 4EECA 2OXRA 3VU0A 5FOWA 2GTPA 3EAFA 2P5YA 2QTCA 1AXRA 1N0WA 1MJHA 2PU5A 3EEFA 4H0FA 1KZYC 1GQOA 5JPCA 1J4AA 1QPGA 2QRHA 4XDYA 1X1DA 2O2HA 1IY9A 4PM4A 3UG6A 4MB0A 4W5JA 2RJNA 2XTJA 1N2BA 4ND4A 5JCOC 3HNOA 3IDFA 4BNKA 3PC2A 2C9CA 4FSDA 4MVJP 3EIXA 3KO8A 4R7TA 3P2YA 3ACCA 4B82A 4MUNA 3KR9A 1P2TA 3OECA 1V6SA 5KOIA 4KQ2A 4JQOA 4DDVA 2ALJA 1KC3A 1ZU4A 2IVZA 3QVJA 2DFPA 1M72A 2XBUA 2FOXA 1P1BA 2PQ2A 2P6MA 3PFBA 2AHRA 2QRMA 4TS9A 2EEZA 3GA0A 1RHQA 2BTQA 4Z0TA 4LMAA 4ZVPA 3GZNA 2VFAA 4Z54A 1XRPA 1B6TA 4MGKR 2F67A 2R65A 3LVRE 5TXGA 4PBSA 1IY0A 2RHOA 1GCOA 4FOLA 2D1TA 1XL1A 1EJBA 1LGYA 3C45A 4DREA 1DDIA 3C8MA 3M5PA 4C7KA 1GXSB 1FFGA 2LIPA 3EGOA 3KUDA 3LHIA 3O7MA 4FPXA 1VGRA 1P1FA 1DBWA 2QR5A 3ONFA 1GDDA 4OHBA 2M6KA 1CJVC 4A2CA 4G8CA 1SQFA 3RVRA 5TPZD 2IE8A 4O4JA 4D9MA 3LYHA 5EXTA 1IHUA 1PTJA 4FEYA 1MRSA 1VJ1A 2IUEA 1OWMA 5EERA 1YB1A 1XDWA 5ALDA 4LJKA 4MTCA 2QENA 2FEPA 4JY7A 1AF7A 4OQYA 5BW8A 1U0TA 1RWOA 1Z7YA 3GEDA 4IV8A 3H2BA 3G7SA 1FMLA 1JU9A 2HF2A 5EWJB 5ADHA 3AO0B 4MHOA 5DI3A 1G64A 2QQ5A 1CRPA 1KDYA 1KBZA 4MEBA 2PBFA 3T35A 3CG0A 1LK0A 3ZXYA 4DJTA 4V02A 3QELA 2FW8A 1CE8B 4O0LA 4QBKA 4KO3S 2AN4A 4MAFA 3PGXA 4BFLA 4JS0A 4YT5A 1TZBA 4ZT3A 2H11A 1TX4B 3SGLA 4O3MA 3H2JA 4I3FA 3HP4A 3CISA 4AP5A 4CIBA 1EUYA 2GZ1A 2B37A 4ZDJA 1M2HA 3L1VA 2VYVD 3F90A 3PGLA 1MNAA 3GBVA 3K9NA 1Z4PX 4INJA 4M7OA 3FCXA 4P5EA 4WLOA 2RGNA 2NXEA 4BQRA 4HN4B 2ZUVA 5IS2A 2IHBA 4OHXA 2CWWA 3CV3A 4HDKA 2UUBB 1YB5A 2XUGA 2ZRDA 2WIAA 4FYXA 4QQFA 1OAOA 4WZBE 3LLSA 3N5CA 4LBYA 2EFEB 3M5CA 2BFEB 4D42A 1V39A 3EJ6A 1M8JA 3KJHA 3HGMA 4OQQA 4MDFA 4UEWA 2OCXA 3K9BA 2PMFA 3IA2A 4PINA 4ZPJA 1E2EA 3TZKA 1CZHA 5D3ZA 1PGQA 1Z7WA 3ZG6A 1IHYA 4OXRA 3ZHCA 4WGFA 2GSWA 4MQEA 1IN7A 3HNPA 2YINC 2WMOB 2CEKA 3LL7A 1TPYA 1Z29A 1E3DA 4GPAA 3EWSA 2WA2A 5KSZA 8GPBA 1DFIA 4UFPA 3DWFA 2GXUA 3OA2A 5BWCA 4YACA 2IBTA 4W5RA 3FTFA 1E6MA 2V5VA 2O7NA 1GCUA 3BF8A 5E4FA 4HVLA 2YXBA 3CN9A 5IJ0A 1W5TA 3ZV7A 4OI4A 2C1XA 1R0KA 2IEGA 4A27A 3ENWA 2VEDA 1SFRA 1NY5A 4NMXB 3OZBA 5ESDA 2F1IA 3O2JA 3U37A 2CXPA 3UJ9A 1E8NA 1YCHA 4ZU6X 4FT4A 1BS2A 3DA8A 3ENVA 2ODBA 4JMLA 1SVKA 2NYUA 2PY6A 2RARA 3I45A 5AI4A 5B4VA 3ST7A 3URKA 1M1YE 4D9JA 1O58A 3NKFA 5EEGA 2B1QA 3V4LA 1TQ2A 4ND8B 1W5EA 2A88A 5CX1A 1F8GA 5TMBA 3A1NA 1YZGA 3DF9A 3IB6A 2WSSD 3MS7A 4G07A 4NATA 1IUOA 3BF7A 3ZI4A 3J7AC 1IXZA 1HDOA 2BFWA 1FZQA 4TTSA 1O6ZA 3VNAA 4L0QA 2ZI6A 4Q15A 2QRGA 3W5DA 3TLAA 4BO1A 1E5QA 2WNIA 1JG3A 2QQFA 4CM4A 1LPAB 2HZBA 1AOXA 1ZM2A 1Y4UA 3ZCUA 3CWQA 1LLDA 1MD9A 4ZO6A 3U16A 1TC2A 1XXHA 5I7FA 2WF7A 3CUVA 2A9OA 1I51A 3OPYA 3OAAD 1J42A 4RA9B 4WZ6A 4CM9A 1JX6A 2ZOSA 3KHTA 4P0QB 4IJUA 3FM9A 3PHCA 4E4TA 2ZUUA 4IGEA 1XAIA 4DVGA 3RSSA 3KP1A 4J7AA 3A27A 3OURA 4M38A 5FJJA 1CB7A 2RKWA 2VIIA 1NW5A 2BMAA 4CU2A 4IFIA 3UK0A 4RMGA 8ADHA 1XFDA 1WV0A 5AI5A 2HI0A 3GGJA 1SUSA 4Z99A 1HTBA 2NZJA 1BVYF 5JNTA 4CXMA 4KN9S 5FA6A 5I7EA 2YWDA 3FH0A 2H1IA 2X5JO 1E0DA 3BB3A 1JU4A 2IU0A 3LC1O 3S6JA 4E21A 4YRNA 2AYXA 4P38A 4ZJYA 2XXAB 1WUJS 3DWGA 1VMDA 2DCUA 4KLRA 4MGYR 3RUCA 4DT1A 3FOEC 1BOFA 1GQRA 3FFXA 3T54A 2KX7A 3T7DA 1YI0A 2XWJI 4ER0A 4II2A 4HQKA 5BRAA 3X1WA 2FCRA 3MWJA 1Y3BE 1Z3IX 3UIEA 5K3CA 2HYIC 3ER8A 5ALYA 2EFHB 1U9JA 2FZEA 3I5UA 4QA9A 4ZOCA 3TAHA 3CEAA 3N2LA 1K88A 1MW8X 2VCEA 3TR6A 2VH5R 3AVQA 1KJ8A 1G6KA 2OSBA 2ZBUA 4X84A 5JAQA 3K1TA 3W5JA 4CHGA 4UBOA 2JKVA 3SK0A 4XFDA 5CG2A 3W3AA 3LF1A 4RPIA 5CDYA 5CFMA 4ZOQI 1HT2E 3FLBA 1WKBA 4U2CA 3R5SA 3FUWA 5CVVA 2I62A 4DDHA 1WXFA 4TL9A 4CKWA 1QGZA 5EMNA 2E1PA 2YWXA 4U7GA 2QLLA 4GKBA 1XSEA 4OI1A 3UUWA 1DC4A 1QWOA 1WVGA 3K5WA 3QTBA 2ADOA 2X5NA 4QLBA 4K6MA 2XD4A 3H9BA 3MUNA 4EA8A 4KVZA 4OSOA 5FF9A 1K5HA 3PRKE 3GELA 2XKJE 3NXSA 3L7JA 3EG9B 4RU1A 4YV7A 1YOBA 2QLNA 4Q4JA 3WSTA 1JSZA 4U2EA 4PGFA 4QXRA 4EJ0A 1UBLS 4KACA 4LGYA 3LT0A 4YMUA 6ABPA 5KNBH 1C14A 3KFXA 4ISCA 1TPZA 3IT3A 3KSDO 5I5GA 3RKSA 5CB4B 3RADC 1N5LA 3BB4A 4KV7A 4G4SP 4I7EA 4M49A 1JWAB 1V2GA 5A62A 2AUNA 1DKMA 2EJBA 2O2GA 1JR3E 3RNLA 7AT1A 3HJBA 1WU7A 3BWMA 3AEKA 4ZVMA 4RVDA 5AYVA 3DULA 4L8FA 4MW4A 4EW1A 1PEAA 4CIYA 2I4LA 4F6RA 3QPCA 4OQLA 3BK7A 1UKVY 1DJNA 2NYAA 2Q9UA 4QE3A 5TQJA 3PU6A 2WYUA 4B5KA 3SSAA 1Y9DA 1TT5A 3M1AA 1LD3A 4IDCA 4OV6B 1S3GA 1PHRA 4CNQA 5JS2A 1GPAA 3T06B 2ZIFA 4MXDA 4EHFA 1Z0UA 3LQQA 1FRQA 4E30A 2WZQA 1U0HC 3I9KA 3ZI7A 3AM4A 5DIFA 4JI4B 1SCUA 1BKDR 5C31A 4UDNA 3TBKA 1YH3A 4RMIA 3KBOA 4DA0A 5BXYA 3O4RA 3PJGA 2CF6A 3C16C 1EEHA 2AZMA 2P6OA 1H93A 2Q4EA 1GYRA 3EPLA 2JF0A 1G9TA 1G16A 3A7EA 3H11A 4HWPA 3ROQA 1W9HA 2A3RA 2YFHA 3EC1A 2AXPA 4DIUA 821PA 3ZE8A 4AECA 5AW3A 5L8VA 4MHTA 4K1XA 3I1FA 4L4SA 5FNVF 3R9IA 1DV2A 3L01A 3OLCX 4MMZB 1TUIA 3L0DA 4ARZA 3F73A 1VLLA 2C4NA 3IRVA 4IUCS 3X43A 4YDRA 5U1PA 1ZOPA 4E1BA 3IIMA 2A0KA 3GG9A 4IZOA 2BTOA 2OAQ1 5G0TA 3KIPA 3D7LA 1EG2A 2Q50A 3I5AA 4JHLA 3IUYA 3VPBA 5IHXA 3PFCA 1EBUA 1FA9A 3GVCA 4UCWA 4Q4HB 1XR3A 1UFRA 1ZM3A 3IRUA 2VDWA 4QFBA 2A1IA 2AI3A 2HHLA 3CNHA 4JBXA 4OTZA 1J07A 4XUDA 4ZO8A 4C7VA 2H7VA 3NAGA 1KK0A 2Z1DA 4UBLA 2ZE7A 4G0WA 3LP5A 1L4FA 1F2TA 2ILVA 4J1QA 5JXGA 5GGYA 1QSGA 2P9HA 2MOKA 2YR0A 4KDFA 1P4AA 1XCLA 3IXMA 5BSGA 3CVVA 1ZLXA 1VRVA 4PAOA 1DKPA 4IIJF 1BE6A 3ZCRA 1QNLA 4FYHA 4B3TB 2CEAA 1H2RS 4MZDA 3D6FA 4B4UA 5HX7A 4I3GA 1XA0A 1YJCA 1YGPA 2IH4A 1TECE 5A3RA 1FMFA 4L6CA 1XRMA 4UULA 5A3QA 1Q14A 3CGWA 2FPSA 5K8TA 1OAAA 1QP7A 1CF4A 2MHCA 2XUDA 3T38A 3TAXA 5BQXA 2BMWA 3U7IA 1NBME 4MV9A 1DEHA 4UMFA 3PCRB 3ORSA 4RZQA 4BN0A 1W6UA 1V5FA 1UT5A 2O3JA 1UKCA 4P53A 1MH1A 3V6MA 2XVZA 2OCIA 5DBGA 1L8LA 1OFIA 2B4TO 2GERA 2O2CA 3G17A 2XUHA 1Z4MA 2PUVA 2XB4A 4J4HA 4YJKA 1ZD3A 3ZUPA 4R1SA 2O2DA 2XYGA 3LUDA 5CNKA 5CDHA 1OH7A 4W5NA 3JCZA 1XN1A 1WSAA 2NU8A 5JTTA 4HQFA 1CZNA 2C3OA 2XNDD 1CP3A 3TDNA 4JJ7A 1ZD9A 2XGOA 3ANMA 4QLOA 4UM9B 5HWSA 2VPYA 1ZOOA 5KTTA 1WY7A 1H8ED 1XZEA 2MDTA 1G66A 3RVKA 2CHGA 2ZRNA 1J2TA 1K92A 2Z2ZA 2AF3C 4AZWA 1QFYA 5A9SB 1US8A 5DXJA 5IBRA 4HX2A 1IK4A 1NMZA 4HUQA 3W4KA 1OFUA 5BMVB 1UMBA 3L40A 3TWOA 2XTAA 4C6TA 5DP2A 3I3SR 4XX0A 4OUDA 3VGPA 5L9AA 1TZKA 5ICCA 3GD5A 4G1UC 2ZBEA 3UW3A 3WBKA 2K4MA 2R00A 1QNFA 3A25A 1M7GA 3GUZA 2Z8YA 4JX8A 1W1IA 4QDTA 5GONF 4TKVA 2OYRA 4MRMA 4QZVA 5CA0A 4P98A 4ZVNA 3QEAZ 1PEDA 3PFFA 2PLFA 3GJ8A 3ZBPA 1GNRA 3IXLA 3HXOA 3HFSA 3O95A 3Q15C 5JY1A 2HQBA 2BI7A 2IITA 3DP7A 5FA8A 4C4RA 1X0XA 4IXNA