3ZK9A

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
278
structure length
278
Chain Sequence
b'KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 104
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zk9A01
4PAGA 2XDQA 1MIOB 4K3VA 2AFIA 1K75A 3PSHA 1EFDN 4NNPA 3MD9A 5BVGA 4TKUB 1KAEA 4XPIA 1G20B 1K2VN 1FP4B 1ESZA 1H1LB 5KOHA 1TOAA 5KOJA 4ND8A 1M1NA 1N2ZA 3MWGA 4OXQA 4CL2A 2ETVA 4DBLE 4BBPA 3HJTA 1XVLA 2AFIB 1M1YA 4OXRA 5CR9A 4HMPA 3G9QA 3GI1A 3AERA 5BVHB 2MINB 4MLZA 4H59A 4XPIB 1QH1A 2XH8A 3AEKA 3AETA 4HMQA 1G21B 1KARA 3ZK9A 3LHSA 2XQVA 3U7QB 4INPA 5KOJB 4ND8B 1M1NB 2X4LA 1PSZA 3MINA 5KHLB 4UDOA 3ZK7A 5M3BA 5JG7A 4GICA 4N01A 3ZK8A 3ZKAA 2YNMC 3UJPA 4UDNA 3AERB 3NU1A 3R5TA 2WI8A 4MO9A 5AFSA 1QH1B 3AEKB 1L5HB 3AEUB 3BE6A 1KAHA 1K7SN 2M6KA 2O1EA 5JOQA 4WESB 5HDQA 3MFQA 2XDQB 3MINB 4WN9A 4WZAA 4FI3F 2PRSA 2R79A 2WHYA 5BVGB 5JJ5A 3AESA 1N2CA 2QI9F 4B8YA 2XY4A 1QGUA 1N4DA 2PS0A 1QH8A 2OGWA 3K1AA 5KOHB 3BE5A 3EIWA 4WZBA 2PS9A 1M34A 2PHZA 1N4AA 4TKVA 3PDIA 2R7AA 4INOA 2XV1A 1K0FA 1MIOA 2Q8QA 3HH8A 4NNOA 1M1YB 4WZAB 4LJSA 3TLKA 1PQ4A 3AESB 4HMOA 1G20A 4MX8A 4UTOA 3AETB 4M7OA 1QGUB 5B58T 4FNAA 4UTPA 3K1AB 4MDYA 5GGYA 3LI2A 2AFHA 4PM4A 4OVKA 4WZBB 1M34B 3HXPA 5GGXA 2XUZA 5M34A 2YNMD 4G07A 2OSVA 5CX1A 5JPDA 3AEQA 5FLYA 2Q8PA 5BVHA 5HX7A 2MINA 3TNYA 3EIXA 2PS3A 4IRMA 1G21A 2RG7A 2OV1A 4WNAA 5M2QA 3U7QA 2OV3A 3ZTTA 3PSAA 2AFHB 3CX3A 4WN9B 4LS3A 4G09A 4TKUA 1N2CB 3R5SA 5CX1B 1FP4A 5M29A 1H1LA 3AEQB 3TEFA 4FKMA 1QH8B 4HN9A 3MWFA 5I4KA 4FILA 1L5HA 3AEUA 4TKVB 3PDIB 2M6LA 4WNAB 4H0FA 4WESA
chains in the Genus database with same CATH superfamily
4WK4B 4P92A 2QM8A 4V0QA 2RBGA 1IBMB 1IG3A 3CRNA 3STXA 1DO8A 1KAEA 2DZDA 1HKHA 2XNSA 3T3IA 5JC8A 1KP3A 1W6UA 3GLVA 4OI2A 1MW8X 1Z16A 2GDJA 3IEIA 4ZJUA 1TQDA 3HBLA 1G42A 3ESCA 5KNCH 1SD2A 4FYJA 2BR3A 1XRJA 4ZOAA 4BP9A 3TN7A 3DMYA 3HR4A 2RI0A 2P0EA 3IMEA 5ES3A 3CX7A 1XVTA 1JEYA 3A4IA 4BO6A 3LV8A 2EWMA 3DCNA 3NRJA 1YZ3A 4QHTA 3RR2A 4CKEA 3ZW8A 3Q88A 1N92A 3VDQA 5F7ZA 4ERNA 1TVKA 2CDRA 2HGZA 5EJ8A 1ZMXA 4G4GA 5FV7A 3T1QA 3W5VA 2VBIA 3PNSA 1R6VA 2W6IA 3PC3A 3N0RA 4EY7A 2TMDA 4CNQA 2PGIA 2O2IA 2QRLA 3RQIA 2BZ1A 1UBCA 3EJWA 3JQ9A 1DKNA 1IN7A 4QUEA 2VHVA 2CV2A 5DRTA 5E9JA 3HB7A 5B3JA 4NATA 4EBBA 3IB6A 3OE7D 4LWQA 4N0EA 5E7MA 3U4HA 4DLPA 2OAGA 1X3SA 4UD6A 3KKPA 4W1QA 1T4BA 3JQCA 4OQQA 3RRFA 1U0JA 5IU6A 3M2TA 1N32B 1EP1B 3PTAA 5FWYB 3CYFA 1QCZA 3BAFA 4LYYA 4A4DA 2JBHA 3M1IA 2VJDA 3U26A 4IDGA 3D6TB 2GTIA 1RHMA 2ZI5A 4Q66C 3TE7A 1JEJA 5HUJA 3CF6R 5C3UA 3RC3A 5IXYA 1OLOA 1M34A 2CLCX 2I7VA 5JS7A 4P32A 2R8RA 1K6IA 1P0MA 4B83A 1J0XO 2E5WA 2HU5A 2EHJA 2P6MA 3NX4A 3L7AA 4IDBA 4K7JA 4DG9A 1VJGA 4YAIA 2OTCA 5EE5B 1KDOA 4GEKA 3U3RA 4GUAA 4BV2A 5CHEA 1F2TA 2QL6A 4O5AA 3ZH9B 1WMEA 4M1MA 1J2JA 3D4BA 5I7OA 4NP6A 4WQMA 1UDBA 3OQPA 4JEUA 3FHTA 1R88A 3SYNA 2O7VA 3WWCA 3FVWA 3SQWA 5K0TA 2MYUA 2XYRA 1CZUA 2ZUUA 3QVWA 3TBKA 2BEUB 1P9WA 1PZHA 1IRIA 2Q0HA 1N6IA 1PYGA 2IOFK 4I1RA 1X6VA 3GD5A 5DTEA 3T35A 3MAJA 1BMFA 1OXKB 3R0JA 3TTVA 4PGAA 3NORA 4I50B 1TAUA 4GBGA 2RGXA 4NESA 2W11A 3GDWA 3K0FA 3TQQA 2XDWA 3GUYA 1EXDA 1YJ5A 3NCHA 2OESA 3K9HA 3QX8A 5F1KA 3ZUGA 5BMVF 4EG8A 1KJJA 2QRVB 2DWPA 4L95C 4QQ8A 3T41A 1AS2A 4EA9A 3ONVA 1L3BA 4Z7OB 3KETA 1R12A 4DUGD 2IKSA 4IDPA 1P2FA 5FWXA 4V38A 5F64A 4G4SP 3NM4A 2HZ7A 1PQWA 4HGRA 1H93A 1KFCB 1NVWQ 4HPXB 5E6UB 1CQJB 1QS0B 3DEYX 3GMDA 4E1VA 3VKWA 4OXKA 1MU0A 3Q7TA 4PAMA 1QGZA 5FTJA 2FSVA 4MA4A 1L8QA 2IYSA 4K46A 5H59A 3HZOA 2B98A 4BNGA 3CTPA 1TK3A 2H1VA 4PRYA 2PKYX 1C7RA 2A0YA 3GEBA 3K9QO 1SEPA 2FX3A 2Z2YA 4GBJA 4V3CA 1YVRA 1NMXA 1WU8A 3BD8A 3MWGA 2OLJA 3E61A 1ZMBA 1L7PA 4JYZA 4EW6A 1E5TA 1EJ2A 1EA7A 1T26A 2ZB8A 5ENZA 1OX4A 1DX4A 2P2YA 3LX8A 4LJYA 5CR9A 3JW8A 1Z5OA 1KH1A 4Z0HO 2BCJQ 2JRLA 3O8QA 1H8ED 5EXTA 2Q6KA 1QANA 4KXVA 1XVIA 1FDOA 1N57A 4U7JA 4PHFA 3PFNA 2HF8A 1H9CA 1XUOA 5U1PA 4J7UA 3NDBB 1D2EA 2WTEA 3B5EA 3EW9A 1SK9A 3UEOA 5LQMA 2GCGA 4KRXA 4S24A 2XCRB 1SVMA 4JK3A 5BOVA 2CK3A 4KX3A 4DNQA 2JFHA 3G2IA 2CNOA 3WGJA 4K0KB 3E82A 2CZGA 1K7SN 2ZSHA 5CK5A 1TT5B 1U0EA 2I8AA 2HXYA 4ZC8A 4CN8A 2HW8A 2NTEA 2I4IA 3GJ6A 4ARSA 1ZIPA 2G06A 2PZ8A 3DD5A 3JRWA 1Y7IA 1U3UA 2BMWA 1YUNA 2C2HA 3HDVA 3F74A 2F9LA 3ZHXA 1Y8ZA 3L7BA 4HNRA 4NWIA 4HAWA 5C8VA 1FXSA 3L7DA 3TLCA 2J46A 2PHZA 5EZYF 3RREA 4EW3A 1TZMA 1UUFA 2HWWA 3GQVA 5E2BA 4I4TF 4N47A 3R9XA 2QNRA 2VAPA 4FYPA 3F7MA 4OM8A 1UP6A 2O6LA 2FX2A 1PQ4A 1Z0UA 4NEQA 3HB1A 1P2SA 1W1UA 3H11A 3JYQA 2VDJA 3WRXC 1EXMA 1UPBA 1TECE 4C89A 2H3HA 5HQ3B 2ZJ3A 4IQ0A 2QGNA 4MQFA 4QEKA 5LOVF 2DVMA 5EKDA 1ESMA 2E87A 2QMHA 4MVYA 5E2AA 5G3ZA 4HRVA 4O02B 4BNJA 1I10A 1KI2A 2ILTA 1W4LA 4R98A 4U2KA 3ZGYA 3KALA 5EY5B 3DDSA 4BCCA 2FPUA 3ZGOA 1K4YA 2IODA 3WWDA 3OQIB 4RZQA 2IU0A 1AZSC 3QZUA 3R3ZA 2QM3A 4J16C 2C0PA 3HO8A 5A9SB 3WGMA 1MC4A 1Y4AE 3A28A 4M99A 1WVMA 2Q4BA 1TIBA 1AY0A 3H5WA 3H4VA 1J0CA 4KWHA 4QBKA 3PQ3A 1M2EA 5AKXA 2H4FA 4OH1A 4PZCA 3CF4G 2QAGC 5AXDA 2HK6A 3GXBA 4DV2B 4KVGA 3P2MA 1SZPA 1I2MA 4TV8A 1ZRSA 1ESNA 4L3WA 3ICCA 2WYUA 4S0ZA 2VA8A 3CGGA 2CE2X 4TSKA 3OEHD 4UNSA 1GNTA 4ILKA 5HJ7A 3CIOA 2ZXEA 1SG9A 4N1AA 3QRWA 2YFYA 4I55A 5KSPA 1KE2A 4UASA 1XP5A 3PJDA 1UOEA 1C1YA 1OLUA 4CMAA 5EHIA 5AM2A 3GT3A 4AS2A 4GZ6A 2WJGA 1AMNA 3CJRA 4OYYA 1SQ0A 3FOAA 2XB9A 2WUEA 1VIDA 3CE6A 3R3VA 2GPWA 2QUAA 3LUFA 2I2FA 5C51B 5JRZA 1JDBB 3OZRA 2D5BA 3GNTA 3MD0A 2CMFA 1SOAA 2XHZA 3QK7A 4PG6A 5LMCA 4QUBA 1D2CA 2NSJA 3C74A 4PLVA 5IDQA 2O8BB 5HTOA 3VHXB 1GQYA 3BWEA 4ZEOA 5LZ7A 3IBGA 3RYIB 1IEVA 3N75A 1YDWA 1Z5UA 4K2HA 1DEOA 1GV1A 5ALPA 2PU7A 1JGTA 2Q1WA 2Y92A 2NUAA 3AETA 3HVHA 2VXOA 4BX3A 1CF2O 4RJIA 3QMVA 2EG9A 1H3FA 1X15A 3ZY3A 3LOPA 1H94A 3HHEA 3R24A 1X7YB 5H70A 3EHEA 3K5PA 3MBIA 5BN4A 2P3LA 5DYGA 3ZK8A 1ULUA 5HOEA 4LRTB 3X1XA 4P8RA 2QSYA 1KI4A 4HBGA 4M8KA 3J80A 1I3MA 4XVQA 3QPAA 5BN3B 5CBPB 3PNPA 4TQ9A 2VTDA 4LOJA 5H02A 3H9EO 3I9NA 4LK2A 5EXPA 2D1YA 4RAQA 1YQUA 3GIDA 2PKQP 3IHLA 4G5XA 3KT0A 1DG9A 1R2QA 1RLIA 4V2IA 1E7SA 2VXYA 3FLEA 3HKEB 4WN9A 4AO7A 1NVUQ 4GPIB 4XH9B 1GTG1 3TSAA 3NWBA 4L4RA 3WGIA 4Y9TA 3ANNA 4I4CA 2WJJA 3P71T 4H3KB 3CZCA 4G0OA 3BE5A 1PJTA 2YVKA 3RTGA 1DZIA 4Q48A 4DLUA 3KFLA 3WXBA 2XB6A 1UFVA 3UFXA 5KQSA 2YY5A 3SFZA 3DC2A 3LQYA 4AKIA 3W7BA 3UGKA 5TLSA 3OQJA 4P9NA 3OIWA 1Q0ZA 2IZ7A 5ALJA 5GY7A 1BEZA 2C94A 4OI1A 1GQOA 2C95A 2WYWA 2OHJA 3LQKA 4PBTA 2XZDA 1OV4A 3TZHA 4IUYA 4WBNF 1WCXA 1BOOA 4JVMA 3FGZA 2CLDX 3GEEA 1Y8QA 1D7AA 1NOKA 2J87A 1E9AA 3GEIA 4KG7A 3JWHA 2B3DA 3ER6A 1JR3E 1KZGB 1OI2A 2A5DA 2DBRA 2J3EA 3VHLB 1OV6A 3SF8A 2ZRBA 3D8TA 1AGNA 4C22A 4UBOA 2QQ5A 4B7CA 3MN1A 4MS1B 5EP1A 3RRXA 3SS9X 3VR1A 2C4VA 4WNAA 2GM9A 1UEJA 2C3YA 3OLXA 4PS0A 5DNDA 3EVCA 3CX4A 4CQJA 2O8EB 1VL6A 1JPJA 4ZARA 1QVVA 1QQTA 3CY6A 1Z2DA 5THKA 3TLJA 1DC7A 2YBEA 1AMUA 4UATA 4N9WA 1ULSA 1W25A 2O14A 3LLVA 3SJAA 1JHOA 4RVSA 1L5VA 4KR2A 4YFVA 2QZ4A 4UDYX 2PX4A 1A5SB 1ZJ5A 4R51A 3AP1A 1PJ2A 1TTPB 1HWYA 4FILA 5KO2A 4CDMA 4NZMA 3GLHA 4CM8B 1KIFA 1TPZA 1M5UA 2PMFA 5K3SA 4XXHA 4GMGA 1TYEB 3WL6A 5FPYA 4L0QA 3JPYA 2PSSA 1FFDA 4E08A 1QCYA 3UO8B 1ZIOA 4BRSA 4KO1S 5I8PA 1YZFA 2P2SA 3QJGA 3RHSA 1N5KA 3U37A 1QZUA 5C8YA 3VYSB 3AX6A 1FDRA 4TWJA 5IUKC 1U80A 4FXPA 1SKYB 3MZ0A 3UAGA 3UN1A 4JSYA 1Z12A 1Y1TA 4BP3A 3ILYA 4POOA 1CUXA 3KAKA 2OGUA 1B43A 4L4YA 3CM0A 3HE3A 5KTOA 4AZ3B 1YRBA 3ETJA 4PSCA 2Q0XA 4HMPA 1RRGA 1U8FO 4AROA 4Y2RA 3KVOA 3UHOA 5K0SA 2EV9A 4JBLA 2NSLA 2Z2XA 1G8KA 1KIAA 4EOGA 2V1XA 2ZSBA 5TVGA 3WGYA 5AI6A 2G6BA 3HU3A 4D3ZA 5E4JA 4HAIA 4CIDA 5ISMA 3HCPA 2PXAA 3W2FA 4GMFA 4HGYA 1GGVA 2V9ZA 4GI5A 2BTQB 4OB6A 3L5OA 5B4VA 3D2LA 1O6CA 3ESYA 4FSXA 1LV8A 3WKEA 1QQ6A 4MR9B 3LOQA 5E9AA 3I2FA 1I9CA 2VXBA 3W2EA 1M74A 4C0KA 3A9WA 4DAOA 1UKBA 3KJQA 5JS2A 1HURA 3B3QA 1UM8A 4Y9DA 4AMGA 1E9SA 3NGLA 1YOVA 2R6R1 3CCFA 4BB0A 5E7QA 1MRSA 1YXMA 2RAUA 3BVPA 4NS1A 5CJJA 3RNOA 4A9AA 1N2CA 4GP7A 4U7FA 3ESQA 1NTRA 4K9MA 4A0HA 3DTNA 4WINA 2W00A 1DIHA 3GHYA 2NU6B 4MJLA 3WGZA 5KYYB 2G9UA 1LW6E 5A5VA 2JH9A 2QRHA 1ONBA 3IPRA 3H4MA 5H83A 2BMDA 4JC8A 4N03A 1JQAA 4OL0A 4X24A 1P3JA 3UMSA 3HACA 1OASA 4OBWA 1PR5A 3QW2A 3M4ZA 4OHUA 3UGTA 2B1QA 2E4ZA 2R9VA 3VMMA 2IYVA 1NBAA 5I9SA 1SOMA 4FGWA 3NOOA 5LUAA 3FPSA 1O03A 1VE5A 3LFUA 2XX3A 3COPA 3W0LB 2WZCA 4OVKA 5GGXA 13PKA 2B37A 4KK3A 1W2HA 1HETA 5LB4A 3WLJA 3N8GA 3ZGZA 2P8JA 5ALGA 2A1TS 3FUXA 1Q0TA 1P1IA 3U7RA 3OQNA 2WWXA 4JR1A 4XTCS 1SVWA 2VDLB 2QTGA 1V1RA 2R751 2JGDA 5CVTA 1GAJA 4XW2A 3CT6A 4OO3A 2O0MA 5HQTA 2WB2A 1TFUA 1HV8A 5AOAA 4NJMA 4DYHA 2ASVA 1XZBA 4C06A 1E6EA 1BX3A 2RBKA 3DE7X 1K5DA 5J1SB 3HJFA 3B5JA 4RLHA 1PLLA 2QYHA 3PF9A 1A9XA 4Q7LA 2FUEA 3LK7A 1MORA 3A70A 3BTVA 3OKPA 3U3XA 2C9YA 1Y1PA 2JH8A 4WKCA 1KZ7B 1JTEA 3D5EA 3LF1A 1O6FA 1PK9A 4RETA 3GEGA 1SH7A 4TM8A 5JALA 5IJ0B 3RROA 1OI3A 3VDXA 4UBIA 2BFCB 3L7OA 5LQNA 4WKBA 4Q16A 2MSDB 1GTZA 2KYRA 4DBVO 2E9SA 3OM0A 3TQCA 1O4VA 1KO5A 1OFUA 2II6A 4RHYA 1XROA 5DHPA 1O1YA 3ZE1B 3WLAA 2AFIA 2HLDA 4HGPA 3WOHA 1EIWA 3EF1A 3QJ5A 1ISRA 4R71A 4C0XA 3H2HA 3K16A 4X1YB 2VDWA 1GR0A 3FAZA 4KXXA 4OY3A 3WK5A 3W79A 1ANKA 2K4MA 1EFPA 1NJ5A 4KYIB 2J3KA 1H0KA 1M0SA 4ZO6A 4CZ2A 5L4LA 2XLCA 1NXXA 1GKLA 1Z8NA 2CXTA 3PNKA 4I5FA 4D25A 5ALHA 4M1EA 5CEEA 3U39A 3S81A 1C7EA 4KIFA 4ACAA 4TZ6A 3EOBI 3OCJA 3L3BA 4FYVA 2LE0A 2CLHB 1SOWA 4KQWA 1RXIA 1G38A 1I3CA 2C5GA 3A4NA 4JYPA 1YK0A 5T7BA 1C8LA 2UXBB 1EFUA 4EKYA 4EQ6A 3THYB 1J0BA 2OL4A 4LUCA 3T7EA 2ZRCA 1U2GA 2PYIA 3IEPA 1GGKA 1C4KA 3B6EA 4JBXA 4K9DA 2GX6A 2MSEB 3E05A 4HF7A 3U4CA 5FJIA 2I91A 2YWEA 4J3JA 4QUAA 4CR7A 4FEEA 4RUKA 3RT9A 2XZLA 4C5BA 3QLUA 3R77A 2KMLA 2VBCA 3OZBA 4M9XA 4TRMA 3RT7A 4FEYA 5K0FA 3U44B 2RJ3A 2BSQA 4RVDA 1E2LA 1RU3A 2HK7A 2PK3A 5IYZB 2WMNB 1U0RA 2RGYA 3DZCA 1IWPB 4FZVA 5AJZA 1EG2A 1S2LA 4W1SA 5IP5A 1SVKA 4BEWA 3Q9LA 1IHPA 4M36A 2ZBRA 1W73A 4XX0A 3TAUA 4DQDA 2BW0A 3KP1A 3T12A 5B4UA 5CVDA 1NFQA 4KOEC 4MAMA 3N58A 4QOSA 2EBFX 5G0UA 3D2CA 3VOBA 1PX0A 2RD2A 3I9MA 3TIVA 1ACLA 4LF9B 3NALA 2H85A 2G4CA 3WYEA 4P4UA 4TQGA 2GARA 4BVAA 1ZM3A 1WLYA 2C77A 4Y2QA 1P7WA 1RYDA 3Q6MA 4EYGA 4WLNA 4XM1A 4AO8A 2P69A 2NU7B 4FNAA 1SO8A 3L9XA 3BCUA 5GGYA 1HDIA 2CWDA 1NDHA 3ZLTA 4FE7A 5CA0F 5I7WA 2I9KA 4JLSA 2AUNA 4OP3A 4JA2A 1E77A 1UEXC 1MGOA 4NXNB 1CUWA 3CUVA 5JHHB 1RJEA 1E3WB 3DTVB 1XU9A 3ZQJA 1MJGM 3BMCA 2ODQA 1P6XA 2X6QA 5DZSA 4BS9A 1TTQB 4EYEA 1NW5A 4L4XA 3PPYA 1EUCB 1VG1A 3KAPA 1L4YA 4RL6A 2PV7A 5AUQA 4FN4A 4DZRA 5B57C 2QT0A 1B73A 3TTUA 4DDMA 3AUYA 2WWWA 4ER3A 2DMRA 1S5PA 1YGPA 4PLPA 4RE5A 2CEAA 4GC5A 1PS0A 5EPOA 1OYVA 2JARA 1Z8HA 1JHQA 1FP4A 2AN4A 2GYVA 2BC9A 2ZW9A 1ZXBA 3OO0A 4MPJA 4QRHA 4Z9XA 3N53A 4D45A 3M3HA 1U6KA 2HN9A 3MMSA 4HNHA 2JC3A 2NWQA 2O5VA 2WDZA 4GI1A 1WW8A 4L9RA 3TJRA 5HG0A 3M3PA 1E20A 4OJMX 4A6XA 4EY8A 4GDMA 2EKQA 3HVUA 2F8TA 3TL2A 2PAAA 5JQGF 2WDPA 4Q1DA 3WRWA 1P1KA 5FWYA 2WT4A 4N0DA 1EBFA 3R44A 3T7CA 3F6BX 4M38A 2IE8A 2B20A 1G6OA 3BRWA 3W4JA 1JBKA 3DDUA 3UG6A 4L5YA 3A6ZA 4G1MB 1I4OA 1M2HA 1QDLB 4NI5A 4QZVA 4EF4A 3FNEA 2Z6UA 3AEZA 3KL4A 2V97A 3L1IA 1X42A 5TX7A 3HUEA 1MQSA 2VJYA 4YUVA 1VDMA 1KJNA 4WCVA 4C21A 1ZD2P 3D54D 5IT9A 3RGWS 3QFFA 2XT0A 4FNMA 1Z0ZA 3WGTA 4DIUA 5J1TB 3ZK9A 3UYKA 3NDRA 5ADUS 3BGWA 4J7XA 4JGGA 5F51A 5E3IA 5KHLB 3UXMA 2AKYA 3UM9A 3PYXA 1B0UA 3AJ9A 1SQFA 1SHTX 2XUOA 3GPIA 1QGED 1X1BA 2ZJ2A 4GXQA 2OHIA 1I3NA 3KT6A 2B0CA 1MH1A 2SCUB 4C6HA 4KR7A 1MAUA 4I50A 3WLHA 3PHHA 5MF6A 2X2PA 3BL8A 3HLKA 1ILWA 2ZBDA 3BTUA 3E7XA 2ZB3A 2ZI7A 1NT4A 3L0BA 2B61A 2PN1A 4TLAA 4IIEA 3R6LA 2ZTUA 4JL6A 3SIXA 1Y34E 2XDQB 4UKDA 2X3UA 1RI1A 3E2PA 1QX3A 3PS9A 3WV5A 1J25A 2CFOA 3JYHA 1H2EA 4J94A 5T8KA 3V2UA 4EJSB 5ILGA 3KJIA 4B2IA 2XAUA 3NCTA 2AQHA 5JD6A 5GZ1A 2HI0A 1J39A 4MUXA 4D96A 4WA8A 1KMMA 4ODIA 4NV3A 2C7OA 2AXNA 3B13B 2F8MA 5CYPA 4N5HX 2R7MA 1A2QA 3C3AA 5IKPA 5JS1A 3HCAA 5FYDA 1J22A 3F2VA 5I4CA 4IM7A 5KJFA 3HYCA 5E6UA 1QS0A 2AFHE 2FUG6 4H1HA 2V7XA 3N59A 5TGTA 2GCIA 3VR5H 5BQ3A 1OVGA 2Y8EA 1DI0A 5GJBA 3LW8A 3GW8A 1AMOA 4L85A 3A06A 3AESB 4P7FA 2ZP1A 3NHJA 3PB3A 3T1HB 2QSJA 4P0TA 1O77A 1OT5A 1QGUB 3F49S 2ZDGA 3I01M 2D3TA 3HKBB 4Y7DA 3QFHA 1GA1A 1C0PA 1MJ5A 3IXMA 4TXHA 2EKLA 4NZPA 5TF4A 3UMBA 1G5HA 3WGVA 5C7OO 4RY2A 3GJXC 3OZUA 4QLAA 3UHFA 3LYHA 1JIVA 2BI7A 5BSFA 3GJQA 3MK31 4YAWA 2NSYA 4ZREA 1K8XB 4Q3CA 2J5RA 3DE2X 1J56A 4ON9A 3HFSA 5A0TA 2ZWAA 4CEIB 2AE2A 2VFAA 4JB2A 1YAHA 4QG7A 3HV2A 3ME5A 3F4LA 2EJVA 2OT3B 3EZ7A 4G8CA 4D56A 4TWRA 2OV3A 2JCXA 3L7MA 2JG3A 2Q5OA 3OI7A 4D79A 3VH4A 4TLCA 2PE5A 5EZ6B 3TMAA 1I4EB 2W43A 2ETXA 2J5XA 4J03A 4Q4CA 5DYWA 3OEED 1CRQA 2X42A 4HTAA 2PO7A 1QE0A 2X0FA 3RARA 2WYVA 2LV8A 1E2BA 4NH4A 1NW3A 2Z08A 4CDNA 1NLZA 4QGAA 1WJGA 2H48A 2Y4NA 3V4FA 5KNBD 2P6NA 2WG1A 1PV2A 4DLAA 5CK4A 3IEXA 3QLVA 4RQTA 1TT5A 1XZKA 3O31A 1J2RA 2DF8A 3X1MA 4M21A 4M1KA 4URYR 1KQNA 4EMSA 5J63A 4B4KA 2W6CX 2CJWB 1X13A 1I2DA 5AKGA 4X7BA 5T6BA 2Y66A 2HA4A 1IRXA 1BCRB 4EGCB 4R69A 4A0GA 3ZCUA 1JIKA 2Q62A 1SU6A 3QX7A 4U9UA 4WZ6A 2IQ5A 4V2UA 3TJMA 4DIBA 4OGGA 4EA7A 4D9GA 3KZNA 4N0PA 2CT8A 1D07A 2KE5A 2ZIVB 3TOZA 1IJBA 3STVA 1XVAA 3PQ8A 4D4MA 3MUNA 1Q11A 2SKDA 4IINA 3A6KA 2BTOA 5C7IO 3EGCA 1Y6RA 3IAUA 1B3RA 4P98A 4TMVA 2PO5A 3WBJA 4BUZA 5B6PA 4YT5A 3RK0A 3SSAA 4DA8A 1KK3A 4NE7A 4EHDA 4GAEA 2P90A 4KPEC 3Q8LA 1FS5A 3KD3A 3LCVB 4M9SA 1ORRA 4OFZA 4C0WA 1S7GA 4MWBA 1A7AA 1LBHA 4GICA 1WOMA 5CAEB 2R6AA 2VPQA 4UXIA 5A05A 2OBNA 1UFQA 3GFFA 1JJ7A 4OQXA 4NYJR 4OAPA 1IZ0A 1R10A 3PQ5A 2YYYA 5IDVA 1S89A 1T8RA 1PW5A 3NVKI 3LUBA 1UC9A 1YR8A 1NJGA 1RJGA 3Q3GE 1YS7A 3A7EA 4UNNA 5A9SA 1QJCA 1WZNA 3VR0A 1VGRA 2R2GA 4K87A 2XVAA 2RDMA 5K8IA 5KIAA 4CHGA 4ICIA 4PIVA 1EHCA 4RVGA 3ZX5A 1T8UA 2VSXA 2MSNA 3EEIA 3IPLA 3M89A 3ZWBA 1U11A 1WCIB 3H04A 3I92A 3MOGA 4X44A 3VNSA 4EFKA 2IH5A 4HZUA 1SUSA 3JAKA 2O54A 4WZBA 1N7HA 1U6JA 2IZOA 1E2HA 1IBRA 1U4SA 3EQ8A 4UREA 1IMOA 3ZS9A 2IGBA 2VKTA 2XQKA 3A04A 5DKFA 3W7VA 5HA5A 3W6NA 3RWBA 1CR1A 4BE7B 1E0JA 5A7GA 3NYRA 1HSZA 1QB7A 3Q2IA 4D26A 3KB2A 3Q0IA 5JAMA 2FPLA 4M6WB 4US1R 3MJEA 1UZUA 3CB4A 3HEAA 1DDOA 3ONNA 5HM8A 5LB2A 2D2VA 2JIOA 3A1WA 3DBOB 821PA 2O8BA 3MF4A 4RSHA 5ESDA 4PAWA 3EBOA 1Y9ZA 3RYIA 2FLVA 2C57A 2JLRA 4S05A 5EP2A 1Z45A 2XMSA 4OHKA 5ITZB 5CJPA 3KV1A 2R5NA 2G6TA 5A1TA 1U7PA 1GPJA 2HRZA 1HDOA 2VWPA 4FGKA 4OQEA 3RLIA 4ZVPA 2FZGA 1X7YA 3FMOB 4H0CA 3EVAA 4R31A 4JLVA 1G6HA 3R5HA 4KKVA 3CWQA 3KYIB 3H7AA 16PKA 2WFAA 4QLBA 2QVZX 1WP9A 3LH5A 1QR2A 4M7WA 4COOA 1KP2A 4O2BB 5JMWA 1L4FA 4LJ4A 3H9UA 1QG6A 3COYA 2GZHA 2NPOA 4JLJA 3TTYA 4CLDA 4OLAA 1U3DA 1W59A 2JFOA 4RULA 3AF5A 2H8GA 2VHJA 1FX0A 3CNNA 3L8GA 4ZO9A 1W34A 3RAFC 3ZY5A 3UAVA 1CUAA 3ZC3A 3H2IA 4MWCA 3JQ8B 4HDAA 1B4DA 4XPIA 3UK6A 3A0RB 3LYUA 2P9QA 3T38A 3PCTA 1PG0A 1IBSA 4M37A 4C14A 2NO9A 4EWLA 3O2QB 3A6GA 3C2QA 3WL7A 1CYDA 2WKQA 3T52A 2VQSA 5CRIA 2HO4A 5E7JA 2YTZA 1C7JA 2AMJA 4QU8A 3ZJUA 2FPPA 3I4LA 1X7XA 1K2WA 2OSBA 4ID9A 1RQ7A 3G2HA 4LK3A 1GLNA 4MZDA 3CW8X 4MS4B 4UDXX 1SNYA 3ZQUA 3E2MA 2GERA 4JVLA 1Z74A 2WAAA 3DAYA 2KJQA 1B74A 5JU6A 4K03A 2ZYGA 4BNHA 4U5QA 1VCHA 4TTRA 2JLXA 1K97A 2ODAA 3CPHA 5K01A 3KKMA 3DG9A 3ED5A 3L8FA 1VIYA 2G25A 3Q6NA 4EUSA 4Y9UA 1EZ4A 4LBVA 4Y1EA 3KE9A 4ZQGA 2B8JA 2A2ZA 1EVEA 2AIRA 2FE4A 2W2OA 2VRNA 3OZSA 4R2MA 2N1BA 1RRKA 3JRXA 4DC0A 4MS1A 1Y8RA 5KJCA 4YJ2A 1ISGA 3RANA 4G0WA 1GN8A 3KTDA 3QVJA 3SOPA 9ABPA 4NC9A 1VYUA 4Y3UA 1YA8A 2W6QA 4MQMA 1DIBA 3V4VB 1JZQA 4QJ3A 2G8LA 1U0LA 2CL5A 4IKPA 4PC7A 1JHMA 3L6RA 3ZE2B 1Q83A 2IEGA 2HWYA 2G40A 3OJEA 5AKKA 2BKEA 3K0CA 4K28A 2VHTA 4G63A 3N2NA 2HK8A 4CM8A 3UVEA 3EC2A 5IABA 1P5HA 3G9ZA 3WLIA 1W75A 2PEZA 2CVOA 1X3LA 3DZJA 4ZTBA 4IG4A 3TD6A 2MMCA 4BQOA 2DPMA 3T5BA 1BWPA 3EZLA 3R7BA 2JGNA 4NJEA 1JJFA 1XMVA 2IYUA 2FGJA 3CBQA 3GGSA 4PE5B 2OR3A 2GLUA 4AY4A 1ZH0A 1BE6A 2DH5A 1I32A 4QDKA 2JLCA 4O2AA 1RI2A 1RXUA 3GRFA 4LW8A 1D6SA 1V2GA 2IY9A 3V8BA 3OEYA 2PNFA 4EUNA 1FK8A 4YRKA 2XUPA 2VJNA 1Y1RA 3M4JA 2FJPA 4G9GA 4DQUA 1OFVA 2CVPA 1K0UA 3F5DA 3QITA 4AUEA 3GB9A 4AZ3A 3ZV5A 3AEQA 2FQXA 4X5OA 2IWRA 1EKXA 3UUWA 4YMTA 3N0XA 2DT5A 1U7TA 2RAPA 1O3YA 2XNDA 1QQ5A 4RDHA 4FLEA 3LLMA 4BP1A 2HYIC 1SUDA 2GVDC 4GYYA 2N46A 3ZU5A 3M4YA 4TSRA 1A9RA 2IPOA 4J0GA 5CITA 4O4JA 1IQPA 1ZK4A 1XLUA 3JTEA 4GMDA 4K9QA 2OZEA 5FFNA 1XVVA 5EKUA 4ZWNA 5JH7B 3NP7A 2VQEB 1F2VA 1RYHA 1YZKA 2QX7A 3KYJB 1JSXA 2EZ8A 2BTQA 1AHIA 1WQ3A 2OC4A 2QJFA 3L1VA 3OO1A 4CTMA 5EJ6A 2WNHA 2JA1A 4B76A 4MR9A 2XBUA 4KE8A 1GGHA 4EA8A 2XUQA 4AWBA 4PZDA 1NVGA 1VC2A 2H1SA 3UUEA 3WJAA 5BMOA 5J4VA 3QWIA 3MA0A 2C1EA 3G02A 1QRDA 2PRJA 3TZKA 5ICCA 4Z3DA 4QDJA 3N6RA 4FJ1A 4LXTA 4E3WA 1O7JA 5LQCA 3FVQA 3IELA 5KVVA 1H05A 3WHIA 1C4XA 3T4PA 5JYDA 4GR4A 4EZEA 1NW8A 2AEFA 2IXEA 1MB4A 3JPWA 1C5KA 1H4VB 2C3PA 1E63A 3LX6A 5CFZA 3F47A 5K20A 5BSHA 2NIPA 2OVBA 3K6KA 2R5FA 5SYAA 1NXSA 5HFAA 3VR2A 3W9SA 2ILVA 3V8MA 4P36A 4UM9D 4Y2TA 1MJGA 1A4RA 3H1AA 4LVOA 5TSDA 1F7VA 3W1EA 5HDBB 4PYOA 2WOJA 3AVWA 5HF5A 3U3MA 1TYAE 3T5GA 2EW2A 1EFCA 1H4TA 2R0QC 1JSRA 4ITUA 1EVIA 3HADA 2B92A 1ZD5A 4J0IA 4LNAA 4N7BA 1KMQA 1HY3A 1IY1A 2V7WA 2V96A 1A88A 1FMCA 1IG0A 2O50A 2R66A 3F3KA 2GJ8A 3RVDA 3U7QB 1QPZA 2KS6A 4UU8A 3SR3A 2YH2A 4B3IA 4HXFB 4BECA 2D2FA 4IDFA 1KEEB 2Y9PB 1Q77A 1LDYA 4R2XA 3HO1A 2ZRPA 1WZIA 3U3OA 1TKAA 4I4NA 3OT1B 3U3KA 3A25A 2NX2A 3PICA 3PJGA 3KR1A 1ML3A 5D1NA 4ZAWA 3UWDA 4C0BA 1LA2A 4KXYA 3M6FA 2PV0A 3TDMA 4OA5A 1SKBA 2PM8A 1RQLA 4A0FA 2XT9A 3MFQA 4EL0A 4XWKA 4MV5A 5A2GA 3T7JA 1WUHS 5KYVA 3TPFA 4BU1A 2VSFA 5H1YA 3ANTA 5IF9A 4UUOA 2QI9F 4B4OA 5A1JA 2QV7A 5KJ1A 2PGNA 1F1BA 1GHTA 1O8CA 1VGVA 1Q3KA 1YBHA 2J48A 5AMXA 3V7UA 2BDEA 2H54A 3OA0A 2OBFA 3GWZA 4RTJA 1LW7A 3OJ0A 3S2SA 3G7NA 4M0LA 1R6TA 3E9DA 1GPDG 2B34A 3NIWA 2GPYA 5EP3A 4C6RA 3GUUA 3H6KA 1VPEA 1ZW1A 3MMNA 2WLSA 5KPJA 1FIUA 5DGDA 1PTJC 3H2YA 4MUFA 4X7PA 4X1YA 1WZCA 2FY8A 1LBTA 2RI6A 5DYTA 3E3NA 4X6YA 3HVJA 3UMFA 2AEEA 4F3CA 2VC2B 2ZT5A 4G36A 5CA1B 5LD2C 4KLCA 1Q6ZA 2JZOA 5TY0A 5KI6A 3ADPA 4RF2A 2B4TO 2GCPA 3NHBA 3VZPA 4YMLA 4YAKA 2CN1A 4B82A 1NKTA 5TQVA 3X1KA 4B4VA 3DDNA 1FSPA 2XMPA 4KLZA 1KAOA 2QLFA 3F5MA 4RACA 3TNYA 4J0FA 4DNPA 4GOJA 2J7PD 4FX5A 5I7UA 3REGA 3WBKA 3Q9SA 2J6IA 2R1TB 4MW2A 5ITWA 3BH6A 2NTYC 3C5CA 5HCIA 2WF8A 1V9LA 2X8JA 1T3LA 3H7IA 2WM2A 1IBCA 4DABA 3WKDA 2VH2A 1LRJA 3P96A 3E22B 2XA9A 1E6MA 4JX9A 1DQSA 3FTPA 4JXZA 1Y5MA 2X1VA 4Q34A 2A5GA 1G291 1DAIA 4BO2A 1QHEA 5J2TA 4B71A 2Y3IA 2ZYRA 1ZR2A 2H7CA 1VHTA 4JJEA 3BSWA 4D0SA 3PE4A 2IY8A 4ND7A 1RQ2A 3FYUC 1QGYA 1PKXA 1D1PA 5FTNA 1GPMA 2IYLD 4WSOA 5I7SA 4CXMA 4Q6BA 1CEYA 5BNWA 1GUZA 1ORTA 2I62A 1E7WA 2P79A 3FH0A 3DP7A 3I01A 3KLNA 4ZODA 4FC7A 1HLGA 2ZIZA 2XBLA 5CLIA 4BO5A 4D3DA 3Q5GA 1REQA 2PGDA 3LUJA 2O20A 5AOVA 3SIRA 1M1NA 3JQAD 4B79A 5LXTB 4DSNA 3CVVA 4HFRA 3OZFA 2HT1A 2J4CA 4FCCA 3WZ2A 2AZTA 1MAAA 4LHYA 4KE9A 4H9GA 1N2SA 2XE7A 1CJUC 1N9GB 1A9QA 1ZIDA 4G2TA 5AI4A 1E3EA 1NBME 5F2OA 2FSPA 3R7DA 3JZMA 4TKLA 2XUFA 1G60A 3K94A 1GL7A 4N0MA 4AB1A 4CMBA 5KZMB 4GLOA 4Y0VA 1C81A 1HC7A 2NU7A 3C4QA 2I03A 3ENZA 3GWGA 1KSGA 5H80A 1W88A 3R5JA 3LTNC 2SHKA 3IFSA 3COVA 3TDKA 2X2OA 3AV0B 3M6VA 4IBOA 3PV0A 5CVJA 4YROA 2K2QB 2PGAA 2QJOA 3FTDA 4EI9A 3OX1A 5SY9A 3D4NA 4NHOA 3LIPA 3SY8A 1ZGCA 4YV2A 3ZKAA 5ECGC 1E3WA 2GVZC 1BWSA 3DTVA 2Y77A 3QHPA 7AT1A 3VXKA 1AA9A 1XYYA 2O2HA 4TLLB 1H2RS 1Q2XA 1NV9A 2JNWA 1EUCA 3KSZO 5AHKA 2R68A 2WWRA 3O94A 1KL7A 3CVOA 5F5LA 2CHEA 4P33A 3NO4A 1YFZA 3PDHA 2XNJA 4BKUA 3OQOA 3ZHSA 1RHUA 4GOND 1BYUA 3GVHA 1B16A 1ZJ4A 1A2KC 4NBUA 4QJBA 4I5IA 2FJUA 3U4GA 1GLVA 4F6RB 8AT1A 2GXQA 3ASUA 5HIJA 2HHAA 4JU8A 3K7EA 5A2QA 4N8DA 3BDIA 5A0VA 1RAHA 1HT0A 1XQ1A 1GZ6A 1E3TA 1L5OA 4KQKA 5PNTA 3VSDA 4HVAA 3C1TA 1NQVA 5SZIA 1AS3A 4IQ8A 4D9EA 1OAKA 2Y68A 4L5JA 1ECLA 3ZCSA 4GZLA 3I3OA 1ZCZA 3E15A 1OU0A 2FI1A 3UCFA 5J3JA 2A88A 4LDNA 3RH0A 2SBTA 3SHTA 4B3XA 1Y81A 4OAOA 3GFOA 3PRHA 2EP5A 3I39X 4NDAA 2FEKA 4MKXA 1EUDB 3BQ9A 4DV0B 2O8FB 2G1JA 1PWXA 2BDUA 1HBJA 3KUUA 5EN4A 1T1GA 4H2DA 4LBYA 5A4KA 3FPFA 4PF1A 4US0R 3R3SA 3R7SA 4EHKA 1O5IA 3D02A 1CLUA 1RIFA 3K20A 4NX2A 1FNDA 3GPCA 3DMGA 3VNAA 1L0BA 2GDZA 2X5OA 2A1IA 3JQBA 1YS2X 4KIJA 2MU1A 3ULKA 3HBJA 3W5SA 4PHTA 4BJHB 3VZQA 3ENQA 3K4HA 1NUSA 2HK9A 4AAYA 1TKBA 2B4RO 4FFLA 2XF8A 3E9QA 1U9IC 4Z8YA 3UHPA 1ZNWA 2PMCA 3B9QA 4GOXA 2C9ZA 3DEJA 2UV8A 3H6GA 4L9WA 4RL4A 5ALKA 1U65A 4D9IA 3K70C 4NBKA 1B8PA 1TQ8A 2YFHA 4TXLA 4M4SA 5CW2A 3G1WA 5EQJB 4YN3A 2JZNA 1E3JA 1FYVA 1GU1A 3G5AA 1QRUA 1C1DA 2W93A 4QDTA 1BS2A 4L4UA 1VI2A 4BEVA 4AF6A 1O57A 2XDQA 5LLDA 1SK8A 3ZGXA 4EJSA 3ABOB 3PHIA 4NNPA 1UP4A 4RO0A 3S8EA 4Z3KA 3BWXA 2ZYVX 2CLLB 2XAAA 3M5PA 2EAUA 1KWGA 5DM1A 2YINC 3FNRA 1EK5A 3OU7A 3PQ4A 5EJEA 1J70A 2PUHA 3ICOA 4ILEA 4P7JA 4ZOCA 2OECA 1EESA 5AJYA 3K5IA 2ZRAA 2HSWA 1CR0A 3AU8A 5EP4A 1NAIA 4ZZ3A 4EB0A 4N9QA 5ERXA 1VTKA 2FW1A 4QHYA 4A03A 5MGBA 1B23P 5CB4B 5DNWA 3PFWO 1PUIA 2VYND 2O8VA 2PG3A 5K3OA 3AERA 1BE1A 4UZSA 3QPCA 3MTDA 1QIDA 4MLZA 3GNSA 1Z7EA 4NJOA 4DB2A 3PR3A 2RHTA 3AR8A 2AN9A 1U2EA 1VSUA 3QY0A 3VTFA 3OE7A 5ARBA 4ARZB 3SKVA 2ZUCA 2RHCA 3LDHA 3MINA 3AL3A 2IYRA 3DYVA 4LZNA 2E0IA 1ZL0A 4G56A 5CFMA 5BSVA 3HYTA 5FA6A 2Q3BA 3OOHA 4CEIA 3EXHB 2GB4A 4UFNA 2ZSAA 5LQSA 1EEXB 3RC1A 1ZFNA 4FT2A 2Q5EA 4PTLA 5ALOA 4BJ5A 4AY6A 3FTCA 3K35A 3AZOA 3FHLA 1NRIA 3FN4A 2IU6A 3B82A 3I64A 4H6XA 2YOGA 1ODCA 3ZCTA 4ER7A 3MUOA 3PC6A 4MB0A 4JZKA 4DRXB 3UC9A 5KX5F 2CFCA 4JQZA 5EJ9A 4MWOA 5JFGA 5AJTA 3PNLA 4KDFA 1O94C 3N0WA 1HA3A 3KVNA 2PX5A 3OD1A 3D3JA 1AUQA 5DHUA 3UB2A 1OC4A 2OP0A 3Q7SA 4WUTA 5JJIA 1CC1S 4FCVA 3G9XA 4K6CA 3D4IA 1UZMA 4K6HA 2PWYA 4AUNA 4HWRA 4C0HA 3DBRB 2CJWA 4OP1A 1RJ9B 1PNOA 1V45E 4FCTA 5FWAA 2ZTHA 5TQJA 2D8MA 2PX6A 4DNXA 3ADCA 1UZLA 3NC0C 3G2NA 4MVJG 5AOCA 1N0HA 3VPFA 1K7EB 1R6DA 3AJAA 4DZTA 5ERGB 2M9MA 3SGLA 2G80A 4JB3A 4CLEA 3QYPA 4Q82A 4G5YA 3PENA 4QPNA 3ZWMA 3G7UA 3Q7IA 1R0WA 4HEA1 4L08A 3MAGA 3EGXB 3D8NA 3VZDA 1VHQA 5FPKA 4QTZA 1GRNA 2NSDA 1JN0A 3GP3A 2FUKA 3IAM6 1O9GA 2ZUDA 5TPZD 3VNBA 5FKJA 2X9VA 3WE7A 4DUGA 3LC7O 5KTMA 1R0YA 3FCXA 4A91A 4P54A 1BOFA 3MT8A 1L7RA 5LMZA 2UUCB 5IVIA 3FF4A 2EIXA 2C4TA 4I1YA 4IGEA 4DWOA 1MB9A 1DKPA 3LT4A 2H57A 1A1VA 1R64A 3B1VA 4M1SA 4MWEA 4MS3B 1J0AA 2OXCA 3VC3A 1YHZA 4OYRA 1NUQA 2M6SA 3DGEC 3E9ZA 2A86A 2M6LA 1AUVA 1SKQA 3IXQA 5KQLA 4KAAA 4I8XA 2R8PA 3RIHA 1NJSA 5DBHX 4ZAZA 3NEYA 4ZOEA 2CL6X 1YI8A 4HEJA 1LI4A 2O8EA 1EBBA 4MPTA 1FY2A 3ZV7A 1BYIA 5EHXA 4KWEA 3TSOA 3ZE6A 3KYCB 2HADA 2PD6A 1P9RA 3HU1A 4MCHA 2WMDA 3I9V1 1H1LB 2OO7A 4BE4A 1H8HD 2GUWA 2DBYA 2B4AA 4WCFB 2R7KA 3C14C 1H8EA 3JSXA 2YXLA 4OGLA 3DLBA 1TRHA 2ZRIA 1TUIA 4MQ6A 3T15A 1CQPA 2UVQA 1HMYA 3HJTA 3MTQA 3LGAA 1L5MA 1QNFA 4Q9NA 5PGMA 3ZBQA 1JXAA 3VDNB 4X1KA 3EF3A 3GPDG 4LJAA 4P34A 5DK6A 5EMNA 3DZBA 2PAFA 1UPXA 3BGIA 3L8ZA 1EQUA 3PZRA 4J2TA 2JGIA 4EHJA 5D3MB 4BZWA 4XE5A 2ZJAA 4JYAB 2H06A 2AW5A 1J2UA 3U6BA 1CKEA 4Q02A 1KQFA 3GFRA 4L3VA 3RJ9A 1DT3A 3RBZA 2YJ6A 3T6KA 2OHHA 3LZCA 3OIFA 4KKXB 4WLEA 1FTWA 2ZEJA 3AKYA 4HDQB 4LZJA 4R2IA 2DEUA 1SU7A 4D9KA 5JSFA 4N3AA 5AJUA 2ZI4A 3RT1A 3QA3E 4JNKA 4K6MA 4X91A 1WF6A 1Q20A 1ZVJA 3A6EA 3QEMA 1V5IA 2HA2A 2HLHA 3E5MA 5FOVA 3VO8A 5ABPA 3E0QA 1IULA 1YRYE 2WFZA 3FVVA 5HTKA 3TKLA 5BY2A 5JRJA 4DCUA 4B1FA 1RXVA 5TT0A 3U4DA 1C9JA 3IPAA 4U63A 2PUGA 3AUAA 2VZ8A 2YN0A 4L6AA 3DAPA 5LP1A 4B40A 1E4EA 4NENA 4E3ZA 3AMVA 1VI6A 3ND5A 4M55A 5JBNA 5KHAA 1KJ9A 2G7ZA 3LL4A 3VJKA 4C4YA 3AI1A 5DXFA 1CVIA 1QGAA 3KAQA 2OUIA 3L43A 3MFYA 4LJ6A 1X38A 1YDEA 4ISCA 2X13A 1L4UA 4DOMA 2PUFA 4EPTA 1R6BX 4ZHQF 1DV2A 3QNUA 1YZNA 2VAWA 4ITRC 2BGJA 4P3OA 1PFUA 1R6XA 3FUTA 1V43A 2XYPA 1IY9A 4R84A 5DLDA 4HK4A 2NM0A 3NYWA 1L8AA 1R8YA 1USKA 4NG4A 1L4KA 2O4UX 4Q9IA 1MRZA 1J5XA 1PR1A 2Z5FA 3QEJA 3D2BA 4OQ4A 3ND8A 1CS4C 2X14A 4IDNA 3RASA 4TLEA 5DM60 1V5EA 1PJCA 3V8EA 3DB1A 1GUBA 4QIHA 3EX7C 3F9RA 3M82A 1TCCA 2QN3A 1YRHA 2XOEA 3PLNA 4YP5A 3OEHA 3ZJ4A 5JAHA 3USZA 4D0RA 4G65A 4G8BA 3EWNA 4IDAA 2WTBA 5FPTA 1LC0A 1XZFA 4S2EA 3O7MA 5ALLA 5JCOC 1WXGA 1DTWB 4PQYA 4HRAA 3U31A 4UEJA 3X2EA 2JCYA 2Q5FA 2P9BA 3WHKA 1RKBA 4YPFA 3K5HA 1Y7TA 4F91B 2OO5A 3B1JA 3FWZA 3O1JC 4CKYA 4D42A 3P0IA 3HABA 1DCTA 3LRPA 2R1ZA 3RU9A 4UD2A 3JVEA 2P2ZA 4OMDA 3OZWA 2QVBA 4OSOA 3OCUA 3NOQA 2HO5A 2XYQA 2Z4SA 4ENQA 3CRRA 3FMVA 4LDRA 2A5YB 1DIOB 3L4KA 4L16A 3UH1A 2VP4A 4HLQB 3AOEC 4MIEA 4YACA 2OC9A 4X20A 3RAGA 4W4TA 5A5GA 3PXXA 1OH8A 3JWEA 1NW4A 1ODSA 2Q1TA 4G5FA 1CDZA 2OAEA 1S2DA 4RHXA 4L27A 4HN2A 2IHJA 4B6RA 3ZTWA 4DMCA 1E4VA 4PFJA 2WAOA 4BU0A 2PGXA 4LJ9A 4EW2A 2I3BA 3HI6A 3RJ5A 3ZDDA 4LGYA 4YUYA 2O2ZA 5C8ZA 1AIPA 3M1YA 2NZJA 5HZKA 5HBRA 4E46A 2B6HA 4D8VA 1XI2A 2Q99A 4IW3B 4EQZA 1UBMS 1MVNA 2X40A 4INPA 1VSBA 4ITVA 3B7GA 1PZMA 4EBFA 1I2AA 2QZ9A 3JYNA 5A6SB 2I55A 1GUDA 1ZUD1 5HKLA 4A5SA 3DMNA 4GRIA 1B8VA 1I1OA 4EUHA 4D9HA 1XK6A 2P77A 2PVPA 4UM8B 5C1BA 4CMEC 2CBXA 4DFDA 3PXGA 4B31A 4RD2A 3FPAA 4CODB 5BV0A 4C5CA 1SD1A 1NVMB 2DHQA 4FOTA 3JSAA 1R0KA 3BPSA 1MUUA 2A0KA 1E2GA 3EIUA 3MWYW 3E3LA 2EHDA 2HZBA 3EWAA 1WB6A 4E2FA 2HB6A 2FP3A 1XEXA 1EFLA 3CVWA 5JH7A 3GJZA 1UMCB 3ZWCA 1Z26A 1AH2A 3QWHA 4RFSA 3H8JA 1U7UA 1I8TA 2B7LA 1QQ7A 4YT2A 4RMJA 1NY6A 3F3YA 3LHFA 4O3MA 4PICA 3OMXA 4RPJA 1VBNA 4UQLA 4B7XA 1SZDA 2LVBA 3A31A 3NIFB 4GXTA 3A36A 4ZZ2A 1VL8A 1CIPA 4MI3A 4BWVA 1CWUA 1GZSA 4OI4A 2OLEA 5CYOA 5DW0A 5AESA 2XWSA 1KPHA 3G2KA 1NVXQ 3FLAA 1PQPA 1UXKA 4RTKA 3O9VA 2BHRA 2NZXA 3DXFA 3ZQ4A 2IYPA 2AJLI 5JXIA 2J85A 1CQWA 1UK7A 4JYBA 5DHTA 1G5RA 1ORDA 2GPBA 2BGIA 3GT0A 3MCWA 3OT4A 4P6VF 4BAUA 4DKJA 1IHYA 1NXWA 1M10A 2BONA 2FWRA 2RHBA 3N2IA 4RV5A 2V7TA 5DEOA 1Q1NA 1QHHB 3ELUA 3OP1A 4F8YA 4B32A 1XC7A 2BFAA 2J41A 4FYHA 4BDSA 1AV6A 5DTIA 3TX6A 2WKWA 4YBRA 4F45A 4OHMA 5B7GA 4H7IA 1L8LA 2HCJB 3O21A 2JKZA 4EJMA 3EF0A 4ZD6A 2I66A 1LPAB 1UKZA 4PZZA 4QTUB 3NGMA 1LDBA 4MGEA 4JOBA 3DPSA 4TKZA 3MPUA 1BX1A 4TROA 3WZMA 1JH8A 3U7QA 1ZOPA 2I7TA 4FDTA 4UC0A 2FSSA 2VDRB 2JJ1D 4JUAA 4QO7A 4OQNA 4EIWA 3H16A 1KEEA 1N6NA 1YL5A 1ZHHA 2C98A 2D2IA 2WSSD 1X7WB 1KI1A 3BMNB 5FUWA 1SXGA 4JX8A 5D3KA 7ABPA 2IF2A 3QF4B 1GTL1 4HLCA 3FXAA 1L7XA 1JXMA 2J0QA 4BEBA 1FUUA 7ADHA 1Y0BA 1C3LA 1OHHA 3D3WB 1LJUA 4MUGA 5LBTA 3WLTA 2RGRA 2VHUA 2Q3LA 2EU8A 5AJVB 1CQIA 2A4KA 5DWQA 3TZCA 1KI8A 2ZSDA 3KZKA 2W2MA 3V7YA 1EG7A 2D7CA 3SSOA 2ZK7A 3W5BA 3D6VA 4AX4A 3DHWC 3M5WA 1KGSA 4HWGA 3ESAA 2OV6A 3GOQA 5U4XA 5BN1A 5JAQA 4TKMA 3Q3HA 4DLZA 5BUQA 1Q0HA 1SVNA 3SQLA 1U5CA 2JLAA 2GI4A 4KPFC 4EI2A 3FOEC 4C2UA 3OOWA 1VM6A 4H6VA 2EKDA 2XTNA 3FDZB 4O4IF 3CLUC 5ALTA 4GMKA 3X3HA 2DWQA 4ECAA 3R8XA 4GE0A 2BM1A 2H63A 3TLMA 1BGXT 4JNCA 3S68A 3TLYA 4Y6PA 2VK8A 4K5QA 4KO3S 3BA1A 3VJRA 2DQKA 2YXPX 4MUYA 4O4LA 3L4BA 4B73A 2EJTA 2FEPA 3ZLBA 4NZZA 3IUMA 2H4ZA 3LRXA 5CNMA 3ZK7A 4PSKA 2CMDA 3AJDA 2XBMA 1YVDA 4OYLA 4AF7A 4PQGA 5IHXA 3X0DA 3GVIA 4FWBA 2JS7A 1WO8A 2XXJA 3OAAD 3LECA 4WNIA 3RFVA 3VMFA 1KRHA 1Q92A 2E82A 3CUUA 3F4KA 4LGMA 4V03A 2XA2A 4YRDA 4DT1A 1DU4A 4JLNA 2XRMA 1C2TA 4DYDA 3AEKB 3WJ1A 1KNXA 1YDGA 3QEAZ 1CU1A 2Z6AA 1YKSA 1U3FA 2H1CA 2K6GA 3PUVA 4P38A 2BKAA 1SUAA 1DWQA 1WU7A 2H00A 2V58A 2PQ0A 2C9CA 4JBIA 2A9OA 1W49A 5E1DA 2OQVA 4CT0A 4J90A 4JDPA 3E22A 2ID4A 2RC5A 1NQAO 4IJMA 1IXSB 4AUMA 1M8FA 4BRZA 4H7EA 1KY3A 1NGSA 2NNWB 2NQ2C 3DS8A 2F3RA 1VYTA 3L77A 4C0JA 1MFZA 4BBAA 4FM9A 3BIOA 1J9ZA 1MAVA 3AIMA 2EFEB 4UBLA 1GZ7A 2XV1A 3AJEA 3GEPA 3BJIC 3MWEB 3ZXSA 4DCNA 1SA0B 2H5JA 4YVFA 4HUTA 1TU0A 2IC5A 5I7AA 5C5CA 1JHZA 4XA8A 3HNOA 4KXQA 2QE7D 1NI5A 3VZRA 3UMYA 2VJBA 2PGJA 3EXFA 3RB8A 1Z2EA 4Z4EA 3DMHA 3T3GA 3ISTA 3RYHA 3BDVA 3CSUA 4U0JA 4OXNA 4CEJA 4PM4A 1GZ4A 2C2ZA 3OCZA 3IP6A 4PSUA 4PZPA 1IAVA 3LKZA 2V6BA 3C7DB 4RMIA 2OCBA 2V7PA 4FMCB 1B1CA 2ZPUA 2EBHX 1UJCA 3N74A 4NFSA 4DJFC 4BCBA 1ZD4A 4QUGA 3G1UA 2QLLA 3LM8A 4IIYA 4ZVUA 1B0PA 1RWKA 4LY0A 2Z2ZA 2BR5A 4JL8A 1Z07A 4Y6RA 5BSTA 5ALYA 3ADBA 3FHJA 4EK9A 1XB2A 2UZ4A 1NI3A 2I6UA 3DOEA 3VDMA 2ZFUA 1RLMA 1PWHA 2ODEA 4H7JA 3DE0X 1KHTA 1AQJA 4TYMA 3RSHA 1N5DA 7MDHA 3QELB 3VKUA 3W5HA 1T2AA 2R1VB 4RPKA 3O8CA 1WPXA 2VHZA 3AK4A 3O8LA 3KXPA 3G8DA 2I4MA 2G9ZA 1XCBA 2Q5CA 1EHYA 3BL6A 4YDHB 3V1LA 1YR2A 4DCVA 1JB9A 3SU8A 4FUTA 4U02A 2FE1A 1YO6A 3RUIA 3SMQA 4BGUA 3LTEA 2Q9UA 4LC0A 1I80A 2O4CA 4YCCA 3TTTA 4KIWA 4RJLA 1R4NB 2FFRA 4RD6A 5T3UA 5JNVA 4K3VA 3W90A 2VCEA 4YRAA 3BDAA 1KBZA 1U2DA 3GLUA 3R6GA 3F8TA 3LFHA 3NASA 3PUIA 5TMBA 3TJZA 5JECA 3U7FB 4R2LA 2NP7A 3KLBA 3BREA 4CKBA 2FLWA 3COZA 4QAJA 4F6RA 3ZHZA 3AF4A 4LCJA 1RKQA 3FETA 5EZSA 4ZCTA 3SHFA 1KRWA 2VZ9A 5IM4F 1NQOA 2QR5A 3FZNA 4FEAA 1N25A 1NSFA 4LWPA 3GDOA 4JD5A 4OFWA 4YEDA 3SAJA 4E2WA 4CLRA 1EUYA 1V39A 4R6WA 2QVLA 1DKRA 4OHPA 4PHGA 4LZPA 3ETDA 1TYZA 1MXHA 1L1EA 1T9GS 1J90A 1Q3TA 3VX4A 1ORHA 3JATA 1B41A 3AL2A 3FPLA 5K7SA 2RE8A 2Q45A 1FNMA 3ZU2A 5A4JA 1ODFA 3E7PA 4FR5A 3S2GA 2Q50A 1KAGA 5C31A 4AXXA 8MHTA 2FSFA 3IKMB 2O8FA 2GA8A 5M3BA 1YE3A 3V1UA 5EMMA 1M6NA 1QV6A 1JKXA 2OXEA 2JAUA 4DA6A 4I6GA 4D8TA 1OROA 3K4PA 3EIQA 4C03A 5A7FA 4FSDA 3KUKA 3MELA 1I6MA 2VH1A 1CHDA 4M0DA 4PCAA 4R2WA 3UXYA 1IOZA 3UUGA 3PL1A 5ENDA 3QFCA 3MTIA 2W5UA 4JUIA 1KAHA 5CYGA 5E95A 1J23A 1LPMA 1ZNZA 2ZE6A 3JQAB 5BMVA 5C7LO 2HUPA 2PFSA 5IPFA 1W85B 1D0VA 4R0VA 3PPWA 2OAQ1 3KHUA 4JKIA 1MRNA 4TMWA 1BO6A 1C2YA 3GFTA 4OQZA 3TVTA 1W4ZA 2HOQA 4INJA 5ITSA 3TF5A 3G8AA 3R9WA 2N0SA 2ZRQA 3ZI0A 1NVEA 2AMYA 4RGBA 4AKGA 2G5TA 2DLNA 3ND9A 3OLYA 3WADA 4A6PA 1I7QB 4A73A 3R9IA 4BVJA 1NR5A 4EG1A 4TS3A 2PS9A 2YMMA 1DX6A 2DPYA 3R3JA 2AL7A 1Q50A 1W29A 2DFLA 1VBMA 2HRBA 1SR8A 2QL7A 3LQ1A 1VDZA 4Q4DA 4R6XA 4WVLA 3WAJA 2VTBB 1Z13A 1AHNA 5JJKA 1KNQA 5L3SA 5KYWB 1XNRB 1L4EA 4URVR 4D6XA 1TX4B 1ZM7A 2IOFA 3E9CA 1ARZA 5CGQB 5K8TA 3LA8A 2DKNA 2D2XA 1KORA 1TB4A 5IAJA 3F3SA 2Z3WA 4DIOA 2E4VA 2A5JA 2L17A 3ET5A 1VG8A 3DE1X 3OTIA 3LO8A 2C4NA 4BO3A 4YR9A 2EF1A 1H2FA 2NV6A 4CTKA 5K2OA 5LDGA 1ZWLA 5FUMA 3K6SA 4XUCA 2AXPA 3ESRA 4N48A 1FMLA 1RIIA 3SJZA 4AS1A 1ISPA 2BHLA 2D13A 2GASA 2I7XA 2PT7A 2YOHA 4YONB 4LHEA 2JW5A 5JSQA 3HZHA 3P2JA 1GDDA 5H3HA 1B8NA 3FOZA 1J2EA 3A9UA 4OV6B 4X00A 4DMLA 5M7EA 5FI5A 1ZPDA 4RGVA 4I08A 1LI7A 2JCSA 3GLQA 4MW9A 1WF3A 2J8ZA 2H92A 2M1ZA 2WOOA 2DFVA 2CHFA 3GDGA 3QG1A 3QTBA 4BPRA 4BV3A 2PYZA 3VQTA 2C5EA 1KF0A 4J4TA 3HPQA 5H9WA 4ZP1A 1RKVA 1FBTA 4RHTA 1FQOA 2ZG6A 1I4TD 1XQ9A 1Z75A 1JIUA 2FMKA 3KZXA 5P8WA 5ADVA 2V7QD 1CZNA 1GFSA 1AVTA 2BKUA 5JAOA 3NH9A 1XAJA 2QT9A 1Y6GA 1N78A 3T94A 1FFWA 2ZBEA 4RK4A 5EFOA 1HE4A 3FY4A 1W4AA 2PUVA 1JHPA 1S2OA 3SQNA 1F2UB 3W3AA 4UUNA 1U81A 1CZLA 3DAFA 2O05A 3BOSA 2QX8A 1OMOA 3GRPA 1YL6A 3IR6A 2P78A 2CCKA 2JATA 4P82A 5EZYA 4ZYYA 5HHTA 4I4TA 1A8HA 5B58C 3I12A 1LK0A 1O94D 3C1UA 2OBLA 2NSHA 3UQYS 2FWNA 5EQFA 2H1WA 3IESA 4MLDA 2JKVA 1P3Y1 2NTNA 2O1XA 4AI6A 2Y1KA 5H16A 2IHZA 3AHIA 1E9DA 1AT1A 1R4MA 3SEZA 4HMQA 1E2DA 4ZRDA 3NLLA 3N2ZB 4CDGA 1W94A 3PXBA 5LOVA 3LY9A 2NUTB 4QPPA 4WKOA 1I4WA 1URPA 4LNHA 1MNQA 1E0SA 3LVBA 4ZI7F 5DEIA 3DFKA 4E1BA 1DAOA 1NY5A 3EGXA 3R5XA 2G77B 5ALEA 5I8ZA 1IN6A 4AT1A 2VK1A 4F2PA 5CDGA 4I19A 3KQUA 5FR1A 1VLLA 1FZQA 4GC9A 1YUBA 4JJ8A 5FBHA 4WESB 4IY1A 1ZMOA 1L5GB 1A5TA 1N3BA 5ARDA 1PJ4A 2BH2A 2QN2A 3R3UA 2W9XA 1X70A 4M98A 3JQ7B 2Q2WA 1IK6A 2B1RA 2Q1UA 4FI3C 1BGVA 1MABA 2P9JA 1CTQA 3I5UA 3ITEA 4MV3A 5F5NA 4JOCA 1FXWF 3O3OB 4X63A 4Z7NB 4YXWD 2QTFA 4KQ6A 1JG1A 4I6EA 1M0EA 1FMTA 1GSIA 2QLBA 2XCOA 4IGKA 1X1SA 4L6CA 2QP3A 2TRSB 3D7KA 3KBBA 3ZWWA 1HG0A 2EFGA 4MW6A 1EVJA 3DNMA 4UHBA 5CLJA 2B69A 4LYAA 1U3CA 3HB4X 4K26A 4C0SA 3CZAA 4N5MA 3WGLA 1MVOA 3TSZA 2VNHA 1QRRA 4G26A 4MUJA 4MVXA 4R9UC 4MRMB 3DUFB 4F1JA 3AVXA 2IUEA 1PFKA 4FGSA 5C2JB 2JF0A 4DLWA 5IN4A 3TZ6A 2A3RA 1O95A 3RYCB 3M34A 3OOSA 5DI9A 1FLNA 1K7YA 4JI1B 2XF2A 3KXLA 1X8XA 3IIJA 1MDBA 2J9FB 4G07A 2CNLA 3USES 5I47A 3OCYA 3H2GA 3OEEA 2BEVB 1FTSA 1Y7LA 3HY3A 4NY1A 3E0XA 4QDOA 4MIOA 5JTUA 3RU7A 4W7IA 1NZDA 2FW8A 2J3JA 3DNPA 1H42A 2WYIA 3V7WA 5KNBA 1RLJA 1ZP6A 4K6FA 5J2UF 4O2RA 1Z5WA 5D3MA 4QUIA 4CIYA 1UANA 4LOLA 3VTAA 4W8OA 1NI4A 2EX1A 4GI7A 4N0QA 2GPSA 3IT0A 5JT1A 3SFVA 1QO0D 2ZRKA 3FTQA 3G8CA 4A82A 1BIFA 2AH5A 4C7BA 3ICVA 5DSTA 1QP0A 1N9KA 1P5JA 3IKTA 2LWIA 3G89A 3KUCA 1KJIA 1KI3A 1E7YA 1JBQA 2ZYDA 4FBMA 4OGFA 2GD1O 1YI0A 3DXXA 2XKBA 3IHWA 3Q15C 4OUDB 1UBFA 1VPLA 3OCXA 1FDVA 1IBKB 5CVUA 2JJQA 2DY1A 3B38A 5EJFA 5HZGA 1QIMA 2ATCA 1ZO8A 1QX4A 3CLSD 2YJNA 3JQGA 2YIVX 1T25A 4RZ3A 4XGQA 1GPYA 2QMYA 4MJXA 2XODA 1HL3A 1GNVA 2BMAA 3OURA 4I9HA 4LVUA 1X7GA 1I2CA 3DW3X 1NPYA 5HIAA 2C5BA 4QRIA 4LF8B 1RTKA 3INTA 5AW6A 4QJ5A 1EWRA 3U17A 5GP1A 2RGNC 3JWPA 1X80B 4PAQA 1VB3A 3ONEA 2QZZA 2ZI3A 4AYXA 4JFRA 1XFDA 3WRXA 1TDJA 3RC7A 1DQZA 2YWGA 2XT6A 3N76A 1EPUA 5I9IA 4WBNA 4MVJP 1BXGA 1P72A 2H1OA 4GIBA 1YB5A 3IODA 5FA5A 1WBJB 4NMXB 4B43A 1AJEA 4A7PA 4QT0A 1T3SA 2ST1A 4D3XA 5SZJA 2ZB4A 1JAIA 3KVVA 3HA5A 4QU5A 2ZSKA 2OCYC 3UJDA 1F48A 2WIDA 1QF6A 4J8PA 3IEKA 5EHQA 1MV5A 3W4IA 4FFWA 2W6ZA 3VPGA 1VRCA 5D7BA 2GBLC 2YXEA 1PDWA 4R3UC 1LTQA 1XF9A 4KP7A 2M6KA 3S8MA 4BVGA 2BPOA 1GUAA 2DAPA 3BZUA 1ESEA 2FEAA 2QAGA 1WB4A 4IH4A 1WQ1R 4FI3F 1T6XA 2P0AA 3X1YA 5BUSA 5B1YA 2FG6C 3H8SA 4KQ2A 1UJBA 5JPIA 4MHOA 1KDYA 1DTWA 3HU5A 4WAUA 2PS1A 2XYHA 3C3WA 1OVMA 1NXOA 2IU4A 3QVGB 2Y0PA 4EEKA 5IKOA 4G4SO 1W5TA 1YQGA 2VTKA 4C5AA 3SX2A 4WKPA 5EAIA 2ZRHA 3NHPA 2NVUB 3VNUA 2VYCA 3LHKA 4NOLA 4IGAA 4E13A 1ZCFA 4OAQA 4GUDA 3OG9A 4OSEA 3WQSB 1GAQA 1OBOA 1ZK3A 4MV8A 5CP8A 3VV3A 3G59A 1E8NA 4YRNA 2XRYA 2OXIA 4IS3A 5KNDH 3WLOA 3ENKA 1BKYA 1FNCA 4UUBA 2OBXA 5HKKD 4ZV9A 1G3RA 1NPTO 4XRRA 3KR9A 3TCXB 4NBNA 3UT5B 2C5AA 4AS3A 2CDBA 2COUA 3A7DA 3TIXB 3NWPA 5CCEA 3D5QA 3D6MA 3FPKA 4ZXPA 2JLYA 1GUFA 1XQ6A 4QQFA 5JS8A 3HXKA 2VPYA 4EEZA 1FC0A 1E66A 2Q3HA 4MGZR 1Z6QA 4FB5A 1JQBA 1BDMA 4I9GA 3G8YA 3O84A 3CURA 4ZVSA 1E7MA 5E4YA 1TIPA 3Q41A 5JPCA 3CZ4A 4Y6LA 2M98A 2O3QA 4XLZA 1GCAA 2VF5X 3IO5A 3L02A 4XKJA 5AKEA 5A6SA 4IWXA 5CG2A 4B74A 4OG2A 1EFVA 1V8FA 2LIVA 3LYLA 4FJ0A 3FSEA 3RUHA 4RHUA 1UK9A 2AWOA 3HNRA 1F3OA 4D6YA 2GXUA 1TYDE 2WMYA 3HLTA 1DDGA 1CRZA 1O58A 1U7ZA 1Z62A 3BRSA 4IO0A 2HWKA 5IW8A 4B4UA 1A50B 4V1CA 4ARBA 3HDGA 3A1CA 4MJ3A 3WLQA 4JEIA 2HNKA 3CSSA 4GM4A 3X44A 1TQ2A 1Y1SA 3EVZA 4BP8A 1TU3A 4TTPA 4EF6A 4YQFA 2V0NA 5DGCA 2FOXA 3CJQA 3WK4A 5LDHA 2B25A 4G25A 1RQPA 3O2JA 2Q6TA 4UVEA 5AHWA 3S2YA 4P5DA 1XTIA 4C29A 5JBQA 1SCAA 2AZDA 1WD7A 2WHPB 3LZ6A 3PPXA 4PR3A 3KJFA 3ZV6A 5E0OA 2JK0A 4CKCB 1NQUA 4HNAA 3TZBA 1Y3FE 4CMKA 4E22A 3ZDEA 2J9YB 1NLMA 3UKOA 4IIJB 1IZ9A 2MSWA 3DL0A 3IP1A 1IXZA 4CV0A 1GQQA 1OIWA 3EQ9A 1JV2B 2G04A 3O4VA 4MQUA 3ZHYA 3C3YA 4FYWA 2JFXA 1A9PA 1PYOA 4TRJA 3DKRA 2RHLA 1XMOB 4GWKA 4L0DA 4QGFA 5CM2Z 3DV0A 4K86A 1USWA 2PMWB 3EFHA 3MXOA 1R8JA 2HREA 3C6QA 1QHHA 4Q1FA 4ZT6A 4D0GA 1DKOA 3I1FA 4RA9A 3IPCA 3UCXA 2WSMA 4JQYA 1D6NA 3QBJA 5KC8A 4HS9A 2YJTD 4YJGA 4LTMA 4A1OA 4P31A 2QTHA 3RF7A 3BQMB 2ZRMA 4G67A 4DDUA 4CKZA 1QYWA 3FCEA 3MCVA 1TTHA 3DONA 3B51X 3I5XA 1RZRD 3VV2A 5HBGA 1JG6A 3H2KA 4CCWA 4NMWA 4X6UA 3Q40A 3SR4A 3GA0A 1F0NA 4FVTA 3B3GA 1CEQA 5L53A 3B6MA 3BMNA 3Q9NA 5AVQA 3AGPA 1V1MA 5T4BA 5KOHB 3UMGA 3QF4A 1KIMA 3JU3A 4M9UA 4EY6A 2D5LA 3Q3VA 2XGGA 4EGFA 5L6LB 2P3OA 3U81A 4N65A 2RGDA 4URHA 3CTMA 4ECEA 4ZCSA 2XSZD 4AO6A 2GKGA 5G53C 1WY7A 1K8RA 1ZH8A 4M1OA 3UATA 1GO2A 3L0SA 2G09A 2CLSA 1X7ZB 2POQX 1R0RE 1K4MA 3IS3A 3QHQA 4LSGA 4JC4A 4H1UA 4QGBA 3EE6A 4HDRB 4LXYA 3KPJA 1TCAA 4HB0A 4FOOA 1QR6A 2QDKA 1KJQA 1NE7A 3N3BC 2ZWIA 3ICEA 3A3OA 4MYCA 3I23A 4WWHA 1UZAA 4B2PA 1QV9A 4YMHA 4LRWA 3MOSA 3QXHA 4M7RA 4KCGA 2V54A 1LNSA 1QMPA 2BZSA 4EGJA 4RELA 5H7XA 2FRDC 2HJGA 1XNQB 5B36A 1L3IA 3RDPA 1AUXA 1JT2A 2RG7A 3JAWB 4ZOLF 3VR4D 2B9EA 5AVJA 3D3EA 2X8AA 2FPRA 4FDVA 3ZD9A 4O8ZA 1F4PA 5BRJA 1FSFA 1TJPB 2VBFA 1E2KA 5E3HA 4DANA 1TIKA 5ANRB 5BR8B 2SNIE 1KHHA 2XCSB 4YP9A 3G49A 1SHJA 4S2UA 4WRRA 1NNEA 2IHVA 1YHYA 1MO3A 1WB9A 1FDIA 2JI9A 1OGYA 2X86A 3AHJA 1QORA 3OMWA 3WWOA 3K31A 4NZ9A 1E9RA 2PKQO 3SDBA 1D4AA 3PA6A 1PV1A 5EE3A 2AG1A 4Q7MB 1RM5A 5E4FA 4REMA 1AV7A 2VEDA 1KMHA 5HOQA 1KXJA 1LTKA 3NNSA 1ZN2A 3I45A 3SJ7A 5MFPA 4W5OA 1UBLS 1OGJA 5JW6A 1SQSA 4D9BA 2VQFB 2QD3A 1LPBB 3KYBA 1WMAA 3LX4A 1YAJA 5LA6B 2E4YA 2EL9A 2XDAA 2AR0A 3GLHE 3W3ZB 4F9TA 5DXAA 3GNQA 3V33A 1P1JA 1YKFA 4AMZA 1W5FA 4BNLA 4BQSA 1IM2A 2DRIA 1DWUA 4M22A 3QFSA 4PXSA 3PITA 3QV2A 4ESOA 3P45A 4R5MA 4LE0A 1QH1A 3PQFA 1I5RA 3CUWA 5CBKA 4KYVA 2D2EA 3UW3A 5CA0A 4HQ0A 2ZI9A 2XQFA 3BZWA 1KZ9A 1TJ3A 1XTKA 3R5FA 3U40A 5JNWA 1TEZA 1Y3DE 2AX4A 2P8SA 2P9FA 2R00C 5AYVA 1E7QA 5BW4A 5JZ9A 3MMZA 3BXGA 4RK0A 4CFYA 1TJ5A 4DNFA 2WUGA 3VPHA 3LQFA 2IYOA 1TO1E 1WDTA 3GFPA 2R4TA 1VJ0A 4HL6A 3SZGA 4UUQA 3VU1A 4CKWA 2DERA 1OXSC 3Q85A 4MRRA 4ZKDA 1CB7A 1CUYA 3UMVA 1A3CA 5DTJA 1P18A 1U3TA 3WXMA 1YB6A 3LT2A 5C0OE 1RI5A 1U8YA 4F21A 2R8ZA 3PFBA 4NV0A 4CMHA 1C29B 1A69A 1YZYA 4N49A 2XRFA 3TDNA 1ZMTA 1E6WA 2J0UA 3PVZA 1JWBB 2GZSA 2BFFA 1E8MA 2A0FA 2PBZA 1BW9B 2G9VA 4CIXA 2AOTB 3IAS6 2FV8A 2ORVA 3QUQA 1JE0A 1RLTA 3DCYA 4BRWA 3TI7A 4BZPA 3NUZA 3IP5A 3K4QA 5IF3A 4LJRA 3EFOB 4Q7JB 4RS4A 1FYXA 1JJAA 5AKIA 1ID8A 4LJSA 2QTRA 4X95A 4CETA 1N2CE 4HJXA 2B4KA 4IZIA 3RSZA 1WTAA 2QYSA 4GPD1 4HPWA 4CIBA 1MV8A 1U8CB 1UKEA 1V8PA 2J7PA 2WHQA 3WYBA 2FZLA 4HAZA 1I2ZA 1NXPA 2OORC 3INRA 3QU7A 4FHDA 4UNQA 4AWXA 5HCNA 2ZUFA 1M2VB 1OJLA 1U9YA 3GN2A 5IKEA 4BLSA 1L4HA 4CG1A 4OJKA 3UCEA 2Z0MA 2WIFA 3KT3A 5FOTA 3OA2A 4LWOA 3E5HA 2UZ0A 1U1CA 3W6ZA 4EARA 4L4ZA 3CNBA 3DCJA 4IH1A 4LX0A 3T9BA 1G8YA 1YBAA 2WTNA 3IHKA 3NHSA 3A4YA 2YUIA 3H2ZA 2Y0EA 4Q19A 4Q1VA 4AK9A 3NHKA 1DRWA 1VIMA 2ISQA 1RKXA 3CMMA 4K9PA 1NU8A 4W7SA 3ZI7A 5DT2A 2KW5A 1NP6A 3BHMA 2L19A 1X9IA 2QL5A 1B00A 2AKAB 4RGYA 3T4XA 4BAGA 2FF7A 2QROA 5HYVA 4GPEA 1CY1A 4I1SA 4Z8XA 2BBWA 5K99A 3EEYA 5IJXA 1T1SA 1BU8A 3WWEA 3DWFA 1JDUA 4RXTA 5ALFA 3GRYA 3AKEA 1P5FA 1BHQ1 3GMSA 3E8MA 3ML1A 4NBVA 4Q1BA 3L6CA 4WKNA 5GM2A 4ZV4A 2HDHA 4BMZA 4AZ0B 1Q0RA 1DXHA 3JQAA 3I6ZA 3C3PA 2O52A 3ECAA 2ZQ5A 2WQ7A 1OFTA 5TJ9A 5I9BA 3T7IA 1M8KA 2GF0A 4AMBA 3OETA 4GOOD 2XR1A 2HKIA 3O26A 2ZIXB 2AG8A 2SICE 4GXRA 4LJKA 3SX4A 2QE6A 4JP8A 4PZUA 1B6TA 4CG2A 3RFTA 2BGWA 3R3YA 4BNDA 2AXQA 1Z0KA 1JECA 1QZZA 4BFSA 4DR6B 4DC1A 3T06B 4OIMA 2JAQA 3V42A 2VTBA 1HRDA 1FVHA 2BM8A 2CZCA 5KYWA 1ZITA 3G2JA 4R41A 3KHSA 4OK3A 2JJ8A 2XGOA 1CY6A 1FYWA 3NVDA 1Z4OA 2OB1A 1S3FA 3RU3A 3V5NA 2O19A 4MH0R 4N8SA 3JQFA 3VYTB 4BJ6A 5JXJA 4WXEA 1VLHA 3LBAA 4QG3A 3IB3A 2JCBA 3RIXA 1EMDA 1NF2A 2YY7A 1UINA 4WUVA 5TS3A 1H0HA 3BWVA 1PSZA 3DEIA 4L1KA 3FDJA 5CLQA 2WHXA 4JUDX 2QUBA 5CHYA 2YNMC 5ILOA 5DGIA 2V0GA 4NR0A 1VCMA 2H2WA 4KU4A 3GLRA 2JPDA 2QZSA 4MI6A 2HSEA 2LCFA 3K8QA 1CCWA 1RYMA 1T10A 1U1GA 2COKA 4I0WB 1UK8A 2G5PA 3B3AA 5JHGB 1UDXA 3GIWA 4FFSA 1DAGA 3KAJA 3V8VA 5FUVA 5KX5B 1CE8B 2BBTA 1X1DA 1N0UA 2C7VA 1FPMA 2J59A 3KB1A 3MAAC 1NRXA 4XJVA 4KK4A 1L9KA 3DZ8A 4DUYB 2O0LA 4UHJA 5DIFA 5B3KA 3HSYA 2IJGX 3AM3A 1OCEA 3DEAA 2C4MA 4FZ5A 4OHCA 3ABZA 3BTOA 2CLOB 3KEOA 4HEHA 4AECA 4C4RA 1ZICA 1U8UA 3B6IA 3BXHA 4ZIRB 3QEBZ 2VT7A 1J8YF 1M1YB 3P1JA 3K2QA 3NEJA 1R0LA 3OZAA 1F2UA 1U28C 4L5IA 3VKGA 2H07A 2YV5A 1P74A 5M5BA 1MAWA 2ID8A 1G8FA 1OF1A 2O7QA 2R8YA 3EAFA 2YOFA 5LIPA 2WVHA 3S27A 1KYZA 1UBHS 3F3MA 2XXAA 3EPHA 4BLQA 1LB1B 4R7ZA 4JLBA 4E33A 4EPWA 2NU8A 1Z08A 4QVIA 5EIOA 2JJMA 4FFVA 3ANMA 3FFTA 1A4IA 3PU6A 3F71A 4N6OA 3TFWA 4DC9A 4YCSA 4XQGA 1XYGA 3PFGA 4JI5B 1B42A 4U7DA 1UM9B 2IX9A 3REFA 4A2WA 4X1IB 2CL0X 3L82B 3PSAA 5DYYA 4M7PA 3EAGA 1JVBA 3E9YA 1QIKA 1UP7A 1JVSA 1YNOA 2GEVA 2QW1A 2VNSA 3FIJA 4GX0A 4HY3A 4K8OA 1QIHA 1EWKA 5JANA 2JD2A 4A92A 3TTWA 1ZBQA 4QJ4A 1YMQA 4IMRA 4RJTA 2NTJA 2LP4Y 3AHHA 4QVGA 1Y9DA 1ZQ1A 1CEXA 1D4OA 1KYIA 3ZE0B 4XVUA 5JI2E 4WESA 5LQUA 4NAVA 4IHJF 3M2PA 3K9BA 1MO6A 4KPUB 4P7KA 3T1TA 4KUHA 5B3AA 3BK1A 2WWGA 3Q9UA 3LIIA 2VYNA 1DBVO 3D59A 5BWMA 4P0QB 4KXFB 2G3YA 2BGMA 4D4HA 1CQZA 1W47A 2IP2A 4XIGS 1OA0A 5B53A 3REQA 1NF3A 1FFCA 2G0NA 1NL3A 1Q1ZA 3HA7A 3IIIA 5AT1A 5AW8A 3OQMA 4ZZIA 4CMIB 1MAHA 1CJKC 1SCBA 4EPXA 2MSCB 4Y2VA 1MQ9A 4C4ZA 3GVXA 4D8WA 3S1AB 1XEAA 2ZJOA 4MI9A 2F48A 3GROA 4EH1A 1EFRD 1QLJA 1O96B 3HL4A 3ILHA 1XU7A 1WP4A 3GHHA 1TJYA 3FYDA 1TPYA 2H08A 4HYTA 4LYHA 4MRMA 2OHXA 1M8JA 2WYHA 3F5SA 2HPVA 4H1TA 4J1TC 4Q0MA 1GU7A 3G8BA 10MHA 3JWIA 5SICE 4KITB 1DFHA 1PN3A 5EWJB 3PJRA 4L5BA 1JI3A 5EG5A 4YJFB 2XUAA 4CI0B 3RYCA 2GN9A 3OBIA 1WXXA 4QGGA 1ECCA 2VDOB 3RVNA 1L2TA 3GJRA 4L8WB 1XZEA 4J49A 3AIKA 3RBVA 5F77A 1W6RA 2JIQA 5C3MA 3ENVA 1RPJA 4JH0A 4QECA 1IY2A 4X45A 1W4BA 3MUFA 1JT9A 1XZNA 3SZMA 3E1SA 4WOCA 4KVAA 3MWDB 5JJBA 3MS2A 2WU3A 5AKHA 1W9MA 2P75A 3QU4A 4MWGA 3RVPA 4NU0A 3UYLA 3G5LA 1NVFA 2GM5A 3COSA 5BRNA 1OYWA 4HJRA 4B3BA 2CJPA 3VBCA 2IA5A 2GNPA 2JBAA 2ZANA 5TC4A 1LVGA 2B21A 1N7JA 4DCPA 1RCTE 1ST2A 1Z4NA 2WKPA 3PQCA 3QNMA 3TD9A 4OUDA 1WMDA 1SULA 5J4LA 3C45A 3HI4A 2VF2A 1Z2CA 4KEAA 4KH1A 3RS9A 3SZ3A 7REQB 5EMLA 2MYPA 1SCUB 4Y9SA 2WJWA 2OD9A 2I3DA 4ZHQB 4R8VA 2A9VA 4EY4A 3AF2A 1OWPA 3USCS 1MT0A</