3ZKLA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotriose
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
molecule keywords PUTATIVE SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
total genus 143
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA02
5CMMA 2OWTA 2PMSA 4GIZA 1FQAA 3G3GA 2O84X 2V3TA 3GLBA 1H43A 1XVYA 1B4HA 2V3QA 1B3FA 4JDFA 1MQHA 3RT6B 4MF3A 5DVIA 1OVBA 5L9MA 4LATA 3FXUA 1A40A 4YICA 4IGRA 2D21A 4XTCQ 3TPAA 4LZ7A 3QXMA 3MPLA 4RPOA 1I6QA 4WKMA 4OVJA 1QJMA 3CSBA 4MH5A 2QS3A 4EF1A 1B52A 1MXWA 2W7YA 1P1QA 4F1YA 4ECFA 3IOVA 1LBBA 2RKMA 1SI0A 2ZYOA 2XHDA 3U92A 1I6AA 1PB9A 1MQGA 4I9DA 2ZNUA 3AXFA 3VXBA 3B7DA 5DEXB 3KOSA 1AL3A 3Q26A 4F1VA 5KDTB 3DP6A 2DE4A 3C35A 5J1DA 2ZNSA 3QAXA 1MY1A 4GLIA 2GHAA 4N6PA 5H8HB 3OO6A 1MRPA 3I3VA 2XXXA 4KD5A 3RNNA 1B9JA 1NH8A 1SYHA 1DSNA 4GOTA 4IO6A 4IO7A 2NWJA 1MXYA 4E0WA 4ZEDA 1JQFA 1ZLQA 5F7VA 3UGWA 4FATA 3S9MC 4PFYA 4RK9A 1EZ9A 3RTWB 3VVFA 5I59B 1BLFA 2WKYA 3GXAA 2REGA 4EXKA 1OQHA 2XD2A 3C33A 4EXLA 3CG1A 3N26A 5L9SA 4P0GA 4U4SA 3TCHA 2F35A 1XOCA 4IGTA 1B1XA 3TTRA 1GVCA 4WEDA 3MVZA 1NNTA 1VE4A 2I0BA 3MZ9A 3PMWA 3L6HA 3PPOA 3OMBA 3Q27A 1MXVA 1D3KA 1CE2A 2DE3A 5KZTA 2PYYA 5K2XA 1WVJA 3H7MA 4LQ2A 3KJ7A 2UVGA 1BTJA 1PBQA 2QS2A 3RTFB 1OLAA 5ISUA 1Y3NA 1SI1A 3DM0A 3HV1A 4BDOA 2GHBA 3F11A 3UP9A 3TMGA 2DS9A 3Q28A 3K6WA 2B3BA 1ZJLA 5AA2B 2G29A 2DSFA 1B51A 1MQIA 1PB8A 3H3GA 4QF9A 4XIGQ 5FHOA 3WAFA 2DYXA 2B65A 3H6TA 3G7WA 1B1HA 2H4IA 4NEDA 1AIVA 3CSGA 3PUYE 3S9EA 5FHNA 2CMOA 1SBPA 1ELJA 4I62A 3T96B 2A5TA 1MXXA 4R2FA 1LB9A 4IY5A 1N7WA 4NMYA 1EZOA 3CR9A 3MW0A 4QSCA 1D9YA 1N3XA 1S9TA 1Z7NE 2XXWA 3H03A 1UTBB 1FQFA 5FTHA 4BDNA 4QSEA 1VFDA 1LFHA 4U2RA 4ELOA 2KLFA 2GFEA 3OEKA 4G8MA 1UTHA 3IB0A 5AA2A 3H6WA 1VSOA 1FQBA 3T9VA 3IL1B 4OESA 1YCJA 1Y4CA 3IAZA 2HFBA 1SVXB 2IA4A 2I4CA 4JB7A 4XKRA 3VLUA 4G68B 3SEUA 4ELQA 5TP9A 1NMUA 2HAUA 3M8UA 3QUFA 4OFLA 4QSDA 3VFJA 1LLSA 3IO4A 1B7ZA 3PD8A 3D4CA 4UA8A 3EHUA 4YKPA 4ZECA 1PC3A 2VD2A 3R26A 2DVCA 4JWOA 4UACA 2FYIA 3E4RA 3IO6A 3KZGA 5I58B 3PV0E 5CC2A 1GR2A 1LAGE 4GL0A 4K3FA 1TFDA 3MP1A 3TTLA 3GZGA 1A55A 2XXQA 3U93A 4G4PA 5AE4A 1A8EA 3HHGA 2I48A 4OYVA 1N76A 3DP8A 1B58A 3H4ZA 3TYHA 3K1MA 4PFUA 3PMXA 4EQ7A 1PB7A 1MPCA 4FIMA 1IXGA 1US5A 2Z8FA 3KGCA 3T22A 2O1LA 1R6ZA 1QVSA 1A99A 3FJ7A 5LOMA 1LB8A 5M2VA 3FVOA 1QUKA 1LFIA 3OD7A 2HXWA 3TCGA 3OELA 4GVOA 1P99A 3C36A 2ZNTA 3HPIA 3FV1A 2ONKE 3OO7A 4NF5B 4R9FA 5FHMA 2IEEA 2REJA 4YKKA 3HSTA 3SEVA 1NH7A 1FQEA 1FCKA 4U23A 4FEDA 5I57B 1DTGA 4AB5A 3LSWA 4QFOA 1MH4A 2HAVA 4H65A 2QS1A 1AMFA 4MLQA 4NF6A 4R6HA 5H8HA 4Q0CA 3W9WA 4KCCA 3I5OA 1A54A 1Z7ME 1S7YA 2QJEA 5DVFA 2O1MA 2UVJA 1QW0A 3S4UA 1CB6A 2DOJA 4KHZE 2H9BA 2FNCA 3TELA 3TQLA 4ZEKA 2RINA 1RYXA 4OFOA 2Q2AA 3IB2A 1URSA 4KPTA 1H44A 3SDFA 3OEMA 4EUOA 5ELVA 3M3FA 1OMPA 4BDQA 1JW4A 2QL3A 1B3HA 2H25A 2Y7IA 4FORA 3FXRA 1TT1A 1LAXA 3PPQA 2THIA 2RC8A 5CI5A 1FTMA 4C1TA 4ELRA 2OWSA 4LVQA 3KN8A 5B7DA 1MG1A 1R9LA 2F8DA 2HZKA 2QPQA 3E3KA 2PVUA 4JWYA 5EHSA 5L9OA 3MP8A 1OQGA 3H6VA 4R6YA 1XS5A 2O7IA 1LBCA 3DELB 5ITOA 1N0TA 3JV9A 4L17A 2F34A 1L5TA 1UIUA 2Q88A 4JSOA 3O9PA 2H99A 4GD5A 2GH9A 3B6TA 2D3IA 2AYSA 2F97A 2G93A 1PEBA 4R73A 4RYAA 1FTLA 3T93B 3ONMA 4DZ1A 3S9NC 1Y1ZA 2BJJX 3PGFA 5AA3A 3H06B 1US4A 4N13A 4ZEFA 4YMAA 1NFTA 3O28A 3VDFA 2NXOA 4MFIA 5HPQA 1AOVA 4U22A 5BUUA 1N84A 4XKNA 2XX8A 3EHTA 2O69A 4FJPA 2Z8EA 3TZAA 4C1UA 2O6AA 3PUXE 3U94A 3IORA 4POXA 1QKBA 3TEPA 4KYSA 2QS4A 3OOAA 4TLLB 4X9TA 2AL4A 4NF6B 4EQBA 2UYEA 3G3IA 1SYIA 2F78A 4R75A 1WDNA 4OEVA 1M5FA 3C32A 4F3GA 2F7AA 2RCBA 3EN3A 5AA1A 4ESXA 4NF4A 2VP1A 5I2NA 5I84A 3PU5A 4YZZA 1GV8A 1WODA 3FJGA 3Q25A 3KEIA 4R74A 1MQDA 5KCJA 1B4ZA 1XC1A 2Q89A 1PBPA 3WAEA 1MY0A 3PUZE 4F3PA 3RQTA 3FVGA 1FTKA 3K02A 3FXQA 3FUZA 1SW4A 4IY6A 4HW8A 4H5FA 1IUDA 1NNPA 1B5IA 5CRYA 5AA2D 2CZLA 3K0VA 3Q29A 2I3VA 4PP0A 2ESNA 2XX9A 3SKPA 4JSDA 1MQJA 3B6QA 2VD3A 2R71A 2F6GA 1RYOA 1UTBA 3JYRA 4GRKA 4KYDA 1GTKA 1JW5A 3W15C 4Z7EA 2Y7RA 5EYFA 3G3FA 4THIA 1EZPA 1B3LA 3C4MA 4LA9A 2QMXA 1NNKA 3SETA 4DLDA 4ZE9A 3FVNA 3T9HB 3T9XB 1QUIA 3O6HA 1II5A 1LAFE 3MJNA 1MM6A 4XKPA 5B70A 2F36A 4F3SA 4FECA 3HO7A 1LFGA 3LSFB 1USYE 3ILUB 4IO3A 4U4XA 3U72A 4BLAA 2VHAA 1HSLA 1NNFA 2OZZA 3H6UA 3ZKKA 4F22A 3MZBA 3TDJA 4H0WA 1UQWA 4R72A 1IZ1A 3JZJA 4Q5TA 5K2YA 1HSEA 2QRYA 1SDXA 3KSJA 3L6GA 4KCDA 4AB6A 1DOTA 1XVXA 3RLFE 4X1BA 4F39A 3UA8A 4OETA 4ONYA 4QFNA 1MY2A 2OBGA 3HHFA 4WEPA 3PD9A 4NWDA 2F7CA 2I58A 4IO2A 1B46A 4R2BA 4RK2A 4X48A 2UVHA 3ILTB 4FEBA 4WXJA 3KOTA 4FAJA 3KSXA 4YKIA 3FZVA 2DXYA 5DTBA 4LUBA 2A5TB 4GF8A 5EHMA 2XXUA 2XXHA 2Z23A 3A09A 3LBSA 2H5YA 3MUQA 3SESA 3VVEA 4DXBA 3MP6A 3N6TA 2Z22A 2XXPA 4F31B 4ISUA 1FQCA 2ONRA 4N07A 3V5AA 3P7IA 1I6BA 4YB6A 5I59A 4F3BA 4LP2B 1IXIA 4TQUQ 1ZBMA 1M5DA 1OIBA 4U1ZA 2DVZA 3C34A 1LCTA 3FD3A 2HQ0A 2OLBA 4PFWA 3IJOB 4YU0A 4C0RA 2XXIA 4X1DA 1B5HA 3U1OA 3U8QA 2Z8DA 2E0SA 4H1XA 4DIGA 3O29A 3V83A 1LGBC 5DT6A 3MWBA 4OFJA 3EPEA 4O3BA 4RA1A 4EDPA 1J1NA 1IEJA 4H67A 3BFUA 1HSJA 3TUSA 3LC8A 5TPAB 2LAOA 2DQVA 5H8FA 3IX1A 2DWJA 3E9XA 3K2DA 4NWCA 3ECRA 3BKIB 2XXTA 3CFXA 1H76A 3UIFA 3W9VA 1ZTYA 1DTZA 4G8HA 5CBRA 4ND9A 4YKJA 3QIMA 1Q1KA 4YB5A 1YPNA 4BDLA 2I6EA 3PUWE 3QK6A 4YB7A 2UXAA 4EQ9A 4ZZAA 4E0XA 4MBPA 3K01A 3UORA 5JTYA 4YMBA 4OENA 1F9BA 1MXUA 2NOOA 4OZ9A 4OXVA 1B3GA 4PQJA 4H6DA 1S50A 1SQYA 5H8FB 1B32A 4G8NA 3RGYA 4H5GA 5CM6A 4ELPA 1NKXA 1GGGA 3S2VA 3VLWA 3SEXA 1B6HA 3A3UA 3T9UA 1DPEA 5KDTA 2XXYA 1Y1MA 2I3WA 4GL8A 3O66A 3VE1B 3ZS6A 1KWHA 2ZMBA 4RPNA 3O6GA 2DXRA 4H8JA 2HCAA 4LZ8A 3TODA 3VLVA 4BDMA 4U21A 3FJMA 3IOUA 1BIYA 2HZLA 1BKAA 1MM7A 4LQ5A 3RUMA 5JK4A 4QFKA 1JVXA 1SW2A 2RC9A 4PFTA 4G2ZA 3N6UA 1DPPA 3PPRA 1B7UA 2E1SA 4PE5B 2QSXA 3FGSA 3O2AA 4DDDA 4RNSA 1LAHE 2Q9TA 2VGQA 1URDA 3IOTA 1A7LA 3PPNA 4H8IA 5F1QA 3T66A 1IXHA 1JETA 3FV2A 4HTGA 3FASA 2ONSA 4NF8B 1ZKBA 3M3LA 4YAHX 2DWIA 4QRZA 4DXUA 1AH5A 3IB1A 1Y4TA 3MVXA 1IIWA 3FIRA 3MBPA 3QSLA 1MY3A 3R6UA 2QMWA 2UYFA 5I2KB 2H98A 2O51A 3MPKA 1P1UA 3CFLA 3A3CA 4KFQA 4RJZA 4DE8A 1FTOA 1Y9UA 3G3HA 2XD3A 1MDQA 3V89B 3BBRA 2R6GE 4ZEBA 4BDRA 5HBCA 1IQ7A 1O63A 2DE2A 4G77A 1SW1A 3LR1A 3SEYA 3CVGA 2F6PA 4IO4A 4M1VA 3O97A 3UK4A 4M4GA 2Q2CA 1XHYA 2P0SA 3IJXB 3K00A 1N7XA 3EF7A 3RPWA 3M3KA 3KN3A 3N94A 2ABHA 4LONB 4OWDA 2D5WA 4G68A 3QYTA 2YPNA 4KI0E 2AIXA 4R6KA 5DEXA 2FA7A 4Z0IA 3VVDA 2B3FA 4JBZA 4TLMB 2X26A 3LUYA 3TKDA 3ZSFA 1UTHB 4JXIA 5CMBA 5CMKA 5FTIA 1JEVA 2X7PA 2XXRA 5A5XA 3RN8A 5BWJA 5DVJA 5DYHA 1JEUA 1VFEA 1Y20A 2F7BA 4FE8A 4HCWA 1A8FA 3K6XA 2UVIA 4XKQA 2VOZA 3KN7A 3TTKA 3ZKLA 4NE4A 1OLCA 5ICQA 1SW5A 2RCAA 4GXSB 4NF4B 4RXLA 5I2NB 1FTJA 4IO5A 4R9GA 4OEUA 2V93A 1H3DA 2ANJA 4KR5A 1MH3A 1USYH 3C9HA 5CMCA 5TU0A 1SD3A 5I56B 3BFTA 2PT2A 5AA4A 1JVYA 5H8NB 3FATA 4GQOA 4GWOA 5TPAA 4U1OA 4ZS9A 4NTLA 3EHSA 2ZYKA 2DWAA 3HCQA 4O3AA 1N3WA 1JW1A 1MY4A 3TAJA 3UN6A 5A5XB 3V8XB 5I2KA 3C31A 3GBBA 2OCUA 2O68A 3CG3A 1ZIUA 4JWXA 1B2HA 1ANFA 4OERA 2HEUA 4OHNA 1POTA 5I57A 2O7UA 1UIVA 2Y84A 3MC2A 4F2QA 3CRBA 3SERA 3MVWA 5JTYB 5ICTA 2NVUB 2R9JA 1P1OA 1N04A 1FW0A 4Q30B 3D4GA 2ZYNA 3THIA 3KBRA 1ZU0A 3TCFA 1DMBA 4F2OA 3I6VA 4KQPA 1IITA 3IOWA 1NL5A 5ITPA 3E13X 2XX7A 4GFRA 4O3CA 3VXCA 1IXCA 2OJTA 3K4UA 3N5LA 5IKBA 3G3KA 3OO9A 5KCJB 3OENA 1B40A 1H45A 1P1NA 4F29A 1M5EA 1ZMGA 2I4BA 4MLVA 1Y3QA 5H8NA 3S9LC 3USDA 1ATGA 1YAEA 1MXZA 3KJTA 3OSRA 3CFZA 1PDAA 1QKAA 4I1DA 4ZZEA 4EF2A 4P0IA 1Y3PA 1BP5A 4ZEIA 1M5CA 3K1NA 3KFMA 3TFLA 4ZE8A 2Q8JA 1LCFA 3O6IA 4PETA 1B3EA 1EU8A 2V25A 5JEIA 1B5JA 2V84A 4IB2A 2YLNA 3LSLA 1MDP1 2P1SA 2DP8A 3CI8A 4LZ5A 1R9QA 4RY1A 3TTNA 2I0CA 2Y7KA 1VR5A 1EH3A 3B6WA 4OMBA 4GXAA 2P2AA 3EQ1A 3K6UA 4AQ4A 4DXCA 3KG2A 4G68C 4DCYA 4QHQA 1B0HA 4HCYA 5H8QB 5L8DA 3FVKA 1O7TA 3DLNA 3MVYA 2I49A 3DP4A 4OQOA 3MAMA 3RY3A 4DCXA 1B7HA 1MPBA 4F18A 4P11A 1T0KA 1JNFA 3MQ9A 3RT8A 1D4NA 1B0LA 3QUJA 4Q8RA 5CBSA 2A5SA 4POWA 1TWYA 3K1PA 1D9VA 3IR1A 2M8CA 4QFLA 5H8SA 1URGA 1R1NA 1TFAA 2NUVA 1XT8A 2RC7A 2GRVA 2ZXTA 3OSQA 3IK6B 5HM4B 1OVTA 3ODBA 1QUJA 4QFPA 3VV5A 5AA4B 5I56A 1POY1 2PX1A 4NF8A 5I58A 1FQDA 3TQWA 2OK2A 4XXUA 1TXFA 3GBAA 1QULA 2Y7WA 2V3UA 4ESWA 4F1UA 4HS7A 4TOZA 2PBWA 1I69A 1RKMA 4F19A 1M5BA 3MZ1A 3TTMA 1B05A 1O64A 1MPDA 4KYEA 5TP9B 3OXNA 3PPPA 4I8CA 5H8QA 3HN0A 3LSXA 3R7XA 3PUVE 2F5XA 3PMVA 1MS7A 1P1WA 2DWHA 1YTVA 2YJPA 3OO8A 4OTEA 1LSTA 5IAIA 2AL5A 2PT1A 4ZDMA 3SEWA 2Y7PA 2RF1A 4NF5A 2ZYMA 2X7QA 3CIJA 2XXVA 2ALUA 3K6VA 3G3JA 1Q35A
chains in the Genus database with same CATH superfamily
3GLBA 1H43A 1XVYA 1B4HA 4GWSA 2V3QA 3FXUA 2ZZVA 4LZ7A 3MPLA 1QJMA 4MH5A 2QS3A 4ECFA 1SI0A 3VXBA 3KOSA 3DP6A 3C35A 3GYYA 4GLIA 4IO7A 4GOTA 1ZLQA 4FATA 3MSTA 4PFYA 1EZ9A 3CG1A 3N26A 4P0GA 4QBAA 1XOCA 3TTRA 2I0BA 3PMWA 1CE2A 5KZTA 2PYYA 5K2XA 2UVGA 1SI1A 3UP9A 3TMGA 3K6WA 2CZIA 5J16A 1PB8A 3RYDA 5ET5A 2CEXA 1EYIA 5IZ3B 5FHNA 2CMOA 4GWYA 4I62A 3T96B 1MXXA 4R2FA 5I7IA 1S9TA 4BDNA 4U2RA 4ELOA 3OEKA 1DBZA 1VSOA 1FQBA 3IAZA 2HFBA 1SVXB 4JB7A 3SEUA 4UA8A 2F3DA 2DVCA 2XXKA 4P8BA 5I58B 3PV0E 3TTLA 4G4PA 1A8EA 3DP8A 3K1MA 1IXGA 1US5A 3T22A 3ROJA 1QVSA 1LB8A 3FVOA 3OD7A 2Q74A 4GVOA 1P99A 3HPIA 3FV1A 2ONKE 4NN3A 3SEVA 4U23A 5ET7A 1MH4A 2HAVA 4KCCA 3I5OA 1A54A 1Z7ME 1S7YA 2UVJA 2RINA 3IB2A 1YZ0A 1B3HA 2H25A 4N6DA 3FXRA 4MEVA 4C1TA 4LVQA 1MG1A 1R9LA 2F8DA 2HZKA 4JWYA 5EHSA 3H6VA 4N17A 3DELB 3JV9A 2F34A 2H99A 2GH9A 3B6TA 2F97A 4MNCA 2VPOA 2BJJX 4N13A 1NFTA 3VDFA 2NXOA 4MFIA 1N84A 4XKNA 3EHTA 2Z8EA 3TZAA 3TEPA 4KYSA 2QS4A 4EQBA 4QXDA 1SYIA 2F7AA 1G0HA 5AA1A 5I2NA 3PU5A 1GV8A 3FJGA 4R74A 5KCJA 1XC1A 1SPIA 3PUZE 3FXQA 4HW8A 1NNPA 5CRYA 2I3VA 3SKPA 1MQJA 4FBPA 4GRKA 5EYFA 1B3LA 3C4MA 3SETA 2QMXA 4PBQA 4ZE9A 3FVNA 1QUIA 1LFGA 3LSFB 4BLAA 3MZBA 4H0WA 3LUZA 1K9ZA 4KCDA 3L6GA 1DOTA 3RLFE 4ONYA 1MY2A 4X9TA 3PD9A 4RK2A 4FAJA 3KSXA 3FZVA 4LUBA 3SESA 2H5YA 4PAFA 3VVEA 4YB6A 1I6BA 5I59A 4F3BA 4JVCA 4TQUQ 1OIBA 3FD3A 1LCTA 2HQ0A 4YU0A 2XWVA 2E0SA 3O29A 3EPEA 4JVDA 4H67A 3BFUA 3IFAA 3E9XA 3CFXA 1H76A 2VT5A 4O94A 4ND9A 3QIMA 3QK6A 2UXAA 2FIEA 2NOOA 4H6DA 4H5GA 1NKXA 1GGGA 3VLWA 2I3WA 3ZS6A 4GL8A 4RPNA 4LZ8A 1Q9DA 3VLVA 4BDMA 3IOUA 1BIYA 4GX6A 2RC9A 4PFTA 2Q8MA 1DPPA 1EYJA 3FGSA 4NF0A 4DDDA 3T66A 1URDA 3R6UA 5I2KB 5J1DA 2QMWA 2O51A 4KFQA 4N15A 1Y9UA 3G3HA 3V89B 2R6GE 2DE2A 1SW1A 3LR1A 3CVGA 2F6PA 4M1VA 3UK4A 3K00A 2ABHA 4G68A 4X04A 1NI9A 2FA7A 4HXVA 2B3FA 5FTIA 2XXRA 1VFEA 2F7BA 1FBCA 2UVIA 1SW5A 4NF4B 4GX3A 1IMBA 1H3DA 2ANJA 2PFYA 5TU0A 3BFTA 2PT2A 4NTLA 3EHSA 2QFLA 5I2KA 1JW1A 4JWXA 4F2QA 2ZYNA 1DMBA 3IOWA 3E13X 3VXCA 3OO9A 1B40A 4F29A 5H8NA 3S9LC 1Y3PA 4ZEIA 4ZE8A 2Q8JA 1EU8A 2V25A 1NV5A 2P1SA 3CI8A 4RY1A 4MAGA 1EH3A 4GXAA 4G68C 4N91A 5L8DA 3FVKA 2I49A 3MAMA 4DCXA 3FBPA 4MHFA 4F18A 1T0KA 3MQ9A 3RT8A 2A5SA 4QFLA 5H8SA 3VV5A 5AA4B 4NF8A 1TXFA 3GBAA 1QULA 2PBWA 1I69A 1RKMA 1M5BA 3MZ1A 3LV0A 1MPDA 3PPPA 3R7XA 3PUVE 4P1EA 2FBPA 5LDZA 4OTEA 1LSTA 2AL5A 2PT1A 5ESYA 1G0IA 2RF1A 2X7QA 5L9MA 4PGNA 1NV7A 3KC1A 1VDWA 1MQHA 4MF3A 4P3LA 1OVBA 4LATA 1A40A 4IGRA 2D21A 3TPAA 3QXMA 4EF1A 2ZYOA 3U92A 2XWIA 1PB9A 5LTCA 1MQGA 4I9DA 3Q26A 2ZNSA 3QAXA 1MY1A 3OO6A 1MRPA 3RNNA 1B9JA 1NH8A 1SYHA 1DSNA 4IO6A 2NWJA 4ZEDA 1MXYA 4RK9A 3RTWB 3VVFA 3HFUA 4EXKA 1OQHA 4EXLA 5L9SA 1GVCA 4WEDA 1MXVA 3H7MA 1FJ9A 1PBQA 2QS2A 1DK4A 3HV1A 2B3BA 5FBPA 5AA2B 2G29A 1MQIA 4XIGQ 2XWOA 4MJOA 3G7WA 4NEDA 3CSGA 3PUYE 1EZOA 3CR9A 4QSCA 5FTHA 1UTBB 4QSEA 5AA2A 3T9VA 4OESA 1YCJA 4XKRA 2IA4A 2I4CA 5TP9A 3VFJA 2HAUA 4F1YA 4QSDA 4YKPA 1PC3A 2VD2A 3R26A 4JWOA 4UACA 3IO6A 2B4MA 4K3FA 1TFDA 3MP1A 1NV4A 3U93A 2Y5KA 3TYHA 3H4ZA 4PFUA 1PB7A 1MPCA 4FIMA 2V4CA 5LOMA 1LFIA 2HXWA 4YKKA 3HSTA 1FBPA 2HPGA 4AB5A 4QFOA 4H65A 2QS1A 2QJEA 5DVFA 2O1MA 1LBZA 2DOJA 3TELA 4P56A 3TQLA 1URSA 4KPTA 1H44A 3SDFA 4N8YA 4EUOA 1FBEA 5IZ1A 4HE2A 2GQ1A 4GWXA 5CI5A 4ELRA 2OWSA 5B7DA 3E3KA 3MP8A 1N0TA 3O9PA 4KXPA 2G93A 1FTLA 3T93B 3PGFA 2L5VA 1FPBA 5HPQA 1AOVA 2XX8A 4FJPA 4C1UA 2O6AA 3PUXE 3IORA 4POXA 1QKBA 2AL4A 2UYEA 4R75A 4F3GA 2RCBA 4ESXA 3Q25A 3KEIA 2ZZXA 1PBPA 3WAEA 3FVGA 3IFCA 4DI4B 1B5IA 2CZLA 4PP0A 3B6QA 4KYDA 1JW5A 4OVQA 1NUWA 1LAFE 3MJNA 5B70A 1MM6A 2HHMA 3HO7A 4IO3A 3ILUB 4U4XA 3TDJA 3B50A 5K2YA 1UQWA 1IZ1A 1SDXA 1XVXA 3SZPA 4QFNA 3HHFA 4NWDA 2I58A 4X48A 2UVHA 3ILTB 4FEBA 4YKIA 5DTBA 2XXUA 2Z23A 3LBSA 4MX6A 3N6TA 2Z22A 2XXPA 1FQCA 2ONRA 1IXIA 1ZBMA 2DVZA 2OLBA 3U1OA 3U8QA 2Z8DA 4PGPA 1LGBC 3QMFA 4OFJA 5ET6A 4RA1A 1HSJA 2DQVA 4NWCA 3ECRA 4YKJA 1FBDA 1CNQA 4ZZAA 4E0XA 1LBYA 4YMBA 4OZ9A 4OXVA 4PQJA 1S50A 1SQYA 4AS5A 5H8FB 3RGYA 5CM6A 1B6HA 3A3UA 2P3NA 1KWHA 2ZMBA 3RUMA 2QVVA 1BKAA 1SW2A 2E1SA 3O2AA 5F1QA 1LAHE 2VGQA 4PAKA 4MNIA 4HTGA 4NF8B 1ZKBA 4YAHX 2DWIA 3MVXA 1IIWA 3QSLA 1MY3A 2H98A 3CFLA 4RJZA 3A3CA 1FTOA 2XD3A 1MDQA 3BBRA 4ZEBA 2XWKA 1O63A 4G77A 3SEYA 2OWZA 4M4GA 3KN3A 4OWDA 2D5WA 1FPIA 2AIXA 4R6KA 3VVDA 2X26A 3ZSFA 1UTHB 5CMBA 5CMKA 1JEUA 4HCWA 2VOZA 3KN7A 4NE4A 1OLCA 1RDXA 1FTJA 4IO5A 5I56B 1SD3A 1JVYA 2ZYKA 2DWAA 1N3WA 2O68A 4OERA 4OHNA 1POTA 2QVRA 1UIVA 4I40A 5JTYB 3THIA 4F2OA 3I6VA 1IITA 1NL5A 4GFRA 4N4UA 4OANA 1IXCA 2OJTA 5IKBA 2HXRA 4N6KA 1H45A 1P1NA 3KBZA 1IMCA 1M5EA 1ATGA 1FSAA 1MXZA 3KJTA 3CFZA 1M5CA 3K1NA 1LCFA 4PETA 5JEIA 3NOHA 5DW8A 1VR5A 2P2AA 5I3SA 4AQ4A 4PDDA 3KG2A 4DCYA 4QHQA 5H8QB 1O7TA 1B7HA 1NV3A 5IGAA 4NHBA 1B0LA 3QUJA 4POWA 1D9VA 3IR1A 1URGA 1TFAA 2NUVA 1XT8A 2RC7A 5EYHA 5HM4B 1QUJA 1KZ8A 1POY1 2KR0A 3PTYA 1FQDA 3TQWA 2Y7WA 4ESWA 4N8GA 4PCDA 1B05A 3OXNA 4I8CA 5H8QA 2F5XA 3PMVA 2DWHA 3OO8A 5IAIA 4ZDMA 2FIXA 2XXVA 3IK6B 5CMMA 4PFRA 4GIZA 5EQAA 2WBDA 2O84X 2V3TA 1B3FA 4JDFA 3BIGA 1YYZA 4XTCQ 3T0JA 4RPOA 4WKMA 1MXWA 2W7YA 2RKMA 1I6AA 2ZNUA 3AXFA 5KDTB 3B7DA 5DEXB 1AL3A 2DE4A 1IMEA 4N81A 4N6PA 2GHAA 4E0WA 1FBGA 1JQFA 2MKZA 5I59B 1BLFA 3GXAA 2XD2A 3C33A 2JJKA 1FPFA 4IGTA 3CHGA 4OVSA 3MVZA 1NUXA 3PPOA 3Q27A 2DE3A 4LQ2A 3KJ7A 1BTJA 3DM0A 3F11A 2DS9A 1ZJLA 1LBWA 3H3GA 3H6TA 2H4IA 3S9EA 1SBPA 1AWBA 4OVPA 1ELJA 2A5TA 1LB9A 1N7WA 3MW0A 1D9YA 1N3XA 1Z7NE 1VFDA 4G8MA 1UTHA 3H6WA 4NAPA 4ELQA 3VLUA 3M8UA 4BDRA 3QUFA 1IMFA 1LLSA 3IO4A 3EHUA 3E4RA 1GR2A 1LAGE 3GZGA 1A55A 2XXQA 5AE4A 2I48A 2QVUA 4OYVA 1N76A 3PMXA 4EQ7A 1FTAA 2Z8FA 3KGCA 5M2VA 1QUKA 3OO7A 4R9FA 5FHMA 2REJA 2F3BA 1NH7A 1FCKA 1DCUA 4NF6A 4Q0CA 3W9WA 4GWZA 3S4UA 1NUYA 2H9BA 2FNCA 1RYXA 4OFOA 3OEMA 5ELVA 1OMPA 2QL3A 2Y7IA 4G61A 3PPQA 2THIA 2RC8A 1FTMA 1NV1A 3KN8A 3E78A 2PVUA 5L9OA 1OQGA 4R6YA 1XS5A 1LBCA 1UIUA 2Q88A 4JSOA 4R73A 2D3IA 2AYSA 2FVZA 3ONMA 3S9NC 1Y1ZA 4MNPA 5AA3A 3H06B 4ZEFA 3O28A 3U94A 1FJ6A 3RPLA 3OOAA 4PBHA 2F78A 1M5FA 5I84A 3ISPA 4MMPA 1WODA 1MQDA 2Q89A 1MY0A 4F3PA 1FTKA 3K02A 3FUZA 1SW4A 4IY6A 4H5FA 5AA2D 3Q29A 2XX9A 3JYRA 3V83A 2R71A 1RYOA 1UTBA 4O8MA 1GTKA 3G3FA 1EZPA 1NNKA 3T9HB 3O6HA 1II5A 4XKPA 2F36A 4F3SA 4H45A 1USYE 2VHAA 3ZKKA 2OZZA 3H6UA 4X1BA 2CZHA 4IO2A 4R2BA 1B46A 3KOTA 4GF8A 3A09A 3MP6A 4ISUA 4N07A 3P7IA 1M5DA 4PFWA 3C34A 2XXIA 4X1DA 1B5HA 5DT6A 3MWBA 4O3BA 5TPAB 2DWJA 1IMDA 1DTZA 2KQZA 4G8HA 5CBRA 5A5LA 4YB5A 4BDLA 2I6EA 4EQ9A 4MBPA 1F9BA 1MXUA 1B3GA 1B32A 3A29A 4ELPA 3S2VA 3VE1B 2OX3A 3O6GA 2WYKA 2HCAA 3FJMA 2HZLA 4LQ5A 1MM7A 3PPRA 1B7UA 2QSXA 1K9YA 2Q9TA 3IOTA 4GBVA 1IXHA 3FV2A 3FASA 2ONSA 4QRZA 1Y4TA 3MBPA 4UABA 1P1UA 4DE8A 1IQ7A 4IO4A 3O97A 2P0SA 5AA4A 3RPWA 3EF7A 5DEXA 4Z0IA 4TLMB 3TKDA 4OVRA 4JXIA 2X7PA 5BWJA 5DVJA 5DYHA 4FE8A 1Y20A 1A8FA 5IM2A 4XKQA 2RCAA 3MYUA 4RXLA 1FPGA 4R9GA 1MH3A 3C9HA 5H8NB 3FATA 4GWOA 4ZS9A 5ET8A 3HCQA 4O3AA 3TAJA 3UN6A 3GBBA 2OCUA 3CG3A 1ZIUA 1B2HA 2HEUA 5I57A 2O7UA 1BK4A 3CRBA 5IZ3A 3SERA 3MVWA 2B4LA 1P1OA 4Q30B 1FW0A 3D4GA 1FPJA 4KQPA 5ITPA 4O3CA 5KCJB 3N5LA 3OENA 1INPA 1ZMGA 4MLVA 3USDA 1YAEA 3OSRA 4P0IA 3TFLA 4PF6A 1B5JA 2V84A 1EYKA 4F19A 2YLNA 3TTNA 1MDP1 4XFEA 2I0CA 4DI3D 3B6WA 1NV2A 4OMBA 3EQ1A 1B0HA 3DLNA 4OQOA 4P11A 1JNFA 4Q8RA 1TWYA 3K1PA 2M8CA 1YXIA 2GRVA 2ZXTA 3ODBA 4QFPA 2PX1A 4XXUA 2V3UA 4F1UA 4HS7A 4TOZA 4KYEA 1P1WA 1NV0A 2YJPA 4O7IA 2WBBA 3CIJA 2ALUA 3K6VA 3G3JA 3N94A 2OWTA 2PMSA 1FQAA 3G3GA 4PAIA 3RT6B 5DVIA 4YICA 1I6QA 4OVJA 3CSBA 1B52A 1P1QA 4XEQA 3IOVA 1LBBA 3D1RA 2XHDA 1KA1A 4F1VA 4IR8A 5H8HB 3I3VA 2XXXA 4KD5A 1NV6A 5F7VA 3S9MC 3UGWA 2WKYA 1KA0A 2REGA 4U4SA 3TCHA 2F35A 1B1XA 1NNTA 1VE4A 3MZ9A 1FPEA 3L6HA 3OMBA 1D3KA 1WVJA 1OLAA 5ISUA 1Y3NA 4BDOA 2GHBA 1LBXA 2PFZA 3Q28A 4NX1A 4PDHA 2DSFA 1B51A 4QF9A 3WAFA 5FHOA 2DYXA 2B65A 1B1HA 1RDZA 1AIVA 4IY5A 4NMYA 2XXWA 3H03A 1FQFA 4P1LA 1LFHA 2KLFA 2GFEA 2CZKA 3IB0A 3IL1B 1Y4CA 1FBHA 1XI6A 4G68B 1NMUA 5IZZA 4OFLA 4ZECA 1B7ZA 3PD8A 3D4CA 4HE1A 2FYIA 1FPLA 3KZGA 5CC2A 4GL0A 3HHGA 2FHYA 1B58A 3B8BA 2PCRA 4XF5A 2O1LA 1R6ZA 1A99A 3FJ7A 3E79A 3TCGA 3OELA 3C36A 2ZZWA 2ZNTA 4NF5B 2IEEA 1FQEA 4FEDA 5I57B 1DTGA 2P3VA 3LSWA 4R6HA 1AMFA 4MLQA 5H8HA 4MCOA 1QW0A 1CB6A 4KHZE 4ZEKA 2Q2AA 2R8TA 4NQ8A 3M3FA 4BDQA 1JW4A 4FORA 1TT1A 1LAXA 2QPQA 2O7IA 1LEVA 5ITOA 4O7MA 4NGUA 4L17A 4OA4A 1L5TA 3RTFB 4GD5A 4OVTA 4RYAA 1PEBA 4DZ1A 4PF8A 4YMAA 1US4A 4PFBA 4U22A 4P9KA 2O69A 5EQ9A 4TLLB 3BIHA 4NF6B 3G3IA 1WDNA 4OEVA 3C32A 3EN3A 4I3YA 4NF4A 2VP1A 4YZZA 4PFIA 1B4ZA 2Y5LA 3RQTA 1FBFA 5T3JA 1IUDA 3K0VA 2ESNA 4JSDA 2VD3A 4LONB 2F6GA 3W15C 4H46A 4Z7EA 2Y7RA 4THIA 1NUZA 4LA9A 4HE0A 4DLDA 3T9XB 4FECA 3U72A 1HSLA 1NNFA 4F22A 4R72A 3JZJA 4Q5TA 1HSEA 2QRYA 3KSJA 4AB6A 4F39A 3UA8A 4OETA 4WEPA 2OBGA 2F7CA 4LN5A 4I3EA 4WXJA 1LBVA 2DXYA 2A5TB 5EHMA 2CEYA 2XXHA 4DXBA 3MUQA 4F31B 1D9QA 3V5AA 4LP2B 5F24A 4U1ZA 3IJOB 4C0RA 3EKIA 4DIGA 4H1XA 4EDPA 1J1NA 1IEJA 3TUSA 3LC8A 2LAOA 5H8FA 3IX1A 3K2DA 3U65A 3BKIB 2XXTA 3UIFA 4X8RA 3W9VA 1ZTYA 1Q1KA 1YPNA 3PUWE 4YB7A 3UORA 3K01A 5JTYA 4OENA 2DDKA 4G8NA 3SEXA 3T9UA 1DPEA 5KDTA 2XXYA 1Y1MA 3O66A 2DXRA 4H8JA 3TODA 4U21A 5JK4A 4QFKA 1JVXA 4AS4A 4G2ZA 3N6UA 1FRPA 4PE5B 2WYPA 4RNSA 3PPNA 4H8IA 1A7LA 1JETA 1FPKA 3M3LA 4DXUA 5BUUA 1AH5A 3IB1A 3FIRA 2UYFA 3MPKA 4PC9A 4P47A 3RPLB 5HBCA 1RDYA 1QGXA 4GWWA 4NG7A 2Q2CA 1XHYA 3IJXB 1N7XA 3M3KA 2WX9A 4KI0E 3QYTA 2YPNA 1IMAA 4JBZA 3LUYA 1JEVA 5A5XA 3RN8A 3K6XA 4PE3A 3TTKA 3ZKLA 4GWUA 5ICQA 4GXSB 5I2NB 4OEUA 2V93A 4KR5A 1USYH 5CMCA 5I5PA 4GQOA 5TPAA 4U1OA 1MY4A 5A5XB 3V8XB 3C31A 2BJIA 5EYGA 1ANFA 2Y84A 3MC2A 5ICTA 2NVUB 2R9JA 1N04A 3KBRA 1ZU0A 3TCFA 2WEFA 2XX7A 3K4UA 3G3KA 2I4BA 1Y3QA 1FPDA 1PDAA 1QKAA 4I1DA 4ZZEA 4EF2A 1BP5A 4GBWA 4JVIA 3KC0A 3KFMA 3O6IA 1B3EA 5EQ7A 4IB2A 3LSLA 2DP8A 4LZ5A 1R9QA 2Y7KA 1JP4A 3K6UA 4DXCA 4PTKA 4HCYA 3MVYA 3DP4A 3T1BA 3RY3A 1MPBA 5EQ8A 1D4NA 5CBSA 2XA5A 1R1NA 3OSQA 3FXBA 4MIJA 1OVTA 5I56A 5I58A 2OK2A 2VPNA 4GX4A 3TTMA 1O64A 5TP9B 3HN0A 3LSXA 1MS7A 1YTVA 3SEWA 2Y7PA 4NF5A 2ZYMA 1Q35A
chains in the Genus database with same CATH topology
5CMMA 2OWTA 2PMSA 4GIZA 1FQAA 3G3GA 2O84X 2V3TA 3GLBA 1H43A 1XVYA 1B4HA 2V3QA 1B3FA 4JDFA 1MQHA 3RT6B 4MF3A 5DVIA 1OVBA 5L9MA 4LATA 3FXUA 1A40A 4YICA 4IGRA 2D21A 4XTCQ 3TPAA 4LZ7A 3QXMA 3MPLA 4RPOA 1I6QA 4WKMA 4OVJA 1QJMA 3CSBA 4MH5A 2QS3A 4EF1A 1B52A 1MXWA 2W7YA 1P1QA 4F1YA 4ECFA 3IOVA 1LBBA 2RKMA 1SI0A 2ZYOA 2XHDA 3U92A 1I6AA 1PB9A 1MQGA 4I9DA 2ZNUA 3AXFA 3VXBA 3B7DA 5DEXB 3KOSA 1AL3A 3Q26A 4F1VA 5KDTB 3DP6A 2DE4A 3C35A 5J1DA 2ZNSA 3QAXA 1MY1A 4GLIA 2GHAA 4N6PA 5H8HB 3OO6A 1MRPA 3I3VA 2XXXA 4KD5A 3RNNA 1B9JA 1NH8A 1SYHA 1DSNA 4GOTA 4IO6A 4IO7A 2NWJA 1MXYA 4E0WA 4ZEDA 1JQFA 1ZLQA 5F7VA 3UGWA 4FATA 3S9MC 4PFYA 4RK9A 1EZ9A 3RTWB 3VVFA 5I59B 1BLFA 2WKYA 3GXAA 2REGA 4EXKA 1OQHA 2XD2A 3C33A 4EXLA 3CG1A 3N26A 5L9SA 4P0GA 4U4SA 3TCHA 2F35A 1XOCA 4IGTA 1B1XA 3TTRA 1GVCA 4WEDA 3MVZA 1NNTA 1VE4A 2I0BA 3MZ9A 3PMWA 3L6HA 3PPOA 3OMBA 3Q27A 1MXVA 1D3KA 1CE2A 2DE3A 5KZTA 2PYYA 5K2XA 1WVJA 3H7MA 4LQ2A 3KJ7A 2UVGA 1BTJA 1PBQA 2QS2A 3RTFB 1OLAA 5ISUA 1Y3NA 1SI1A 3DM0A 3HV1A 4BDOA 2GHBA 3F11A 3UP9A 3TMGA 2DS9A 3Q28A 3K6WA 2B3BA 1ZJLA 5AA2B 2G29A 2DSFA 1B51A 1MQIA 1PB8A 3H3GA 4QF9A 4XIGQ 5FHOA 3WAFA 2DYXA 2B65A 3H6TA 3G7WA 1B1HA 2H4IA 4NEDA 1AIVA 3CSGA 3PUYE 3S9EA 5FHNA 2CMOA 1SBPA 1ELJA 4I62A 3T96B 2A5TA 1MXXA 4R2FA 1LB9A 4IY5A 1N7WA 4NMYA 1EZOA 3CR9A 3MW0A 4QSCA 1D9YA 1N3XA 1S9TA 1Z7NE 2XXWA 3H03A 1UTBB 1FQFA 5FTHA 4BDNA 4QSEA 1VFDA 1LFHA 4U2RA 4ELOA 2KLFA 2GFEA 3OEKA 4G8MA 1UTHA 3IB0A 5AA2A 3H6WA 1VSOA 1FQBA 3T9VA 3IL1B 4OESA 1YCJA 1Y4CA 3IAZA 2HFBA 1SVXB 2IA4A 2I4CA 4JB7A 4XKRA 3VLUA 4G68B 3SEUA 4ELQA 5TP9A 1NMUA 2HAUA 3M8UA 3QUFA 4OFLA 4QSDA 3VFJA 1LLSA 3IO4A 1B7ZA 3PD8A 3D4CA 4UA8A 3EHUA 4YKPA 4ZECA 1PC3A 2VD2A 3R26A 2DVCA 4JWOA 4UACA 2FYIA 3E4RA 3IO6A 3KZGA 5I58B 3PV0E 5CC2A 1GR2A 1LAGE 4GL0A 4K3FA 1TFDA 3MP1A 3TTLA 3GZGA 1A55A 2XXQA 3U93A 4G4PA 5AE4A 1A8EA 3HHGA 2I48A 4OYVA 1N76A 3DP8A 1B58A 3H4ZA 3TYHA 3K1MA 4PFUA 3PMXA 4EQ7A 1PB7A 1MPCA 4FIMA 1IXGA 1US5A 2Z8FA 3KGCA 3T22A 2O1LA 1R6ZA 1QVSA 1A99A 3FJ7A 5LOMA 1LB8A 5M2VA 3FVOA 1QUKA 1LFIA 3OD7A 2HXWA 3TCGA 3OELA 4GVOA 1P99A 3C36A 2ZNTA 3HPIA 3FV1A 2ONKE 3OO7A 4NF5B 4R9FA 5FHMA 2IEEA 2REJA 4YKKA 3HSTA 3SEVA 1NH7A 1FQEA 1FCKA 4U23A 4FEDA 5I57B 1DTGA 4AB5A 3LSWA 4QFOA 1MH4A 2HAVA 4H65A 2QS1A 1AMFA 4MLQA 4NF6A 4R6HA 5H8HA 4Q0CA 3W9WA 4KCCA 3I5OA 1A54A 1Z7ME 1S7YA 2QJEA 5DVFA 2O1MA 2UVJA 1QW0A 3S4UA 1CB6A 2DOJA 4KHZE 2H9BA 2FNCA 3TELA 3TQLA 4ZEKA 2RINA 1RYXA 4OFOA 2Q2AA 3IB2A 1URSA 4KPTA 1H44A 3SDFA 3OEMA 4EUOA 5ELVA 3M3FA 1OMPA 4BDQA 1JW4A 2QL3A 1B3HA 2H25A 2Y7IA 4FORA 3FXRA 1TT1A 1LAXA 3PPQA 2THIA 2RC8A 5CI5A 1FTMA 4C1TA 4ELRA 2OWSA 4LVQA 3KN8A 5B7DA 1MG1A 1R9LA 2F8DA 2HZKA 2QPQA 3E3KA 2PVUA 4JWYA 5EHSA 5L9OA 3MP8A 1OQGA 3H6VA 4R6YA 1XS5A 2O7IA 1LBCA 3DELB 5ITOA 1N0TA 3JV9A 4L17A 2F34A 1L5TA 1UIUA 2Q88A 4JSOA 3O9PA 2H99A 4GD5A 2GH9A 3B6TA 2D3IA 2AYSA 2F97A 2G93A 1PEBA 4R73A 4RYAA 1FTLA 3T93B 3ONMA 4DZ1A 3S9NC 1Y1ZA 2BJJX 3PGFA 5AA3A 3H06B 1US4A 4N13A 4ZEFA 4YMAA 1NFTA 3O28A 3VDFA 2NXOA 4MFIA 5HPQA 1AOVA 4U22A 5BUUA 1N84A 4XKNA 2XX8A 3EHTA 2O69A 4FJPA 2Z8EA 3TZAA 4C1UA 2O6AA 3PUXE 3U94A 3IORA 4POXA 1QKBA 3TEPA 4KYSA 2QS4A 3OOAA 4TLLB 4X9TA 2AL4A 4NF6B 4EQBA 2UYEA 3G3IA 1SYIA 2F78A 4R75A 1WDNA 4OEVA 1M5FA 3C32A 4F3GA 2F7AA 2RCBA 3EN3A 5AA1A 4ESXA 4NF4A 2VP1A 5I2NA 5I84A 3PU5A 4YZZA 1GV8A 1WODA 3FJGA 3Q25A 3KEIA 4R74A 1MQDA 5KCJA 1B4ZA 1XC1A 2Q89A 1PBPA 3WAEA 1MY0A 3PUZE 4F3PA 3RQTA 3FVGA 1FTKA 3K02A 3FXQA 3FUZA 1SW4A 4IY6A 4HW8A 4H5FA 1IUDA 1NNPA 1B5IA 5CRYA 5AA2D 2CZLA 3K0VA 3Q29A 2I3VA 4PP0A 2ESNA 2XX9A 3SKPA 4JSDA 1MQJA 3B6QA 2VD3A 2R71A 2F6GA 1RYOA 1UTBA 3JYRA 4GRKA 4KYDA 1GTKA 1JW5A 3W15C 4Z7EA 2Y7RA 5EYFA 3G3FA 4THIA 1EZPA 1B3LA 3C4MA 4LA9A 2QMXA 1NNKA 3SETA 4DLDA 4ZE9A 3FVNA 3T9HB 3T9XB 1QUIA 3O6HA 1II5A 1LAFE 3MJNA 1MM6A 4XKPA 5B70A 2F36A 4F3SA 4FECA 3HO7A 1LFGA 3LSFB 1USYE 3ILUB 4IO3A 4U4XA 3U72A 4BLAA 2VHAA 1HSLA 1NNFA 2OZZA 3H6UA 3ZKKA 4F22A 3MZBA 3TDJA 4H0WA 1UQWA 4R72A 1IZ1A 3JZJA 4Q5TA 5K2YA 1HSEA 2QRYA 1SDXA 3KSJA 3L6GA 4KCDA 4AB6A 1DOTA 1XVXA 3RLFE 4X1BA 4F39A 3UA8A 4OETA 4ONYA 4QFNA 1MY2A 2OBGA 3HHFA 4WEPA 3PD9A 4NWDA 2F7CA 2I58A 4IO2A 1B46A 4R2BA 4RK2A 4X48A 2UVHA 3ILTB 4FEBA 4WXJA 3KOTA 4FAJA 3KSXA 4YKIA 3FZVA 2DXYA 5DTBA 4LUBA 2A5TB 4GF8A 5EHMA 2XXUA 2XXHA 2Z23A 3A09A 3LBSA 2H5YA 3MUQA 3SESA 3VVEA 4DXBA 3MP6A 3N6TA 2Z22A 2XXPA 4F31B 4ISUA 1FQCA 2ONRA 4N07A 3V5AA 3P7IA 1I6BA 4YB6A 5I59A 4F3BA 4LP2B 1IXIA 4TQUQ 1ZBMA 1M5DA 1OIBA 4U1ZA 2DVZA 3C34A 1LCTA 3FD3A 2HQ0A 2OLBA 4PFWA 3IJOB 4YU0A 4C0RA 2XXIA 4X1DA 1B5HA 3U1OA 3U8QA 2Z8DA 2E0SA 4H1XA 4DIGA 3O29A 3V83A 1LGBC 5DT6A 3MWBA 4OFJA 3EPEA 4O3BA 4RA1A 4EDPA 1J1NA 1IEJA 4H67A 3BFUA 1HSJA 3TUSA 3LC8A 5TPAB 2LAOA 2DQVA 5H8FA 3IX1A 2DWJA 3E9XA 3K2DA 4NWCA 3ECRA 3BKIB 2XXTA 3CFXA 1H76A 3UIFA 3W9VA 1ZTYA 1DTZA 4G8HA 5CBRA 4ND9A 4YKJA 3QIMA 1Q1KA 4YB5A 1YPNA 4BDLA 2I6EA 3PUWE 3QK6A 4YB7A 2UXAA 4EQ9A 4ZZAA 4E0XA 4MBPA 3K01A 3UORA 5JTYA 4YMBA 4OENA 1F9BA 1MXUA 2NOOA 4OZ9A 4OXVA 1B3GA 4PQJA 4H6DA 1S50A 1SQYA 5H8FB 1B32A 4G8NA 3RGYA 4H5GA 5CM6A 4ELPA 1NKXA 1GGGA 3S2VA 3VLWA 3SEXA 1B6HA 3A3UA 3T9UA 1DPEA 5KDTA 2XXYA 1Y1MA 2I3WA 4GL8A 3O66A 3VE1B 3ZS6A 1KWHA 2ZMBA 4RPNA 3O6GA 2DXRA 4H8JA 2HCAA 4LZ8A 3TODA 3VLVA 4BDMA 4U21A 3FJMA 3IOUA 1BIYA 2HZLA 1BKAA 1MM7A 4LQ5A 3RUMA 5JK4A 4QFKA 1JVXA 1SW2A 2RC9A 4PFTA 4G2ZA 3N6UA 1DPPA 3PPRA 1B7UA 2E1SA 4PE5B 2QSXA 3FGSA 3O2AA 4DDDA 4RNSA 1LAHE 2Q9TA 2VGQA 1URDA 3IOTA 1A7LA 3PPNA 4H8IA 5F1QA 3T66A 1IXHA 1JETA 3FV2A 4HTGA 3FASA 2ONSA 4NF8B 1ZKBA 3M3LA 4YAHX 2DWIA 4QRZA 4DXUA 1AH5A 3IB1A 1Y4TA 3MVXA 1IIWA 3FIRA 3MBPA 3QSLA 1MY3A 3R6UA 2QMWA 2UYFA 5I2KB 2H98A 2O51A 3MPKA 1P1UA 3CFLA 3A3CA 4KFQA 4RJZA 4DE8A 1FTOA 1Y9UA 3G3HA 2XD3A 1MDQA 3V89B 3BBRA 2R6GE 4ZEBA 4BDRA 5HBCA 1IQ7A 1O63A 2DE2A 4G77A 1SW1A 3LR1A 3SEYA 3CVGA 2F6PA 4IO4A 4M1VA 3O97A 3UK4A 4M4GA 2Q2CA 1XHYA 2P0SA 3IJXB 3K00A 1N7XA 3EF7A 3RPWA 3M3KA 3KN3A 3N94A 2ABHA 4LONB 4OWDA 2D5WA 4G68A 3QYTA 2YPNA 4KI0E 2AIXA 4R6KA 5DEXA 2FA7A 4Z0IA 3VVDA 2B3FA 4JBZA 4TLMB 2X26A 3LUYA 3TKDA 3ZSFA 1UTHB 4JXIA 5CMBA 5CMKA 5FTIA 1JEVA 2X7PA 2XXRA 5A5XA 3RN8A 5BWJA 5DVJA 5DYHA 1JEUA 1VFEA 1Y20A 2F7BA 4FE8A 4HCWA 1A8FA 3K6XA 2UVIA 4XKQA 2VOZA 3KN7A 3TTKA 3ZKLA 4NE4A 1OLCA 5ICQA 1SW5A 2RCAA 4GXSB 4NF4B 4RXLA 5I2NB 1FTJA 4IO5A 4R9GA 4OEUA 2V93A 1H3DA 2ANJA 4KR5A 1MH3A 1USYH 3C9HA 5CMCA 5TU0A 1SD3A 5I56B 3BFTA 2PT2A 5AA4A 1JVYA 5H8NB 3FATA 4GQOA 4GWOA 5TPAA 4U1OA 4ZS9A 4NTLA 3EHSA 2ZYKA 2DWAA 3HCQA 4O3AA 1N3WA 1JW1A 1MY4A 3TAJA 3UN6A 5A5XB 3V8XB 5I2KA 3C31A 3GBBA 2OCUA 2O68A 3CG3A 1ZIUA 4JWXA 1B2HA 1ANFA 4OERA 2HEUA 4OHNA 1POTA 5I57A 2O7UA 1UIVA 2Y84A 3MC2A 4F2QA 3CRBA 3SERA 3MVWA 5JTYB 5ICTA 2NVUB 2R9JA 1P1OA 1N04A 1FW0A 4Q30B 3D4GA 2ZYNA 3THIA 3KBRA 1ZU0A 3TCFA 1DMBA 4F2OA 3I6VA 4KQPA 1IITA 3IOWA 1NL5A 5ITPA 3E13X 2XX7A 4GFRA 4O3CA 3VXCA 1IXCA 2OJTA 3K4UA 3N5LA 5IKBA 3G3KA 3OO9A 5KCJB 3OENA 1B40A 1H45A 1P1NA 4F29A 1M5EA 1ZMGA 2I4BA 4MLVA 1Y3QA 5H8NA 3S9LC 3USDA 1ATGA 1YAEA 1MXZA 3KJTA 3OSRA 3CFZA 1PDAA 1QKAA 4I1DA 4ZZEA 4EF2A 4P0IA 1Y3PA 1BP5A 4ZEIA 1M5CA 3K1NA 3KFMA 3TFLA 4ZE8A 2Q8JA 1LCFA 3O6IA 4PETA 1B3EA 1EU8A 2V25A 5JEIA 1B5JA 2V84A 4IB2A 2YLNA 3LSLA 1MDP1 2P1SA 2DP8A 3CI8A 4LZ5A 1R9QA 4RY1A 3TTNA 2I0CA 2Y7KA 1VR5A 1EH3A 3B6WA 4OMBA 4GXAA 2P2AA 3EQ1A 3K6UA 4AQ4A 4DXCA 3KG2A 4G68C 4DCYA 4QHQA 1B0HA 4HCYA 5H8QB 5L8DA 3FVKA 1O7TA 3DLNA 3MVYA 2I49A 3DP4A 4OQOA 3MAMA 3RY3A 4DCXA 1B7HA 1MPBA 4F18A 4P11A 1T0KA 1JNFA 3MQ9A 3RT8A 1D4NA 1B0LA 3QUJA 4Q8RA 5CBSA 2A5SA 4POWA 1TWYA 3K1PA 1D9VA 3IR1A 2M8CA 4QFLA 5H8SA 1URGA 1R1NA 1TFAA 2NUVA 1XT8A 2RC7A 2GRVA 2ZXTA 3OSQA 3IK6B 5HM4B 1OVTA 3ODBA 1QUJA 4QFPA 3VV5A 5AA4B 5I56A 1POY1 2PX1A 4NF8A 5I58A 1FQDA 3TQWA 2OK2A 4XXUA 1TXFA 3GBAA 1QULA 2Y7WA 2V3UA 4ESWA 4F1UA 4HS7A 4TOZA 2PBWA 1I69A 1RKMA 4F19A 1M5BA 3MZ1A 3TTMA 1B05A 1O64A 1MPDA 4KYEA 5TP9B 3OXNA 3PPPA 4I8CA 5H8QA 3HN0A 3LSXA 3R7XA 3PUVE 2F5XA 3PMVA 1MS7A 1P1WA 2DWHA 1YTVA 2YJPA 3OO8A 4OTEA 1LSTA 5IAIA 2AL5A 2PT1A 4ZDMA 3SEWA 2Y7PA 2RF1A 4NF5A 2ZYMA 2X7QA 3CIJA 2XXVA 2ALUA 3K6VA 3G3JA 1Q35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMM A;  2OWT A;  2PMS A;  4GIZ A;  1FQA A;  3G3G A;  2O84 X;  2V3T A;  3GLB A;  1H43 A;  1XVY A;  1B4H A;  2V3Q A;  1B3F A;  4JDF A;  1MQH A;  3RT6 B;  4MF3 A;  5DVI A;  1OVB A;  5L9M A;  4LAT A;  3FXU A;  1A40 A;  4YIC A;  4IGR A;  2D21 A;  4XTC Q;  3TPA A;  4LZ7 A;  3QXM A;  3MPL A;  4RPO A;  1I6Q A;  4WKM A;  4OVJ A;  1QJM A;  3CSB A;  4MH5 A;  2QS3 A;  4EF1 A;  1B52 A;  1MXW A;  2W7Y A;  1P1Q A;  4F1Y A;  4ECF A;  3IOV A;  1LBB A;  2RKM A;  1SI0 A;  2ZYO A;  2XHD A;  3U92 A;  1I6A A;  1PB9 A;  1MQG A;  4I9D A;  2ZNU A;  3AXF A;  3VXB A;  3B7D A;  5DEX B;  3KOS A;  1AL3 A;  3Q26 A;  4F1V A;  5KDT B;  3DP6 A;  2DE4 A;  3C35 A;  5J1D A;  2ZNS A;  3QAX A;  1MY1 A;  4GLI A;  2GHA A;  4N6P A;  5H8H B;  3OO6 A;  1MRP A;  3I3V A;  2XXX A;  4KD5 A;  3RNN A;  1B9J A;  1NH8 A;  1SYH A;  1DSN A;  4GOT A;  4IO6 A;  4IO7 A;  2NWJ A;  1MXY A;  4E0W A;  4ZED A;  1JQF A;  1ZLQ A;  5F7V A;  3UGW A;  4FAT A;  3S9M C;  4PFY A;  4RK9 A;  1EZ9 A;  3RTW B;  3VVF A;  5I59 B;  1BLF A;  2WKY A;  3GXA A;  2REG A;  4EXK A;  1OQH A;  2XD2 A;  3C33 A;  4EXL A;  3CG1 A;  3N26 A;  5L9S A;  4P0G A;  4U4S A;  3TCH A;  2F35 A;  1XOC A;  4IGT A;  1B1X A;  3TTR A;  1GVC A;  4WED A;  3MVZ A;  1NNT A;  1VE4 A;  2I0B A;  3MZ9 A;  3PMW A;  3L6H A;  3PPO A;  3OMB A;  3Q27 A;  1MXV A;  1D3K A;  1CE2 A;  2DE3 A;  5KZT A;  2PYY A;  5K2X A;  1WVJ A;  3H7M A;  4LQ2 A;  3KJ7 A;  2UVG A;  1BTJ A;  1PBQ A;  2QS2 A;  3RTF B;  1OLA A;  5ISU A;  1Y3N A;  1SI1 A;  3DM0 A;  3HV1 A;  4BDO A;  2GHB A;  3F11 A;  3UP9 A;  3TMG A;  2DS9 A;  3Q28 A;  3K6W A;  2B3B A;  1ZJL A;  5AA2 B;  2G29 A;  2DSF A;  1B51 A;  1MQI A;  1PB8 A;  3H3G A;  4QF9 A;  4XIG Q;  5FHO A;  3WAF A;  2DYX A;  2B65 A;  3H6T A;  3G7W A;  1B1H A;  2H4I A;  4NED A;  1AIV A;  3CSG A;  3PUY E;  3S9E A;  5FHN A;  2CMO A;  1SBP A;  1ELJ A;  4I62 A;  3T96 B;  2A5T A;  1MXX A;  4R2F A;  1LB9 A;  4IY5 A;  1N7W A;  4NMY A;  1EZO A;  3CR9 A;  3MW0 A;  4QSC A;  1D9Y A;  1N3X A;  1S9T A;  1Z7N E;  2XXW A;  3H03 A;  1UTB B;  1FQF A;  5FTH A;  4BDN A;  4QSE A;  1VFD A;  1LFH A;  4U2R A;  4ELO A;  2KLF A;  2GFE A;  3OEK A;  4G8M A;  1UTH A;  3IB0 A;  5AA2 A;  3H6W A;  1VSO A;  1FQB A;  3T9V A;  3IL1 B;  4OES A;  1YCJ A;  1Y4C A;  3IAZ A;  2HFB A;  1SVX B;  2IA4 A;  2I4C A;  4JB7 A;  4XKR A;  3VLU A;  4G68 B;  3SEU A;  4ELQ A;  5TP9 A;  1NMU A;  2HAU A;  3M8U A;  3QUF A;  4OFL A;  4QSD A;  3VFJ A;  1LLS A;  3IO4 A;  1B7Z A;  3PD8 A;  3D4C A;  4UA8 A;  3EHU A;  4YKP A;  4ZEC A;  1PC3 A;  2VD2 A;  3R26 A;  2DVC A;  4JWO A;  4UAC A;  2FYI A;  3E4R A;  3IO6 A;  3KZG A;  5I58 B;  3PV0 E;  5CC2 A;  1GR2 A;  1LAG E;  4GL0 A;  4K3F A;  1TFD A;  3MP1 A;  3TTL A;  3GZG A;  1A55 A;  2XXQ A;  3U93 A;  4G4P A;  5AE4 A;  1A8E A;  3HHG A;  2I48 A;  4OYV A;  1N76 A;  3DP8 A;  1B58 A;  3H4Z A;  3TYH A;  3K1M A;  4PFU A;  3PMX A;  4EQ7 A;  1PB7 A;  1MPC A;  4FIM A;  1IXG A;  1US5 A;  2Z8F A;  3KGC A;  3T22 A;  2O1L A;  1R6Z A;  1QVS A;  1A99 A;  3FJ7 A;  5LOM A;  1LB8 A;  5M2V A;  3FVO A;  1QUK A;  1LFI A;  3OD7 A;  2HXW A;  3TCG A;  3OEL A;  4GVO A;  1P99 A;  3C36 A;  2ZNT A;  3HPI A;  3FV1 A;  2ONK E;  3OO7 A;  4NF5 B;  4R9F A;  5FHM A;  2IEE A;  2REJ A;  4YKK A;  3HST A;  3SEV A;  1NH7 A;  1FQE A;  1FCK A;  4U23 A;  4FED A;  5I57 B;  1DTG A;  4AB5 A;  3LSW A;  4QFO A;  1MH4 A;  2HAV A;  4H65 A;  2QS1 A;  1AMF A;  4MLQ A;  4NF6 A;  4R6H A;  5H8H A;  4Q0C A;  3W9W A;  4KCC A;  3I5O A;  1A54 A;  1Z7M E;  1S7Y A;  2QJE A;  5DVF A;  2O1M A;  2UVJ A;  1QW0 A;  3S4U A;  1CB6 A;  2DOJ A;  4KHZ E;  2H9B A;  2FNC A;  3TEL A;  3TQL A;  4ZEK A;  2RIN A;  1RYX A;  4OFO A;  2Q2A A;  3IB2 A;  1URS A;  4KPT A;  1H44 A;  3SDF A;  3OEM A;  4EUO A;  5ELV A;  3M3F A;  1OMP A;  4BDQ A;  1JW4 A;  2QL3 A;  1B3H A;  2H25 A;  2Y7I A;  4FOR A;  3FXR A;  1TT1 A;  1LAX A;  3PPQ A;  2THI A;  2RC8 A;  5CI5 A;  1FTM A;  4C1T A;  4ELR A;  2OWS A;  4LVQ A;  3KN8 A;  5B7D A;  1MG1 A;  1R9L A;  2F8D A;  2HZK A;  2QPQ A;  3E3K A;  2PVU A;  4JWY A;  5EHS A;  5L9O A;  3MP8 A;  1OQG A;  3H6V A;  4R6Y A;  1XS5 A;  2O7I A;  1LBC A;  3DEL B;  5ITO A;  1N0T A;  3JV9 A;  4L17 A;  2F34 A;  1L5T A;  1UIU A;  2Q88 A;  4JSO A;  3O9P A;  2H99 A;  4GD5 A;  2GH9 A;  3B6T A;  2D3I A;  2AYS A;  2F97 A;  2G93 A;  1PEB A;  4R73 A;  4RYA A;  1FTL A;  3T93 B;  3ONM A;  4DZ1 A;  3S9N C;  1Y1Z A;  2BJJ X;  3PGF A;  5AA3 A;  3H06 B;  1US4 A;  4N13 A;  4ZEF A;  4YMA A;  1NFT A;  3O28 A;  3VDF A;  2NXO A;  4MFI A;  5HPQ A;  1AOV A;  4U22 A;  5BUU A;  1N84 A;  4XKN A;  2XX8 A;  3EHT A;  2O69 A;  4FJP A;  2Z8E A;  3TZA A;  4C1U A;  2O6A A;  3PUX E;  3U94 A;  3IOR A;  4POX A;  1QKB A;  3TEP A;  4KYS A;  2QS4 A;  3OOA A;  4TLL B;  4X9T A;  2AL4 A;  4NF6 B;  4EQB A;  2UYE A;  3G3I A;  1SYI A;  2F78 A;  4R75 A;  1WDN A;  4OEV A;  1M5F A;  3C32 A;  4F3G A;  2F7A A;  2RCB A;  3EN3 A;  5AA1 A;  4ESX A;  4NF4 A;  2VP1 A;  5I2N A;  5I84 A;  3PU5 A;  4YZZ A;  1GV8 A;  1WOD A;  3FJG A;  3Q25 A;  3KEI A;  4R74 A;  1MQD A;  5KCJ A;  1B4Z A;  1XC1 A;  2Q89 A;  1PBP A;  3WAE A;  1MY0 A;  3PUZ E;  4F3P A;  3RQT A;  3FVG A;  1FTK A;  3K02 A;  3FXQ A;  3FUZ A;  1SW4 A;  4IY6 A;  4HW8 A;  4H5F A;  1IUD A;  1NNP A;  1B5I A;  5CRY A;  5AA2 D;  2CZL A;  3K0V A;  3Q29 A;  2I3V A;  4PP0 A;  2ESN A;  2XX9 A;  3SKP A;  4JSD A;  1MQJ A;  3B6Q A;  2VD3 A;  2R71 A;  2F6G A;  1RYO A;  1UTB A;  3JYR A;  4GRK A;  4KYD A;  1GTK A;  1JW5 A;  3W15 C;  4Z7E A;  2Y7R A;  5EYF A;  3G3F A;  4THI A;  1EZP A;  1B3L A;  3C4M A;  4LA9 A;  2QMX A;  1NNK A;  3SET A;  4DLD A;  4ZE9 A;  3FVN A;  3T9H B;  3T9X B;  1QUI A;  3O6H A;  1II5 A;  1LAF E;  3MJN A;  1MM6 A;  4XKP A;  5B70 A;  2F36 A;  4F3S A;  4FEC A;  3HO7 A;  1LFG A;  3LSF B;  1USY E;  3ILU B;  4IO3 A;  4U4X A;  3U72 A;  4BLA A;  2VHA A;  1HSL A;  1NNF A;  2OZZ A;  3H6U A;  3ZKK A;  4F22 A;  3MZB A;  3TDJ A;  4H0W A;  1UQW A;  4R72 A;  1IZ1 A;  3JZJ A;  4Q5T A;  5K2Y A;  1HSE A;  2QRY A;  1SDX A;  3KSJ A;  3L6G A;  4KCD A;  4AB6 A;  1DOT A;  1XVX A;  3RLF E;  4X1B A;  4F39 A;  3UA8 A;  4OET A;  4ONY A;  4QFN A;  1MY2 A;  2OBG A;  3HHF A;  4WEP A;  3PD9 A;  4NWD A;  2F7C A;  2I58 A;  4IO2 A;  1B46 A;  4R2B A;  4RK2 A;  4X48 A;  2UVH A;  3ILT B;  4FEB A;  4WXJ A;  3KOT A;  4FAJ A;  3KSX A;  4YKI A;  3FZV A;  2DXY A;  5DTB A;  4LUB A;  2A5T B;  4GF8 A;  5EHM A;  2XXU A;  2XXH A;  2Z23 A;  3A09 A;  3LBS A;  2H5Y A;  3MUQ A;  3SES A;  3VVE A;  4DXB A;  3MP6 A;  3N6T A;  2Z22 A;  2XXP A;  4F31 B;  4ISU A;  1FQC A;  2ONR A;  4N07 A;  3V5A A;  3P7I A;  1I6B A;  4YB6 A;  5I59 A;  4F3B A;  4LP2 B;  1IXI A;  4TQU Q;  1ZBM A;  1M5D A;  1OIB A;  4U1Z A;  2DVZ A;  3C34 A;  1LCT A;  3FD3 A;  2HQ0 A;  2OLB A;  4PFW A;  3IJO B;  4YU0 A;  4C0R A;  2XXI A;  4X1D A;  1B5H A;  3U1O A;  3U8Q A;  2Z8D A;  2E0S A;  4H1X A;  4DIG A;  3O29 A;  3V83 A;  1LGB C;  5DT6 A;  3MWB A;  4OFJ A;  3EPE A;  4O3B A;  4RA1 A;  4EDP A;  1J1N A;  1IEJ A;  4H67 A;  3BFU A;  1HSJ A;  3TUS A;  3LC8 A;  5TPA B;  2LAO A;  2DQV A;  5H8F A;  3IX1 A;  2DWJ A;  3E9X A;  3K2D A;  4NWC A;  3ECR A;  3BKI B;  2XXT A;  3CFX A;  1H76 A;  3UIF A;  3W9V A;  1ZTY A;  1DTZ A;  4G8H A;  5CBR A;  4ND9 A;  4YKJ A;  3QIM A;  1Q1K A;  4YB5 A;  1YPN A;  4BDL A;  2I6E A;  3PUW E;  3QK6 A;  4YB7 A;  2UXA A;  4EQ9 A;  4ZZA A;  4E0X A;  4MBP A;  3K01 A;  3UOR A;  5JTY A;  4YMB A;  4OEN A;  1F9B A;  1MXU A;  2NOO A;  4OZ9 A;  4OXV A;  1B3G A;  4PQJ A;  4H6D A;  1S50 A;  1SQY A;  5H8F B;  1B32 A;  4G8N A;  3RGY A;  4H5G A;  5CM6 A;  4ELP A;  1NKX A;  1GGG A;  3S2V A;  3VLW A;  3SEX A;  1B6H A;  3A3U A;  3T9U A;  1DPE A;  5KDT A;  2XXY A;  1Y1M A;  2I3W A;  4GL8 A;  3O66 A;  3VE1 B;  3ZS6 A;  1KWH A;  2ZMB A;  4RPN A;  3O6G A;  2DXR A;  4H8J A;  2HCA A;  4LZ8 A;  3TOD A;  3VLV A;  4BDM A;  4U21 A;  3FJM A;  3IOU A;  1BIY A;  2HZL A;  1BKA A;  1MM7 A;  4LQ5 A;  3RUM A;  5JK4 A;  4QFK A;  1JVX A;  1SW2 A;  2RC9 A;  4PFT A;  4G2Z A;  3N6U A;  1DPP A;  3PPR A;  1B7U A;  2E1S A;  4PE5 B;  2QSX A;  3FGS A;  3O2A A;  4DDD A;  4RNS A;  1LAH E;  2Q9T A;  2VGQ A;  1URD A;  3IOT A;  1A7L A;  3PPN A;  4H8I A;  5F1Q A;  3T66 A;  1IXH A;  1JET A;  3FV2 A;  4HTG A;  3FAS A;  2ONS A;  4NF8 B;  1ZKB A;  3M3L A;  4YAH X;  2DWI A;  4QRZ A;  4DXU A;  1AH5 A;  3IB1 A;  1Y4T A;  3MVX A;  1IIW A;  3FIR A;  3MBP A;  3QSL A;  1MY3 A;  3R6U A;  2QMW A;  2UYF A;  5I2K B;  2H98 A;  2O51 A;  3MPK A;  1P1U A;  3CFL A;  3A3C A;  4KFQ A;  4RJZ A;  4DE8 A;  1FTO A;  1Y9U A;  3G3H A;  2XD3 A;  1MDQ A;  3V89 B;  3BBR A;  2R6G E;  4ZEB A;  4BDR A;  5HBC A;  1IQ7 A;  1O63 A;  2DE2 A;  4G77 A;  1SW1 A;  3LR1 A;  3SEY A;  3CVG A;  2F6P A;  4IO4 A;  4M1V A;  3O97 A;  3UK4 A;  4M4G A;  2Q2C A;  1XHY A;  2P0S A;  3IJX B;  3K00 A;  1N7X A;  3EF7 A;  3RPW A;  3M3K A;  3KN3 A;  3N94 A;  2ABH A;  4LON B;  4OWD A;  2D5W A;  4G68 A;  3QYT A;  2YPN A;  4KI0 E;  2AIX A;  4R6K A;  5DEX A;  2FA7 A;  4Z0I A;  3VVD A;  2B3F A;  4JBZ A;  4TLM B;  2X26 A;  3LUY A;  3TKD A;  3ZSF A;  1UTH B;  4JXI A;  5CMB A;  5CMK A;  5FTI A;  1JEV A;  2X7P A;  2XXR A;  5A5X A;  3RN8 A;  5BWJ A;  5DVJ A;  5DYH A;  1JEU A;  1VFE A;  1Y20 A;  2F7B A;  4FE8 A;  4HCW A;  1A8F A;  3K6X A;  2UVI A;  4XKQ A;  2VOZ A;  3KN7 A;  3TTK A;  3ZKL A;  4NE4 A;  1OLC A;  5ICQ A;  1SW5 A;  2RCA A;  4GXS B;  4NF4 B;  4RXL A;  5I2N B;  1FTJ A;  4IO5 A;  4R9G A;  4OEU A;  2V93 A;  1H3D A;  2ANJ A;  4KR5 A;  1MH3 A;  1USY H;  3C9H A;  5CMC A;  5TU0 A;  1SD3 A;  5I56 B;  3BFT A;  2PT2 A;  5AA4 A;  1JVY A;  5H8N B;  3FAT A;  4GQO A;  4GWO A;  5TPA A;  4U1O A;  4ZS9 A;  4NTL A;  3EHS A;  2ZYK A;  2DWA A;  3HCQ A;  4O3A A;  1N3W A;  1JW1 A;  1MY4 A;  3TAJ A;  3UN6 A;  5A5X B;  3V8X B;  5I2K A;  3C31 A;  3GBB A;  2OCU A;  2O68 A;  3CG3 A;  1ZIU A;  4JWX A;  1B2H A;  1ANF A;  4OER A;  2HEU A;  4OHN A;  1POT A;  5I57 A;  2O7U A;  1UIV A;  2Y84 A;  3MC2 A;  4F2Q A;  3CRB A;  3SER A;  3MVW A;  5JTY B;  5ICT A;  2NVU B;  2R9J A;  1P1O A;  1N04 A;  1FW0 A;  4Q30 B;  3D4G A;  2ZYN A;  3THI A;  3KBR A;  1ZU0 A;  3TCF A;  1DMB A;  4F2O A;  3I6V A;  4KQP A;  1IIT A;  3IOW A;  1NL5 A;  5ITP A;  3E13 X;  2XX7 A;  4GFR A;  4O3C A;  3VXC A;  1IXC A;  2OJT A;  3K4U A;  3N5L A;  5IKB A;  3G3K A;  3OO9 A;  5KCJ B;  3OEN A;  1B40 A;  1H45 A;  1P1N A;  4F29 A;  1M5E A;  1ZMG A;  2I4B A;  4MLV A;  1Y3Q A;  5H8N A;  3S9L C;  3USD A;  1ATG A;  1YAE A;  1MXZ A;  3KJT A;  3OSR A;  3CFZ A;  1PDA A;  1QKA A;  4I1D A;  4ZZE A;  4EF2 A;  4P0I A;  1Y3P A;  1BP5 A;  4ZEI A;  1M5C A;  3K1N A;  3KFM A;  3TFL A;  4ZE8 A;  2Q8J A;  1LCF A;  3O6I A;  4PET A;  1B3E A;  1EU8 A;  2V25 A;  5JEI A;  1B5J A;  2V84 A;  4IB2 A;  2YLN A;  3LSL A;  1MDP 1;  2P1S A;  2DP8 A;  3CI8 A;  4LZ5 A;  1R9Q A;  4RY1 A;  3TTN A;  2I0C A;  2Y7K A;  1VR5 A;  1EH3 A;  3B6W A;  4OMB A;  4GXA A;  2P2A A;  3EQ1 A;  3K6U A;  4AQ4 A;  4DXC A;  3KG2 A;  4G68 C;  4DCY A;  4QHQ A;  1B0H A;  4HCY A;  5H8Q B;  5L8D A;  3FVK A;  1O7T A;  3DLN A;  3MVY A;  2I49 A;  3DP4 A;  4OQO A;  3MAM A;  3RY3 A;  4DCX A;  1B7H A;  1MPB A;  4F18 A;  4P11 A;  1T0K A;  1JNF A;  3MQ9 A;  3RT8 A;  1D4N A;  1B0L A;  3QUJ A;  4Q8R A;  5CBS A;  2A5S A;  4POW A;  1TWY A;  3K1P A;  1D9V A;  3IR1 A;  2M8C A;  4QFL A;  5H8S A;  1URG A;  1R1N A;  1TFA A;  2NUV A;  1XT8 A;  2RC7 A;  2GRV A;  2ZXT A;  3OSQ A;  3IK6 B;  5HM4 B;  1OVT A;  3ODB A;  1QUJ A;  4QFP A;  3VV5 A;  5AA4 B;  5I56 A;  1POY 1;  2PX1 A;  4NF8 A;  5I58 A;  1FQD A;  3TQW A;  2OK2 A;  4XXU A;  1TXF A;  3GBA A;  1QUL A;  2Y7W A;  2V3U A;  4ESW A;  4F1U A;  4HS7 A;  4TOZ A;  2PBW A;  1I69 A;  1RKM A;  4F19 A;  1M5B A;  3MZ1 A;  3TTM A;  1B05 A;  1O64 A;  1MPD A;  4KYE A;  5TP9 B;  3OXN A;  3PPP A;  4I8C A;  5H8Q A;  3HN0 A;  3LSX A;  3R7X A;  3PUV E;  2F5X A;  3PMV A;  1MS7 A;  1P1W A;  2DWH A;  1YTV A;  2YJP A;  3OO8 A;  4OTE A;  1LST A;  5IAI A;  2AL5 A;  2PT1 A;  4ZDM A;  3SEW A;  2Y7P A;  2RF1 A;  4NF5 A;  2ZYM A;  2X7Q A;  3CIJ A;  2XXV A;  2ALU A;  3K6V A;  3G3J A;  1Q35 A; 
#chains in the Genus database with same CATH topology
 3GLB A;  1H43 A;  1XVY A;  1B4H A;  4GWS A;  2V3Q A;  3FXU A;  2ZZV A;  4LZ7 A;  3MPL A;  1QJM A;  4MH5 A;  2QS3 A;  4ECF A;  1SI0 A;  3VXB A;  3KOS A;  3DP6 A;  3C35 A;  3GYY A;  4GLI A;  4IO7 A;  4GOT A;  1ZLQ A;  4FAT A;  3MST A;  4PFY A;  1EZ9 A;  3CG1 A;  3N26 A;  4P0G A;  4QBA A;  1XOC A;  3TTR A;  2I0B A;  3PMW A;  1CE2 A;  5KZT A;  2PYY A;  5K2X A;  2UVG A;  1SI1 A;  3UP9 A;  3TMG A;  3K6W A;  2CZI A;  5J16 A;  1PB8 A;  3RYD A;  5ET5 A;  2CEX A;  1EYI A;  5IZ3 B;  5FHN A;  2CMO A;  4GWY A;  4I62 A;  3T96 B;  1MXX A;  4R2F A;  5I7I A;  1S9T A;  4BDN A;  4U2R A;  4ELO A;  3OEK A;  1DBZ A;  1VSO A;  1FQB A;  3IAZ A;  2HFB A;  1SVX B;  4JB7 A;  3SEU A;  4UA8 A;  2F3D A;  2DVC A;  2XXK A;  4P8B A;  5I58 B;  3PV0 E;  3TTL A;  4G4P A;  1A8E A;  3DP8 A;  3K1M A;  1IXG A;  1US5 A;  3T22 A;  3ROJ A;  1QVS A;  1LB8 A;  3FVO A;  3OD7 A;  2Q74 A;  4GVO A;  1P99 A;  3HPI A;  3FV1 A;  2ONK E;  4NN3 A;  3SEV A;  4U23 A;  5ET7 A;  1MH4 A;  2HAV A;  4KCC A;  3I5O A;  1A54 A;  1Z7M E;  1S7Y A;  2UVJ A;  2RIN A;  3IB2 A;  1YZ0 A;  1B3H A;  2H25 A;  4N6D A;  3FXR A;  4MEV A;  4C1T A;  4LVQ A;  1MG1 A;  1R9L A;  2F8D A;  2HZK A;  4JWY A;  5EHS A;  3H6V A;  4N17 A;  3DEL B;  3JV9 A;  2F34 A;  2H99 A;  2GH9 A;  3B6T A;  2F97 A;  4MNC A;  2VPO A;  2BJJ X;  4N13 A;  1NFT A;  3VDF A;  2NXO A;  4MFI A;  1N84 A;  4XKN A;  3EHT A;  2Z8E A;  3TZA A;  3TEP A;  4KYS A;  2QS4 A;  4EQB A;  4QXD A;  1SYI A;  2F7A A;  1G0H A;  5AA1 A;  5I2N A;  3PU5 A;  1GV8 A;  3FJG A;  4R74 A;  5KCJ A;  1XC1 A;  1SPI A;  3PUZ E;  3FXQ A;  4HW8 A;  1NNP A;  5CRY A;  2I3V A;  3SKP A;  1MQJ A;  4FBP A;  4GRK A;  5EYF A;  1B3L A;  3C4M A;  3SET A;  2QMX A;  4PBQ A;  4ZE9 A;  3FVN A;  1QUI A;  1LFG A;  3LSF B;  4BLA A;  3MZB A;  4H0W A;  3LUZ A;  1K9Z A;  4KCD A;  3L6G A;  1DOT A;  3RLF E;  4ONY A;  1MY2 A;  4X9T A;  3PD9 A;  4RK2 A;  4FAJ A;  3KSX A;  3FZV A;  4LUB A;  3SES A;  2H5Y A;  4PAF A;  3VVE A;  4YB6 A;  1I6B A;  5I59 A;  4F3B A;  4JVC A;  4TQU Q;  1OIB A;  3FD3 A;  1LCT A;  2HQ0 A;  4YU0 A;  2XWV A;  2E0S A;  3O29 A;  3EPE A;  4JVD A;  4H67 A;  3BFU A;  3IFA A;  3E9X A;  3CFX A;  1H76 A;  2VT5 A;  4O94 A;  4ND9 A;  3QIM A;  3QK6 A;  2UXA A;  2FIE A;  2NOO A;  4H6D A;  4H5G A;  1NKX A;  1GGG A;  3VLW A;  2I3W A;  3ZS6 A;  4GL8 A;  4RPN A;  4LZ8 A;  1Q9D A;  3VLV A;  4BDM A;  3IOU A;  1BIY A;  4GX6 A;  2RC9 A;  4PFT A;  2Q8M A;  1DPP A;  1EYJ A;  3FGS A;  4NF0 A;  4DDD A;  3T66 A;  1URD A;  3R6U A;  5I2K B;  5J1D A;  2QMW A;  2O51 A;  4KFQ A;  4N15 A;  1Y9U A;  3G3H A;  3V89 B;  2R6G E;  2DE2 A;  1SW1 A;  3LR1 A;  3CVG A;  2F6P A;  4M1V A;  3UK4 A;  3K00 A;  2ABH A;  4G68 A;  4X04 A;  1NI9 A;  2FA7 A;  4HXV A;  2B3F A;  5FTI A;  2XXR A;  1VFE A;  2F7B A;  1FBC A;  2UVI A;  1SW5 A;  4NF4 B;  4GX3 A;  1IMB A;  1H3D A;  2ANJ A;  2PFY A;  5TU0 A;  3BFT A;  2PT2 A;  4NTL A;  3EHS A;  2QFL A;  5I2K A;  1JW1 A;  4JWX A;  4F2Q A;  2ZYN A;  1DMB A;  3IOW A;  3E13 X;  3VXC A;  3OO9 A;  1B40 A;  4F29 A;  5H8N A;  3S9L C;  1Y3P A;  4ZEI A;  4ZE8 A;  2Q8J A;  1EU8 A;  2V25 A;  1NV5 A;  2P1S A;  3CI8 A;  4RY1 A;  4MAG A;  1EH3 A;  4GXA A;  4G68 C;  4N91 A;  5L8D A;  3FVK A;  2I49 A;  3MAM A;  4DCX A;  3FBP A;  4MHF A;  4F18 A;  1T0K A;  3MQ9 A;  3RT8 A;  2A5S A;  4QFL A;  5H8S A;  3VV5 A;  5AA4 B;  4NF8 A;  1TXF A;  3GBA A;  1QUL A;  2PBW A;  1I69 A;  1RKM A;  1M5B A;  3MZ1 A;  3LV0 A;  1MPD A;  3PPP A;  3R7X A;  3PUV E;  4P1E A;  2FBP A;  5LDZ A;  4OTE A;  1LST A;  2AL5 A;  2PT1 A;  5ESY A;  1G0I A;  2RF1 A;  2X7Q A;  5L9M A;  4PGN A;  1NV7 A;  3KC1 A;  1VDW A;  1MQH A;  4MF3 A;  4P3L A;  1OVB A;  4LAT A;  1A40 A;  4IGR A;  2D21 A;  3TPA A;  3QXM A;  4EF1 A;  2ZYO A;  3U92 A;  2XWI A;  1PB9 A;  5LTC A;  1MQG A;  4I9D A;  3Q26 A;  2ZNS A;  3QAX A;  1MY1 A;  3OO6 A;  1MRP A;  3RNN A;  1B9J A;  1NH8 A;  1SYH A;  1DSN A;  4IO6 A;  2NWJ A;  4ZED A;  1MXY A;  4RK9 A;  3RTW B;  3VVF A;  3HFU A;  4EXK A;  1OQH A;  4EXL A;  5L9S A;  1GVC A;  4WED A;  1MXV A;  3H7M A;  1FJ9 A;  1PBQ A;  2QS2 A;  1DK4 A;  3HV1 A;  2B3B A;  5FBP A;  5AA2 B;  2G29 A;  1MQI A;  4XIG Q;  2XWO A;  4MJO A;  3G7W A;  4NED A;  3CSG A;  3PUY E;  1EZO A;  3CR9 A;  4QSC A;  5FTH A;  1UTB B;  4QSE A;  5AA2 A;  3T9V A;  4OES A;  1YCJ A;  4XKR A;  2IA4 A;  2I4C A;  5TP9 A;  3VFJ A;  2HAU A;  4F1Y A;  4QSD A;  4YKP A;  1PC3 A;  2VD2 A;  3R26 A;  4JWO A;  4UAC A;  3IO6 A;  2B4M A;  4K3F A;  1TFD A;  3MP1 A;  1NV4 A;  3U93 A;  2Y5K A;  3TYH A;  3H4Z A;  4PFU A;  1PB7 A;  1MPC A;  4FIM A;  2V4C A;  5LOM A;  1LFI A;  2HXW A;  4YKK A;  3HST A;  1FBP A;  2HPG A;  4AB5 A;  4QFO A;  4H65 A;  2QS1 A;  2QJE A;  5DVF A;  2O1M A;  1LBZ A;  2DOJ A;  3TEL A;  4P56 A;  3TQL A;  1URS A;  4KPT A;  1H44 A;  3SDF A;  4N8Y A;  4EUO A;  1FBE A;  5IZ1 A;  4HE2 A;  2GQ1 A;  4GWX A;  5CI5 A;  4ELR A;  2OWS A;  5B7D A;  3E3K A;  3MP8 A;  1N0T A;  3O9P A;  4KXP A;  2G93 A;  1FTL A;  3T93 B;  3PGF A;  2L5V A;  1FPB A;  5HPQ A;  1AOV A;  2XX8 A;  4FJP A;  4C1U A;  2O6A A;  3PUX E;  3IOR A;  4POX A;  1QKB A;  2AL4 A;  2UYE A;  4R75 A;  4F3G A;  2RCB A;  4ESX A;  3Q25 A;  3KEI A;  2ZZX A;  1PBP A;  3WAE A;  3FVG A;  3IFC A;  4DI4 B;  1B5I A;  2CZL A;  4PP0 A;  3B6Q A;  4KYD A;  1JW5 A;  4OVQ A;  1NUW A;  1LAF E;  3MJN A;  5B70 A;  1MM6 A;  2HHM A;  3HO7 A;  4IO3 A;  3ILU B;  4U4X A;  3TDJ A;  3B50 A;  5K2Y A;  1UQW A;  1IZ1 A;  1SDX A;  1XVX A;  3SZP A;  4QFN A;  3HHF A;  4NWD A;  2I58 A;  4X48 A;  2UVH A;  3ILT B;  4FEB A;  4YKI A;  5DTB A;  2XXU A;  2Z23 A;  3LBS A;  4MX6 A;  3N6T A;  2Z22 A;  2XXP A;  1FQC A;  2ONR A;  1IXI A;  1ZBM A;  2DVZ A;  2OLB A;  3U1O A;  3U8Q A;  2Z8D A;  4PGP A;  1LGB C;  3QMF A;  4OFJ A;  5ET6 A;  4RA1 A;  1HSJ A;  2DQV A;  4NWC A;  3ECR A;  4YKJ A;  1FBD A;  1CNQ A;  4ZZA A;  4E0X A;  1LBY A;  4YMB A;  4OZ9 A;  4OXV A;  4PQJ A;  1S50 A;  1SQY A;  4AS5 A;  5H8F B;  3RGY A;  5CM6 A;  1B6H A;  3A3U A;  2P3N A;  1KWH A;  2ZMB A;  3RUM A;  2QVV A;  1BKA A;  1SW2 A;  2E1S A;  3O2A A;  5F1Q A;  1LAH E;  2VGQ A;  4PAK A;  4MNI A;  4HTG A;  4NF8 B;  1ZKB A;  4YAH X;  2DWI A;  3MVX A;  1IIW A;  3QSL A;  1MY3 A;  2H98 A;  3CFL A;  4RJZ A;  3A3C A;  1FTO A;  2XD3 A;  1MDQ A;  3BBR A;  4ZEB A;  2XWK A;  1O63 A;  4G77 A;  3SEY A;  2OWZ A;  4M4G A;  3KN3 A;  4OWD A;  2D5W A;  1FPI A;  2AIX A;  4R6K A;  3VVD A;  2X26 A;  3ZSF A;  1UTH B;  5CMB A;  5CMK A;  1JEU A;  4HCW A;  2VOZ A;  3KN7 A;  4NE4 A;  1OLC A;  1RDX A;  1FTJ A;  4IO5 A;  5I56 B;  1SD3 A;  1JVY A;  2ZYK A;  2DWA A;  1N3W A;  2O68 A;  4OER A;  4OHN A;  1POT A;  2QVR A;  1UIV A;  4I40 A;  5JTY B;  3THI A;  4F2O A;  3I6V A;  1IIT A;  1NL5 A;  4GFR A;  4N4U A;  4OAN A;  1IXC A;  2OJT A;  5IKB A;  2HXR A;  4N6K A;  1H45 A;  1P1N A;  3KBZ A;  1IMC A;  1M5E A;  1ATG A;  1FSA A;  1MXZ A;  3KJT A;  3CFZ A;  1M5C A;  3K1N A;  1LCF A;  4PET A;  5JEI A;  3NOH A;  5DW8 A;  1VR5 A;  2P2A A;  5I3S A;  4AQ4 A;  4PDD A;  3KG2 A;  4DCY A;  4QHQ A;  5H8Q B;  1O7T A;  1B7H A;  1NV3 A;  5IGA A;  4NHB A;  1B0L A;  3QUJ A;  4POW A;  1D9V A;  3IR1 A;  1URG A;  1TFA A;  2NUV A;  1XT8 A;  2RC7 A;  5EYH A;  5HM4 B;  1QUJ A;  1KZ8 A;  1POY 1;  2KR0 A;  3PTY A;  1FQD A;  3TQW A;  2Y7W A;  4ESW A;  4N8G A;  4PCD A;  1B05 A;  3OXN A;  4I8C A;  5H8Q A;  2F5X A;  3PMV A;  2DWH A;  3OO8 A;  5IAI A;  4ZDM A;  2FIX A;  2XXV A;  3IK6 B;  5CMM A;  4PFR A;  4GIZ A;  5EQA A;  2WBD A;  2O84 X;  2V3T A;  1B3F A;  4JDF A;  3BIG A;  1YYZ A;  4XTC Q;  3T0J A;  4RPO A;  4WKM A;  1MXW A;  2W7Y A;  2RKM A;  1I6A A;  2ZNU A;  3AXF A;  5KDT B;  3B7D A;  5DEX B;  1AL3 A;  2DE4 A;  1IME A;  4N81 A;  4N6P A;  2GHA A;  4E0W A;  1FBG A;  1JQF A;  2MKZ A;  5I59 B;  1BLF A;  3GXA A;  2XD2 A;  3C33 A;  2JJK A;  1FPF A;  4IGT A;  3CHG A;  4OVS A;  3MVZ A;  1NUX A;  3PPO A;  3Q27 A;  2DE3 A;  4LQ2 A;  3KJ7 A;  1BTJ A;  3DM0 A;  3F11 A;  2DS9 A;  1ZJL A;  1LBW A;  3H3G A;  3H6T A;  2H4I A;  3S9E A;  1SBP A;  1AWB A;  4OVP A;  1ELJ A;  2A5T A;  1LB9 A;  1N7W A;  3MW0 A;  1D9Y A;  1N3X A;  1Z7N E;  1VFD A;  4G8M A;  1UTH A;  3H6W A;  4NAP A;  4ELQ A;  3VLU A;  3M8U A;  4BDR A;  3QUF A;  1IMF A;  1LLS A;  3IO4 A;  3EHU A;  3E4R A;  1GR2 A;  1LAG E;  3GZG A;  1A55 A;  2XXQ A;  5AE4 A;  2I48 A;  2QVU A;  4OYV A;  1N76 A;  3PMX A;  4EQ7 A;  1FTA A;  2Z8F A;  3KGC A;  5M2V A;  1QUK A;  3OO7 A;  4R9F A;  5FHM A;  2REJ A;  2F3B A;  1NH7 A;  1FCK A;  1DCU A;  4NF6 A;  4Q0C A;  3W9W A;  4GWZ A;  3S4U A;  1NUY A;  2H9B A;  2FNC A;  1RYX A;  4OFO A;  3OEM A;  5ELV A;  1OMP A;  2QL3 A;  2Y7I A;  4G61 A;  3PPQ A;  2THI A;  2RC8 A;  1FTM A;  1NV1 A;  3KN8 A;  3E78 A;  2PVU A;  5L9O A;  1OQG A;  4R6Y A;  1XS5 A;  1LBC A;  1UIU A;  2Q88 A;  4JSO A;  4R73 A;  2D3I A;  2AYS A;  2FVZ A;  3ONM A;  3S9N C;  1Y1Z A;  4MNP A;  5AA3 A;  3H06 B;  4ZEF A;  3O28 A;  3U94 A;  1FJ6 A;  3RPL A;  3OOA A;  4PBH A;  2F78 A;  1M5F A;  5I84 A;  3ISP A;  4MMP A;  1WOD A;  1MQD A;  2Q89 A;  1MY0 A;  4F3P A;  1FTK A;  3K02 A;  3FUZ A;  1SW4 A;  4IY6 A;  4H5F A;  5AA2 D;  3Q29 A;  2XX9 A;  3JYR A;  3V83 A;  2R71 A;  1RYO A;  1UTB A;  4O8M A;  1GTK A;  3G3F A;  1EZP A;  1NNK A;  3T9H B;  3O6H A;  1II5 A;  4XKP A;  2F36 A;  4F3S A;  4H45 A;  1USY E;  2VHA A;  3ZKK A;  2OZZ A;  3H6U A;  4X1B A;  2CZH A;  4IO2 A;  4R2B A;  1B46 A;  3KOT A;  4GF8 A;  3A09 A;  3MP6 A;  4ISU A;  4N07 A;  3P7I A;  1M5D A;  4PFW A;  3C34 A;  2XXI A;  4X1D A;  1B5H A;  5DT6 A;  3MWB A;  4O3B A;  5TPA B;  2DWJ A;  1IMD A;  1DTZ A;  2KQZ A;  4G8H A;  5CBR A;  5A5L A;  4YB5 A;  4BDL A;  2I6E A;  4EQ9 A;  4MBP A;  1F9B A;  1MXU A;  1B3G A;  1B32 A;  3A29 A;  4ELP A;  3S2V A;  3VE1 B;  2OX3 A;  3O6G A;  2WYK A;  2HCA A;  3FJM A;  2HZL A;  4LQ5 A;  1MM7 A;  3PPR A;  1B7U A;  2QSX A;  1K9Y A;  2Q9T A;  3IOT A;  4GBV A;  1IXH A;  3FV2 A;  3FAS A;  2ONS A;  4QRZ A;  1Y4T A;  3MBP A;  4UAB A;  1P1U A;  4DE8 A;  1IQ7 A;  4IO4 A;  3O97 A;  2P0S A;  5AA4 A;  3RPW A;  3EF7 A;  5DEX A;  4Z0I A;  4TLM B;  3TKD A;  4OVR A;  4JXI A;  2X7P A;  5BWJ A;  5DVJ A;  5DYH A;  4FE8 A;  1Y20 A;  1A8F A;  5IM2 A;  4XKQ A;  2RCA A;  3MYU A;  4RXL A;  1FPG A;  4R9G A;  1MH3 A;  3C9H A;  5H8N B;  3FAT A;  4GWO A;  4ZS9 A;  5ET8 A;  3HCQ A;  4O3A A;  3TAJ A;  3UN6 A;  3GBB A;  2OCU A;  3CG3 A;  1ZIU A;  1B2H A;  2HEU A;  5I57 A;  2O7U A;  1BK4 A;  3CRB A;  5IZ3 A;  3SER A;  3MVW A;  2B4L A;  1P1O A;  4Q30 B;  1FW0 A;  3D4G A;  1FPJ A;  4KQP A;  5ITP A;  4O3C A;  5KCJ B;  3N5L A;  3OEN A;  1INP A;  1ZMG A;  4MLV A;  3USD A;  1YAE A;  3OSR A;  4P0I A;  3TFL A;  4PF6 A;  1B5J A;  2V84 A;  1EYK A;  4F19 A;  2YLN A;  3TTN A;  1MDP 1;  4XFE A;  2I0C A;  4DI3 D;  3B6W A;  1NV2 A;  4OMB A;  3EQ1 A;  1B0H A;  3DLN A;  4OQO A;  4P11 A;  1JNF A;  4Q8R A;  1TWY A;  3K1P A;  2M8C A;  1YXI A;  2GRV A;  2ZXT A;  3ODB A;  4QFP A;  2PX1 A;  4XXU A;  2V3U A;  4F1U A;  4HS7 A;  4TOZ A;  4KYE A;  1P1W A;  1NV0 A;  2YJP A;  4O7I A;  2WBB A;  3CIJ A;  2ALU A;  3K6V A;  3G3J A;  3N94 A;  2OWT A;  2PMS A;  1FQA A;  3G3G A;  4PAI A;  3RT6 B;  5DVI A;  4YIC A;  1I6Q A;  4OVJ A;  3CSB A;  1B52 A;  1P1Q A;  4XEQ A;  3IOV A;  1LBB A;  3D1R A;  2XHD A;  1KA1 A;  4F1V A;  4IR8 A;  5H8H B;  3I3V A;  2XXX A;  4KD5 A;  1NV6 A;  5F7V A;  3S9M C;  3UGW A;  2WKY A;  1KA0 A;  2REG A;  4U4S A;  3TCH A;  2F35 A;  1B1X A;  1NNT A;  1VE4 A;  3MZ9 A;  1FPE A;  3L6H A;  3OMB A;  1D3K A;  1WVJ A;  1OLA A;  5ISU A;  1Y3N A;  4BDO A;  2GHB A;  1LBX A;  2PFZ A;  3Q28 A;  4NX1 A;  4PDH A;  2DSF A;  1B51 A;  4QF9 A;  3WAF A;  5FHO A;  2DYX A;  2B65 A;  1B1H A;  1RDZ A;  1AIV A;  4IY5 A;  4NMY A;  2XXW A;  3H03 A;  1FQF A;  4P1L A;  1LFH A;  2KLF A;  2GFE A;  2CZK A;  3IB0 A;  3IL1 B;  1Y4C A;  1FBH A;  1XI6 A;  4G68 B;  1NMU A;  5IZZ A;  4OFL A;  4ZEC A;  1B7Z A;  3PD8 A;  3D4C A;  4HE1 A;  2FYI A;  1FPL A;  3KZG A;  5CC2 A;  4GL0 A;  3HHG A;  2FHY A;  1B58 A;  3B8B A;  2PCR A;  4XF5 A;  2O1L A;  1R6Z A;  1A99 A;  3FJ7 A;  3E79 A;  3TCG A;  3OEL A;  3C36 A;  2ZZW A;  2ZNT A;  4NF5 B;  2IEE A;  1FQE A;  4FED A;  5I57 B;  1DTG A;  2P3V A;  3LSW A;  4R6H A;  1AMF A;  4MLQ A;  5H8H A;  4MCO A;  1QW0 A;  1CB6 A;  4KHZ E;  4ZEK A;  2Q2A A;  2R8T A;  4NQ8 A;  3M3F A;  4BDQ A;  1JW4 A;  4FOR A;  1TT1 A;  1LAX A;  2QPQ A;  2O7I A;  1LEV A;  5ITO A;  4O7M A;  4NGU A;  4L17 A;  4OA4 A;  1L5T A;  3RTF B;  4GD5 A;  4OVT A;  4RYA A;  1PEB A;  4DZ1 A;  4PF8 A;  4YMA A;  1US4 A;  4PFB A;  4U22 A;  4P9K A;  2O69 A;  5EQ9 A;  4TLL B;  3BIH A;  4NF6 B;  3G3I A;  1WDN A;  4OEV A;  3C32 A;  3EN3 A;  4I3Y A;  4NF4 A;  2VP1 A;  4YZZ A;  4PFI A;  1B4Z A;  2Y5L A;  3RQT A;  1FBF A;  5T3J A;  1IUD A;  3K0V A;  2ESN A;  4JSD A;  2VD3 A;  4LON B;  2F6G A;  3W15 C;  4H46 A;  4Z7E A;  2Y7R A;  4THI A;  1NUZ A;  4LA9 A;  4HE0 A;  4DLD A;  3T9X B;  4FEC A;  3U72 A;  1HSL A;  1NNF A;  4F22 A;  4R72 A;  3JZJ A;  4Q5T A;  1HSE A;  2QRY A;  3KSJ A;  4AB6 A;  4F39 A;  3UA8 A;  4OET A;  4WEP A;  2OBG A;  2F7C A;  4LN5 A;  4I3E A;  4WXJ A;  1LBV A;  2DXY A;  2A5T B;  5EHM A;  2CEY A;  2XXH A;  4DXB A;  3MUQ A;  4F31 B;  1D9Q A;  3V5A A;  4LP2 B;  5F24 A;  4U1Z A;  3IJO B;  4C0R A;  3EKI A;  4DIG A;  4H1X A;  4EDP A;  1J1N A;  1IEJ A;  3TUS A;  3LC8 A;  2LAO A;  5H8F A;  3IX1 A;  3K2D A;  3U65 A;  3BKI B;  2XXT A;  3UIF A;  4X8R A;  3W9V A;  1ZTY A;  1Q1K A;  1YPN A;  3PUW E;  4YB7 A;  3UOR A;  3K01 A;  5JTY A;  4OEN A;  2DDK A;  4G8N A;  3SEX A;  3T9U A;  1DPE A;  5KDT A;  2XXY A;  1Y1M A;  3O66 A;  2DXR A;  4H8J A;  3TOD A;  4U21 A;  5JK4 A;  4QFK A;  1JVX A;  4AS4 A;  4G2Z A;  3N6U A;  1FRP A;  4PE5 B;  2WYP A;  4RNS A;  3PPN A;  4H8I A;  1A7L A;  1JET A;  1FPK A;  3M3L A;  4DXU A;  5BUU A;  1AH5 A;  3IB1 A;  3FIR A;  2UYF A;  3MPK A;  4PC9 A;  4P47 A;  3RPL B;  5HBC A;  1RDY A;  1QGX A;  4GWW A;  4NG7 A;  2Q2C A;  1XHY A;  3IJX B;  1N7X A;  3M3K A;  2WX9 A;  4KI0 E;  3QYT A;  2YPN A;  1IMA A;  4JBZ A;  3LUY A;  1JEV A;  5A5X A;  3RN8 A;  3K6X A;  4PE3 A;  3TTK A;  3ZKL A;  4GWU A;  5ICQ A;  4GXS B;  5I2N B;  4OEU A;  2V93 A;  4KR5 A;  1USY H;  5CMC A;  5I5P A;  4GQO A;  5TPA A;  4U1O A;  1MY4 A;  5A5X B;  3V8X B;  3C31 A;  2BJI A;  5EYG A;  1ANF A;  2Y84 A;  3MC2 A;  5ICT A;  2NVU B;  2R9J A;  1N04 A;  3KBR A;  1ZU0 A;  3TCF A;  2WEF A;  2XX7 A;  3K4U A;  3G3K A;  2I4B A;  1Y3Q A;  1FPD A;  1PDA A;  1QKA A;  4I1D A;  4ZZE A;  4EF2 A;  1BP5 A;  4GBW A;  4JVI A;  3KC0 A;  3KFM A;  3O6I A;  1B3E A;  5EQ7 A;  4IB2 A;  3LSL A;  2DP8 A;  4LZ5 A;  1R9Q A;  2Y7K A;  1JP4 A;  3K6U A;  4DXC A;  4PTK A;  4HCY A;  3MVY A;  3DP4 A;  3T1B A;  3RY3 A;  1MPB A;  5EQ8 A;  1D4N A;  5CBS A;  2XA5 A;  1R1N A;  3OSQ A;  3FXB A;  4MIJ A;  1OVT A;  5I56 A;  5I58 A;  2OK2 A;  2VPN A;  4GX4 A;  3TTM A;  1O64 A;  5TP9 B;  3HN0 A;  3LSX A;  1MS7 A;  1YTV A;  3SEW A;  2Y7P A;  4NF5 A;  2ZYM A;  1Q35 A; 
#chains in the Genus database with same CATH homology
 5CMM A;  2OWT A;  2PMS A;  4GIZ A;  1FQA A;  3G3G A;  2O84 X;  2V3T A;  3GLB A;  1H43 A;  1XVY A;  1B4H A;  2V3Q A;  1B3F A;  4JDF A;  1MQH A;  3RT6 B;  4MF3 A;  5DVI A;  1OVB A;  5L9M A;  4LAT A;  3FXU A;  1A40 A;  4YIC A;  4IGR A;  2D21 A;  4XTC Q;  3TPA A;  4LZ7 A;  3QXM A;  3MPL A;  4RPO A;  1I6Q A;  4WKM A;  4OVJ A;  1QJM A;  3CSB A;  4MH5 A;  2QS3 A;  4EF1 A;  1B52 A;  1MXW A;  2W7Y A;  1P1Q A;  4F1Y A;  4ECF A;  3IOV A;  1LBB A;  2RKM A;  1SI0 A;  2ZYO A;  2XHD A;  3U92 A;  1I6A A;  1PB9 A;  1MQG A;  4I9D A;  2ZNU A;  3AXF A;  3VXB A;  3B7D A;  5DEX B;  3KOS A;  1AL3 A;  3Q26 A;  4F1V A;  5KDT B;  3DP6 A;  2DE4 A;  3C35 A;  5J1D A;  2ZNS A;  3QAX A;  1MY1 A;  4GLI A;  2GHA A;  4N6P A;  5H8H B;  3OO6 A;  1MRP A;  3I3V A;  2XXX A;  4KD5 A;  3RNN A;  1B9J A;  1NH8 A;  1SYH A;  1DSN A;  4GOT A;  4IO6 A;  4IO7 A;  2NWJ A;  1MXY A;  4E0W A;  4ZED A;  1JQF A;  1ZLQ A;  5F7V A;  3UGW A;  4FAT A;  3S9M C;  4PFY A;  4RK9 A;  1EZ9 A;  3RTW B;  3VVF A;  5I59 B;  1BLF A;  2WKY A;  3GXA A;  2REG A;  4EXK A;  1OQH A;  2XD2 A;  3C33 A;  4EXL A;  3CG1 A;  3N26 A;  5L9S A;  4P0G A;  4U4S A;  3TCH A;  2F35 A;  1XOC A;  4IGT A;  1B1X A;  3TTR A;  1GVC A;  4WED A;  3MVZ A;  1NNT A;  1VE4 A;  2I0B A;  3MZ9 A;  3PMW A;  3L6H A;  3PPO A;  3OMB A;  3Q27 A;  1MXV A;  1D3K A;  1CE2 A;  2DE3 A;  5KZT A;  2PYY A;  5K2X A;  1WVJ A;  3H7M A;  4LQ2 A;  3KJ7 A;  2UVG A;  1BTJ A;  1PBQ A;  2QS2 A;  3RTF B;  1OLA A;  5ISU A;  1Y3N A;  1SI1 A;  3DM0 A;  3HV1 A;  4BDO A;  2GHB A;  3F11 A;  3UP9 A;  3TMG A;  2DS9 A;  3Q28 A;  3K6W A;  2B3B A;  1ZJL A;  5AA2 B;  2G29 A;  2DSF A;  1B51 A;  1MQI A;  1PB8 A;  3H3G A;  4QF9 A;  4XIG Q;  5FHO A;  3WAF A;  2DYX A;  2B65 A;  3H6T A;  3G7W A;  1B1H A;  2H4I A;  4NED A;  1AIV A;  3CSG A;  3PUY E;  3S9E A;  5FHN A;  2CMO A;  1SBP A;  1ELJ A;  4I62 A;  3T96 B;  2A5T A;  1MXX A;  4R2F A;  1LB9 A;  4IY5 A;  1N7W A;  4NMY A;  1EZO A;  3CR9 A;  3MW0 A;  4QSC A;  1D9Y A;  1N3X A;  1S9T A;  1Z7N E;  2XXW A;  3H03 A;  1UTB B;  1FQF A;  5FTH A;  4BDN A;  4QSE A;  1VFD A;  1LFH A;  4U2R A;  4ELO A;  2KLF A;  2GFE A;  3OEK A;  4G8M A;  1UTH A;  3IB0 A;  5AA2 A;  3H6W A;  1VSO A;  1FQB A;  3T9V A;  3IL1 B;  4OES A;  1YCJ A;  1Y4C A;  3IAZ A;  2HFB A;  1SVX B;  2IA4 A;  2I4C A;  4JB7 A;  4XKR A;  3VLU A;  4G68 B;  3SEU A;  4ELQ A;  5TP9 A;  1NMU A;  2HAU A;  3M8U A;  3QUF A;  4OFL A;  4QSD A;  3VFJ A;  1LLS A;  3IO4 A;  1B7Z A;  3PD8 A;  3D4C A;  4UA8 A;  3EHU A;  4YKP A;  4ZEC A;  1PC3 A;  2VD2 A;  3R26 A;  2DVC A;  4JWO A;  4UAC A;  2FYI A;  3E4R A;  3IO6 A;  3KZG A;  5I58 B;  3PV0 E;  5CC2 A;  1GR2 A;  1LAG E;  4GL0 A;  4K3F A;  1TFD A;  3MP1 A;  3TTL A;  3GZG A;  1A55 A;  2XXQ A;  3U93 A;  4G4P A;  5AE4 A;  1A8E A;  3HHG A;  2I48 A;  4OYV A;  1N76 A;  3DP8 A;  1B58 A;  3H4Z A;  3TYH A;  3K1M A;  4PFU A;  3PMX A;  4EQ7 A;  1PB7 A;  1MPC A;  4FIM A;  1IXG A;  1US5 A;  2Z8F A;  3KGC A;  3T22 A;  2O1L A;  1R6Z A;  1QVS A;  1A99 A;  3FJ7 A;  5LOM A;  1LB8 A;  5M2V A;  3FVO A;  1QUK A;  1LFI A;  3OD7 A;  2HXW A;  3TCG A;  3OEL A;  4GVO A;  1P99 A;  3C36 A;  2ZNT A;  3HPI A;  3FV1 A;  2ONK E;  3OO7 A;  4NF5 B;  4R9F A;  5FHM A;  2IEE A;  2REJ A;  4YKK A;  3HST A;  3SEV A;  1NH7 A;  1FQE A;  1FCK A;  4U23 A;  4FED A;  5I57 B;  1DTG A;  4AB5 A;  3LSW A;  4QFO A;  1MH4 A;  2HAV A;  4H65 A;  2QS1 A;  1AMF A;  4MLQ A;  4NF6 A;  4R6H A;  5H8H A;  4Q0C A;  3W9W A;  4KCC A;  3I5O A;  1A54 A;  1Z7M E;  1S7Y A;  2QJE A;  5DVF A;  2O1M A;  2UVJ A;  1QW0 A;  3S4U A;  1CB6 A;  2DOJ A;  4KHZ E;  2H9B A;  2FNC A;  3TEL A;  3TQL A;  4ZEK A;  2RIN A;  1RYX A;  4OFO A;  2Q2A A;  3IB2 A;  1URS A;  4KPT A;  1H44 A;  3SDF A;  3OEM A;  4EUO A;  5ELV A;  3M3F A;  1OMP A;  4BDQ A;  1JW4 A;  2QL3 A;  1B3H A;  2H25 A;  2Y7I A;  4FOR A;  3FXR A;  1TT1 A;  1LAX A;  3PPQ A;  2THI A;  2RC8 A;  5CI5 A;  1FTM A;  4C1T A;  4ELR A;  2OWS A;  4LVQ A;  3KN8 A;  5B7D A;  1MG1 A;  1R9L A;  2F8D A;  2HZK A;  2QPQ A;  3E3K A;  2PVU A;  4JWY A;  5EHS A;  5L9O A;  3MP8 A;  1OQG A;  3H6V A;  4R6Y A;  1XS5 A;  2O7I A;  1LBC A;  3DEL B;  5ITO A;  1N0T A;  3JV9 A;  4L17 A;  2F34 A;  1L5T A;  1UIU A;  2Q88 A;  4JSO A;  3O9P A;  2H99 A;  4GD5 A;  2GH9 A;  3B6T A;  2D3I A;  2AYS A;  2F97 A;  2G93 A;  1PEB A;  4R73 A;  4RYA A;  1FTL A;  3T93 B;  3ONM A;  4DZ1 A;  3S9N C;  1Y1Z A;  2BJJ X;  3PGF A;  5AA3 A;  3H06 B;  1US4 A;  4N13 A;  4ZEF A;  4YMA A;  1NFT A;  3O28 A;  3VDF A;  2NXO A;  4MFI A;  5HPQ A;  1AOV A;  4U22 A;  5BUU A;  1N84 A;  4XKN A;  2XX8 A;  3EHT A;  2O69 A;  4FJP A;  2Z8E A;  3TZA A;  4C1U A;  2O6A A;  3PUX E;  3U94 A;  3IOR A;  4POX A;  1QKB A;  3TEP A;  4KYS A;  2QS4 A;  3OOA A;  4TLL B;  4X9T A;  2AL4 A;  4NF6 B;  4EQB A;  2UYE A;  3G3I A;  1SYI A;  2F78 A;  4R75 A;  1WDN A;  4OEV A;  1M5F A;  3C32 A;  4F3G A;  2F7A A;  2RCB A;  3EN3 A;  5AA1 A;  4ESX A;  4NF4 A;  2VP1 A;  5I2N A;  5I84 A;  3PU5 A;  4YZZ A;  1GV8 A;  1WOD A;  3FJG A;  3Q25 A;  3KEI A;  4R74 A;  1MQD A;  5KCJ A;  1B4Z A;  1XC1 A;  2Q89 A;  1PBP A;  3WAE A;  1MY0 A;  3PUZ E;  4F3P A;  3RQT A;  3FVG A;  1FTK A;  3K02 A;  3FXQ A;  3FUZ A;  1SW4 A;  4IY6 A;  4HW8 A;  4H5F A;  1IUD A;  1NNP A;  1B5I A;  5CRY A;  5AA2 D;  2CZL A;  3K0V A;  3Q29 A;  2I3V A;  4PP0 A;  2ESN A;  2XX9 A;  3SKP A;  4JSD A;  1MQJ A;  3B6Q A;  2VD3 A;  2R71 A;  2F6G A;  1RYO A;  1UTB A;  3JYR A;  4GRK A;  4KYD A;  1GTK A;  1JW5 A;  3W15 C;  4Z7E A;  2Y7R A;  5EYF A;  3G3F A;  4THI A;  1EZP A;  1B3L A;  3C4M A;  4LA9 A;  2QMX A;  1NNK A;  3SET A;  4DLD A;  4ZE9 A;  3FVN A;  3T9H B;  3T9X B;  1QUI A;  3O6H A;  1II5 A;  1LAF E;  3MJN A;  1MM6 A;  4XKP A;  5B70 A;  2F36 A;  4F3S A;  4FEC A;  3HO7 A;  1LFG A;  3LSF B;  1USY E;  3ILU B;  4IO3 A;  4U4X A;  3U72 A;  4BLA A;  2VHA A;  1HSL A;  1NNF A;  2OZZ A;  3H6U A;  3ZKK A;  4F22 A;  3MZB A;  3TDJ A;  4H0W A;  1UQW A;  4R72 A;  1IZ1 A;  3JZJ A;  4Q5T A;  5K2Y A;  1HSE A;  2QRY A;  1SDX A;  3KSJ A;  3L6G A;  4KCD A;  4AB6 A;  1DOT A;  1XVX A;  3RLF E;  4X1B A;  4F39 A;  3UA8 A;  4OET A;  4ONY A;  4QFN A;  1MY2 A;  2OBG A;  3HHF A;  4WEP A;  3PD9 A;  4NWD A;  2F7C A;  2I58 A;  4IO2 A;  1B46 A;  4R2B A;  4RK2 A;  4X48 A;  2UVH A;  3ILT B;  4FEB A;  4WXJ A;  3KOT A;  4FAJ A;  3KSX A;  4YKI A;  3FZV A;  2DXY A;  5DTB A;  4LUB A;  2A5T B;  4GF8 A;  5EHM A;  2XXU A;  2XXH A;  2Z23 A;  3A09 A;  3LBS A;  2H5Y A;  3MUQ A;  3SES A;  3VVE A;  4DXB A;  3MP6 A;  3N6T A;  2Z22 A;  2XXP A;  4F31 B;  4ISU A;  1FQC A;  2ONR A;  4N07 A;  3V5A A;  3P7I A;  1I6B A;  4YB6 A;  5I59 A;  4F3B A;  4LP2 B;  1IXI A;  4TQU Q;  1ZBM A;  1M5D A;  1OIB A;  4U1Z A;  2DVZ A;  3C34 A;  1LCT A;  3FD3 A;  2HQ0 A;  2OLB A;  4PFW A;  3IJO B;  4YU0 A;  4C0R A;  2XXI A;  4X1D A;  1B5H A;  3U1O A;  3U8Q A;  2Z8D A;  2E0S A;  4H1X A;  4DIG A;  3O29 A;  3V83 A;  1LGB C;  5DT6 A;  3MWB A;  4OFJ A;  3EPE A;  4O3B A;  4RA1 A;  4EDP A;  1J1N A;  1IEJ A;  4H67 A;  3BFU A;  1HSJ A;  3TUS A;  3LC8 A;  5TPA B;  2LAO A;  2DQV A;  5H8F A;  3IX1 A;  2DWJ A;  3E9X A;  3K2D A;  4NWC A;  3ECR A;  3BKI B;  2XXT A;  3CFX A;  1H76 A;  3UIF A;  3W9V A;  1ZTY A;  1DTZ A;  4G8H A;  5CBR A;  4ND9 A;  4YKJ A;  3QIM A;  1Q1K A;  4YB5 A;  1YPN A;  4BDL A;  2I6E A;  3PUW E;  3QK6 A;  4YB7 A;  2UXA A;  4EQ9 A;  4ZZA A;  4E0X A;  4MBP A;  3K01 A;  3UOR A;  5JTY A;  4YMB A;  4OEN A;  1F9B A;  1MXU A;  2NOO A;  4OZ9 A;  4OXV A;  1B3G A;  4PQJ A;  4H6D A;  1S50 A;  1SQY A;  5H8F B;  1B32 A;  4G8N A;  3RGY A;  4H5G A;  5CM6 A;  4ELP A;  1NKX A;  1GGG A;  3S2V A;  3VLW A;  3SEX A;  1B6H A;  3A3U A;  3T9U A;  1DPE A;  5KDT A;  2XXY A;  1Y1M A;  2I3W A;  4GL8 A;  3O66 A;  3VE1 B;  3ZS6 A;  1KWH A;  2ZMB A;  4RPN A;  3O6G A;  2DXR A;  4H8J A;  2HCA A;  4LZ8 A;  3TOD A;  3VLV A;  4BDM A;  4U21 A;  3FJM A;  3IOU A;  1BIY A;  2HZL A;  1BKA A;  1MM7 A;  4LQ5 A;  3RUM A;  5JK4 A;  4QFK A;  1JVX A;  1SW2 A;  2RC9 A;  4PFT A;  4G2Z A;  3N6U A;  1DPP A;  3PPR A;  1B7U A;  2E1S A;  4PE5 B;  2QSX A;  3FGS A;  3O2A A;  4DDD A;  4RNS A;  1LAH E;  2Q9T A;  2VGQ A;  1URD A;  3IOT A;  1A7L A;  3PPN A;  4H8I A;  5F1Q A;  3T66 A;  1IXH A;  1JET A;  3FV2 A;  4HTG A;  3FAS A;  2ONS A;  4NF8 B;  1ZKB A;  3M3L A;  4YAH X;  2DWI A;  4QRZ A;  4DXU A;  1AH5 A;  3IB1 A;  1Y4T A;  3MVX A;  1IIW A;  3FIR A;  3MBP A;  3QSL A;  1MY3 A;  3R6U A;  2QMW A;  2UYF A;  5I2K B;  2H98 A;  2O51 A;  3MPK A;  1P1U A;  3CFL A;  3A3C A;  4KFQ A;  4RJZ A;  4DE8 A;  1FTO A;  1Y9U A;  3G3H A;  2XD3 A;  1MDQ A;  3V89 B;  3BBR A;  2R6G E;  4ZEB A;  4BDR A;  5HBC A;  1IQ7 A;  1O63 A;  2DE2 A;  4G77 A;  1SW1 A;  3LR1 A;  3SEY A;  3CVG A;  2F6P A;  4IO4 A;  4M1V A;  3O97 A;  3UK4 A;  4M4G A;  2Q2C A;  1XHY A;  2P0S A;  3IJX B;  3K00 A;  1N7X A;  3EF7 A;  3RPW A;  3M3K A;  3KN3 A;  3N94 A;  2ABH A;  4LON B;  4OWD A;  2D5W A;  4G68 A;  3QYT A;  2YPN A;  4KI0 E;  2AIX A;  4R6K A;  5DEX A;  2FA7 A;  4Z0I A;  3VVD A;  2B3F A;  4JBZ A;  4TLM B;  2X26 A;  3LUY A;  3TKD A;  3ZSF A;  1UTH B;  4JXI A;  5CMB A;  5CMK A;  5FTI A;  1JEV A;  2X7P A;  2XXR A;  5A5X A;  3RN8 A;  5BWJ A;  5DVJ A;  5DYH A;  1JEU A;  1VFE A;  1Y20 A;  2F7B A;  4FE8 A;  4HCW A;  1A8F A;  3K6X A;  2UVI A;  4XKQ A;  2VOZ A;  3KN7 A;  3TTK A;  3ZKL A;  4NE4 A;  1OLC A;  5ICQ A;  1SW5 A;  2RCA A;  4GXS B;  4NF4 B;  4RXL A;  5I2N B;  1FTJ A;  4IO5 A;  4R9G A;  4OEU A;  2V93 A;  1H3D A;  2ANJ A;  4KR5 A;  1MH3 A;  1USY H;  3C9H A;  5CMC A;  5TU0 A;  1SD3 A;  5I56 B;  3BFT A;  2PT2 A;  5AA4 A;  1JVY A;  5H8N B;  3FAT A;  4GQO A;  4GWO A;  5TPA A;  4U1O A;  4ZS9 A;  4NTL A;  3EHS A;  2ZYK A;  2DWA A;  3HCQ A;  4O3A A;  1N3W A;  1JW1 A;  1MY4 A;  3TAJ A;  3UN6 A;  5A5X B;  3V8X B;  5I2K A;  3C31 A;  3GBB A;  2OCU A;  2O68 A;  3CG3 A;  1ZIU A;  4JWX A;  1B2H A;  1ANF A;  4OER A;  2HEU A;  4OHN A;  1POT A;  5I57 A;  2O7U A;  1UIV A;  2Y84 A;  3MC2 A;  4F2Q A;  3CRB A;  3SER A;  3MVW A;  5JTY B;  5ICT A;  2NVU B;  2R9J A;  1P1O A;  1N04 A;  1FW0 A;  4Q30 B;  3D4G A;  2ZYN A;  3THI A;  3KBR A;  1ZU0 A;  3TCF A;  1DMB A;  4F2O A;  3I6V A;  4KQP A;  1IIT A;  3IOW A;  1NL5 A;  5ITP A;  3E13 X;  2XX7 A;  4GFR A;  4O3C A;  3VXC A;  1IXC A;  2OJT A;  3K4U A;  3N5L A;  5IKB A;  3G3K A;  3OO9 A;  5KCJ B;  3OEN A;  1B40 A;  1H45 A;  1P1N A;  4F29 A;  1M5E A;  1ZMG A;  2I4B A;  4MLV A;  1Y3Q A;  5H8N A;  3S9L C;  3USD A;  1ATG A;  1YAE A;  1MXZ A;  3KJT A;  3OSR A;  3CFZ A;  1PDA A;  1QKA A;  4I1D A;  4ZZE A;  4EF2 A;  4P0I A;  1Y3P A;  1BP5 A;  4ZEI A;  1M5C A;  3K1N A;  3KFM A;  3TFL A;  4ZE8 A;  2Q8J A;  1LCF A;  3O6I A;  4PET A;  1B3E A;  1EU8 A;  2V25 A;  5JEI A;  1B5J A;  2V84 A;  4IB2 A;  2YLN A;  3LSL A;  1MDP 1;  2P1S A;  2DP8 A;  3CI8 A;  4LZ5 A;  1R9Q A;  4RY1 A;  3TTN A;  2I0C A;  2Y7K A;  1VR5 A;  1EH3 A;  3B6W A;  4OMB A;  4GXA A;  2P2A A;  3EQ1 A;  3K6U A;  4AQ4 A;  4DXC A;  3KG2 A;  4G68 C;  4DCY A;  4QHQ A;  1B0H A;  4HCY A;  5H8Q B;  5L8D A;  3FVK A;  1O7T A;  3DLN A;  3MVY A;  2I49 A;  3DP4 A;  4OQO A;  3MAM A;  3RY3 A;  4DCX A;  1B7H A;  1MPB A;  4F18 A;  4P11 A;  1T0K A;  1JNF A;  3MQ9 A;  3RT8 A;  1D4N A;  1B0L A;  3QUJ A;  4Q8R A;  5CBS A;  2A5S A;  4POW A;  1TWY A;  3K1P A;  1D9V A;  3IR1 A;  2M8C A;  4QFL A;  5H8S A;  1URG A;  1R1N A;  1TFA A;  2NUV A;  1XT8 A;  2RC7 A;  2GRV A;  2ZXT A;  3OSQ A;  3IK6 B;  5HM4 B;  1OVT A;  3ODB A;  1QUJ A;  4QFP A;  3VV5 A;  5AA4 B;  5I56 A;  1POY 1;  2PX1 A;  4NF8 A;  5I58 A;  1FQD A;  3TQW A;  2OK2 A;  4XXU A;  1TXF A;  3GBA A;  1QUL A;  2Y7W A;  2V3U A;  4ESW A;  4F1U A;  4HS7 A;  4TOZ A;  2PBW A;  1I69 A;  1RKM A;  4F19 A;  1M5B A;  3MZ1 A;  3TTM A;  1B05 A;  1O64 A;  1MPD A;  4KYE A;  5TP9 B;  3OXN A;  3PPP A;  4I8C A;  5H8Q A;  3HN0 A;  3LSX A;  3R7X A;  3PUV E;  2F5X A;  3PMV A;  1MS7 A;  1P1W A;  2DWH A;  1YTV A;  2YJP A;  3OO8 A;  4OTE A;  1LST A;  5IAI A;  2AL5 A;  2PT1 A;  4ZDM A;  3SEW A;  2Y7P A;  2RF1 A;  4NF5 A;  2ZYM A;  2X7Q A;  3CIJ A;  2XXV A;  2ALU A;  3K6V A;  3G3J A;  1Q35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...