3ZKLA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotriose
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
molecule keywords PUTATIVE SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
total genus 143
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA02
3TMGA 4OENA 1SW2A 5DEXB 5BWJA 4WEDA 2O7IA 1H43A 1XS5A 4NEDA 4XTCQ 2PX1A 1B5IA 1FW0A 2ZXTA 3H6TA 1IXGA 2HCAA 3OOAA 1RYXA 2R9JA 3M3FA 4ZZEA 3T96B 3PPOA 5AA2B 4JBZA 3N6UA 2Z8EA 3RNNA 2XXIA 2HFBA 1II5A 1MQHA 3LBSA 5H8QB 2UVGA 5K2XA 3T66A 2I48A 1MY0A 3TCHA 1USYH 3MZBA 1POTA 2ZNSA 1URGA 2O7UA 3K6XA 1QKBA 3U92A 4GVOA 2XXHA 2ESNA 3SEWA 3VFJA 4QSDA 4HCWA 2ONSA 3A09A 1CE2A 1N7XA 3RUMA 1NKXA 3KG2A 3KGCA 4OEVA 5I56B 2NUVA 2REGA 4G68B 4F3GA 1A8FA 5AA1A 1US5A 2PT1A 3R26A 2DVCA 3RT8A 3T9UA 4JWOA 4R9GA 3FATA 3PD9A 3EQ1A 2F7AA 3IOUA 5AA4A 1H3DA 4UA8A 4DE8A 2B3FA 3G3KA 1S9TA 4KCCA 3OELA 4R72A 1TFAA 1TWYA 3MZ9A 3D4CA 3QIMA 5EHSA 1OVBA 3A3CA 2FYIA 5ITOA 4DXUA 4EQ9A 4Q8RA 2HAUA 2XXQA 1N76A 2F6PA 2Y7WA 5A5XA 1A7LA 1FTKA 4KD5A 4DDDA 2AL4A 3H4ZA 1NH8A 3IB0A 4FECA 4HCYA 4KQPA 2V3TA 4X1BA 4G8MA 4ZEKA 2V84A 3UGWA 5B7DA 3G7WA 1LAHE 4XKNA 2ZYNA 2H25A 3VLVA 4F18A 4O3CA 2Q9TA 2XXPA 3O97A 4P0GA 3L6HA 3FV2A 5FTIA 3K1MA 4ZEBA 4GL0A 5CMKA 3B6QA 3OMBA 5DEXA 3ZKLA 1D9YA 1R6ZA 2M8CA 2O6AA 2XX7A 1PB9A 4IO6A 1SI1A 3TTNA 3DM0A 1MY1A 1O63A 1EZ9A 2ZYOA 3TODA 5CC2A 3N94A 3PPNA 2A5TA 5M2VA 1H44A 2F78A 4P11A 1VE4A 4OWDA 1LCTA 3GZGA 4X1DA 5CBRA 1MXVA 1USYE 1B3GA 3OEMA 3TQLA 1PBPA 2REJA 4ELOA 1H76A 3VV5A 1QW0A 4HS7A 2ZYMA 4F29A 3PMXA 2QJEA 5KCJB 3S9MC 4EDPA 1FTJA 2Z22A 4Q5TA 1YCJA 3LUYA 1A99A 1I6AA 5F7VA 1QUJA 2THIA 5CI5A 5ICQA 3TUSA 3FZVA 1I69A 4IO2A 5A5XB 4U4SA 1OVTA 2QS4A 4H1XA 2I3VA 3P7IA 2ALUA 1B4ZA 2NVUB 3QSLA 4LZ8A 5KCJA 2IA4A 4FEBA 3MPKA 4G68A 4EUOA 5JK4A 1M5FA 4PETA 4F19A 5I59B 3E13X 5I2NA 4RY1A 2VOZA 4H6DA 1US4A 4KI0E 2Q8JA 4EXLA 1JVXA 4F3BA 4I8CA 2I4CA 3FVNA 2RCBA 3G3GA 1JVYA 2ONRA 2XXRA 4K3FA 3BFUA 2DE2A 1VFDA 3EHSA 1PDAA 1Y20A 2DXYA 3M3LA 5I57B 1YTVA 1WVJA 4XKQA 1DTZA 2Y7IA 2Z8DA 1SYHA 1B0LA 4QRZA 4L17A 3K1NA 3HN0A 3RT6B 1ZJLA 3SESA 2RCAA 4RPNA 1IITA 1QUKA 1ZMGA 1QJMA 2P0SA 1TT1A 1Y4CA 3AXFA 3CSGA 3N5LA 3MQ9A 4NF4B 4YKPA 1JW4A 1ZU0A 3LR1A 1NNPA 1EH3A 1GGGA 1EZPA 4RJZA 1MQGA 3BKIB 4R6KA 2F8DA 3IOTA 3CIJA 3E3KA 3MBPA 3N6TA 1ZLQA 4GD5A 2DS9A 1OQGA 2OK2A 3KOSA 1AOVA 2PT2A 4DCYA 1P1NA 2O68A 1DPPA 4ELRA 4F2OA 3U93A 2AIXA 1MPBA 3ECRA 3FD3A 3K4UA 3PU5A 4H5GA 3SEUA 1SD3A 2ZNTA 1XT8A 1HSEA 3TDJA 2H99A 4U1ZA 5J1DA 1LGBC 1ELJA 1QKAA 3MVYA 3IOWA 3FASA 3QAXA 4OESA 4X48A 4ZZAA 4ESWA 3Q27A 3UA8A 3QUFA 1JQFA 3E4RA 1TXFA 2ONKE 2XXUA 3CG1A 3GXAA 2CZLA 2LAOA 3CI8A 4IO5A 4QFKA 2NOOA 4QFNA 3TELA 1MG1A 3B7DA 4THIA 2GH9A 2QMXA 3V89B 3MAMA 4WEPA 3SEYA 4EQBA 5KDTA 2B65A 5FHOA 4F22A 4NF4A 3OO8A 3TZAA 3T22A 1SW5A 1CB6A 1LB9A 1JW1A 3H03A 2XXXA 3N26A 4ESXA 1LAXA 4OFOA 1B1XA 3IORA 2I3WA 1URDA 4H67A 5TPAB 2RC8A 2Y7PA 3EHUA 3UN6A 3G3IA 4IB2A 1NL5A 1NFTA 1OMPA 2UVIA 5FHNA 3OXNA 2QMWA 1P1WA 4R2BA 2P1SA 3MP8A 3PUXE 1B7UA 5I58A 3H6WA 4Z7EA 1D3KA 3WAEA 5H8NB 2Q88A 1Y3QA 1N0TA 2XD3A 1UTHA 3MPLA 3PUYE 2DWAA 4O3BA 4BDMA 1T0KA 1PC3A 1DPEA 3KJ7A 1VFEA 1YPNA 1ZTYA 1O64A 2GHAA 2HAVA 2O1LA 2QL3A 3CFZA 4DXBA 2UXAA 1OQHA 3HCQA 5I58B 1Z7NE 3MVWA 4OEUA 3W15C 4F31B 2YPNA 4OFJA 4IO4A 2QS2A 1FQEA 1SBPA 4POXA 4ZDMA 3FXQA 1POY1 4OVJA 3PGFA 4ZEFA 4YICA 3DP8A 1J1NA 3KOTA 3TTLA 3VE1B 5ITPA 4ZS9A 3H6UA 2F36A 1PBQA 3Q29A 4HW8A 3O6IA 3C35A 1FQAA 2H5YA 1DMBA 2VD3A 3JYRA 3TCFA 3VVFA 4H65A 2I0BA 4F39A 3PUVE 3JZJA 3TCGA 4POWA 3GLBA 4GOTA 4M1VA 3IJOB 4BDRA 4DIGA 4PP0A 4P0IA 3V8XB 2HZKA 4U21A 3VVEA 3HSTA 3H7MA 5CBSA 4YMAA 4JWXA 4X9TA 1MXUA 4MH5A 4OFLA 1UQWA 4RK9A 5K2YA 3C33A 4KYEA 4BDNA 1B9JA 5DVIA 2DVZA 2DXRA 1LBCA 4NF8A 4QF9A 2DWJA 1MQIA 1MXYA 2V3QA 4YU0A 2F6GA 3V5AA 5H8NA 4C1TA 2H4IA 3KN8A 4XKRA 2X7PA 4GF8A 5JTYB 4KR5A 4NWCA 1B3HA 5CRYA 5I57A 4U22A 3W9VA 1MXWA 3UORA 2F7CA 2Q2AA 4H5FA 4YAHX 3TTMA 1ATGA 3VVDA 3U72A 4C1UA 3PMVA 3K0VA 3E9XA 4JSDA 1MPCA 2AYSA 2O51A 5F1QA 3I6VA 4E0WA 5AA2A 2OLBA 2F5XA 2OWTA 3A3UA 4IGTA 5TP9A 5TU0A 3S9NC 1SYIA 3MVXA 1P1QA 4LP2B 4YB5A 5IKBA 4KYDA 4NWDA 3IJXB 1GV8A 3RY3A 4FAJA 4TOZA 3S4UA 4F1UA 3EPEA 1MH3A 4DLDA 1FQCA 1B2HA 3I5OA 4OYVA 1IXIA 4I1DA 4JSOA 1A40A 5ELVA 1MY2A 1AMFA 4XIGQ 3IO6A 4Q30B 1R9QA 3CR9A 1Y3NA 1R9LA 3O9PA 4IO7A 1D4NA 5L8DA 1UTBA 3K1PA 3EF7A 4R75A 3VLWA 1FQDA 1SQYA 5L9MA 2O69A 3PPQA 3VXBA 4G8HA 4EF2A 1B32A 3GBBA 4R74A 2RF1A 3PPPA 4GWOA 4JB7A 4KFQA 1M5EA 3MWBA 4GIZA 2PMSA 1UIVA 4BDQA 1M5DA 1KWHA 1IEJA 4G4PA 1JEUA 2OZZA 4IY5A 5H8SA 4ELQA 5EYFA 5DT6A 4LVQA 3C34A 1WODA 4PFTA 1N04A 2G29A 2PYYA 3K6WA 3UIFA 2DE4A 2Y7KA 1OLCA 1Z7ME 2HXWA 5DVJA 2PVUA 1IQ7A 5EHMA 1MY3A 2ABHA 2NWJA 3HV1A 3GBAA 1FTLA 3MW0A 4RYAA 5CMCA 3TTRA 2I0CA 5HM4B 3KJTA 4I9DA 5IAIA 1Y9UA 3G3FA 2ZMBA 4YZZA 1UIUA 1R1NA 1NNFA 4NF5B 5HBCA 3FVOA 3EN3A 2BJJX 1IIWA 1QVSA 2Q89A 2DWIA 2QSXA 3Q26A 4GL8A 4RXLA 3FUZA 1M5CA 3LC8A 5FHMA 1L5TA 3FXUA 2HZLA 3G3JA 2D3IA 3IAZA 1B51A 4H8JA 4I62A 4AB5A 4O3AA 3RLFE 3BBRA 1DOTA 4KYSA 1B52A 3O66A 3RGYA 4YB7A 4LATA 3QK6A 3OEKA 1UTHB 2W7YA 1I6BA 3ILUB 3IX1A 1AIVA 2I4BA 2XXVA 5KZTA 3S9LC 4PQJA 2XX8A 1AH5A 4EXKA 4FATA 4JXIA 3KFMA 4GQOA 5CM6A 1YAEA 2RINA 1B58A 1Y3PA 2V93A 3KN3A 3DP6A 1TFDA 3H3GA 5AA4B 4FORA 4FE8A 1S50A 1MS7A 2Y84A 5TPAA 1LLSA 3KN7A 3CSBA 3FIRA 1B05A 1JETA 2NXOA 1WDNA 2E0SA 3TKDA 1BIYA 2V3UA 3L6GA 3TTKA 5AA2D 4PE5B 3FJMA 1S7YA 4ZE9A 1IUDA 3LSFB 1Y1ZA 4GRKA 3C9HA 2FNCA 4N6PA 1MDQA 2OWSA 1I6QA 1NNTA 4OERA 3IB2A 5TP9B 3TFLA 3S9EA 4N07A 2A5TB 2B3BA 4OXVA 3M8UA 4E0XA 3B6TA 4G2ZA 2XX9A 1B7HA 4LONB 2V25A 1MDP1 4IGRA 4WKMA 2F7BA 3FJGA 3K01A 2HEUA 1LCFA 1BTJA 4OQOA 3SERA 1JW5A 1NH7A 5FTHA 4YKIA 3U94A 3DP4A 1RKMA 1FCKA 3KZGA 4OTEA 3UP9A 2GHBA 3OENA 2QPQA 3D4GA 1BLFA 3OSRA 3SDFA 3USDA 1P99A 4IY6A 4QFPA 4NF6A 2H98A 4G77A 4F2QA 1LAGE 1QULA 2X26A 4BDLA 4ISUA 3T9HB 1LFIA 4H8IA 1SVXB 4NMYA 4U1OA 4MLQA 4QHQA 3PD8A 4R9FA 3MJNA 2XHDA 4PFWA 1MXZA 5JTYA 5L9OA 4GFRA 4DXCA 2VP1A 3KSXA 4YMBA 1MXXA 2A5SA 1FQFA 2RC9A 3DELB 1UTBB 4BDOA 4FJPA 1HSLA 5DVFA 2GRVA 2D5WA 2VHAA 1XVXA 3RN8A 4GXAA 1JEVA 1VR5A 2XXYA 3CFLA 1B40A 2X7QA 3CRBA 3M3KA 3ODBA 2F35A 4NTLA 3HHFA 2I6EA 4KCDA 1OLAA 4YKJA 1ZIUA 2I58A 4TLLB 2F34A 3O29A 2DE3A 1MQDA 3OO7A 4H0WA 2YLNA 1B46A 3O28A 4TLMB 4N13A 4XXUA 2VD2A 3CVGA 2H9BA 3G3HA 3OSQA 1Y4TA 4DZ1A 5I84A 3ONMA 3WAFA 4MLVA 4UACA 2F97A 1MPDA 4OHNA 1DTGA 4MBPA 4OMBA 1SDXA 1MM7A 1MH4A 3B6WA 2OJTA 4ONYA 1B3LA 5I2NB 3ZKKA 5I59A 4KHZE 3SETA 4F3SA 3IB1A 1BKAA 4NE4A 3T93B 1PEBA 1LAFE 4R6YA 5HPQA 2OBGA 4F1VA 1LFGA 2E1SA 3MP1A 5BUUA 3FGSA 2DYXA 3F11A 1LSTA 3IOVA 3LSWA 3QUJA 4R6HA 3C31A 1B4HA 2O84X 5H8QA 3TPAA 1LFHA 2P2AA 4R2FA 1MQJA 3QYTA 3UK4A 4ELPA 3IO4A 3OD7A 2DSFA 1MRPA 3BFTA 3R6UA 1EU8A 2ZNUA 5CMMA 4ECFA 1EZOA 3IR1A 5JEIA 3FJ7A 1NMUA 1XHYA 3MP6A 4G8NA 4R73A 2YJPA 4GXSB 1GVCA 4U4XA 5B70A 3TAJA 2UVHA 5LOMA 3DLNA 3U1OA 4ZEDA 2QS3A 1PB8A 4ND9A 3TYHA 3ZSFA 2DP8A 2PBWA 3OO6A 3SEXA 4AB6A 3K2DA 2R71A 4AQ4A 3U8QA 1FTOA 1B3FA 4RNSA 2G93A 4LA9A 1LB8A 1LBBA 2RC7A 5H8FA 5ISUA 3MVZA 1B6HA 3THIA 1PB7A 2AL5A 3IK6B 1NNKA 4QSCA 2ANJA 1P1OA 2GFEA 1IZ1A 2UYFA 3C4MA 3FVGA 4LZ7A 1GTKA 1SI0A 4YKKA 3SEVA 5I2KB 1SW4A 2Q2CA 3RTFB 1BP5A 1B1HA 3KSJA 3I3VA 2XXTA 4GLIA 5H8HB 1MM6A 1H45A 2UYEA 3ZS6A 2XXWA 1O7TA 1OIBA 4PFUA 1A8EA 1DSNA 2VGQA 3K6VA 3C36A 2QS1A 3PMWA 4NF8B 4U2RA 4EQ7A 2XD2A 2FA7A 4JWYA 4NF5A 1B7ZA 2QRYA 3PPRA 4LZ5A 5H8FB 5I2KA 3K6UA 2OCUA 4MFIA 4DCXA 1P1UA 2DOJA 5I56A 4PFYA 2DWHA 1B3EA 1M5BA 4G68C 4LQ5A 1FQBA 5L9SA 4M4GA 1N7WA 2Z23A 1MY4A 3ILTB 4KPTA 4NF6B 3VXCA 1XVYA 1JNFA 3H6VA 3O6HA 4FEDA 4QFOA 4EF1A 1N3XA 3TQWA 1B0HA 3H06B 3VDFA 2R6GE 1VSOA 2IEEA 1QUIA 3K00A 4TQUQ 1A55A 3T9XB 3HO7A 1AL3A 3LSXA 3TEPA 2CMOA 4ZECA 1ZBMA 3S2VA 5KDTB 4WXJA 4RA1A 1F9BA 1N3WA 4HTGA 3VLUA 3RQTA 4QSEA 1HSJA 1GR2A 1A54A 3PV0E 2D21A 1XOCA 3W9WA 1ANFA 3JV9A 4RPOA 2ZYKA 1FTMA 2KLFA 3MZ1A 4U23A 4ZEIA 4XKPA 4F3PA 4F1YA 2O1MA 1RYOA 2HQ0A 3O2AA 3IL1B 3HHGA 4IO3A 4Q0CA 4BLAA 3V83A 4OETA 4ZE8A 5DYHA 3LSLA 3R7XA 2I49A 3KBRA 1Q35A 1URSA 4JDFA 4QFLA 4Z0IA 3RPWA 1ZKBA 3PUZE 2RKMA 4LUBA 3RTWB 5AA3A 1Y1MA 3FV1A 4YB6A 5ICTA 3KEIA 3CG3A 3MC2A 1B5HA 1Q1KA 5H8HA 2DQVA 3PUWE 1IXHA 2WKYA 3FXRA 4RK2A 3Q25A 1B5JA 3C32A 3FVKA 3O6GA 3QXMA 3K02A 3OO9A 5CMBA 4FIMA 4OZ9A 1D9VA 3SKPA 3HPIA 1IXCA 3CFXA 4MF3A 2UVJA 5DTBA 3T9VA 1N84A 1SW1A 2Z8FA 3MUQA 2Y7RA 3Q28A 4LQ2A 5AE4A 1XC1A 4C0RA 3EHTA
chains in the Genus database with same CATH superfamily
2FIXA 5BWJA 4NEDA 5FHOA 3UP9A 3H6TA 3T96B 3PPOA 2WX9A 3LBSA 3T66A 3TCHA 1URGA 2O7UA 1QKBA 2ESNA 4HCWA 3KG2A 2NUVA 2REGA 1A8FA 2PT1A 3RT8A 2DVCA 4R9GA 3EQ1A 2F7AA 4H45A 1S9TA 3OELA 4R72A 1TFAA 5EHSA 2FYIA 3IB0A 4HCYA 4KQPA 4N15A 4OVRA 3UGWA 4N6DA 1FBFA 2XXPA 3O97A 4P0GA 5DEXA 4IO6A 3KBZA 3TTNA 5FBPA 1EZ9A 5CC2A 4DI3D 4OWDA 4X1DA 1LCTA 3GZGA 1FTAA 1QW0A 2ZYMA 2QJEA 5KCJB 2Z22A 1A99A 5ICQA 3B8BA 1I69A 2QS4A 4EUOA 5I2NA 4PFIA 4RY1A 1PDAA 1Y20A 2DXYA 1RDYA 1DTZA 2Y7IA 1B0LA 3K1NA 1QUKA 2P0SA 1FRPA 1TT1A 4NF4B 4YKPA 1GGGA 3LV0A 1K9ZA 2F8DA 3N6TA 4OA4A 3NOHA 4DCYA 4ELRA 4F2OA 4HE1A 3ECRA 4H5GA 3PU5A 1XT8A 4ZZAA 3QAXA 3FASA 3Q27A 3UA8A 3QUFA 3CG1A 2CZLA 1MG1A 4THIA 2GH9A 2QMXA 5KDTA 4EQBA 4NF4A 2OWZA 3TZAA 3N26A 1CB6A 2CEYA 1JW1A 3H03A 1B1XA 3IORA 4DI4B 3UN6A 4IR8A 4MJOA 4IB2A 3MP8A 1D3KA 1Y3QA 2XD3A 3PUYE 4LN5A 5H8FA 5I58B 1SBPA 4POXA 4ZDMA 3FXQA 1POY1 3PGFA 4YICA 1J1NA 3H6UA 4HE2A 4FBPA 3TCFA 3JZJA 3GLBA 5LTCA 3IJOB 4DIGA 4PP0A 4P1LA 5CBSA 3H7MA 4JWXA 4OFLA 2DWJA 4MNCA 4C1TA 2H4IA 2JJKA 3KN8A 2X7PA 4GF8A 4H5FA 2Q2AA 4YAHX 3VVDA 1ATGA 5ESYA 3K0VA 3QMFA 3I6VA 2OWTA 5TP9A 3S9NC 5TU0A 1SYIA 3MVXA 4LP2B 5IKBA 4FAJA 1IMCA 3EPEA 1MH3A 4DLDA 4OYVA 1YZ0A 4HE0A 1MY2A 1AMFA 5IZ1A 3IO6A 3O9PA 1LBZA 2WYKA 3VLWA 1SQYA 2O69A 3PPQA 2VPNA 1B32A 4JVIA 3PPPA 4BDQA 1M5DA 4G4PA 4ELQA 4LVQA 1NUYA 2DE4A 2Y7KA 1OLCA 4FATA 5IAIA 2ZMBA 1KA0A 3FVOA 3U8QA 5A5XA 1QVSA 1L5TA 1M5CA 5FHMA 2HZLA 1FBGA 1B51A 1DOTA 3O66A 3OEKA 2W7YA 3IX1A 1AIVA 5KZTA 1AH5A 5IZ3A 5CM6A 1YAEA 1Y3PA 3DP6A 1TFDA 3H3GA 3KN7A 3CSBA 2PFZA 2V3UA 3L6GA 4ZE9A 1IUDA 1LBWA 1Y1ZA 1MDQA 2OWSA 5TP9B 3S9EA 3M8UA 1MDP1 4IGRA 1G0IA 5EQAA 2HEUA 1LCFA 1BTJA 1NH7A 2KR0A 2CZKA 2QPQA 4QFPA 1LAGE 2X26A 4ISUA 5LDZA 4U1OA 3MJNA 4KXPA 1FBCA 4YMBA 1MXXA 1UTBB 4FJPA 1K9YA 2GRVA 5IZZA 2VHAA 1XVXA 1VR5A 1B40A 3CRBA 4KCDA 1ZIUA 1MQDA 5EQ7A 4N13A 3G3HA 4UACA 1MM7A 2KQZA 1PEBA 3GYYA 4F1VA 1RDZA 3FGSA 2DYXA 4R6HA 2O84X 3TPAA 3FXBA 2F3BA 3FJ7A 3MP6A 4P8BA 4R73A 5LOMA 5B70A 3ZSFA 4AB6A 4AQ4A 2G93A 4LA9A 1LBBA 3RPLA 3MVZA 2AL5A 1NNKA 2ANJA 3C4MA 4LZ7A 4YKKA 4OVPA 4AS4A 1SW4A 4O7IA 1NV0A 2XXTA 3ZS6A 2XXWA 4U2RA 4NF8B 4EQ7A 3PMWA 4NF5A 3K6UA 4OANA 2OCUA 4DCXA 4PFBA 4G68C 1FQBA 2Y5LA 1N7WA 4KPTA 4PGPA 3H06B 2IEEA 3T9XB 3HO7A 4ZECA 3S2VA 1NV5A 4PAIA 4QSEA 4RPOA 4GBVA 2KLFA 4ZEIA 2O1MA 4BLAA 4IO3A 4ZE8A 5DYHA 3R7XA 2I49A 1Q35A 3RPWA 1ZKBA 3FV1A 4YB6A 3KEIA 5H8HA 4RK2A 3Q25A 3C32A 3OO9A 1D9VA 4UABA 3T9VA 3MUQA 2Y7RA 4C0RA 5A5LA 1SW2A 3B50A 1H43A 1XS5A 4XTCQ 2ZXTA 3M3FA 2Z8EA 3RNNA 4PDDA 1NUWA 5K2XA 1MY0A 3MZBA 2ZNSA 3HFUA 3MYUA 3K6XA 3U92A 1N7XA 1NKXA 4G68B 4F3GA 5AA1A 3R26A 3T9UA 3FATA 3PD9A 3IOUA 2WBDA 4DE8A 2B3FA 4KCCA 3TTKA 4HW8A 3MZ9A 3QIMA 3D4CA 1OVBA 1FBDA 3A3CA 4Q8RA 1N76A 2F6PA 2Y7WA 4KD5A 4NN3A 4PFRA 4DDDA 2AL4A 3H4ZA 1NH8A 4EQ9A 2V3TA 4G8MA 1LAHE 4F18A 4O3CA 4ELOA 3FV2A 5FTIA 5CMKA 3B6QA 3OMBA 2VPOA 1PB9A 2A5TA 2F78A 1MXVA 1USYE 1NV1A 4F29A 5I5PA 4Q5TA 1YCJA 2THIA 1INPA 3FZVA 4IO2A 1KA1A 4U4SA 4PF8A 2ALUA 1B4ZA 5KCJA 4FEBA 4XEQA 4G68A 5I59B 4P3LA 5ET6A 1US4A 1JVXA 4F3BA 4K3FA 1FPIA 2P3NA 3SESA 1FJ6A 1IITA 3AXFA 3CSGA 3ISPA 1JW4A 1NNPA 1EH3A 3MBPA 3E3KA 4GD5A 1AOVA 2Q8MA 3U93A 3FD3A 1MPBA 4X8RA 1SD3A 3TDJA 1LGBC 1ELJA 1QKAA 4OESA 3E4RA 1TXFA 2XXUA 4IO5A 3TELA 3U65A 2NOOA 3B7DA 3MAMA 4N91A 4WEPA 3SEYA 2B65A 2CEXA 1VDWA 3T22A 2ZZWA 1SW5A 2I3WA 1BK4A 1URDA 4GWWA 5TPAB 3EHUA 3G3IA 1NFTA 3OXNA 2QMWA 1P1WA 4R2BA 2P1SA 1B7UA 4Z7EA 5H8NB 4O3BA 2DWAA 1PC3A 1DPEA 3KC1A 1YPNA 4P56A 2O1LA 4DXBA 2HAVA 2QVUA 3HCQA 1Z7NE 3KOTA 3TTLA 2F36A 3O6IA 2L5VA 3JYRA 4H65A 2I0BA 3PUVE 3TCGA 4N8GA 4POWA 4GOTA 4U21A 3HSTA 1SPIA 4X9TA 1DK4A 3C33A 4KYEA 4BDNA 5DVIA 3D1RA 1MQIA 2V3QA 4YU0A 3V5AA 4KR5A 1B3HA 5CRYA 5I57A 3UORA 1NUZA 1FPFA 1FBHA 4JSDA 2AYSA 4IGTA 3IJXB 3S4UA 1B2HA 3I5OA 1IXIA 1NV6A 2XWVA 1D4NA 4GWOA 4JB7A 4GIZA 2WEFA 1KWHA 5H8SA 5EYFA 4PFTA 1N04A 2NWJA 2FVZA 2HXWA 2XWIA 1IQ7A 3GBAA 3MW0A 5CMCA 2I0CA 5HM4B 3G3FA 4YZZA 4GL8A 1IIWA 4G61A 2DWIA 3FXUA 2D3IA 4H8JA 4O3AA 3BBRA 4KYSA 1B52A 4LATA 3QK6A 1NI9A 3ILUB 2XXVA 4PQJA 1KZ8A 1B58A 5TPAA 1S50A 1MS7A 4PTKA 4QXDA 1LLSA 1JETA 1WDNA 2E0SA 4XF5A 1BIYA 5AA2D 1Q9DA 1S7YA 3EKIA 4GRKA 3C9HA 4N6PA 1I6QA 3IB2A 4N07A 2B3BA 4LONB 3K01A 1D9QA 4PDHA 4OQOA 4GBWA 5FTHA 4YKIA 1FCKA 3KZGA 3OENA 3D4GA 3OSRA 3USDA 4G77A 1QULA 3PD8A 4I3YA 2Y5KA 2XHDA 5J16A 1FQFA 5DVFA 2D5WA 3RN8A 4NTLA 2I58A 4H0WA 2YLNA 5I84A 3CVGA 3OSQA 1Y4TA 2F97A 4OMBA 1MH4A 1B3LA 2F3DA 3ZKKA 4KHZE 1DCUA 4F3SA 3IB1A 4R6YA 5HPQA 2OBGA 1IMAA 2E1SA 3F11A 3LSWA 3QUJA 3C31A 5H8QA 1LFHA 1MQJA 3QYTA 4ELPA 3IO4A 3BFTA 1EU8A 4ECFA 1GVCA 4U4XA 2UVHA 3DLNA 3U1OA 2QS3A 4ND9A 3TYHA 3OO6A 2PBWA 3K2DA 2R71A 1B6HA 3IK6B 1IZ1A 2XWOA 3SEVA 5I2KB 3RTFB 5H8HB 3KSJA 1H45A 1OIBA 1DSNA 2VGQA 5AA4B 4NQ8A 5H8FB 1B7ZA 3PPRA 2V4CA 2DWHA 1B3EA 4LQ5A 3ILTB 2Z23A 2BJIA 1XVYA 4EF1A 1N3XA 3VDFA 2CMOA 5KDTB 4HTGA 3VLUA 3RQTA 1A54A 4PBQA 2ZYKA 4F3PA 3MZ1A 4F1YA 1RYOA 4PC9A 4OETA 2XXKA 3RTWB 4LUBA 5ICTA 1B5HA 1FBEA 4N4UA 5IZ3B 3PUWE 3FXRA 4OZ9A 1IXCA 3CFXA 2UVJA 4H46A 3Q28A 4LQ2A 5AE4A 1XC1A 4OENA 5ET8A 2O7IA 1B5IA 1FW0A 2HCAA 4ZZEA 1RYXA 2R9JA 4JBZA 1FSAA 3N6UA 2HFBA 1MQHA 5H8QB 2I48A 1USYH 1POTA 4GVOA 2XXHA 3E79A 5I3SA 4O7MA 3VFJA 4QSDA 2ONSA 3A09A 4JVDA 4OEVA 4PAFA 1US5A 4X04A 4JWOA 1H3DA 1TWYA 3UIFA 4DXUA 2ZZXA 5ITOA 2HAUA 2XXQA 1A7LA 2XA5A 4FECA 4NF0A 4X1BA 4ZEKA 2V84A 5B7DA 4XKNA 4GWZA 2ZYNA 4ZEBA 2Q9TA 4MX6A 2B4MA 2O6AA 2M8CA 2XX7A 3DM0A 1MY1A 1O63A 4PE3A 2ZYOA 4HXVA 3N94A 3PPNA 5M2VA 1H44A 4P11A 5CBRA 1IMEA 4MMPA 1B3GA 1IMFA 4HS7A 3PMXA 4EDPA 3LUYA 5F7VA 1FPKA 5CI5A 4QBAA 5ET7A 4H1XA 3QSLA 4LZ8A 3MPKA 4PETA 1G0HA 2VOZA 4H6DA 2Q8JA 4EXLA 4I8CA 2I4CA 3FVNA 2RCBA 1JVYA 3BFUA 1VFDA 3EHSA 3M3LA 1WVJA 4XKQA 3HN0A 2HPGA 1ZJLA 2RCAA 4RPNA 1ZMGA 1QJMA 3RPLB 1ZU0A 3LR1A 1EZPA 4RJZA 1MQGA 3IOTA 1ZLQA 3KOSA 2OK2A 1P1NA 2O68A 2AIXA 3K4UA 3SEUA 3FBPA 2H99A 4U1ZA 3MVYA 2HXRA 4ESWA 1JQFA 3GXAA 4N6KA 2ONKE 4BDOA 4QFNA 5I57B 3CI8A 3V89B 4F22A 2MKZA 1NV2A 4ESXA 2DDKA 1FBPA 2RC8A 2Y7PA 1NL5A 2UVIA 2HHMA 3PUXE 3H6WA 2R8TA 1N0TA 4BDMA 1UTHA 1T0KA 3KJ7A 4R2FA 1ZTYA 2QL3A 1O64A 3CFZA 3MVWA 4OEUA 3W15C 4F31B 1FQEA 4ZEFA 3DP8A 3VE1B 5ITPA 1PBQA 3Q29A 3C35A 2H5YA 4JVCA 1DMBA 2VD3A 4M1VA 4BDRA 3V8XB 2HZKA 3VVEA 4YMAA 1MXUA 4RK9A 1UQWA 3KC0A 2DXRA 4QF9A 5H8NA 4XKRA 5JTYB 4U22A 1MXWA 4C1UA 3U72A 3PMVA 3E9XA 1MPCA 5F1QA 5AA2A 4P9KA 1FPLA 3A3UA 3RY3A 4TOZA 1FQCA 1A40A 5ELVA 4Q30B 1R9QA 3CR9A 1Y3NA 4IO7A 3PTYA 5L8DA 3K1PA 3EF7A 4R75A 5ET5A 4EF2A 4G8HA 3GBBA 4R74A 4KFQA 1M5EA 2PMSA 1IEJA 4IY5A 2OZZA 3SZPA 3C34A 1WODA 3A29A 1FPJA 3UK4A 1MY3A 3HV1A 4RYAA 1FTLA 3BIGA 1EYJA 3TTRA 4I9DA 1Y9UA 4MHFA 1UIUA 1R1NA 1NNFA 5HBCA 2BJJX 2Q89A 4RXLA 3FUZA 3G3JA 4OVQA 4I62A 3RLFE 3RGYA 4YB7A 1UTHB 3S9LC 1I6BA 2I4BA 4EXKA 4JXIA 3KFMA 4FORA 4FE8A 3FIRA 2NXOA 3TKDA 1LEVA 4PE5B 3FJMA 3LSFB 1NV4A 2FNCA 4OERA 3TFLA 2A5TB 4E0XA 4G2ZA 2XX9A 1B7HA 2V25A 4WKMA 2B4LA 3SERA 1JW5A 3U94A 3DP4A 4OTEA 2GHBA 5T3JA 1P99A 4IY6A 4NF6A 1LFIA 2QVVA 4NMYA 4QHQA 5JTYA 5L9OA 1MXZA 4DXCA 2VP1A 2A5SA 2RC9A 2GQ1A 4GXAA 3M3KA 4I40A 4N8YA 3ODBA 1FPBA 1OLAA 5FHNA 4TLLB 3O29A 4TLMB 2DE3A 3OO7A 3O28A 4MLVA 4NG7A 1MPDA 4OHNA 1DTGA 3B6WA 5I2NB 1BKAA 4NE4A 3T93B 1LAFE 4GWUA 1AWBA 3R6UA 5CMMA 3IR1A 3E78A 1NMUA 1XHYA 2CZHA 3TAJA 4GX3A 1EYIA 3SEXA 4PAKA 1PB7A 2UYFA 3FVGA 1SI0A 4GLIA 1MM6A 1FPDA 4PFUA 2XD2A 4JWYA 2QRYA 4LZ5A 5I2KA 4MFIA 1P1UA 2DOJA 4MCOA 4PFYA 1M5BA 4MNPA 5L9SA 4M4GA 4OVTA 4NF6B 4P1EA 1JNFA 3O6HA 4FEDA 4QFOA 1QUIA 3LSXA 1ZBMA 4WXJA 4RA1A 1HSJA 3JV9A 1FTMA 2HQ0A 3O2AA 4Q0CA 3V83A 3KBRA 4QFLA 4Z0IA 3PUZE 5AA3A 1Y1MA 2DQVA 3RYDA 1B5JA 3FVKA 2Q74A 3QXMA 3HPIA 4MF3A 5DTBA 1N84A 1SW1A 4N81A 2Z8FA 3EHTA 3TMGA 5DEXB 4WEDA 2PX1A 5BUUA 1IXGA 3OOAA 5AA2B 2XXIA 1II5A 2UVGA 3SEWA 3RUMA 1CE2A 3KGCA 5I56B 2QVRA 5AA4A 4UA8A 3G3KA 1LBVA 4NHBA 1FTKA 5IGAA 3G7WA 3VLVA 2H25A 3L6HA 3K1MA 4GL0A 4NGUA 3ZKLA 1D9YA 1R6ZA 1SI1A 1VE4A 3OEMA 3TQLA 1PBPA 2REJA 1H76A 3VV5A 3T1BA 3S9MC 1YXIA 1FTJA 3TODA 1I6AA 1QUJA 4GX4A 3TUSA 5A5XB 1OVTA 2I3VA 3P7IA 2NVUB 2IA4A 1M5FA 4F19A 1XI6A 3E13X 4KI0E 2VT5A 3G3GA 2ONRA 2XXRA 4N17A 2DE2A 1DBZA 1YTVA 2Z8DA 1SYHA 2FHYA 3RT6B 4QRZA 4L17A 4PBHA 1Y4CA 3N5LA 3MQ9A 4AS5A 5EQ9A 3BKIB 4R6KA 3CIJA 2WBBA 4O94A 2DS9A 1OQGA 2PT2A 1DPPA 2ZNTA 1HSEA 5J1DA 4GWYA 1EYKA 3IOWA 4X48A 2XWKA 4QFKA 2LAOA 3OO8A 1RDXA 1LB9A 2XXXA 1LAXA 4OFOA 4H67A 1OMPA 2OX3A 5I58A 4NX1A 4I3EA 3WAEA 2Q88A 3MPLA 4NF5B 1VFEA 2GHAA 4PF6A 2UXAA 1OQHA 2YPNA 4OFJA 4IO4A 2QS2A 4OVJA 1NV7A 1FQAA 3MSTA 3VVFA 4F39A 3LUZA 4P0IA 1YYZA 4MH5A 5K2YA 1B9JA 2DVZA 5IM2A 4MIJA 1LBCA 4NF8A 5EYHA 1MXYA 2F6GA 1FPEA 3W9VA 2F7CA 3TTMA 2O51A 4E0WA 2OLBA 2F5XA 4YB5A 1P1QA 4KYDA 4NWDA 1GV8A 4F1UA 4I1DA 4JSOA 4XIGQ 1R9LA 1UTBA 2ZZVA 1FQDA 5L9MA 3VXBA 2RF1A 4MNIA 5EYGA 3MWBA 1UIVA 1JEUA 5DT6A 1LBXA 2FIEA 2G29A 2PYYA 3K6WA 1Z7ME 5DVJA 2PVUA 5EHMA 2ABHA 4MAGA 3KJTA 3EN3A 5F24A 2QSXA 3Q26A 5JK4A 3LC8A 4GWXA 1QGXA 3IAZA 4AB5A 2XX8A 4GWSA 4GQOA 2RINA 2V93A 3KN3A 2Y84A 1B05A 3CHGA 2FBPA 2P3VA 4PCDA 1NNTA 5EQ8A 3BIHA 4OXVA 3B6TA 2F7BA 3FJGA 1RKMA 4MEVA 1BLFA 4OVSA 4GX6A 3IFAA 3SDFA 2H98A 4F2QA 4BDLA 3T9HB 4H8IA 5I7IA 1SVXB 4XKPA 4MLQA 4R9FA 4PFWA 4GFRA 3KSXA 3DELB 1HSLA 1JEVA 2XXYA 3CFLA 4NWCA 2X7QA 2PFYA 1CNQA 2F35A 3HHFA 2I6EA 4O8MA 4YKJA 2F34A 1B46A 4XXUA 4XFEA 2VD2A 2H9BA 4DZ1A 3ONMA 3WAFA 4MBPA 1SDXA 4ONYA 2OJTA 5DW8A 5I59A 3SETA 3IFCA 1JP4A 1LFGA 3MP1A 1NV3A 3IOVA 1LSTA 1B4HA 2P2AA 1FPGA 3OD7A 2DSFA 1MRPA 2CZIA 2ZNUA 1EZOA 1NUXA 3ROJA 5JEIA 1IMDA 4G8NA 2YJPA 4GXSB 1LBYA 4ZEDA 1PB8A 2DP8A 1FTOA 1B3FA 4RNSA 1LB8A 2RC7A 5ISUA 3THIA 4QSCA 1P1OA 2GFEA 1GTKA 2Q2CA 2WYPA 1BP5A 1B1HA 3I3VA 2UYEA 1FJ9A 1O7TA 1A8EA 3K6VA 3C36A 2QS1A 2FA7A 5I56A 3VXCA 1MY4A 3H6VA 1IMBA 2QFLA 3TQWA 1B0HA 2R6GE 1VSOA 3T0JA 3K00A 4TQUQ 1A55A 3TEPA 1AL3A 1F9BA 1N3WA 2PCRA 1GR2A 3W9WA 3PV0E 2D21A 1XOCA 1ANFA 4U23A 3IL1B 3HHGA 4PGNA 3LSLA 4JDFA 1URSA 2RKMA 3CG3A 3MC2A 1Q1KA 4ZS9A 1IXHA 2WKYA 3O6GA 3K02A 5CMBA 4FIMA 3SKPA 4NAPA 4P47A
chains in the Genus database with same CATH topology
3TMGA 4OENA 1SW2A 5DEXB 5BWJA 4WEDA 2O7IA 1H43A 1XS5A 4NEDA 4XTCQ 2PX1A 1B5IA 1FW0A 2ZXTA 3H6TA 1IXGA 2HCAA 3OOAA 1RYXA 2R9JA 3M3FA 4ZZEA 3T96B 3PPOA 5AA2B 4JBZA 3N6UA 2Z8EA 3RNNA 2XXIA 2HFBA 1II5A 1MQHA 3LBSA 5H8QB 2UVGA 5K2XA 3T66A 2I48A 1MY0A 3TCHA 1USYH 3MZBA 1POTA 2ZNSA 1URGA 2O7UA 3K6XA 1QKBA 3U92A 4GVOA 2XXHA 2ESNA 3SEWA 3VFJA 4QSDA 4HCWA 2ONSA 3A09A 1CE2A 1N7XA 3RUMA 1NKXA 3KG2A 3KGCA 4OEVA 5I56B 2NUVA 2REGA 4G68B 4F3GA 1A8FA 5AA1A 1US5A 2PT1A 3R26A 2DVCA 3RT8A 3T9UA 4JWOA 4R9GA 3FATA 3PD9A 3EQ1A 2F7AA 3IOUA 5AA4A 1H3DA 4UA8A 4DE8A 2B3FA 3G3KA 1S9TA 4KCCA 3OELA 4R72A 1TFAA 1TWYA 3MZ9A 3D4CA 3QIMA 5EHSA 1OVBA 3A3CA 2FYIA 5ITOA 4DXUA 4EQ9A 4Q8RA 2HAUA 2XXQA 1N76A 2F6PA 2Y7WA 5A5XA 1A7LA 1FTKA 4KD5A 4DDDA 2AL4A 3H4ZA 1NH8A 3IB0A 4FECA 4HCYA 4KQPA 2V3TA 4X1BA 4G8MA 4ZEKA 2V84A 3UGWA 5B7DA 3G7WA 1LAHE 4XKNA 2ZYNA 2H25A 3VLVA 4F18A 4O3CA 2Q9TA 2XXPA 3O97A 4P0GA 3L6HA 3FV2A 5FTIA 3K1MA 4ZEBA 4GL0A 5CMKA 3B6QA 3OMBA 5DEXA 3ZKLA 1D9YA 1R6ZA 2M8CA 2O6AA 2XX7A 1PB9A 4IO6A 1SI1A 3TTNA 3DM0A 1MY1A 1O63A 1EZ9A 2ZYOA 3TODA 5CC2A 3N94A 3PPNA 2A5TA 5M2VA 1H44A 2F78A 4P11A 1VE4A 4OWDA 1LCTA 3GZGA 4X1DA 5CBRA 1MXVA 1USYE 1B3GA 3OEMA 3TQLA 1PBPA 2REJA 4ELOA 1H76A 3VV5A 1QW0A 4HS7A 2ZYMA 4F29A 3PMXA 2QJEA 5KCJB 3S9MC 4EDPA 1FTJA 2Z22A 4Q5TA 1YCJA 3LUYA 1A99A 1I6AA 5F7VA 1QUJA 2THIA 5CI5A 5ICQA 3TUSA 3FZVA 1I69A 4IO2A 5A5XB 4U4SA 1OVTA 2QS4A 4H1XA 2I3VA 3P7IA 2ALUA 1B4ZA 2NVUB 3QSLA 4LZ8A 5KCJA 2IA4A 4FEBA 3MPKA 4G68A 4EUOA 5JK4A 1M5FA 4PETA 4F19A 5I59B 3E13X 5I2NA 4RY1A 2VOZA 4H6DA 1US4A 4KI0E 2Q8JA 4EXLA 1JVXA 4F3BA 4I8CA 2I4CA 3FVNA 2RCBA 3G3GA 1JVYA 2ONRA 2XXRA 4K3FA 3BFUA 2DE2A 1VFDA 3EHSA 1PDAA 1Y20A 2DXYA 3M3LA 5I57B 1YTVA 1WVJA 4XKQA 1DTZA 2Y7IA 2Z8DA 1SYHA 1B0LA 4QRZA 4L17A 3K1NA 3HN0A 3RT6B 1ZJLA 3SESA 2RCAA 4RPNA 1IITA 1QUKA 1ZMGA 1QJMA 2P0SA 1TT1A 1Y4CA 3AXFA 3CSGA 3N5LA 3MQ9A 4NF4B 4YKPA 1JW4A 1ZU0A 3LR1A 1NNPA 1EH3A 1GGGA 1EZPA 4RJZA 1MQGA 3BKIB 4R6KA 2F8DA 3IOTA 3CIJA 3E3KA 3MBPA 3N6TA 1ZLQA 4GD5A 2DS9A 1OQGA 2OK2A 3KOSA 1AOVA 2PT2A 4DCYA 1P1NA 2O68A 1DPPA 4ELRA 4F2OA 3U93A 2AIXA 1MPBA 3ECRA 3FD3A 3K4UA 3PU5A 4H5GA 3SEUA 1SD3A 2ZNTA 1XT8A 1HSEA 3TDJA 2H99A 4U1ZA 5J1DA 1LGBC 1ELJA 1QKAA 3MVYA 3IOWA 3FASA 3QAXA 4OESA 4X48A 4ZZAA 4ESWA 3Q27A 3UA8A 3QUFA 1JQFA 3E4RA 1TXFA 2ONKE 2XXUA 3CG1A 3GXAA 2CZLA 2LAOA 3CI8A 4IO5A 4QFKA 2NOOA 4QFNA 3TELA 1MG1A 3B7DA 4THIA 2GH9A 2QMXA 3V89B 3MAMA 4WEPA 3SEYA 4EQBA 5KDTA 2B65A 5FHOA 4F22A 4NF4A 3OO8A 3TZAA 3T22A 1SW5A 1CB6A 1LB9A 1JW1A 3H03A 2XXXA 3N26A 4ESXA 1LAXA 4OFOA 1B1XA 3IORA 2I3WA 1URDA 4H67A 5TPAB 2RC8A 2Y7PA 3EHUA 3UN6A 3G3IA 4IB2A 1NL5A 1NFTA 1OMPA 2UVIA 5FHNA 3OXNA 2QMWA 1P1WA 4R2BA 2P1SA 3MP8A 3PUXE 1B7UA 5I58A 3H6WA 4Z7EA 1D3KA 3WAEA 5H8NB 2Q88A 1Y3QA 1N0TA 2XD3A 1UTHA 3MPLA 3PUYE 2DWAA 4O3BA 4BDMA 1T0KA 1PC3A 1DPEA 3KJ7A 1VFEA 1YPNA 1ZTYA 1O64A 2GHAA 2HAVA 2O1LA 2QL3A 3CFZA 4DXBA 2UXAA 1OQHA 3HCQA 5I58B 1Z7NE 3MVWA 4OEUA 3W15C 4F31B 2YPNA 4OFJA 4IO4A 2QS2A 1FQEA 1SBPA 4POXA 4ZDMA 3FXQA 1POY1 4OVJA 3PGFA 4ZEFA 4YICA 3DP8A 1J1NA 3KOTA 3TTLA 3VE1B 5ITPA 4ZS9A 3H6UA 2F36A 1PBQA 3Q29A 4HW8A 3O6IA 3C35A 1FQAA 2H5YA 1DMBA 2VD3A 3JYRA 3TCFA 3VVFA 4H65A 2I0BA 4F39A 3PUVE 3JZJA 3TCGA 4POWA 3GLBA 4GOTA 4M1VA 3IJOB 4BDRA 4DIGA 4PP0A 4P0IA 3V8XB 2HZKA 4U21A 3VVEA 3HSTA 3H7MA 5CBSA 4YMAA 4JWXA 4X9TA 1MXUA 4MH5A 4OFLA 1UQWA 4RK9A 5K2YA 3C33A 4KYEA 4BDNA 1B9JA 5DVIA 2DVZA 2DXRA 1LBCA 4NF8A 4QF9A 2DWJA 1MQIA 1MXYA 2V3QA 4YU0A 2F6GA 3V5AA 5H8NA 4C1TA 2H4IA 3KN8A 4XKRA 2X7PA 4GF8A 5JTYB 4KR5A 4NWCA 1B3HA 5CRYA 5I57A 4U22A 3W9VA 1MXWA 3UORA 2F7CA 2Q2AA 4H5FA 4YAHX 3TTMA 1ATGA 3VVDA 3U72A 4C1UA 3PMVA 3K0VA 3E9XA 4JSDA 1MPCA 2AYSA 2O51A 5F1QA 3I6VA 4E0WA 5AA2A 2OLBA 2F5XA 2OWTA 3A3UA 4IGTA 5TP9A 5TU0A 3S9NC 1SYIA 3MVXA 1P1QA 4LP2B 4YB5A 5IKBA 4KYDA 4NWDA 3IJXB 1GV8A 3RY3A 4FAJA 4TOZA 3S4UA 4F1UA 3EPEA 1MH3A 4DLDA 1FQCA 1B2HA 3I5OA 4OYVA 1IXIA 4I1DA 4JSOA 1A40A 5ELVA 1MY2A 1AMFA 4XIGQ 3IO6A 4Q30B 1R9QA 3CR9A 1Y3NA 1R9LA 3O9PA 4IO7A 1D4NA 5L8DA 1UTBA 3K1PA 3EF7A 4R75A 3VLWA 1FQDA 1SQYA 5L9MA 2O69A 3PPQA 3VXBA 4G8HA 4EF2A 1B32A 3GBBA 4R74A 2RF1A 3PPPA 4GWOA 4JB7A 4KFQA 1M5EA 3MWBA 4GIZA 2PMSA 1UIVA 4BDQA 1M5DA 1KWHA 1IEJA 4G4PA 1JEUA 2OZZA 4IY5A 5H8SA 4ELQA 5EYFA 5DT6A 4LVQA 3C34A 1WODA 4PFTA 1N04A 2G29A 2PYYA 3K6WA 3UIFA 2DE4A 2Y7KA 1OLCA 1Z7ME 2HXWA 5DVJA 2PVUA 1IQ7A 5EHMA 1MY3A 2ABHA 2NWJA 3HV1A 3GBAA 1FTLA 3MW0A 4RYAA 5CMCA 3TTRA 2I0CA 5HM4B 3KJTA 4I9DA 5IAIA 1Y9UA 3G3FA 2ZMBA 4YZZA 1UIUA 1R1NA 1NNFA 4NF5B 5HBCA 3FVOA 3EN3A 2BJJX 1IIWA 1QVSA 2Q89A 2DWIA 2QSXA 3Q26A 4GL8A 4RXLA 3FUZA 1M5CA 3LC8A 5FHMA 1L5TA 3FXUA 2HZLA 3G3JA 2D3IA 3IAZA 1B51A 4H8JA 4I62A 4AB5A 4O3AA 3RLFE 3BBRA 1DOTA 4KYSA 1B52A 3O66A 3RGYA 4YB7A 4LATA 3QK6A 3OEKA 1UTHB 2W7YA 1I6BA 3ILUB 3IX1A 1AIVA 2I4BA 2XXVA 5KZTA 3S9LC 4PQJA 2XX8A 1AH5A 4EXKA 4FATA 4JXIA 3KFMA 4GQOA 5CM6A 1YAEA 2RINA 1B58A 1Y3PA 2V93A 3KN3A 3DP6A 1TFDA 3H3GA 5AA4B 4FORA 4FE8A 1S50A 1MS7A 2Y84A 5TPAA 1LLSA 3KN7A 3CSBA 3FIRA 1B05A 1JETA 2NXOA 1WDNA 2E0SA 3TKDA 1BIYA 2V3UA 3L6GA 3TTKA 5AA2D 4PE5B 3FJMA 1S7YA 4ZE9A 1IUDA 3LSFB 1Y1ZA 4GRKA 3C9HA 2FNCA 4N6PA 1MDQA 2OWSA 1I6QA 1NNTA 4OERA 3IB2A 5TP9B 3TFLA 3S9EA 4N07A 2A5TB 2B3BA 4OXVA 3M8UA 4E0XA 3B6TA 4G2ZA 2XX9A 1B7HA 4LONB 2V25A 1MDP1 4IGRA 4WKMA 2F7BA 3FJGA 3K01A 2HEUA 1LCFA 1BTJA 4OQOA 3SERA 1JW5A 1NH7A 5FTHA 4YKIA 3U94A 3DP4A 1RKMA 1FCKA 3KZGA 4OTEA 3UP9A 2GHBA 3OENA 2QPQA 3D4GA 1BLFA 3OSRA 3SDFA 3USDA 1P99A 4IY6A 4QFPA 4NF6A 2H98A 4G77A 4F2QA 1LAGE 1QULA 2X26A 4BDLA 4ISUA 3T9HB 1LFIA 4H8IA 1SVXB 4NMYA 4U1OA 4MLQA 4QHQA 3PD8A 4R9FA 3MJNA 2XHDA 4PFWA 1MXZA 5JTYA 5L9OA 4GFRA 4DXCA 2VP1A 3KSXA 4YMBA 1MXXA 2A5SA 1FQFA 2RC9A 3DELB 1UTBB 4BDOA 4FJPA 1HSLA 5DVFA 2GRVA 2D5WA 2VHAA 1XVXA 3RN8A 4GXAA 1JEVA 1VR5A 2XXYA 3CFLA 1B40A 2X7QA 3CRBA 3M3KA 3ODBA 2F35A 4NTLA 3HHFA 2I6EA 4KCDA 1OLAA 4YKJA 1ZIUA 2I58A 4TLLB 2F34A 3O29A 2DE3A 1MQDA 3OO7A 4H0WA 2YLNA 1B46A 3O28A 4TLMB 4N13A 4XXUA 2VD2A 3CVGA 2H9BA 3G3HA 3OSQA 1Y4TA 4DZ1A 5I84A 3ONMA 3WAFA 4MLVA 4UACA 2F97A 1MPDA 4OHNA 1DTGA 4MBPA 4OMBA 1SDXA 1MM7A 1MH4A 3B6WA 2OJTA 4ONYA 1B3LA 5I2NB 3ZKKA 5I59A 4KHZE 3SETA 4F3SA 3IB1A 1BKAA 4NE4A 3T93B 1PEBA 1LAFE 4R6YA 5HPQA 2OBGA 4F1VA 1LFGA 2E1SA 3MP1A 5BUUA 3FGSA 2DYXA 3F11A 1LSTA 3IOVA 3LSWA 3QUJA 4R6HA 3C31A 1B4HA 2O84X 5H8QA 3TPAA 1LFHA 2P2AA 4R2FA 1MQJA 3QYTA 3UK4A 4ELPA 3IO4A 3OD7A 2DSFA 1MRPA 3BFTA 3R6UA 1EU8A 2ZNUA 5CMMA 4ECFA 1EZOA 3IR1A 5JEIA 3FJ7A 1NMUA 1XHYA 3MP6A 4G8NA 4R73A 2YJPA 4GXSB 1GVCA 4U4XA 5B70A 3TAJA 2UVHA 5LOMA 3DLNA 3U1OA 4ZEDA 2QS3A 1PB8A 4ND9A 3TYHA 3ZSFA 2DP8A 2PBWA 3OO6A 3SEXA 4AB6A 3K2DA 2R71A 4AQ4A 3U8QA 1FTOA 1B3FA 4RNSA 2G93A 4LA9A 1LB8A 1LBBA 2RC7A 5H8FA 5ISUA 3MVZA 1B6HA 3THIA 1PB7A 2AL5A 3IK6B 1NNKA 4QSCA 2ANJA 1P1OA 2GFEA 1IZ1A 2UYFA 3C4MA 3FVGA 4LZ7A 1GTKA 1SI0A 4YKKA 3SEVA 5I2KB 1SW4A 2Q2CA 3RTFB 1BP5A 1B1HA 3KSJA 3I3VA 2XXTA 4GLIA 5H8HB 1MM6A 1H45A 2UYEA 3ZS6A 2XXWA 1O7TA 1OIBA 4PFUA 1A8EA 1DSNA 2VGQA 3K6VA 3C36A 2QS1A 3PMWA 4NF8B 4U2RA 4EQ7A 2XD2A 2FA7A 4JWYA 4NF5A 1B7ZA 2QRYA 3PPRA 4LZ5A 5H8FB 5I2KA 3K6UA 2OCUA 4MFIA 4DCXA 1P1UA 2DOJA 5I56A 4PFYA 2DWHA 1B3EA 1M5BA 4G68C 4LQ5A 1FQBA 5L9SA 4M4GA 1N7WA 2Z23A 1MY4A 3ILTB 4KPTA 4NF6B 3VXCA 1XVYA 1JNFA 3H6VA 3O6HA 4FEDA 4QFOA 4EF1A 1N3XA 3TQWA 1B0HA 3H06B 3VDFA 2R6GE 1VSOA 2IEEA 1QUIA 3K00A 4TQUQ 1A55A 3T9XB 3HO7A 1AL3A 3LSXA 3TEPA 2CMOA 4ZECA 1ZBMA 3S2VA 5KDTB 4WXJA 4RA1A 1F9BA 1N3WA 4HTGA 3VLUA 3RQTA 4QSEA 1HSJA 1GR2A 1A54A 3PV0E 2D21A 1XOCA 3W9WA 1ANFA 3JV9A 4RPOA 2ZYKA 1FTMA 2KLFA 3MZ1A 4U23A 4ZEIA 4XKPA 4F3PA 4F1YA 2O1MA 1RYOA 2HQ0A 3O2AA 3IL1B 3HHGA 4IO3A 4Q0CA 4BLAA 3V83A 4OETA 4ZE8A 5DYHA 3LSLA 3R7XA 2I49A 3KBRA 1Q35A 1URSA 4JDFA 4QFLA 4Z0IA 3RPWA 1ZKBA 3PUZE 2RKMA 4LUBA 3RTWB 5AA3A 1Y1MA 3FV1A 4YB6A 5ICTA 3KEIA 3CG3A 3MC2A 1B5HA 1Q1KA 5H8HA 2DQVA 3PUWE 1IXHA 2WKYA 3FXRA 4RK2A 3Q25A 1B5JA 3C32A 3FVKA 3O6GA 3QXMA 3K02A 3OO9A 5CMBA 4FIMA 4OZ9A 1D9VA 3SKPA 3HPIA 1IXCA 3CFXA 4MF3A 2UVJA 5DTBA 3T9VA 1N84A 1SW1A 2Z8FA 3MUQA 2Y7RA 3Q28A 4LQ2A 5AE4A 1XC1A 4C0RA 3EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMG A;  4OEN A;  1SW2 A;  5DEX B;  5BWJ A;  4WED A;  2O7I A;  1H43 A;  1XS5 A;  4NED A;  4XTC Q;  2PX1 A;  1B5I A;  1FW0 A;  2ZXT A;  3H6T A;  1IXG A;  2HCA A;  3OOA A;  1RYX A;  2R9J A;  3M3F A;  4ZZE A;  3T96 B;  3PPO A;  5AA2 B;  4JBZ A;  3N6U A;  2Z8E A;  3RNN A;  2XXI A;  2HFB A;  1II5 A;  1MQH A;  3LBS A;  5H8Q B;  2UVG A;  5K2X A;  3T66 A;  2I48 A;  1MY0 A;  3TCH A;  1USY H;  3MZB A;  1POT A;  2ZNS A;  1URG A;  2O7U A;  3K6X A;  1QKB A;  3U92 A;  4GVO A;  2XXH A;  2ESN A;  3SEW A;  3VFJ A;  4QSD A;  4HCW A;  2ONS A;  3A09 A;  1CE2 A;  1N7X A;  3RUM A;  1NKX A;  3KG2 A;  3KGC A;  4OEV A;  5I56 B;  2NUV A;  2REG A;  4G68 B;  4F3G A;  1A8F A;  5AA1 A;  1US5 A;  2PT1 A;  3R26 A;  2DVC A;  3RT8 A;  3T9U A;  4JWO A;  4R9G A;  3FAT A;  3PD9 A;  3EQ1 A;  2F7A A;  3IOU A;  5AA4 A;  1H3D A;  4UA8 A;  4DE8 A;  2B3F A;  3G3K A;  1S9T A;  4KCC A;  3OEL A;  4R72 A;  1TFA A;  1TWY A;  3MZ9 A;  3D4C A;  3QIM A;  5EHS A;  1OVB A;  3A3C A;  2FYI A;  5ITO A;  4DXU A;  4EQ9 A;  4Q8R A;  2HAU A;  2XXQ A;  1N76 A;  2F6P A;  2Y7W A;  5A5X A;  1A7L A;  1FTK A;  4KD5 A;  4DDD A;  2AL4 A;  3H4Z A;  1NH8 A;  3IB0 A;  4FEC A;  4HCY A;  4KQP A;  2V3T A;  4X1B A;  4G8M A;  4ZEK A;  2V84 A;  3UGW A;  5B7D A;  3G7W A;  1LAH E;  4XKN A;  2ZYN A;  2H25 A;  3VLV A;  4F18 A;  4O3C A;  2Q9T A;  2XXP A;  3O97 A;  4P0G A;  3L6H A;  3FV2 A;  5FTI A;  3K1M A;  4ZEB A;  4GL0 A;  5CMK A;  3B6Q A;  3OMB A;  5DEX A;  3ZKL A;  1D9Y A;  1R6Z A;  2M8C A;  2O6A A;  2XX7 A;  1PB9 A;  4IO6 A;  1SI1 A;  3TTN A;  3DM0 A;  1MY1 A;  1O63 A;  1EZ9 A;  2ZYO A;  3TOD A;  5CC2 A;  3N94 A;  3PPN A;  2A5T A;  5M2V A;  1H44 A;  2F78 A;  4P11 A;  1VE4 A;  4OWD A;  1LCT A;  3GZG A;  4X1D A;  5CBR A;  1MXV A;  1USY E;  1B3G A;  3OEM A;  3TQL A;  1PBP A;  2REJ A;  4ELO A;  1H76 A;  3VV5 A;  1QW0 A;  4HS7 A;  2ZYM A;  4F29 A;  3PMX A;  2QJE A;  5KCJ B;  3S9M C;  4EDP A;  1FTJ A;  2Z22 A;  4Q5T A;  1YCJ A;  3LUY A;  1A99 A;  1I6A A;  5F7V A;  1QUJ A;  2THI A;  5CI5 A;  5ICQ A;  3TUS A;  3FZV A;  1I69 A;  4IO2 A;  5A5X B;  4U4S A;  1OVT A;  2QS4 A;  4H1X A;  2I3V A;  3P7I A;  2ALU A;  1B4Z A;  2NVU B;  3QSL A;  4LZ8 A;  5KCJ A;  2IA4 A;  4FEB A;  3MPK A;  4G68 A;  4EUO A;  5JK4 A;  1M5F A;  4PET A;  4F19 A;  5I59 B;  3E13 X;  5I2N A;  4RY1 A;  2VOZ A;  4H6D A;  1US4 A;  4KI0 E;  2Q8J A;  4EXL A;  1JVX A;  4F3B A;  4I8C A;  2I4C A;  3FVN A;  2RCB A;  3G3G A;  1JVY A;  2ONR A;  2XXR A;  4K3F A;  3BFU A;  2DE2 A;  1VFD A;  3EHS A;  1PDA A;  1Y20 A;  2DXY A;  3M3L A;  5I57 B;  1YTV A;  1WVJ A;  4XKQ A;  1DTZ A;  2Y7I A;  2Z8D A;  1SYH A;  1B0L A;  4QRZ A;  4L17 A;  3K1N A;  3HN0 A;  3RT6 B;  1ZJL A;  3SES A;  2RCA A;  4RPN A;  1IIT A;  1QUK A;  1ZMG A;  1QJM A;  2P0S A;  1TT1 A;  1Y4C A;  3AXF A;  3CSG A;  3N5L A;  3MQ9 A;  4NF4 B;  4YKP A;  1JW4 A;  1ZU0 A;  3LR1 A;  1NNP A;  1EH3 A;  1GGG A;  1EZP A;  4RJZ A;  1MQG A;  3BKI B;  4R6K A;  2F8D A;  3IOT A;  3CIJ A;  3E3K A;  3MBP A;  3N6T A;  1ZLQ A;  4GD5 A;  2DS9 A;  1OQG A;  2OK2 A;  3KOS A;  1AOV A;  2PT2 A;  4DCY A;  1P1N A;  2O68 A;  1DPP A;  4ELR A;  4F2O A;  3U93 A;  2AIX A;  1MPB A;  3ECR A;  3FD3 A;  3K4U A;  3PU5 A;  4H5G A;  3SEU A;  1SD3 A;  2ZNT A;  1XT8 A;  1HSE A;  3TDJ A;  2H99 A;  4U1Z A;  5J1D A;  1LGB C;  1ELJ A;  1QKA A;  3MVY A;  3IOW A;  3FAS A;  3QAX A;  4OES A;  4X48 A;  4ZZA A;  4ESW A;  3Q27 A;  3UA8 A;  3QUF A;  1JQF A;  3E4R A;  1TXF A;  2ONK E;  2XXU A;  3CG1 A;  3GXA A;  2CZL A;  2LAO A;  3CI8 A;  4IO5 A;  4QFK A;  2NOO A;  4QFN A;  3TEL A;  1MG1 A;  3B7D A;  4THI A;  2GH9 A;  2QMX A;  3V89 B;  3MAM A;  4WEP A;  3SEY A;  4EQB A;  5KDT A;  2B65 A;  5FHO A;  4F22 A;  4NF4 A;  3OO8 A;  3TZA A;  3T22 A;  1SW5 A;  1CB6 A;  1LB9 A;  1JW1 A;  3H03 A;  2XXX A;  3N26 A;  4ESX A;  1LAX A;  4OFO A;  1B1X A;  3IOR A;  2I3W A;  1URD A;  4H67 A;  5TPA B;  2RC8 A;  2Y7P A;  3EHU A;  3UN6 A;  3G3I A;  4IB2 A;  1NL5 A;  1NFT A;  1OMP A;  2UVI A;  5FHN A;  3OXN A;  2QMW A;  1P1W A;  4R2B A;  2P1S A;  3MP8 A;  3PUX E;  1B7U A;  5I58 A;  3H6W A;  4Z7E A;  1D3K A;  3WAE A;  5H8N B;  2Q88 A;  1Y3Q A;  1N0T A;  2XD3 A;  1UTH A;  3MPL A;  3PUY E;  2DWA A;  4O3B A;  4BDM A;  1T0K A;  1PC3 A;  1DPE A;  3KJ7 A;  1VFE A;  1YPN A;  1ZTY A;  1O64 A;  2GHA A;  2HAV A;  2O1L A;  2QL3 A;  3CFZ A;  4DXB A;  2UXA A;  1OQH A;  3HCQ A;  5I58 B;  1Z7N E;  3MVW A;  4OEU A;  3W15 C;  4F31 B;  2YPN A;  4OFJ A;  4IO4 A;  2QS2 A;  1FQE A;  1SBP A;  4POX A;  4ZDM A;  3FXQ A;  1POY 1;  4OVJ A;  3PGF A;  4ZEF A;  4YIC A;  3DP8 A;  1J1N A;  3KOT A;  3TTL A;  3VE1 B;  5ITP A;  4ZS9 A;  3H6U A;  2F36 A;  1PBQ A;  3Q29 A;  4HW8 A;  3O6I A;  3C35 A;  1FQA A;  2H5Y A;  1DMB A;  2VD3 A;  3JYR A;  3TCF A;  3VVF A;  4H65 A;  2I0B A;  4F39 A;  3PUV E;  3JZJ A;  3TCG A;  4POW A;  3GLB A;  4GOT A;  4M1V A;  3IJO B;  4BDR A;  4DIG A;  4PP0 A;  4P0I A;  3V8X B;  2HZK A;  4U21 A;  3VVE A;  3HST A;  3H7M A;  5CBS A;  4YMA A;  4JWX A;  4X9T A;  1MXU A;  4MH5 A;  4OFL A;  1UQW A;  4RK9 A;  5K2Y A;  3C33 A;  4KYE A;  4BDN A;  1B9J A;  5DVI A;  2DVZ A;  2DXR A;  1LBC A;  4NF8 A;  4QF9 A;  2DWJ A;  1MQI A;  1MXY A;  2V3Q A;  4YU0 A;  2F6G A;  3V5A A;  5H8N A;  4C1T A;  2H4I A;  3KN8 A;  4XKR A;  2X7P A;  4GF8 A;  5JTY B;  4KR5 A;  4NWC A;  1B3H A;  5CRY A;  5I57 A;  4U22 A;  3W9V A;  1MXW A;  3UOR A;  2F7C A;  2Q2A A;  4H5F A;  4YAH X;  3TTM A;  1ATG A;  3VVD A;  3U72 A;  4C1U A;  3PMV A;  3K0V A;  3E9X A;  4JSD A;  1MPC A;  2AYS A;  2O51 A;  5F1Q A;  3I6V A;  4E0W A;  5AA2 A;  2OLB A;  2F5X A;  2OWT A;  3A3U A;  4IGT A;  5TP9 A;  5TU0 A;  3S9N C;  1SYI A;  3MVX A;  1P1Q A;  4LP2 B;  4YB5 A;  5IKB A;  4KYD A;  4NWD A;  3IJX B;  1GV8 A;  3RY3 A;  4FAJ A;  4TOZ A;  3S4U A;  4F1U A;  3EPE A;  1MH3 A;  4DLD A;  1FQC A;  1B2H A;  3I5O A;  4OYV A;  1IXI A;  4I1D A;  4JSO A;  1A40 A;  5ELV A;  1MY2 A;  1AMF A;  4XIG Q;  3IO6 A;  4Q30 B;  1R9Q A;  3CR9 A;  1Y3N A;  1R9L A;  3O9P A;  4IO7 A;  1D4N A;  5L8D A;  1UTB A;  3K1P A;  3EF7 A;  4R75 A;  3VLW A;  1FQD A;  1SQY A;  5L9M A;  2O69 A;  3PPQ A;  3VXB A;  4G8H A;  4EF2 A;  1B32 A;  3GBB A;  4R74 A;  2RF1 A;  3PPP A;  4GWO A;  4JB7 A;  4KFQ A;  1M5E A;  3MWB A;  4GIZ A;  2PMS A;  1UIV A;  4BDQ A;  1M5D A;  1KWH A;  1IEJ A;  4G4P A;  1JEU A;  2OZZ A;  4IY5 A;  5H8S A;  4ELQ A;  5EYF A;  5DT6 A;  4LVQ A;  3C34 A;  1WOD A;  4PFT A;  1N04 A;  2G29 A;  2PYY A;  3K6W A;  3UIF A;  2DE4 A;  2Y7K A;  1OLC A;  1Z7M E;  2HXW A;  5DVJ A;  2PVU A;  1IQ7 A;  5EHM A;  1MY3 A;  2ABH A;  2NWJ A;  3HV1 A;  3GBA A;  1FTL A;  3MW0 A;  4RYA A;  5CMC A;  3TTR A;  2I0C A;  5HM4 B;  3KJT A;  4I9D A;  5IAI A;  1Y9U A;  3G3F A;  2ZMB A;  4YZZ A;  1UIU A;  1R1N A;  1NNF A;  4NF5 B;  5HBC A;  3FVO A;  3EN3 A;  2BJJ X;  1IIW A;  1QVS A;  2Q89 A;  2DWI A;  2QSX A;  3Q26 A;  4GL8 A;  4RXL A;  3FUZ A;  1M5C A;  3LC8 A;  5FHM A;  1L5T A;  3FXU A;  2HZL A;  3G3J A;  2D3I A;  3IAZ A;  1B51 A;  4H8J A;  4I62 A;  4AB5 A;  4O3A A;  3RLF E;  3BBR A;  1DOT A;  4KYS A;  1B52 A;  3O66 A;  3RGY A;  4YB7 A;  4LAT A;  3QK6 A;  3OEK A;  1UTH B;  2W7Y A;  1I6B A;  3ILU B;  3IX1 A;  1AIV A;  2I4B A;  2XXV A;  5KZT A;  3S9L C;  4PQJ A;  2XX8 A;  1AH5 A;  4EXK A;  4FAT A;  4JXI A;  3KFM A;  4GQO A;  5CM6 A;  1YAE A;  2RIN A;  1B58 A;  1Y3P A;  2V93 A;  3KN3 A;  3DP6 A;  1TFD A;  3H3G A;  5AA4 B;  4FOR A;  4FE8 A;  1S50 A;  1MS7 A;  2Y84 A;  5TPA A;  1LLS A;  3KN7 A;  3CSB A;  3FIR A;  1B05 A;  1JET A;  2NXO A;  1WDN A;  2E0S A;  3TKD A;  1BIY A;  2V3U A;  3L6G A;  3TTK A;  5AA2 D;  4PE5 B;  3FJM A;  1S7Y A;  4ZE9 A;  1IUD A;  3LSF B;  1Y1Z A;  4GRK A;  3C9H A;  2FNC A;  4N6P A;  1MDQ A;  2OWS A;  1I6Q A;  1NNT A;  4OER A;  3IB2 A;  5TP9 B;  3TFL A;  3S9E A;  4N07 A;  2A5T B;  2B3B A;  4OXV A;  3M8U A;  4E0X A;  3B6T A;  4G2Z A;  2XX9 A;  1B7H A;  4LON B;  2V25 A;  1MDP 1;  4IGR A;  4WKM A;  2F7B A;  3FJG A;  3K01 A;  2HEU A;  1LCF A;  1BTJ A;  4OQO A;  3SER A;  1JW5 A;  1NH7 A;  5FTH A;  4YKI A;  3U94 A;  3DP4 A;  1RKM A;  1FCK A;  3KZG A;  4OTE A;  3UP9 A;  2GHB A;  3OEN A;  2QPQ A;  3D4G A;  1BLF A;  3OSR A;  3SDF A;  3USD A;  1P99 A;  4IY6 A;  4QFP A;  4NF6 A;  2H98 A;  4G77 A;  4F2Q A;  1LAG E;  1QUL A;  2X26 A;  4BDL A;  4ISU A;  3T9H B;  1LFI A;  4H8I A;  1SVX B;  4NMY A;  4U1O A;  4MLQ A;  4QHQ A;  3PD8 A;  4R9F A;  3MJN A;  2XHD A;  4PFW A;  1MXZ A;  5JTY A;  5L9O A;  4GFR A;  4DXC A;  2VP1 A;  3KSX A;  4YMB A;  1MXX A;  2A5S A;  1FQF A;  2RC9 A;  3DEL B;  1UTB B;  4BDO A;  4FJP A;  1HSL A;  5DVF A;  2GRV A;  2D5W A;  2VHA A;  1XVX A;  3RN8 A;  4GXA A;  1JEV A;  1VR5 A;  2XXY A;  3CFL A;  1B40 A;  2X7Q A;  3CRB A;  3M3K A;  3ODB A;  2F35 A;  4NTL A;  3HHF A;  2I6E A;  4KCD A;  1OLA A;  4YKJ A;  1ZIU A;  2I58 A;  4TLL B;  2F34 A;  3O29 A;  2DE3 A;  1MQD A;  3OO7 A;  4H0W A;  2YLN A;  1B46 A;  3O28 A;  4TLM B;  4N13 A;  4XXU A;  2VD2 A;  3CVG A;  2H9B A;  3G3H A;  3OSQ A;  1Y4T A;  4DZ1 A;  5I84 A;  3ONM A;  3WAF A;  4MLV A;  4UAC A;  2F97 A;  1MPD A;  4OHN A;  1DTG A;  4MBP A;  4OMB A;  1SDX A;  1MM7 A;  1MH4 A;  3B6W A;  2OJT A;  4ONY A;  1B3L A;  5I2N B;  3ZKK A;  5I59 A;  4KHZ E;  3SET A;  4F3S A;  3IB1 A;  1BKA A;  4NE4 A;  3T93 B;  1PEB A;  1LAF E;  4R6Y A;  5HPQ A;  2OBG A;  4F1V A;  1LFG A;  2E1S A;  3MP1 A;  5BUU A;  3FGS A;  2DYX A;  3F11 A;  1LST A;  3IOV A;  3LSW A;  3QUJ A;  4R6H A;  3C31 A;  1B4H A;  2O84 X;  5H8Q A;  3TPA A;  1LFH A;  2P2A A;  4R2F A;  1MQJ A;  3QYT A;  3UK4 A;  4ELP A;  3IO4 A;  3OD7 A;  2DSF A;  1MRP A;  3BFT A;  3R6U A;  1EU8 A;  2ZNU A;  5CMM A;  4ECF A;  1EZO A;  3IR1 A;  5JEI A;  3FJ7 A;  1NMU A;  1XHY A;  3MP6 A;  4G8N A;  4R73 A;  2YJP A;  4GXS B;  1GVC A;  4U4X A;  5B70 A;  3TAJ A;  2UVH A;  5LOM A;  3DLN A;  3U1O A;  4ZED A;  2QS3 A;  1PB8 A;  4ND9 A;  3TYH A;  3ZSF A;  2DP8 A;  2PBW A;  3OO6 A;  3SEX A;  4AB6 A;  3K2D A;  2R71 A;  4AQ4 A;  3U8Q A;  1FTO A;  1B3F A;  4RNS A;  2G93 A;  4LA9 A;  1LB8 A;  1LBB A;  2RC7 A;  5H8F A;  5ISU A;  3MVZ A;  1B6H A;  3THI A;  1PB7 A;  2AL5 A;  3IK6 B;  1NNK A;  4QSC A;  2ANJ A;  1P1O A;  2GFE A;  1IZ1 A;  2UYF A;  3C4M A;  3FVG A;  4LZ7 A;  1GTK A;  1SI0 A;  4YKK A;  3SEV A;  5I2K B;  1SW4 A;  2Q2C A;  3RTF B;  1BP5 A;  1B1H A;  3KSJ A;  3I3V A;  2XXT A;  4GLI A;  5H8H B;  1MM6 A;  1H45 A;  2UYE A;  3ZS6 A;  2XXW A;  1O7T A;  1OIB A;  4PFU A;  1A8E A;  1DSN A;  2VGQ A;  3K6V A;  3C36 A;  2QS1 A;  3PMW A;  4NF8 B;  4U2R A;  4EQ7 A;  2XD2 A;  2FA7 A;  4JWY A;  4NF5 A;  1B7Z A;  2QRY A;  3PPR A;  4LZ5 A;  5H8F B;  5I2K A;  3K6U A;  2OCU A;  4MFI A;  4DCX A;  1P1U A;  2DOJ A;  5I56 A;  4PFY A;  2DWH A;  1B3E A;  1M5B A;  4G68 C;  4LQ5 A;  1FQB A;  5L9S A;  4M4G A;  1N7W A;  2Z23 A;  1MY4 A;  3ILT B;  4KPT A;  4NF6 B;  3VXC A;  1XVY A;  1JNF A;  3H6V A;  3O6H A;  4FED A;  4QFO A;  4EF1 A;  1N3X A;  3TQW A;  1B0H A;  3H06 B;  3VDF A;  2R6G E;  1VSO A;  2IEE A;  1QUI A;  3K00 A;  4TQU Q;  1A55 A;  3T9X B;  3HO7 A;  1AL3 A;  3LSX A;  3TEP A;  2CMO A;  4ZEC A;  1ZBM A;  3S2V A;  5KDT B;  4WXJ A;  4RA1 A;  1F9B A;  1N3W A;  4HTG A;  3VLU A;  3RQT A;  4QSE A;  1HSJ A;  1GR2 A;  1A54 A;  3PV0 E;  2D21 A;  1XOC A;  3W9W A;  1ANF A;  3JV9 A;  4RPO A;  2ZYK A;  1FTM A;  2KLF A;  3MZ1 A;  4U23 A;  4ZEI A;  4XKP A;  4F3P A;  4F1Y A;  2O1M A;  1RYO A;  2HQ0 A;  3O2A A;  3IL1 B;  3HHG A;  4IO3 A;  4Q0C A;  4BLA A;  3V83 A;  4OET A;  4ZE8 A;  5DYH A;  3LSL A;  3R7X A;  2I49 A;  3KBR A;  1Q35 A;  1URS A;  4JDF A;  4QFL A;  4Z0I A;  3RPW A;  1ZKB A;  3PUZ E;  2RKM A;  4LUB A;  3RTW B;  5AA3 A;  1Y1M A;  3FV1 A;  4YB6 A;  5ICT A;  3KEI A;  3CG3 A;  3MC2 A;  1B5H A;  1Q1K A;  5H8H A;  2DQV A;  3PUW E;  1IXH A;  2WKY A;  3FXR A;  4RK2 A;  3Q25 A;  1B5J A;  3C32 A;  3FVK A;  3O6G A;  3QXM A;  3K02 A;  3OO9 A;  5CMB A;  4FIM A;  4OZ9 A;  1D9V A;  3SKP A;  3HPI A;  1IXC A;  3CFX A;  4MF3 A;  2UVJ A;  5DTB A;  3T9V A;  1N84 A;  1SW1 A;  2Z8F A;  3MUQ A;  2Y7R A;  3Q28 A;  4LQ2 A;  5AE4 A;  1XC1 A;  4C0R A;  3EHT A; 
#chains in the Genus database with same CATH topology
 2FIX A;  5BWJ A;  4NED A;  5FHO A;  3UP9 A;  3H6T A;  3T96 B;  3PPO A;  2WX9 A;  3LBS A;  3T66 A;  3TCH A;  1URG A;  2O7U A;  1QKB A;  2ESN A;  4HCW A;  3KG2 A;  2NUV A;  2REG A;  1A8F A;  2PT1 A;  3RT8 A;  2DVC A;  4R9G A;  3EQ1 A;  2F7A A;  4H45 A;  1S9T A;  3OEL A;  4R72 A;  1TFA A;  5EHS A;  2FYI A;  3IB0 A;  4HCY A;  4KQP A;  4N15 A;  4OVR A;  3UGW A;  4N6D A;  1FBF A;  2XXP A;  3O97 A;  4P0G A;  5DEX A;  4IO6 A;  3KBZ A;  3TTN A;  5FBP A;  1EZ9 A;  5CC2 A;  4DI3 D;  4OWD A;  4X1D A;  1LCT A;  3GZG A;  1FTA A;  1QW0 A;  2ZYM A;  2QJE A;  5KCJ B;  2Z22 A;  1A99 A;  5ICQ A;  3B8B A;  1I69 A;  2QS4 A;  4EUO A;  5I2N A;  4PFI A;  4RY1 A;  1PDA A;  1Y20 A;  2DXY A;  1RDY A;  1DTZ A;  2Y7I A;  1B0L A;  3K1N A;  1QUK A;  2P0S A;  1FRP A;  1TT1 A;  4NF4 B;  4YKP A;  1GGG A;  3LV0 A;  1K9Z A;  2F8D A;  3N6T A;  4OA4 A;  3NOH A;  4DCY A;  4ELR A;  4F2O A;  4HE1 A;  3ECR A;  4H5G A;  3PU5 A;  1XT8 A;  4ZZA A;  3QAX A;  3FAS A;  3Q27 A;  3UA8 A;  3QUF A;  3CG1 A;  2CZL A;  1MG1 A;  4THI A;  2GH9 A;  2QMX A;  5KDT A;  4EQB A;  4NF4 A;  2OWZ A;  3TZA A;  3N26 A;  1CB6 A;  2CEY A;  1JW1 A;  3H03 A;  1B1X A;  3IOR A;  4DI4 B;  3UN6 A;  4IR8 A;  4MJO A;  4IB2 A;  3MP8 A;  1D3K A;  1Y3Q A;  2XD3 A;  3PUY E;  4LN5 A;  5H8F A;  5I58 B;  1SBP A;  4POX A;  4ZDM A;  3FXQ A;  1POY 1;  3PGF A;  4YIC A;  1J1N A;  3H6U A;  4HE2 A;  4FBP A;  3TCF A;  3JZJ A;  3GLB A;  5LTC A;  3IJO B;  4DIG A;  4PP0 A;  4P1L A;  5CBS A;  3H7M A;  4JWX A;  4OFL A;  2DWJ A;  4MNC A;  4C1T A;  2H4I A;  2JJK A;  3KN8 A;  2X7P A;  4GF8 A;  4H5F A;  2Q2A A;  4YAH X;  3VVD A;  1ATG A;  5ESY A;  3K0V A;  3QMF A;  3I6V A;  2OWT A;  5TP9 A;  3S9N C;  5TU0 A;  1SYI A;  3MVX A;  4LP2 B;  5IKB A;  4FAJ A;  1IMC A;  3EPE A;  1MH3 A;  4DLD A;  4OYV A;  1YZ0 A;  4HE0 A;  1MY2 A;  1AMF A;  5IZ1 A;  3IO6 A;  3O9P A;  1LBZ A;  2WYK A;  3VLW A;  1SQY A;  2O69 A;  3PPQ A;  2VPN A;  1B32 A;  4JVI A;  3PPP A;  4BDQ A;  1M5D A;  4G4P A;  4ELQ A;  4LVQ A;  1NUY A;  2DE4 A;  2Y7K A;  1OLC A;  4FAT A;  5IAI A;  2ZMB A;  1KA0 A;  3FVO A;  3U8Q A;  5A5X A;  1QVS A;  1L5T A;  1M5C A;  5FHM A;  2HZL A;  1FBG A;  1B51 A;  1DOT A;  3O66 A;  3OEK A;  2W7Y A;  3IX1 A;  1AIV A;  5KZT A;  1AH5 A;  5IZ3 A;  5CM6 A;  1YAE A;  1Y3P A;  3DP6 A;  1TFD A;  3H3G A;  3KN7 A;  3CSB A;  2PFZ A;  2V3U A;  3L6G A;  4ZE9 A;  1IUD A;  1LBW A;  1Y1Z A;  1MDQ A;  2OWS A;  5TP9 B;  3S9E A;  3M8U A;  1MDP 1;  4IGR A;  1G0I A;  5EQA A;  2HEU A;  1LCF A;  1BTJ A;  1NH7 A;  2KR0 A;  2CZK A;  2QPQ A;  4QFP A;  1LAG E;  2X26 A;  4ISU A;  5LDZ A;  4U1O A;  3MJN A;  4KXP A;  1FBC A;  4YMB A;  1MXX A;  1UTB B;  4FJP A;  1K9Y A;  2GRV A;  5IZZ A;  2VHA A;  1XVX A;  1VR5 A;  1B40 A;  3CRB A;  4KCD A;  1ZIU A;  1MQD A;  5EQ7 A;  4N13 A;  3G3H A;  4UAC A;  1MM7 A;  2KQZ A;  1PEB A;  3GYY A;  4F1V A;  1RDZ A;  3FGS A;  2DYX A;  4R6H A;  2O84 X;  3TPA A;  3FXB A;  2F3B A;  3FJ7 A;  3MP6 A;  4P8B A;  4R73 A;  5LOM A;  5B70 A;  3ZSF A;  4AB6 A;  4AQ4 A;  2G93 A;  4LA9 A;  1LBB A;  3RPL A;  3MVZ A;  2AL5 A;  1NNK A;  2ANJ A;  3C4M A;  4LZ7 A;  4YKK A;  4OVP A;  4AS4 A;  1SW4 A;  4O7I A;  1NV0 A;  2XXT A;  3ZS6 A;  2XXW A;  4U2R A;  4NF8 B;  4EQ7 A;  3PMW A;  4NF5 A;  3K6U A;  4OAN A;  2OCU A;  4DCX A;  4PFB A;  4G68 C;  1FQB A;  2Y5L A;  1N7W A;  4KPT A;  4PGP A;  3H06 B;  2IEE A;  3T9X B;  3HO7 A;  4ZEC A;  3S2V A;  1NV5 A;  4PAI A;  4QSE A;  4RPO A;  4GBV A;  2KLF A;  4ZEI A;  2O1M A;  4BLA A;  4IO3 A;  4ZE8 A;  5DYH A;  3R7X A;  2I49 A;  1Q35 A;  3RPW A;  1ZKB A;  3FV1 A;  4YB6 A;  3KEI A;  5H8H A;  4RK2 A;  3Q25 A;  3C32 A;  3OO9 A;  1D9V A;  4UAB A;  3T9V A;  3MUQ A;  2Y7R A;  4C0R A;  5A5L A;  1SW2 A;  3B50 A;  1H43 A;  1XS5 A;  4XTC Q;  2ZXT A;  3M3F A;  2Z8E A;  3RNN A;  4PDD A;  1NUW A;  5K2X A;  1MY0 A;  3MZB A;  2ZNS A;  3HFU A;  3MYU A;  3K6X A;  3U92 A;  1N7X A;  1NKX A;  4G68 B;  4F3G A;  5AA1 A;  3R26 A;  3T9U A;  3FAT A;  3PD9 A;  3IOU A;  2WBD A;  4DE8 A;  2B3F A;  4KCC A;  3TTK A;  4HW8 A;  3MZ9 A;  3QIM A;  3D4C A;  1OVB A;  1FBD A;  3A3C A;  4Q8R A;  1N76 A;  2F6P A;  2Y7W A;  4KD5 A;  4NN3 A;  4PFR A;  4DDD A;  2AL4 A;  3H4Z A;  1NH8 A;  4EQ9 A;  2V3T A;  4G8M A;  1LAH E;  4F18 A;  4O3C A;  4ELO A;  3FV2 A;  5FTI A;  5CMK A;  3B6Q A;  3OMB A;  2VPO A;  1PB9 A;  2A5T A;  2F78 A;  1MXV A;  1USY E;  1NV1 A;  4F29 A;  5I5P A;  4Q5T A;  1YCJ A;  2THI A;  1INP A;  3FZV A;  4IO2 A;  1KA1 A;  4U4S A;  4PF8 A;  2ALU A;  1B4Z A;  5KCJ A;  4FEB A;  4XEQ A;  4G68 A;  5I59 B;  4P3L A;  5ET6 A;  1US4 A;  1JVX A;  4F3B A;  4K3F A;  1FPI A;  2P3N A;  3SES A;  1FJ6 A;  1IIT A;  3AXF A;  3CSG A;  3ISP A;  1JW4 A;  1NNP A;  1EH3 A;  3MBP A;  3E3K A;  4GD5 A;  1AOV A;  2Q8M A;  3U93 A;  3FD3 A;  1MPB A;  4X8R A;  1SD3 A;  3TDJ A;  1LGB C;  1ELJ A;  1QKA A;  4OES A;  3E4R A;  1TXF A;  2XXU A;  4IO5 A;  3TEL A;  3U65 A;  2NOO A;  3B7D A;  3MAM A;  4N91 A;  4WEP A;  3SEY A;  2B65 A;  2CEX A;  1VDW A;  3T22 A;  2ZZW A;  1SW5 A;  2I3W A;  1BK4 A;  1URD A;  4GWW A;  5TPA B;  3EHU A;  3G3I A;  1NFT A;  3OXN A;  2QMW A;  1P1W A;  4R2B A;  2P1S A;  1B7U A;  4Z7E A;  5H8N B;  4O3B A;  2DWA A;  1PC3 A;  1DPE A;  3KC1 A;  1YPN A;  4P56 A;  2O1L A;  4DXB A;  2HAV A;  2QVU A;  3HCQ A;  1Z7N E;  3KOT A;  3TTL A;  2F36 A;  3O6I A;  2L5V A;  3JYR A;  4H65 A;  2I0B A;  3PUV E;  3TCG A;  4N8G A;  4POW A;  4GOT A;  4U21 A;  3HST A;  1SPI A;  4X9T A;  1DK4 A;  3C33 A;  4KYE A;  4BDN A;  5DVI A;  3D1R A;  1MQI A;  2V3Q A;  4YU0 A;  3V5A A;  4KR5 A;  1B3H A;  5CRY A;  5I57 A;  3UOR A;  1NUZ A;  1FPF A;  1FBH A;  4JSD A;  2AYS A;  4IGT A;  3IJX B;  3S4U A;  1B2H A;  3I5O A;  1IXI A;  1NV6 A;  2XWV A;  1D4N A;  4GWO A;  4JB7 A;  4GIZ A;  2WEF A;  1KWH A;  5H8S A;  5EYF A;  4PFT A;  1N04 A;  2NWJ A;  2FVZ A;  2HXW A;  2XWI A;  1IQ7 A;  3GBA A;  3MW0 A;  5CMC A;  2I0C A;  5HM4 B;  3G3F A;  4YZZ A;  4GL8 A;  1IIW A;  4G61 A;  2DWI A;  3FXU A;  2D3I A;  4H8J A;  4O3A A;  3BBR A;  4KYS A;  1B52 A;  4LAT A;  3QK6 A;  1NI9 A;  3ILU B;  2XXV A;  4PQJ A;  1KZ8 A;  1B58 A;  5TPA A;  1S50 A;  1MS7 A;  4PTK A;  4QXD A;  1LLS A;  1JET A;  1WDN A;  2E0S A;  4XF5 A;  1BIY A;  5AA2 D;  1Q9D A;  1S7Y A;  3EKI A;  4GRK A;  3C9H A;  4N6P A;  1I6Q A;  3IB2 A;  4N07 A;  2B3B A;  4LON B;  3K01 A;  1D9Q A;  4PDH A;  4OQO A;  4GBW A;  5FTH A;  4YKI A;  1FCK A;  3KZG A;  3OEN A;  3D4G A;  3OSR A;  3USD A;  4G77 A;  1QUL A;  3PD8 A;  4I3Y A;  2Y5K A;  2XHD A;  5J16 A;  1FQF A;  5DVF A;  2D5W A;  3RN8 A;  4NTL A;  2I58 A;  4H0W A;  2YLN A;  5I84 A;  3CVG A;  3OSQ A;  1Y4T A;  2F97 A;  4OMB A;  1MH4 A;  1B3L A;  2F3D A;  3ZKK A;  4KHZ E;  1DCU A;  4F3S A;  3IB1 A;  4R6Y A;  5HPQ A;  2OBG A;  1IMA A;  2E1S A;  3F11 A;  3LSW A;  3QUJ A;  3C31 A;  5H8Q A;  1LFH A;  1MQJ A;  3QYT A;  4ELP A;  3IO4 A;  3BFT A;  1EU8 A;  4ECF A;  1GVC A;  4U4X A;  2UVH A;  3DLN A;  3U1O A;  2QS3 A;  4ND9 A;  3TYH A;  3OO6 A;  2PBW A;  3K2D A;  2R71 A;  1B6H A;  3IK6 B;  1IZ1 A;  2XWO A;  3SEV A;  5I2K B;  3RTF B;  5H8H B;  3KSJ A;  1H45 A;  1OIB A;  1DSN A;  2VGQ A;  5AA4 B;  4NQ8 A;  5H8F B;  1B7Z A;  3PPR A;  2V4C A;  2DWH A;  1B3E A;  4LQ5 A;  3ILT B;  2Z23 A;  2BJI A;  1XVY A;  4EF1 A;  1N3X A;  3VDF A;  2CMO A;  5KDT B;  4HTG A;  3VLU A;  3RQT A;  1A54 A;  4PBQ A;  2ZYK A;  4F3P A;  3MZ1 A;  4F1Y A;  1RYO A;  4PC9 A;  4OET A;  2XXK A;  3RTW B;  4LUB A;  5ICT A;  1B5H A;  1FBE A;  4N4U A;  5IZ3 B;  3PUW E;  3FXR A;  4OZ9 A;  1IXC A;  3CFX A;  2UVJ A;  4H46 A;  3Q28 A;  4LQ2 A;  5AE4 A;  1XC1 A;  4OEN A;  5ET8 A;  2O7I A;  1B5I A;  1FW0 A;  2HCA A;  4ZZE A;  1RYX A;  2R9J A;  4JBZ A;  1FSA A;  3N6U A;  2HFB A;  1MQH A;  5H8Q B;  2I48 A;  1USY H;  1POT A;  4GVO A;  2XXH A;  3E79 A;  5I3S A;  4O7M A;  3VFJ A;  4QSD A;  2ONS A;  3A09 A;  4JVD A;  4OEV A;  4PAF A;  1US5 A;  4X04 A;  4JWO A;  1H3D A;  1TWY A;  3UIF A;  4DXU A;  2ZZX A;  5ITO A;  2HAU A;  2XXQ A;  1A7L A;  2XA5 A;  4FEC A;  4NF0 A;  4X1B A;  4ZEK A;  2V84 A;  5B7D A;  4XKN A;  4GWZ A;  2ZYN A;  4ZEB A;  2Q9T A;  4MX6 A;  2B4M A;  2O6A A;  2M8C A;  2XX7 A;  3DM0 A;  1MY1 A;  1O63 A;  4PE3 A;  2ZYO A;  4HXV A;  3N94 A;  3PPN A;  5M2V A;  1H44 A;  4P11 A;  5CBR A;  1IME A;  4MMP A;  1B3G A;  1IMF A;  4HS7 A;  3PMX A;  4EDP A;  3LUY A;  5F7V A;  1FPK A;  5CI5 A;  4QBA A;  5ET7 A;  4H1X A;  3QSL A;  4LZ8 A;  3MPK A;  4PET A;  1G0H A;  2VOZ A;  4H6D A;  2Q8J A;  4EXL A;  4I8C A;  2I4C A;  3FVN A;  2RCB A;  1JVY A;  3BFU A;  1VFD A;  3EHS A;  3M3L A;  1WVJ A;  4XKQ A;  3HN0 A;  2HPG A;  1ZJL A;  2RCA A;  4RPN A;  1ZMG A;  1QJM A;  3RPL B;  1ZU0 A;  3LR1 A;  1EZP A;  4RJZ A;  1MQG A;  3IOT A;  1ZLQ A;  3KOS A;  2OK2 A;  1P1N A;  2O68 A;  2AIX A;  3K4U A;  3SEU A;  3FBP A;  2H99 A;  4U1Z A;  3MVY A;  2HXR A;  4ESW A;  1JQF A;  3GXA A;  4N6K A;  2ONK E;  4BDO A;  4QFN A;  5I57 B;  3CI8 A;  3V89 B;  4F22 A;  2MKZ A;  1NV2 A;  4ESX A;  2DDK A;  1FBP A;  2RC8 A;  2Y7P A;  1NL5 A;  2UVI A;  2HHM A;  3PUX E;  3H6W A;  2R8T A;  1N0T A;  4BDM A;  1UTH A;  1T0K A;  3KJ7 A;  4R2F A;  1ZTY A;  2QL3 A;  1O64 A;  3CFZ A;  3MVW A;  4OEU A;  3W15 C;  4F31 B;  1FQE A;  4ZEF A;  3DP8 A;  3VE1 B;  5ITP A;  1PBQ A;  3Q29 A;  3C35 A;  2H5Y A;  4JVC A;  1DMB A;  2VD3 A;  4M1V A;  4BDR A;  3V8X B;  2HZK A;  3VVE A;  4YMA A;  1MXU A;  4RK9 A;  1UQW A;  3KC0 A;  2DXR A;  4QF9 A;  5H8N A;  4XKR A;  5JTY B;  4U22 A;  1MXW A;  4C1U A;  3U72 A;  3PMV A;  3E9X A;  1MPC A;  5F1Q A;  5AA2 A;  4P9K A;  1FPL A;  3A3U A;  3RY3 A;  4TOZ A;  1FQC A;  1A40 A;  5ELV A;  4Q30 B;  1R9Q A;  3CR9 A;  1Y3N A;  4IO7 A;  3PTY A;  5L8D A;  3K1P A;  3EF7 A;  4R75 A;  5ET5 A;  4EF2 A;  4G8H A;  3GBB A;  4R74 A;  4KFQ A;  1M5E A;  2PMS A;  1IEJ A;  4IY5 A;  2OZZ A;  3SZP A;  3C34 A;  1WOD A;  3A29 A;  1FPJ A;  3UK4 A;  1MY3 A;  3HV1 A;  4RYA A;  1FTL A;  3BIG A;  1EYJ A;  3TTR A;  4I9D A;  1Y9U A;  4MHF A;  1UIU A;  1R1N A;  1NNF A;  5HBC A;  2BJJ X;  2Q89 A;  4RXL A;  3FUZ A;  3G3J A;  4OVQ A;  4I62 A;  3RLF E;  3RGY A;  4YB7 A;  1UTH B;  3S9L C;  1I6B A;  2I4B A;  4EXK A;  4JXI A;  3KFM A;  4FOR A;  4FE8 A;  3FIR A;  2NXO A;  3TKD A;  1LEV A;  4PE5 B;  3FJM A;  3LSF B;  1NV4 A;  2FNC A;  4OER A;  3TFL A;  2A5T B;  4E0X A;  4G2Z A;  2XX9 A;  1B7H A;  2V25 A;  4WKM A;  2B4L A;  3SER A;  1JW5 A;  3U94 A;  3DP4 A;  4OTE A;  2GHB A;  5T3J A;  1P99 A;  4IY6 A;  4NF6 A;  1LFI A;  2QVV A;  4NMY A;  4QHQ A;  5JTY A;  5L9O A;  1MXZ A;  4DXC A;  2VP1 A;  2A5S A;  2RC9 A;  2GQ1 A;  4GXA A;  3M3K A;  4I40 A;  4N8Y A;  3ODB A;  1FPB A;  1OLA A;  5FHN A;  4TLL B;  3O29 A;  4TLM B;  2DE3 A;  3OO7 A;  3O28 A;  4MLV A;  4NG7 A;  1MPD A;  4OHN A;  1DTG A;  3B6W A;  5I2N B;  1BKA A;  4NE4 A;  3T93 B;  1LAF E;  4GWU A;  1AWB A;  3R6U A;  5CMM A;  3IR1 A;  3E78 A;  1NMU A;  1XHY A;  2CZH A;  3TAJ A;  4GX3 A;  1EYI A;  3SEX A;  4PAK A;  1PB7 A;  2UYF A;  3FVG A;  1SI0 A;  4GLI A;  1MM6 A;  1FPD A;  4PFU A;  2XD2 A;  4JWY A;  2QRY A;  4LZ5 A;  5I2K A;  4MFI A;  1P1U A;  2DOJ A;  4MCO A;  4PFY A;  1M5B A;  4MNP A;  5L9S A;  4M4G A;  4OVT A;  4NF6 B;  4P1E A;  1JNF A;  3O6H A;  4FED A;  4QFO A;  1QUI A;  3LSX A;  1ZBM A;  4WXJ A;  4RA1 A;  1HSJ A;  3JV9 A;  1FTM A;  2HQ0 A;  3O2A A;  4Q0C A;  3V83 A;  3KBR A;  4QFL A;  4Z0I A;  3PUZ E;  5AA3 A;  1Y1M A;  2DQV A;  3RYD A;  1B5J A;  3FVK A;  2Q74 A;  3QXM A;  3HPI A;  4MF3 A;  5DTB A;  1N84 A;  1SW1 A;  4N81 A;  2Z8F A;  3EHT A;  3TMG A;  5DEX B;  4WED A;  2PX1 A;  5BUU A;  1IXG A;  3OOA A;  5AA2 B;  2XXI A;  1II5 A;  2UVG A;  3SEW A;  3RUM A;  1CE2 A;  3KGC A;  5I56 B;  2QVR A;  5AA4 A;  4UA8 A;  3G3K A;  1LBV A;  4NHB A;  1FTK A;  5IGA A;  3G7W A;  3VLV A;  2H25 A;  3L6H A;  3K1M A;  4GL0 A;  4NGU A;  3ZKL A;  1D9Y A;  1R6Z A;  1SI1 A;  1VE4 A;  3OEM A;  3TQL A;  1PBP A;  2REJ A;  1H76 A;  3VV5 A;  3T1B A;  3S9M C;  1YXI A;  1FTJ A;  3TOD A;  1I6A A;  1QUJ A;  4GX4 A;  3TUS A;  5A5X B;  1OVT A;  2I3V A;  3P7I A;  2NVU B;  2IA4 A;  1M5F A;  4F19 A;  1XI6 A;  3E13 X;  4KI0 E;  2VT5 A;  3G3G A;  2ONR A;  2XXR A;  4N17 A;  2DE2 A;  1DBZ A;  1YTV A;  2Z8D A;  1SYH A;  2FHY A;  3RT6 B;  4QRZ A;  4L17 A;  4PBH A;  1Y4C A;  3N5L A;  3MQ9 A;  4AS5 A;  5EQ9 A;  3BKI B;  4R6K A;  3CIJ A;  2WBB A;  4O94 A;  2DS9 A;  1OQG A;  2PT2 A;  1DPP A;  2ZNT A;  1HSE A;  5J1D A;  4GWY A;  1EYK A;  3IOW A;  4X48 A;  2XWK A;  4QFK A;  2LAO A;  3OO8 A;  1RDX A;  1LB9 A;  2XXX A;  1LAX A;  4OFO A;  4H67 A;  1OMP A;  2OX3 A;  5I58 A;  4NX1 A;  4I3E A;  3WAE A;  2Q88 A;  3MPL A;  4NF5 B;  1VFE A;  2GHA A;  4PF6 A;  2UXA A;  1OQH A;  2YPN A;  4OFJ A;  4IO4 A;  2QS2 A;  4OVJ A;  1NV7 A;  1FQA A;  3MST A;  3VVF A;  4F39 A;  3LUZ A;  4P0I A;  1YYZ A;  4MH5 A;  5K2Y A;  1B9J A;  2DVZ A;  5IM2 A;  4MIJ A;  1LBC A;  4NF8 A;  5EYH A;  1MXY A;  2F6G A;  1FPE A;  3W9V A;  2F7C A;  3TTM A;  2O51 A;  4E0W A;  2OLB A;  2F5X A;  4YB5 A;  1P1Q A;  4KYD A;  4NWD A;  1GV8 A;  4F1U A;  4I1D A;  4JSO A;  4XIG Q;  1R9L A;  1UTB A;  2ZZV A;  1FQD A;  5L9M A;  3VXB A;  2RF1 A;  4MNI A;  5EYG A;  3MWB A;  1UIV A;  1JEU A;  5DT6 A;  1LBX A;  2FIE A;  2G29 A;  2PYY A;  3K6W A;  1Z7M E;  5DVJ A;  2PVU A;  5EHM A;  2ABH A;  4MAG A;  3KJT A;  3EN3 A;  5F24 A;  2QSX A;  3Q26 A;  5JK4 A;  3LC8 A;  4GWX A;  1QGX A;  3IAZ A;  4AB5 A;  2XX8 A;  4GWS A;  4GQO A;  2RIN A;  2V93 A;  3KN3 A;  2Y84 A;  1B05 A;  3CHG A;  2FBP A;  2P3V A;  4PCD A;  1NNT A;  5EQ8 A;  3BIH A;  4OXV A;  3B6T A;  2F7B A;  3FJG A;  1RKM A;  4MEV A;  1BLF A;  4OVS A;  4GX6 A;  3IFA A;  3SDF A;  2H98 A;  4F2Q A;  4BDL A;  3T9H B;  4H8I A;  5I7I A;  1SVX B;  4XKP A;  4MLQ A;  4R9F A;  4PFW A;  4GFR A;  3KSX A;  3DEL B;  1HSL A;  1JEV A;  2XXY A;  3CFL A;  4NWC A;  2X7Q A;  2PFY A;  1CNQ A;  2F35 A;  3HHF A;  2I6E A;  4O8M A;  4YKJ A;  2F34 A;  1B46 A;  4XXU A;  4XFE A;  2VD2 A;  2H9B A;  4DZ1 A;  3ONM A;  3WAF A;  4MBP A;  1SDX A;  4ONY A;  2OJT A;  5DW8 A;  5I59 A;  3SET A;  3IFC A;  1JP4 A;  1LFG A;  3MP1 A;  1NV3 A;  3IOV A;  1LST A;  1B4H A;  2P2A A;  1FPG A;  3OD7 A;  2DSF A;  1MRP A;  2CZI A;  2ZNU A;  1EZO A;  1NUX A;  3ROJ A;  5JEI A;  1IMD A;  4G8N A;  2YJP A;  4GXS B;  1LBY A;  4ZED A;  1PB8 A;  2DP8 A;  1FTO A;  1B3F A;  4RNS A;  1LB8 A;  2RC7 A;  5ISU A;  3THI A;  4QSC A;  1P1O A;  2GFE A;  1GTK A;  2Q2C A;  2WYP A;  1BP5 A;  1B1H A;  3I3V A;  2UYE A;  1FJ9 A;  1O7T A;  1A8E A;  3K6V A;  3C36 A;  2QS1 A;  2FA7 A;  5I56 A;  3VXC A;  1MY4 A;  3H6V A;  1IMB A;  2QFL A;  3TQW A;  1B0H A;  2R6G E;  1VSO A;  3T0J A;  3K00 A;  4TQU Q;  1A55 A;  3TEP A;  1AL3 A;  1F9B A;  1N3W A;  2PCR A;  1GR2 A;  3W9W A;  3PV0 E;  2D21 A;  1XOC A;  1ANF A;  4U23 A;  3IL1 B;  3HHG A;  4PGN A;  3LSL A;  4JDF A;  1URS A;  2RKM A;  3CG3 A;  3MC2 A;  1Q1K A;  4ZS9 A;  1IXH A;  2WKY A;  3O6G A;  3K02 A;  5CMB A;  4FIM A;  3SKP A;  4NAP A;  4P47 A; 
#chains in the Genus database with same CATH homology
 3TMG A;  4OEN A;  1SW2 A;  5DEX B;  5BWJ A;  4WED A;  2O7I A;  1H43 A;  1XS5 A;  4NED A;  4XTC Q;  2PX1 A;  1B5I A;  1FW0 A;  2ZXT A;  3H6T A;  1IXG A;  2HCA A;  3OOA A;  1RYX A;  2R9J A;  3M3F A;  4ZZE A;  3T96 B;  3PPO A;  5AA2 B;  4JBZ A;  3N6U A;  2Z8E A;  3RNN A;  2XXI A;  2HFB A;  1II5 A;  1MQH A;  3LBS A;  5H8Q B;  2UVG A;  5K2X A;  3T66 A;  2I48 A;  1MY0 A;  3TCH A;  1USY H;  3MZB A;  1POT A;  2ZNS A;  1URG A;  2O7U A;  3K6X A;  1QKB A;  3U92 A;  4GVO A;  2XXH A;  2ESN A;  3SEW A;  3VFJ A;  4QSD A;  4HCW A;  2ONS A;  3A09 A;  1CE2 A;  1N7X A;  3RUM A;  1NKX A;  3KG2 A;  3KGC A;  4OEV A;  5I56 B;  2NUV A;  2REG A;  4G68 B;  4F3G A;  1A8F A;  5AA1 A;  1US5 A;  2PT1 A;  3R26 A;  2DVC A;  3RT8 A;  3T9U A;  4JWO A;  4R9G A;  3FAT A;  3PD9 A;  3EQ1 A;  2F7A A;  3IOU A;  5AA4 A;  1H3D A;  4UA8 A;  4DE8 A;  2B3F A;  3G3K A;  1S9T A;  4KCC A;  3OEL A;  4R72 A;  1TFA A;  1TWY A;  3MZ9 A;  3D4C A;  3QIM A;  5EHS A;  1OVB A;  3A3C A;  2FYI A;  5ITO A;  4DXU A;  4EQ9 A;  4Q8R A;  2HAU A;  2XXQ A;  1N76 A;  2F6P A;  2Y7W A;  5A5X A;  1A7L A;  1FTK A;  4KD5 A;  4DDD A;  2AL4 A;  3H4Z A;  1NH8 A;  3IB0 A;  4FEC A;  4HCY A;  4KQP A;  2V3T A;  4X1B A;  4G8M A;  4ZEK A;  2V84 A;  3UGW A;  5B7D A;  3G7W A;  1LAH E;  4XKN A;  2ZYN A;  2H25 A;  3VLV A;  4F18 A;  4O3C A;  2Q9T A;  2XXP A;  3O97 A;  4P0G A;  3L6H A;  3FV2 A;  5FTI A;  3K1M A;  4ZEB A;  4GL0 A;  5CMK A;  3B6Q A;  3OMB A;  5DEX A;  3ZKL A;  1D9Y A;  1R6Z A;  2M8C A;  2O6A A;  2XX7 A;  1PB9 A;  4IO6 A;  1SI1 A;  3TTN A;  3DM0 A;  1MY1 A;  1O63 A;  1EZ9 A;  2ZYO A;  3TOD A;  5CC2 A;  3N94 A;  3PPN A;  2A5T A;  5M2V A;  1H44 A;  2F78 A;  4P11 A;  1VE4 A;  4OWD A;  1LCT A;  3GZG A;  4X1D A;  5CBR A;  1MXV A;  1USY E;  1B3G A;  3OEM A;  3TQL A;  1PBP A;  2REJ A;  4ELO A;  1H76 A;  3VV5 A;  1QW0 A;  4HS7 A;  2ZYM A;  4F29 A;  3PMX A;  2QJE A;  5KCJ B;  3S9M C;  4EDP A;  1FTJ A;  2Z22 A;  4Q5T A;  1YCJ A;  3LUY A;  1A99 A;  1I6A A;  5F7V A;  1QUJ A;  2THI A;  5CI5 A;  5ICQ A;  3TUS A;  3FZV A;  1I69 A;  4IO2 A;  5A5X B;  4U4S A;  1OVT A;  2QS4 A;  4H1X A;  2I3V A;  3P7I A;  2ALU A;  1B4Z A;  2NVU B;  3QSL A;  4LZ8 A;  5KCJ A;  2IA4 A;  4FEB A;  3MPK A;  4G68 A;  4EUO A;  5JK4 A;  1M5F A;  4PET A;  4F19 A;  5I59 B;  3E13 X;  5I2N A;  4RY1 A;  2VOZ A;  4H6D A;  1US4 A;  4KI0 E;  2Q8J A;  4EXL A;  1JVX A;  4F3B A;  4I8C A;  2I4C A;  3FVN A;  2RCB A;  3G3G A;  1JVY A;  2ONR A;  2XXR A;  4K3F A;  3BFU A;  2DE2 A;  1VFD A;  3EHS A;  1PDA A;  1Y20 A;  2DXY A;  3M3L A;  5I57 B;  1YTV A;  1WVJ A;  4XKQ A;  1DTZ A;  2Y7I A;  2Z8D A;  1SYH A;  1B0L A;  4QRZ A;  4L17 A;  3K1N A;  3HN0 A;  3RT6 B;  1ZJL A;  3SES A;  2RCA A;  4RPN A;  1IIT A;  1QUK A;  1ZMG A;  1QJM A;  2P0S A;  1TT1 A;  1Y4C A;  3AXF A;  3CSG A;  3N5L A;  3MQ9 A;  4NF4 B;  4YKP A;  1JW4 A;  1ZU0 A;  3LR1 A;  1NNP A;  1EH3 A;  1GGG A;  1EZP A;  4RJZ A;  1MQG A;  3BKI B;  4R6K A;  2F8D A;  3IOT A;  3CIJ A;  3E3K A;  3MBP A;  3N6T A;  1ZLQ A;  4GD5 A;  2DS9 A;  1OQG A;  2OK2 A;  3KOS A;  1AOV A;  2PT2 A;  4DCY A;  1P1N A;  2O68 A;  1DPP A;  4ELR A;  4F2O A;  3U93 A;  2AIX A;  1MPB A;  3ECR A;  3FD3 A;  3K4U A;  3PU5 A;  4H5G A;  3SEU A;  1SD3 A;  2ZNT A;  1XT8 A;  1HSE A;  3TDJ A;  2H99 A;  4U1Z A;  5J1D A;  1LGB C;  1ELJ A;  1QKA A;  3MVY A;  3IOW A;  3FAS A;  3QAX A;  4OES A;  4X48 A;  4ZZA A;  4ESW A;  3Q27 A;  3UA8 A;  3QUF A;  1JQF A;  3E4R A;  1TXF A;  2ONK E;  2XXU A;  3CG1 A;  3GXA A;  2CZL A;  2LAO A;  3CI8 A;  4IO5 A;  4QFK A;  2NOO A;  4QFN A;  3TEL A;  1MG1 A;  3B7D A;  4THI A;  2GH9 A;  2QMX A;  3V89 B;  3MAM A;  4WEP A;  3SEY A;  4EQB A;  5KDT A;  2B65 A;  5FHO A;  4F22 A;  4NF4 A;  3OO8 A;  3TZA A;  3T22 A;  1SW5 A;  1CB6 A;  1LB9 A;  1JW1 A;  3H03 A;  2XXX A;  3N26 A;  4ESX A;  1LAX A;  4OFO A;  1B1X A;  3IOR A;  2I3W A;  1URD A;  4H67 A;  5TPA B;  2RC8 A;  2Y7P A;  3EHU A;  3UN6 A;  3G3I A;  4IB2 A;  1NL5 A;  1NFT A;  1OMP A;  2UVI A;  5FHN A;  3OXN A;  2QMW A;  1P1W A;  4R2B A;  2P1S A;  3MP8 A;  3PUX E;  1B7U A;  5I58 A;  3H6W A;  4Z7E A;  1D3K A;  3WAE A;  5H8N B;  2Q88 A;  1Y3Q A;  1N0T A;  2XD3 A;  1UTH A;  3MPL A;  3PUY E;  2DWA A;  4O3B A;  4BDM A;  1T0K A;  1PC3 A;  1DPE A;  3KJ7 A;  1VFE A;  1YPN A;  1ZTY A;  1O64 A;  2GHA A;  2HAV A;  2O1L A;  2QL3 A;  3CFZ A;  4DXB A;  2UXA A;  1OQH A;  3HCQ A;  5I58 B;  1Z7N E;  3MVW A;  4OEU A;  3W15 C;  4F31 B;  2YPN A;  4OFJ A;  4IO4 A;  2QS2 A;  1FQE A;  1SBP A;  4POX A;  4ZDM A;  3FXQ A;  1POY 1;  4OVJ A;  3PGF A;  4ZEF A;  4YIC A;  3DP8 A;  1J1N A;  3KOT A;  3TTL A;  3VE1 B;  5ITP A;  4ZS9 A;  3H6U A;  2F36 A;  1PBQ A;  3Q29 A;  4HW8 A;  3O6I A;  3C35 A;  1FQA A;  2H5Y A;  1DMB A;  2VD3 A;  3JYR A;  3TCF A;  3VVF A;  4H65 A;  2I0B A;  4F39 A;  3PUV E;  3JZJ A;  3TCG A;  4POW A;  3GLB A;  4GOT A;  4M1V A;  3IJO B;  4BDR A;  4DIG A;  4PP0 A;  4P0I A;  3V8X B;  2HZK A;  4U21 A;  3VVE A;  3HST A;  3H7M A;  5CBS A;  4YMA A;  4JWX A;  4X9T A;  1MXU A;  4MH5 A;  4OFL A;  1UQW A;  4RK9 A;  5K2Y A;  3C33 A;  4KYE A;  4BDN A;  1B9J A;  5DVI A;  2DVZ A;  2DXR A;  1LBC A;  4NF8 A;  4QF9 A;  2DWJ A;  1MQI A;  1MXY A;  2V3Q A;  4YU0 A;  2F6G A;  3V5A A;  5H8N A;  4C1T A;  2H4I A;  3KN8 A;  4XKR A;  2X7P A;  4GF8 A;  5JTY B;  4KR5 A;  4NWC A;  1B3H A;  5CRY A;  5I57 A;  4U22 A;  3W9V A;  1MXW A;  3UOR A;  2F7C A;  2Q2A A;  4H5F A;  4YAH X;  3TTM A;  1ATG A;  3VVD A;  3U72 A;  4C1U A;  3PMV A;  3K0V A;  3E9X A;  4JSD A;  1MPC A;  2AYS A;  2O51 A;  5F1Q A;  3I6V A;  4E0W A;  5AA2 A;  2OLB A;  2F5X A;  2OWT A;  3A3U A;  4IGT A;  5TP9 A;  5TU0 A;  3S9N C;  1SYI A;  3MVX A;  1P1Q A;  4LP2 B;  4YB5 A;  5IKB A;  4KYD A;  4NWD A;  3IJX B;  1GV8 A;  3RY3 A;  4FAJ A;  4TOZ A;  3S4U A;  4F1U A;  3EPE A;  1MH3 A;  4DLD A;  1FQC A;  1B2H A;  3I5O A;  4OYV A;  1IXI A;  4I1D A;  4JSO A;  1A40 A;  5ELV A;  1MY2 A;  1AMF A;  4XIG Q;  3IO6 A;  4Q30 B;  1R9Q A;  3CR9 A;  1Y3N A;  1R9L A;  3O9P A;  4IO7 A;  1D4N A;  5L8D A;  1UTB A;  3K1P A;  3EF7 A;  4R75 A;  3VLW A;  1FQD A;  1SQY A;  5L9M A;  2O69 A;  3PPQ A;  3VXB A;  4G8H A;  4EF2 A;  1B32 A;  3GBB A;  4R74 A;  2RF1 A;  3PPP A;  4GWO A;  4JB7 A;  4KFQ A;  1M5E A;  3MWB A;  4GIZ A;  2PMS A;  1UIV A;  4BDQ A;  1M5D A;  1KWH A;  1IEJ A;  4G4P A;  1JEU A;  2OZZ A;  4IY5 A;  5H8S A;  4ELQ A;  5EYF A;  5DT6 A;  4LVQ A;  3C34 A;  1WOD A;  4PFT A;  1N04 A;  2G29 A;  2PYY A;  3K6W A;  3UIF A;  2DE4 A;  2Y7K A;  1OLC A;  1Z7M E;  2HXW A;  5DVJ A;  2PVU A;  1IQ7 A;  5EHM A;  1MY3 A;  2ABH A;  2NWJ A;  3HV1 A;  3GBA A;  1FTL A;  3MW0 A;  4RYA A;  5CMC A;  3TTR A;  2I0C A;  5HM4 B;  3KJT A;  4I9D A;  5IAI A;  1Y9U A;  3G3F A;  2ZMB A;  4YZZ A;  1UIU A;  1R1N A;  1NNF A;  4NF5 B;  5HBC A;  3FVO A;  3EN3 A;  2BJJ X;  1IIW A;  1QVS A;  2Q89 A;  2DWI A;  2QSX A;  3Q26 A;  4GL8 A;  4RXL A;  3FUZ A;  1M5C A;  3LC8 A;  5FHM A;  1L5T A;  3FXU A;  2HZL A;  3G3J A;  2D3I A;  3IAZ A;  1B51 A;  4H8J A;  4I62 A;  4AB5 A;  4O3A A;  3RLF E;  3BBR A;  1DOT A;  4KYS A;  1B52 A;  3O66 A;  3RGY A;  4YB7 A;  4LAT A;  3QK6 A;  3OEK A;  1UTH B;  2W7Y A;  1I6B A;  3ILU B;  3IX1 A;  1AIV A;  2I4B A;  2XXV A;  5KZT A;  3S9L C;  4PQJ A;  2XX8 A;  1AH5 A;  4EXK A;  4FAT A;  4JXI A;  3KFM A;  4GQO A;  5CM6 A;  1YAE A;  2RIN A;  1B58 A;  1Y3P A;  2V93 A;  3KN3 A;  3DP6 A;  1TFD A;  3H3G A;  5AA4 B;  4FOR A;  4FE8 A;  1S50 A;  1MS7 A;  2Y84 A;  5TPA A;  1LLS A;  3KN7 A;  3CSB A;  3FIR A;  1B05 A;  1JET A;  2NXO A;  1WDN A;  2E0S A;  3TKD A;  1BIY A;  2V3U A;  3L6G A;  3TTK A;  5AA2 D;  4PE5 B;  3FJM A;  1S7Y A;  4ZE9 A;  1IUD A;  3LSF B;  1Y1Z A;  4GRK A;  3C9H A;  2FNC A;  4N6P A;  1MDQ A;  2OWS A;  1I6Q A;  1NNT A;  4OER A;  3IB2 A;  5TP9 B;  3TFL A;  3S9E A;  4N07 A;  2A5T B;  2B3B A;  4OXV A;  3M8U A;  4E0X A;  3B6T A;  4G2Z A;  2XX9 A;  1B7H A;  4LON B;  2V25 A;  1MDP 1;  4IGR A;  4WKM A;  2F7B A;  3FJG A;  3K01 A;  2HEU A;  1LCF A;  1BTJ A;  4OQO A;  3SER A;  1JW5 A;  1NH7 A;  5FTH A;  4YKI A;  3U94 A;  3DP4 A;  1RKM A;  1FCK A;  3KZG A;  4OTE A;  3UP9 A;  2GHB A;  3OEN A;  2QPQ A;  3D4G A;  1BLF A;  3OSR A;  3SDF A;  3USD A;  1P99 A;  4IY6 A;  4QFP A;  4NF6 A;  2H98 A;  4G77 A;  4F2Q A;  1LAG E;  1QUL A;  2X26 A;  4BDL A;  4ISU A;  3T9H B;  1LFI A;  4H8I A;  1SVX B;  4NMY A;  4U1O A;  4MLQ A;  4QHQ A;  3PD8 A;  4R9F A;  3MJN A;  2XHD A;  4PFW A;  1MXZ A;  5JTY A;  5L9O A;  4GFR A;  4DXC A;  2VP1 A;  3KSX A;  4YMB A;  1MXX A;  2A5S A;  1FQF A;  2RC9 A;  3DEL B;  1UTB B;  4BDO A;  4FJP A;  1HSL A;  5DVF A;  2GRV A;  2D5W A;  2VHA A;  1XVX A;  3RN8 A;  4GXA A;  1JEV A;  1VR5 A;  2XXY A;  3CFL A;  1B40 A;  2X7Q A;  3CRB A;  3M3K A;  3ODB A;  2F35 A;  4NTL A;  3HHF A;  2I6E A;  4KCD A;  1OLA A;  4YKJ A;  1ZIU A;  2I58 A;  4TLL B;  2F34 A;  3O29 A;  2DE3 A;  1MQD A;  3OO7 A;  4H0W A;  2YLN A;  1B46 A;  3O28 A;  4TLM B;  4N13 A;  4XXU A;  2VD2 A;  3CVG A;  2H9B A;  3G3H A;  3OSQ A;  1Y4T A;  4DZ1 A;  5I84 A;  3ONM A;  3WAF A;  4MLV A;  4UAC A;  2F97 A;  1MPD A;  4OHN A;  1DTG A;  4MBP A;  4OMB A;  1SDX A;  1MM7 A;  1MH4 A;  3B6W A;  2OJT A;  4ONY A;  1B3L A;  5I2N B;  3ZKK A;  5I59 A;  4KHZ E;  3SET A;  4F3S A;  3IB1 A;  1BKA A;  4NE4 A;  3T93 B;  1PEB A;  1LAF E;  4R6Y A;  5HPQ A;  2OBG A;  4F1V A;  1LFG A;  2E1S A;  3MP1 A;  5BUU A;  3FGS A;  2DYX A;  3F11 A;  1LST A;  3IOV A;  3LSW A;  3QUJ A;  4R6H A;  3C31 A;  1B4H A;  2O84 X;  5H8Q A;  3TPA A;  1LFH A;  2P2A A;  4R2F A;  1MQJ A;  3QYT A;  3UK4 A;  4ELP A;  3IO4 A;  3OD7 A;  2DSF A;  1MRP A;  3BFT A;  3R6U A;  1EU8 A;  2ZNU A;  5CMM A;  4ECF A;  1EZO A;  3IR1 A;  5JEI A;  3FJ7 A;  1NMU A;  1XHY A;  3MP6 A;  4G8N A;  4R73 A;  2YJP A;  4GXS B;  1GVC A;  4U4X A;  5B70 A;  3TAJ A;  2UVH A;  5LOM A;  3DLN A;  3U1O A;  4ZED A;  2QS3 A;  1PB8 A;  4ND9 A;  3TYH A;  3ZSF A;  2DP8 A;  2PBW A;  3OO6 A;  3SEX A;  4AB6 A;  3K2D A;  2R71 A;  4AQ4 A;  3U8Q A;  1FTO A;  1B3F A;  4RNS A;  2G93 A;  4LA9 A;  1LB8 A;  1LBB A;  2RC7 A;  5H8F A;  5ISU A;  3MVZ A;  1B6H A;  3THI A;  1PB7 A;  2AL5 A;  3IK6 B;  1NNK A;  4QSC A;  2ANJ A;  1P1O A;  2GFE A;  1IZ1 A;  2UYF A;  3C4M A;  3FVG A;  4LZ7 A;  1GTK A;  1SI0 A;  4YKK A;  3SEV A;  5I2K B;  1SW4 A;  2Q2C A;  3RTF B;  1BP5 A;  1B1H A;  3KSJ A;  3I3V A;  2XXT A;  4GLI A;  5H8H B;  1MM6 A;  1H45 A;  2UYE A;  3ZS6 A;  2XXW A;  1O7T A;  1OIB A;  4PFU A;  1A8E A;  1DSN A;  2VGQ A;  3K6V A;  3C36 A;  2QS1 A;  3PMW A;  4NF8 B;  4U2R A;  4EQ7 A;  2XD2 A;  2FA7 A;  4JWY A;  4NF5 A;  1B7Z A;  2QRY A;  3PPR A;  4LZ5 A;  5H8F B;  5I2K A;  3K6U A;  2OCU A;  4MFI A;  4DCX A;  1P1U A;  2DOJ A;  5I56 A;  4PFY A;  2DWH A;  1B3E A;  1M5B A;  4G68 C;  4LQ5 A;  1FQB A;  5L9S A;  4M4G A;  1N7W A;  2Z23 A;  1MY4 A;  3ILT B;  4KPT A;  4NF6 B;  3VXC A;  1XVY A;  1JNF A;  3H6V A;  3O6H A;  4FED A;  4QFO A;  4EF1 A;  1N3X A;  3TQW A;  1B0H A;  3H06 B;  3VDF A;  2R6G E;  1VSO A;  2IEE A;  1QUI A;  3K00 A;  4TQU Q;  1A55 A;  3T9X B;  3HO7 A;  1AL3 A;  3LSX A;  3TEP A;  2CMO A;  4ZEC A;  1ZBM A;  3S2V A;  5KDT B;  4WXJ A;  4RA1 A;  1F9B A;  1N3W A;  4HTG A;  3VLU A;  3RQT A;  4QSE A;  1HSJ A;  1GR2 A;  1A54 A;  3PV0 E;  2D21 A;  1XOC A;  3W9W A;  1ANF A;  3JV9 A;  4RPO A;  2ZYK A;  1FTM A;  2KLF A;  3MZ1 A;  4U23 A;  4ZEI A;  4XKP A;  4F3P A;  4F1Y A;  2O1M A;  1RYO A;  2HQ0 A;  3O2A A;  3IL1 B;  3HHG A;  4IO3 A;  4Q0C A;  4BLA A;  3V83 A;  4OET A;  4ZE8 A;  5DYH A;  3LSL A;  3R7X A;  2I49 A;  3KBR A;  1Q35 A;  1URS A;  4JDF A;  4QFL A;  4Z0I A;  3RPW A;  1ZKB A;  3PUZ E;  2RKM A;  4LUB A;  3RTW B;  5AA3 A;  1Y1M A;  3FV1 A;  4YB6 A;  5ICT A;  3KEI A;  3CG3 A;  3MC2 A;  1B5H A;  1Q1K A;  5H8H A;  2DQV A;  3PUW E;  1IXH A;  2WKY A;  3FXR A;  4RK2 A;  3Q25 A;  1B5J A;  3C32 A;  3FVK A;  3O6G A;  3QXM A;  3K02 A;  3OO9 A;  5CMB A;  4FIM A;  4OZ9 A;  1D9V A;  3SKP A;  3HPI A;  1IXC A;  3CFX A;  4MF3 A;  2UVJ A;  5DTB A;  3T9V A;  1N84 A;  1SW1 A;  2Z8F A;  3MUQ A;  2Y7R A;  3Q28 A;  4LQ2 A;  5AE4 A;  1XC1 A;  4C0R A;  3EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...