3ZKLA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotriose
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 143
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA02
1MY0A 1ZIUA 2QJEA 1OIBA 4XKRA 2RINA 4G8HA 3TTRA 4LONB 4DLDA 4KI0E 4OEVA 3O6GA 3BFTA 1FCKA 1MQJA 3U1OA 3KN7A 2DE3A 4HS7A 4KR5A 4ZDMA 4JXIA 1LBBA 1AOVA 2P1SA 4YICA 4F29A 1LB9A 4IO3A 1B7ZA 3U93A 1MH4A 1N7WA 5CC2A 2ONRA 5FTHA 1SW4A 2DOJA 4LQ5A 5L9SA 3FXQA 1MM7A 1UTBB 3OO6A 1ZJLA 1N76A 4G8MA 2QS4A 1PEBA 1EZOA 5DEXA 4NMYA 1N7XA 1B32A 1QW0A 1XOCA 4R9FA 1MDQA 3MJNA 3T22A 3R26A 3SEWA 3C36A 1SYIA 1POTA 2XXHA 1B46A 1A7LA 1B0LA 3RGYA 3H3GA 1UIVA 2PVUA 3FVKA 3HN0A 2ZYKA 3CSBA 1SVXB 5CMMA 4H0WA 4PFYA 3DLNA 1NNFA 4N6PA 1FQAA 2XXWA 2H98A 4BDNA 3FASA 3OELA 4H6DA 3IOUA 3IX1A 2D21A 1M5BA 4F2OA 2X26A 3U8QA 3K4UA 4KPTA 3RPWA 1POY1 1GR2A 3QIMA 4LATA 1XT8A 4GOTA 1DTGA 1MM6A 3KEIA 2DP8A 3G3IA 2E0SA 3TODA 3SKPA 2F97A 3EHTA 1ZKBA 5CBRA 3Q29A 4EXLA 4R75A 5KCJA 4DE8A 3H6TA 1B5HA 4TLMB 3U72A 1LBCA 3IO4A 5EHMA 5LOMA 3E4RA 3BBRA 1JEUA 1B05A 4GL8A 4EQBA 2F6GA 4N07A 4R74A 1A8FA 4QSCA 4DCYA 3G3HA 3PPQA 2R9JA 4NF5B 2Y7WA 4EF2A 1ATGA 3C31A 4O3AA 4IO7A 1FTJA 4G77A 3TYHA 3VV5A 3E9XA 1IITA 1S50A 3MWBA 3CI8A 4G68B 4NF8A 3FGSA 4YAHX 4F3BA 2V3QA 3B7DA 1P1QA 3UA8A 5FTIA 2DQVA 5J1DA 2Y7PA 1H44A 3CRBA 3KBRA 2VD3A 3IB1A 2XHDA 2Z23A 3HPIA 4BDLA 1LGBC 2XX7A 5EHSA 2HAVA 2Y84A 1BLFA 2RCBA 1D3KA 1Y9UA 3G7WA 3KSJA 2NOOA 1NMUA 2QRYA 2E1SA 4FATA 3JYRA 4G4PA 1M5CA 4M4GA 1SI1A 2V25A 3SEVA 5AA1A 1XC1A 4DZ1A 4H5GA 4POWA 3TAJA 3TTNA 3K2DA 1SD3A 3RQTA 3IAZA 1N84A 4LZ7A 1LSTA 4P0IA 1LAHE 4H1XA 2HAUA 2ABHA 1Y20A 1EZPA 1Y1MA 4GIZA 3GBBA 4L17A 4QHQA 4OHNA 5H8QA 1ZBMA 3ZKLA 2I6EA 2F6PA 5H8NB 3V89B 3ILTB 3LR1A 1PC3A 5H8HA 5ITOA 2DYXA 1B3HA 2H5YA 3K6VA 3UGWA 3SEYA 5I59A 3FV1A 3MP6A 4G2ZA 5A5XB 4ELPA 4H67A 3WAFA 2XD3A 3VLUA 2XXXA 4IY5A 3PMVA 5CM6A 2QL3A 2R71A 3H6VA 1B6HA 4RXLA 1YAEA 3JV9A 1MY1A 3H6WA 4PQJA 5KDTA 3M3FA 1Z7NE 2XXYA 1QUKA 4G68A 2QMXA 3CG3A 4I1DA 1DSNA 5I58A 4GQOA 4HW8A 4LA9A 3K02A 1JVYA 5IAIA 2OLBA 3IR1A 1O63A 4DCXA 2OWTA 4QFNA 5I56B 1MPBA 5CRYA 1B40A 1R1NA 4MBPA 3MVXA 3A3CA 3MVWA 3PMXA 2VHAA 3CVGA 3KG2A 1OVBA 2I49A 3OXNA 2ZYMA 3UP9A 3KZGA 3FVOA 3PGFA 1BIYA 1NL5A 2I3WA 1SBPA 3PPNA 1PBPA 3M3LA 4R73A 4F1UA 1JETA 1S9TA 1FTMA 5DEXB 1P1UA 3OEKA 3ODBA 4X9TA 2P2AA 1H3DA 2LAOA 1EU8A 1WDNA 1MPDA 4GWOA 1JNFA 2G93A 4XKPA 2I4BA 4YKPA 2P0SA 1AL3A 3UORA 2ANJA 2ONSA 4GRKA 1NH7A 2XX9A 3KJTA 3ECRA 3FJGA 4P11A 1QUIA 3HHGA 3TQWA 1NH8A 4KCDA 1A54A 2Y7IA 2VOZA 5H8NA 4ECFA 3MW0A 3T9VA 4C0RA 1PB7A 1Y4TA 1TXFA 1FQDA 1IQ7A 4XIGQ 3R6UA 4ZEKA 5CMBA 1URGA 4ZZAA 3T9HB 1MQDA 2QPQA 1FQCA 3MBPA 1US5A 3MVZA 2REGA 3FV2A 1B4ZA 3IOWA 3VVFA 4Q30B 2I0BA 3UN6A 4ZEDA 2ESNA 4U2RA 3FXRA 4R2FA 4FE8A 4TOZA 3DP6A 1FQFA 2RKMA 4F19A 1B4HA 5H8SA 2OBGA 4UA8A 3IOVA 5KCJB 1DPPA 2ZMBA 5AA4A 4YU0A 2GHBA 4FIMA 3GZGA 2RC7A 4MFIA 1B1XA 1H45A 2HFBA 5I56A 4RK9A 4I9DA 2ZYNA 2AIXA 3G3JA 3S9EA 1I6AA 3C32A 2HZLA 1NFTA 2CMOA 2XXVA 3PMWA 4IO4A 1ZTYA 4YKKA 3I5OA 4HCWA 3IL1B 2Q2CA 1HSLA 2PBWA 4H65A 3H4ZA 3TKDA 1QVSA 2X7PA 3GXAA 4QFOA 4WEPA 5TU0A 3ZKKA 2Z22A 5CBSA 2I0CA 4NE4A 1M5DA 1SDXA 2O69A 2DWIA 1VR5A 1GV8A 3LC8A 3SEUA 3DP4A 1FQEA 1B2HA 4NF8B 4JBZA 4Q5TA 2RC9A 1Y3QA 2F78A 4EDPA 4PFUA 3FXUA 3W9VA 4FEBA 1RYOA 3PUYE 5M2VA 1CE2A 2OJTA 5ITPA 5ISUA 3VE1B 4FECA 2NVUB 2DWHA 1IIWA 3HO7A 1MXZA 3TUSA 1LCTA 3IO6A 1P1OA 5JK4A 2ZNUA 1JW1A 4C1TA 4POXA 4LVQA 4DIGA 5TPAA 2F36A 2I4CA 2I3VA 3WAEA 2B65A 2OK2A 3O6HA 4M1VA 4DDDA 3Q27A 1N04A 4Z7EA 1AMFA 5H8QB 4PE5B 3UIFA 1HSEA 1P1NA 2W7YA 4F39A 2XXRA 4U4SA 5H8HB 4QFKA 5B7DA 3MVYA 4LZ8A 2Q8JA 1R6ZA 2GFEA 1HSJA 1LLSA 5I59B 5JTYA 1GVCA 1LAFE 3O66A 3DELB 3E3KA 5CMKA 3MPKA 2O1MA 3K00A 1ELJA 2D3IA 4ONYA 3RN8A 4GVOA 1UQWA 2Z8EA 4TQUQ 3GLBA 5L8DA 3MZ1A 4GFRA 5KDTB 4TLLB 3H7MA 1M5EA 2OWSA 1EZ9A 3EHUA 1WODA 3O9PA 4Z0IA 2UVIA 4NWCA 5AA2D 3OO9A 3K01A 4RYAA 5I58B 3FD3A 1MPCA 1SW1A 5FHNA 3S4UA 1OLAA 3K1MA 4R6KA 2Q89A 4OFJA 2O7UA 3SERA 3FVGA 1TFAA 3EN3A 4LZ5A 3V83A 3RY3A 4EQ9A 5DVIA 3THIA 3ZS6A 3FUZA 1O7TA 4KD5A 1A8EA 1LAXA 1T0KA 4YB6A 4XTCQ 4F3GA 1A55A 2RF1A 3KGCA 5TP9B 1B3FA 4IO6A 3Q28A 4U21A 4JSDA 3D4CA 4QSDA 1WVJA 3DP8A 4ZECA 1B51A 1RKMA 2RC8A 3PUVE 4FJPA 4ELQA 4RPOA 1LAGE 4OMBA 3CR9A 1MY2A 3M8UA 3HCQA 4QFPA 4ISUA 5I2NB 5CMCA 1OQHA 3QUFA 4JWOA 4WKMA 1B5JA 4IY6A 4EUOA 1Q1KA 3VLVA 2VD2A 2V3UA 1FTKA 1UIUA 3TELA 1SW5A 2V84A 3CFLA 1XVYA 1L5TA 3W9WA 5HM4B 3RTWB 5L9OA 4NEDA 1H76A 1SQYA 1IEJA 3K0VA 4ESXA 2PMSA 5AA2B 1A99A 4X1DA 4JB7A 1DTZA 1JW5A 3C34A 3QSLA 3KOSA 4YMBA 2F35A 3HV1A 4OQOA 3TDJA 2B3FA 3TQLA 3M3KA 1MS7A 2O1LA 3IB2A 1Y3PA 3MUQA 3LSWA 1VE4A 2PYYA 3FJMA 3MC2A 3U92A 1UTHA 1MY4A 3JZJA 2YJPA 3SESA 1MH3A 4G8NA 4DXUA 1DOTA 5DTBA 5AA4B 5JEIA 1DPEA 1B58A 1LB8A 1VFDA 1MQHA 2QS2A 1Y4CA 3T9UA 4ELOA 1B3LA 3QK6A 3L6HA 3VFJA 2NUVA 3B6TA 3HSTA 2QSXA 4YKIA 3MAMA 2F34A 4XKNA 3KSXA 4G68C 3KOTA 1M5FA 1B0HA 3PD9A 2Y7RA 1OQGA 4F1YA 1XHYA 1USYE 3H6UA 2DWAA 4MLQA 4RA1A 3C35A 5TP9A 3H03A 4KYEA 4ESWA 4U22A 1MXXA 2AL5A 4KYDA 4KQPA 3TFLA 2XXPA 3N94A 3P7IA 1B1HA 4YMAA 3TCHA 4K3FA 3PUZE 3HHFA 3FZVA 5I2NA 2QS1A 3N5LA 5DYHA 1TFDA 3RTFB 4ZS9A 2REJA 1SW2A 1XVXA 4F22A 3RNNA 3EPEA 2OCUA 3RUMA 1URSA 3PUWE 1MXVA 3TMGA 1D4NA 1QKBA 2AYSA 3TTKA 4RPNA 5FHOA 4ZEFA 2H9BA 4BLAA 4NTLA 1B52A 1B5IA 5AA2A 2X7QA 1D9VA 4JWYA 3D4GA 5H8FA 4O3CA 1LCFA 3S9NC 2A5SA 5TPAB 2XD2A 1IXCA 3RT8A 4KHZE 4R9GA 3EF7A 4OWDA 4NWDA 5ICQA 4RNSA 2F7CA 3VXCA 5DT6A 4KCCA 2Z8FA 1LFHA 2HQ0A 1NKXA 2F5XA 4ZEIA 3PPPA 5HBCA 3SEXA 1Y3NA 2HZKA 4HCYA 1JW4A 4HTGA 4E0XA 4AQ4A 2V3TA 5HPQA 2KLFA 4R6HA 3PPRA 4X48A 3KFMA 4GL0A 2DVZA 3AXFA 5JTYB 4OFOA 4KYSA 3RT6B 1B7UA 1MDP1 2Y7KA 3B6WA 4OYVA 1PDAA 1FQBA 4GF8A 3EHSA 4MH5A 1OVTA 1A40A 4GXAA 2F8DA 4Q8RA 4F18A 2IA4A 1B3GA 1I69A 4R2BA 2ZYOA 3G3GA 4FORA 1ZLQA 3T66A 1ZMGA 2RCAA 5I57A 1R9LA 4UACA 4QF9A 1FTOA 1LFGA 1FTLA 1IZ1A 1TT1A 2F7AA 3C33A 1CB6A 3PPOA 2ZXTA 2H4IA 2HEUA 2BJJX 3K1NA 4IO2A 5FHMA 5DVJA 3V5AA 1EH3A 2Q9TA 3PU5A 1B3EA 4LUBA 1QJMA 1OMPA 2QMWA 1BKAA 3T96B 4RK2A 2O68A 1JVXA 1YCJA 3CFXA 4U1OA 3T9XB 2O51A 2OZZA 2A5TB 3IJXB 1MQIA 1S7YA 1B9JA 1USYH 3OMBA 3CIJA 4YZZA 4QRZA 3OD7A 4LQ2A 3MP8A 3K6UA 4PFWA 3TCFA 4F1VA 4F2QA 3TEPA 4MF3A 1P1WA 2YPNA 3OENA 3MP1A 1AH5A 1IXGA 3E13X 1QULA 4XKQA 1GTKA 5CI5A 4WEDA 4NF6A 2XX8A 5I2KA 2GH9A 5EYFA 4PFTA 3CSGA 4JSOA 3FATA 2Q88A 5K2XA 4OFLA 2XXQA 3K6XA 4P0GA 4U4XA 2V93A 3FIRA 3W15C 3ZSFA 3LSXA 5BUUA 2UVGA 1YPNA 4GXSB 1II5A 1MRPA 2UYEA 2HCAA 3O28A 4AB6A 3VLWA 1I6QA 4OESA 1JQFA 4I62A 5F1QA 1I6BA 3O6IA 1MXYA 1Z7ME 2B3BA 5K2YA 3KN8A 4U23A 4C1UA 3LUYA 4ZE9A 2O84X 1Y1ZA 2FNCA 2NWJA 4ELRA 1NNPA 2PT2A 4PP0A 1TWYA 2DVCA 4BDQA 3C4MA 4F31B 1UTHB 2VP1A 4U1ZA 4RJZA 1UTBA 5BWJA 2AL4A 4OETA 2WKYA 4X1BA 2F7BA 4H8JA 4OVJA 2XXTA 1FW0A 4BDRA 1DMBA 3EQ1A 1N0TA 3B6QA 5IKBA 1Q35A 1F9BA 4FAJA 4BDMA 2VGQA 4DXCA 5AE4A 1PB8A 3CG1A 3K1PA 3KJ7A 2DWJA 3N6UA 1MY3A 1QUJA 2DXRA 2A5TA 4O3BA 4H8IA 3GBAA 1J1NA 4YB5A 5KZTA 3K6WA 2ZNTA 1MG1A 2O6AA 1JEVA 1QKAA 2ZNSA 2FYIA 4JDFA 4AB5A 3OEMA 4IO5A 2Z8DA 2DSFA 4WXJA 3TPAA 3BKIB 3CFZA 4F3PA 3BFUA 1IXIA 3PV0E 4QSEA 2DE2A 1NNTA 2Q2AA 3PUXE 5L9MA 1NNKA 3H06B 1YTVA 4F3SA 3USDA 3S2VA 1PBQA 4MLVA 1PB9A 2IEEA 3KN3A 2UVJA 2THIA 3A09A 5ICTA 1OLCA 2ONKE 3PD8A 1KWHA 4ZZEA 1RYXA 5H8FB 4EQ7A 1MXWA 2FA7A 4R72A 3VVDA 3LSFB 2M8CA 3LSLA 1D9YA 1B7HA 2R6GE 4NF4B 4OERA 3IOTA 2D5WA 3T93B 2H99A 4N13A 4Q0CA 4RY1A 1VFEA 3I6VA 4EF1A 4NF5A 3S9MC 2GHAA 4YB7A 5DVFA 3IK6B 4YKJA 3R7XA 2YLNA 3IORA 2PT1A 3OSQA 3OSRA 3U94A 4OXVA 4I8CA 3G3FA 4R6YA 2XXIA 3RLFE 4GLIA 1N3XA 5I84A 1URDA 2I48A 2XXUA 1SI0A 2DE4A 2H25A 4FEDA 4OENA 1O64A 1N3WA 4IGTA 3QXMA 4IGRA 3TTMA 1BP5A 2HXWA 3C9HA 3LBSA 1SYHA 3FJ7A 3TCGA 1GGGA 3I3VA 4OTEA 2UYFA 2O7IA 4IB2A 2ALUA 3Q25A 5F7VA 1ZU0A 1P99A 3QAXA 4THIA 5I57B 2QS3A 3VVEA 3IJOB 3QUJA 3S9LC 3ONMA 4PETA 3L6GA 1AIVA 3FVNA 3OOAA 3V8XB 5ELVA 3TZAA 4H5FA 1VSOA 2PX1A 3MPLA 3TTLA 5B70A 1H43A 1MQGA 1IXHA 3OO8A 4JWXA 4BDOA 4ZE8A 3MZBA 5AA3A 2UXAA 3MZ9A 1ANFA 1BTJA 3IB0A 2GRVA 4QFLA 3ILUB 3Q26A 4OEUA 3UK4A 2DXYA 1XS5A 4EXKA 2CZLA 3O29A 4ND9A 1R9QA 1MXUA 3SDFA 3G3KA 3N26A 3F11A 4DXBA 4OZ9A 4KFQA 2G29A 2UVHA 4NF4A 2DS9A 5A5XA 3DM0A 4GD5A 3VDFA 3MQ9A 4E0WA 3O2AA 4NF6B 4LP2B 2NXOA 5I2KB 2I58A 4XXUA 4ZEBA 3OO7A 1LFIA 1US4A 3QYTA 3N6TA 1IUDA 3O97A 3SETA 3VXBA 3A3UA
chains in the Genus database with same CATH superfamily
1MY0A 1ZIUA 2QJEA 1OIBA 4XKRA 2RINA 4G8HA 3TTRA 4LONB 4DLDA 4KI0E 4OEVA 3O6GA 3BFTA 5IGAA 1FCKA 1MQJA 1QGXA 3U1OA 3KN7A 2DE3A 4HS7A 4KR5A 4ZDMA 4JXIA 1LBBA 3T0JA 1AOVA 2P1SA 4YICA 4F29A 2DDKA 1LB9A 4IO3A 1B7ZA 3U93A 4GBVA 1MH4A 1N7WA 5CC2A 2ONRA 5FTHA 1SW4A 2DOJA 4LQ5A 5L9SA 3FXQA 1MM7A 1UTBB 3OO6A 1IMBA 1NUXA 1ZJLA 4GBWA 1N76A 4G8MA 2QS4A 1PEBA 1EZOA 5DEXA 4NMYA 1N7XA 1B32A 1QW0A 1XOCA 3E78A 4R9FA 1MDQA 4PTKA 3MJNA 3T22A 3R26A 3SEWA 3C36A 1SYIA 1POTA 2XXHA 4MNCA 1B46A 1A7LA 1B0LA 1AWBA 3RGYA 3H3GA 5EQ8A 2ZZVA 1UIVA 2PVUA 3ISPA 3FVKA 2L5VA 1IMEA 3HN0A 2ZYKA 3CSBA 1SVXB 5CMMA 4H0WA 4PFYA 3DLNA 4N6KA 1NNFA 4N6PA 1FQAA 1FBGA 2XXWA 2H98A 4BDNA 3FASA 3OELA 4H6DA 1YZ0A 3IOUA 3IX1A 2D21A 1M5BA 4F2OA 2X26A 3U8QA 3K4UA 4KPTA 2FIEA 1RDYA 3EKIA 4PFIA 3RPWA 1POY1 1GR2A 3QIMA 4LATA 1XT8A 4GOTA 1DTGA 1MM6A 4OVQA 3KEIA 2DP8A 3G3IA 4N15A 2E0SA 3TODA 3SKPA 2F97A 3EHTA 2FHYA 1ZKBA 5CBRA 3Q29A 4PC9A 4EXLA 4R75A 5KCJA 4DE8A 3H6TA 1B5HA 4TLMB 3U72A 1LBCA 3IO4A 5EHMA 5LOMA 3E4RA 3BBRA 1JEUA 1B05A 4GL8A 1FJ9A 1NUZA 4EQBA 2F6GA 4N07A 4R74A 1A8FA 1IMAA 4QSCA 4DCYA 3G3HA 3PPQA 1EYJA 2R9JA 4NF5B 2Y7WA 4EF2A 1ATGA 3C31A 4O3AA 4IO7A 1FTJA 4G77A 3TYHA 1FTAA 3NOHA 1YYZA 4AS4A 3VV5A 3E9XA 1IITA 1S50A 3MWBA 3CI8A 4G68B 4NF8A 3FGSA 4YAHX 4F3BA 2V3QA 3B7DA 1P1QA 3UA8A 5FTIA 2DQVA 1INPA 2Y7PA 5J1DA 3KBZA 5ET5A 1H44A 1FBCA 3LUZA 1FBFA 3CRBA 3KBRA 5I3SA 2VD3A 2OX3A 3IB1A 2XHDA 4NHBA 2Z23A 3HPIA 1NV4A 4BDLA 1LGBC 2XX7A 5EHSA 2HAVA 2Y84A 1BLFA 2RCBA 1D3KA 1EYIA 2CEXA 1Y9UA 3G7WA 3KSJA 2NOOA 1NMUA 2QRYA 2E1SA 4FATA 5ESYA 3JYRA 4G4PA 1M5CA 4M4GA 1SI1A 2V25A 3SEVA 5AA1A 3IFCA 1XC1A 4DZ1A 4H5GA 4POWA 5ET7A 3TAJA 3TTNA 3K2DA 1SD3A 3RQTA 3IAZA 1N84A 4LZ7A 1LSTA 4FBPA 4OVRA 4P0IA 1LAHE 4H1XA 2HAUA 1FBDA 2ABHA 1Y20A 1EZPA 1Y1MA 3QMFA 4GIZA 3GBBA 4L17A 4QHQA 4OHNA 5H8QA 1ZBMA 3ZKLA 2I6EA 3FBPA 2F6PA 5H8NB 3V89B 3ILTB 3LR1A 1PC3A 5H8HA 5ITOA 2DYXA 1B3HA 2H5YA 2Y5KA 3K6VA 1LBVA 3UGWA 3SEYA 5I59A 3FV1A 3MP6A 4GWSA 4G2ZA 5A5XB 1NV0A 4ELPA 4H67A 3WAFA 2XD3A 3VLUA 2XXXA 4IY5A 3PMVA 5CM6A 2QL3A 2R71A 3H6VA 4OVPA 1B6HA 4MEVA 4RXLA 1YAEA 3JV9A 1MY1A 3H6WA 2QFLA 4PQJA 5KDTA 3M3FA 1Z7NE 1NV1A 4MCOA 2XXYA 5DW8A 1QUKA 4G68A 2QMXA 3CG3A 2P3NA 4I1DA 1DSNA 5I58A 4GQOA 4HW8A 4MAGA 4LA9A 3K02A 1JVYA 5IAIA 2OLBA 3IR1A 1O63A 4DCXA 2OWTA 5ET8A 4QFNA 1K9YA 5I56B 1MPBA 4OVSA 2HXRA 4P8BA 5CRYA 5ET6A 1B40A 1R1NA 4MBPA 3MVXA 5IZ3B 3A3CA 3MVWA 1NUYA 3PMXA 2VHAA 3CVGA 3KG2A 1OVBA 1KA1A 2I49A 3OXNA 2ZYMA 3UP9A 4GWWA 3KZGA 3FVOA 3PGFA 1BIYA 1NL5A 2I3WA 1SBPA 3PPNA 1PBPA 3M3LA 4R73A 4F1UA 1JETA 3KC0A 1S9TA 2VT5A 1FTMA 5DEXB 1P1UA 3OEKA 3ODBA 4X9TA 1NV5A 1H3DA 2P2AA 1NV2A 2LAOA 1EU8A 4PFRA 1WDNA 1MPDA 4GWOA 1JNFA 2G93A 4XKPA 2I4BA 4YKPA 5LDZA 2P0SA 1AL3A 3UORA 2ANJA 2ONSA 4GRKA 1NH7A 2XX9A 4PGPA 3KJTA 3ECRA 3FJGA 1NUWA 4P11A 1QUIA 3HHGA 4P9KA 1G0IA 3TQWA 1NH8A 4KCDA 1A54A 2Y7IA 2VOZA 5H8NA 4ECFA 4PF8A 3MW0A 3T9VA 4C0RA 1PB7A 1Y4TA 1TXFA 1FQDA 1IQ7A 4XIGQ 3R6UA 2XWOA 4ZEKA 5CMBA 1URGA 4ZZAA 3T9HB 4PBHA 1MQDA 1EYKA 2QPQA 1FQCA 3MBPA 1US5A 3MVZA 2REGA 3FV2A 5I5PA 3MSTA 1B4ZA 3IOWA 3VVFA 4Q30B 2I0BA 4O94A 3UN6A 4ZEDA 2ESNA 4U2RA 2CZIA 3FXRA 4R2FA 4FE8A 4TOZA 4P56A 3DP6A 4O7MA 1FQFA 2RKMA 4F19A 1B4HA 1FJ6A 5H8SA 2ZZXA 2B4MA 2OBGA 4UA8A 3IOVA 5KCJB 1DPPA 2XA5A 2ZMBA 5AA4A 4YU0A 2ZZWA 3D1RA 2GHBA 1IMFA 1FPFA 4FIMA 3GZGA 5EYGA 5EYHA 2RC7A 4MFIA 1B1XA 1H45A 2HFBA 5I56A 4RK9A 4I9DA 2ZYNA 2AIXA 5IZ3A 3G3JA 3PTYA 3S9EA 2FIXA 1I6AA 3C32A 2HZLA 1NFTA 2CMOA 2XXVA 2KR0A 3PMWA 4IO4A 1ZTYA 4YKKA 3I5OA 4HCWA 4PDDA 1FPBA 3IL1B 2Q2CA 1HSLA 2PBWA 4H45A 4H65A 3H4ZA 3TKDA 1QVSA 2X7PA 1RDZA 3GXAA 4QFOA 4WEPA 5TU0A 3ZKKA 2Z22A 5CBSA 2I0CA 3LV0A 4NE4A 1M5DA 1SDXA 2O69A 2DWIA 1VR5A 1GV8A 3LC8A 3RYDA 3SEUA 3DP4A 1FQEA 1B2HA 4NF8B 4JBZA 1LBZA 4Q5TA 2RC9A 1Y3QA 2F78A 4EDPA 4PFUA 3FXUA 3W9VA 4FEBA 1RYOA 4PE3A 3PUYE 5M2VA 3BIGA 2VPOA 1CE2A 2OJTA 5ITPA 5ISUA 3VE1B 4FECA 2NVUB 2DWHA 1IIWA 3HO7A 1MXZA 3TUSA 1LCTA 3IO6A 1P1OA 5JK4A 2ZNUA 1JW1A 4C1TA 4POXA 3GYYA 4LVQA 3T1BA 4N91A 2WYPA 4DIGA 5TPAA 2F36A 2I4CA 2I3VA 3WAEA 2B65A 2OK2A 3O6HA 4M1VA 4DDDA 3Q27A 4N8GA 2V4CA 1N04A 4Z7EA 1AMFA 5H8QB 4PE5B 3UIFA 1HSEA 1P1NA 2W7YA 4HXVA 4F39A 2XXRA 4U4SA 2B4LA 5H8HB 2OWZA 4QFKA 3MVYA 5B7DA 4LZ8A 2Q8JA 1R6ZA 4XFEA 2GFEA 1HSJA 1LLSA 5I59B 1FPGA 4N17A 5JTYA 1GVCA 1LAFE 3O66A 3DELB 4PCDA 4PGNA 3E3KA 4GWZA 5CMKA 3MPKA 2O1MA 1CNQA 3K00A 1ELJA 2FBPA 2D3IA 4ONYA 3RN8A 2P3VA 4GVOA 1UQWA 4NN3A 2CEYA 2Z8EA 4TQUQ 3GLBA 5L8DA 3MZ1A 4GFRA 5KDTB 4TLLB 3H7MA 4XEQA 1M5EA 2OWSA 1EZ9A 3EHUA 1WODA 1JP4A 3O9PA 4Z0IA 1FPEA 2UVIA 4NWCA 5AA2D 3OO9A 3K01A 4QXDA 4RYAA 5I58B 3FD3A 1MPCA 1SW1A 5FHNA 3S4UA 1OLAA 3K1MA 4R6KA 2Q89A 4OFJA 4PAIA 2O7UA 1LBYA 3SERA 3FVGA 1TFAA 3EN3A 4LZ5A 3V83A 3RY3A 4EQ9A 5DVIA 3THIA 3ZS6A 3FUZA 1O7TA 4KD5A 1A8EA 1LAXA 1T0KA 4YB6A 4XTCQ 4F3GA 1A55A 2RF1A 1FBEA 4JVIA 3KGCA 5TP9B 1B3FA 4IO6A 3Q28A 4U21A 5A5LA 4PBQA 4JSDA 3D4CA 4QSDA 1WVJA 3DP8A 4ZECA 4P1LA 4MJOA 4GWYA 1B51A 1RKMA 4AS5A 2RC8A 3PUVE 2HHMA 4FJPA 4ELQA 4RPOA 1LAGE 4OMBA 3CR9A 1MY2A 3M8UA 4NX1A 3HCQA 4QFPA 4ISUA 4N81A 5I2NB 5CMCA 1OQHA 3QUFA 4JWOA 4WKMA 1B5JA 4IY6A 4EUOA 1Q1KA 3VLVA 2PFYA 2VD2A 2V3UA 1FTKA 1UIUA 3TELA 1SW5A 2V84A 3CFLA 1XVYA 1L5TA 3W9WA 5HM4B 3RTWB 4O7IA 5L9OA 4NEDA 1H76A 1XI6A 1SQYA 1IEJA 3K0VA 5EQ7A 4JVCA 2PMSA 4ESXA 5AA2B 1A99A 4X1DA 4JB7A 1DTZA 1JW5A 3C34A 3QSLA 3E79A 3KOSA 4YMBA 2F35A 4MHFA 4HE1A 3HV1A 2XWVA 4OQOA 1K9ZA 3TDJA 1FBPA 2B3FA 3BIHA 3TQLA 3M3KA 1MS7A 2O1LA 3IB2A 1Y3PA 4MNIA 3MUQA 3LSWA 1VE4A 2PYYA 3FJMA 3MC2A 1NV7A 3U92A 1UTHA 1MY4A 3JZJA 2YJPA 3SESA 1MH3A 4G8NA 4DXUA 1DOTA 5LTCA 5DTBA 5AA4B 5JEIA 1DPEA 1B58A 1LB8A 1VFDA 1MQHA 2QS2A 1Y4CA 2XWKA 3T9UA 4ELOA 1B3LA 3QK6A 3L6HA 3VFJA 2NUVA 3B6TA 3HSTA 2QSXA 4YKIA 3MAMA 2F34A 4XKNA 3KSXA 4G68C 3KOTA 4N6DA 1M5FA 1B0HA 3PD9A 2Y7RA 1OQGA 4F1YA 1XHYA 1USYE 2Q8MA 3H6UA 4GX4A 2DWAA 4I3EA 4MLQA 4RA1A 3C35A 5TP9A 2WBBA 3H03A 4KYEA 3A29A 4ESWA 4U22A 1MXXA 2Y5LA 2AL5A 4KYDA 4KQPA 3TFLA 2XXPA 1LEVA 3N94A 1BK4A 3P7IA 1B1HA 4O8MA 4YMAA 3TCHA 4K3FA 3PUZE 3HHFA 1IMDA 3FZVA 5I2NA 2QS1A 3N5LA 5DYHA 4DI4B 1TFDA 3RTFB 4ZS9A 1KZ8A 1SW2A 1XVXA 2REJA 4OANA 4F22A 3RNNA 5IZZA 3EPEA 2OCUA 3SZPA 3RUMA 1NI9A 1URSA 3PUWE 1MXVA 3TMGA 1D4NA 1QKBA 2AYSA 3TTKA 4RPNA 5FHOA 4ZEFA 2H9BA 4BLAA 4NTLA 1B52A 1B5IA 5AA2A 2X7QA 1D9VA 4JWYA 3D4GA 5H8FA 4O3CA 1LCFA 3S9NC 2A5SA 4I40A 1FPJA 5TPAB 2XD2A 1IXCA 3RT8A 4KHZE 4R9GA 3EF7A 4OWDA 4UABA 4NWDA 3MYUA 5ICQA 3ROJA 4RNSA 2F7CA 3VXCA 2XWIA 5DT6A 4KCCA 2Z8FA 1LFHA 1FPIA 2HQ0A 1NKXA 2F5XA 4ZEIA 3PPPA 5HBCA 3SEXA 3RPLB 1Y3NA 2HZKA 4HCYA 4JVDA 1JW4A 4HTGA 4E0XA 4AQ4A 2V3TA 5HPQA 2KLFA 4R6HA 3PPRA 4X48A 3KFMA 4GL0A 2DVZA 3AXFA 5JTYB 2PCRA 4OFOA 4KYSA 3RT6B 2CZKA 1B7UA 1MDP1 1Q9DA 2Y7KA 3B6WA 4OYVA 4GX3A 1PDAA 1FQBA 4GF8A 3EHSA 4MH5A 1OVTA 1A40A 4GXAA 4OA4A 2F8DA 4PAKA 4Q8RA 4F18A 2IA4A 1B3GA 1I69A 4R2BA 2ZYOA 4GWXA 3G3GA 4FORA 1ZLQA 1NV3A 3T66A 1ZMGA 2RCAA 5I57A 1R9LA 4NF0A 4UACA 3HFUA 4QF9A 1FTOA 1LFGA 1FTLA 1IZ1A 1TT1A 2F7AA 1YXIA 3C33A 4KXPA 1CB6A 3PPOA 2ZXTA 2H4IA 2HEUA 2BJJX 3K1NA 4IO2A 5FHMA 5DVJA 3V5AA 1EH3A 2Q9TA 1LBXA 3PU5A 1B3EA 4LUBA 1QJMA 1OMPA 2QMWA 1BKAA 3T96B 4RK2A 2O68A 1JVXA 1YCJA 3CFXA 4U1OA 3T9XB 2R8TA 2O51A 2OZZA 2A5TB 3IJXB 4N4UA 1VDWA 1MQIA 1S7YA 1B9JA 1USYH 3OMBA 3CIJA 4YZZA 4PF6A 3U65A 4QRZA 3OD7A 4LQ2A 3KC1A 3MP8A 3K6UA 4PFWA 3TCFA 4F1VA 4F2QA 3TEPA 4MF3A 1P1WA 2YPNA 3OENA 3MP1A 1AH5A 1IXGA 3E13X 1QULA 4XKQA 1GTKA 1SPIA 4XF5A 5IZ1A 5CI5A 4WEDA 4NF6A 2XX8A 5I2KA 2GH9A 5EYFA 4PFTA 3CSGA 4JSOA 3FATA 2Q88A 5K2XA 3CHGA 3RPLA 2F3BA 3B8BA 4OFLA 2XXQA 3K6XA 4P0GA 4U4XA 2V93A 3FIRA 3W15C 3ZSFA 3LSXA 5BUUA 2UVGA 1YPNA 1FBHA 1FPKA 4GXSB 1II5A 1MRPA 2UYEA 2HCAA 3O28A 4AB6A 3VLWA 1I6QA 4OESA 1JQFA 4I62A 5F1QA 4NAPA 1I6BA 2WX9A 3O6IA 5T3JA 2WYKA 1MXYA 1Z7ME 2B3BA 5K2YA 5IM2A 5I7IA 4G61A 3KN8A 4U23A 4C1UA 3LUYA 4ZE9A 2O84X 1Y1ZA 2FNCA 2NWJA 4ELRA 1NNPA 2PT2A 4PP0A 1TWYA 4X04A 2DVCA 4BDQA 3C4MA 4F31B 1UTHB 2VP1A 4MIJA 2XXKA 4U1ZA 4RJZA 1UTBA 5BWJA 2AL4A 4OETA 2WKYA 4X1BA 2F7BA 4H8JA 4OVJA 2XXTA 1FW0A 4BDRA 1DMBA 4GX6A 3EQ1A 1N0TA 3FXBA 3B6QA 5IKBA 1Q35A 1F9BA 4FAJA 4BDMA 2VGQA 4DXCA 4DI3D 5AE4A 1PB8A 1NV6A 3CG1A 3K1PA 3KJ7A 2DWJA 2HPGA 4HE2A 3N6UA 1MY3A 1QUJA 2DXRA 2A5TA 4O3BA 4H8IA 3GBAA 1KA0A 4P3LA 1J1NA 4YB5A 5KZTA 3K6WA 4NG7A 2ZNTA 1MG1A 2KQZA 2O6AA 1JEVA 3B50A 1QKAA 2ZNSA 2FYIA 4JDFA 4AB5A 3OEMA 1RDXA 4IO5A 2Z8DA 2DSFA 4WXJA 3TPAA 3BKIB 3CFZA 4F3PA 3BFUA 1IXIA 4N8YA 2WEFA 3PV0E 4QSEA 2DE2A 1NNTA 1DK4A 2Q2AA 3PUXE 5L9MA 1NNKA 4LN5A 3H06B 1YTVA 4F3SA 3USDA 4X8RA 1IMCA 3S2VA 4MMPA 1PBQA 4MLVA 1PB9A 2IEEA 3KN3A 2UVJA 2JJKA 2THIA 3A09A 4I3YA 5ICTA 2CZHA 4NGUA 4H46A 1OLCA 2ONKE 3PD8A 1KWHA 4ZZEA 4QBAA 1RYXA 5H8FB 4EQ7A 1MXWA 2VPNA 2FA7A 4R72A 3VVDA 4HE0A 3LSFB 2M8CA 4P47A 1FPDA 3LSLA 1D9YA 3IFAA 1B7HA 2R6GE 4NF4B 4OERA 3IOTA 2D5WA 2QVUA 3T93B 2H99A 4N13A 4Q0CA 4RY1A 1VFEA 3I6VA 4EF1A 4NF5A 5EQ9A 3S9MC 2GHAA 2QVVA 4YB7A 5DVFA 3IK6B 4YKJA 1D9QA 3R7XA 2YLNA 3IORA 2PT1A 3OSQA 1FRPA 3OSRA 3U94A 4OXVA 4I8CA 3G3FA 4R6YA 2XXIA 3RLFE 4GLIA 1N3XA 5I84A 1URDA 4OVTA 2I48A 2XXUA 1SI0A 2DE4A 4PDHA 2BJIA 2H25A 4FEDA 2FVZA 4OENA 1O64A 1N3WA 4IGTA 3QXMA 4IGRA 3TTMA 4NQ8A 1BP5A 4GWUA 2HXWA 5FBPA 3C9HA 3LBSA 1SYHA 3FJ7A 4PAFA 2Q74A 3TCGA 1GGGA 3I3VA 4OTEA 2UYFA 2O7IA 2F3DA 4IB2A 2ALUA 3Q25A 5F7VA 1ZU0A 1P99A 3QAXA 4THIA 1DCUA 5I57B 2QS3A 3VVEA 3IJOB 3QUJA 3S9LC 3ONMA 4PETA 3L6GA 1AIVA 3FVNA 3OOAA 3V8XB 1G0HA 5ELVA 3TZAA 4H5FA 1VSOA 2PX1A 3MPLA 5J16A 3TTLA 5EQAA 5B70A 1H43A 1MQGA 1IXHA 3OO8A 1FSAA 4JWXA 4BDOA 4ZE8A 3MZBA 5AA3A 2UXAA 3MZ9A 1ANFA 1BTJA 1DBZA 3IB0A 2GRVA 4QFLA 3ILUB 3Q26A 4OEUA 3UK4A 2DXYA 1XS5A 4EXKA 2CZLA 2QVRA 3O29A 4ND9A 1R9QA 1MXUA 3SDFA 2PFZA 2WBDA 3G3KA 1FPLA 3N26A 3F11A 4DXBA 4OZ9A 4KFQA 2G29A 4PFBA 2GQ1A 2UVHA 4NF4A 2DS9A 5A5XA 3DM0A 4GD5A 3VDFA 3MQ9A 4E0WA 3O2AA 4NF6B 4LP2B 2NXOA 5I2KB 2I58A 4XXUA 4IR8A 4ZEBA 3OO7A 4MX6A 4MNPA 2MKZA 1LFIA 1LBWA 1US4A 3QYTA 5F24A 3N6TA 4P1EA 1IUDA 3O97A 3SETA 3VXBA 3A3UA
chains in the Genus database with same CATH topology
1MY0A 1ZIUA 2QJEA 1OIBA 4XKRA 2RINA 4G8HA 3TTRA 4LONB 4DLDA 4KI0E 4OEVA 3O6GA 3BFTA 1FCKA 1MQJA 3U1OA 3KN7A 2DE3A 4HS7A 4KR5A 4ZDMA 4JXIA 1LBBA 1AOVA 2P1SA 4YICA 4F29A 1LB9A 4IO3A 1B7ZA 3U93A 1MH4A 1N7WA 5CC2A 2ONRA 5FTHA 1SW4A 2DOJA 4LQ5A 5L9SA 3FXQA 1MM7A 1UTBB 3OO6A 1ZJLA 1N76A 4G8MA 2QS4A 1PEBA 1EZOA 5DEXA 4NMYA 1N7XA 1B32A 1QW0A 1XOCA 4R9FA 1MDQA 3MJNA 3T22A 3R26A 3SEWA 3C36A 1SYIA 1POTA 2XXHA 1B46A 1A7LA 1B0LA 3RGYA 3H3GA 1UIVA 2PVUA 3FVKA 3HN0A 2ZYKA 3CSBA 1SVXB 5CMMA 4H0WA 4PFYA 3DLNA 1NNFA 4N6PA 1FQAA 2XXWA 2H98A 4BDNA 3FASA 3OELA 4H6DA 3IOUA 3IX1A 2D21A 1M5BA 4F2OA 2X26A 3U8QA 3K4UA 4KPTA 3RPWA 1POY1 1GR2A 3QIMA 4LATA 1XT8A 4GOTA 1DTGA 1MM6A 3KEIA 2DP8A 3G3IA 2E0SA 3TODA 3SKPA 2F97A 3EHTA 1ZKBA 5CBRA 3Q29A 4EXLA 4R75A 5KCJA 4DE8A 3H6TA 1B5HA 4TLMB 3U72A 1LBCA 3IO4A 5EHMA 5LOMA 3E4RA 3BBRA 1JEUA 1B05A 4GL8A 4EQBA 2F6GA 4N07A 4R74A 1A8FA 4QSCA 4DCYA 3G3HA 3PPQA 2R9JA 4NF5B 2Y7WA 4EF2A 1ATGA 3C31A 4O3AA 4IO7A 1FTJA 4G77A 3TYHA 3VV5A 3E9XA 1IITA 1S50A 3MWBA 3CI8A 4G68B 4NF8A 3FGSA 4YAHX 4F3BA 2V3QA 3B7DA 1P1QA 3UA8A 5FTIA 2DQVA 5J1DA 2Y7PA 1H44A 3CRBA 3KBRA 2VD3A 3IB1A 2XHDA 2Z23A 3HPIA 4BDLA 1LGBC 2XX7A 5EHSA 2HAVA 2Y84A 1BLFA 2RCBA 1D3KA 1Y9UA 3G7WA 3KSJA 2NOOA 1NMUA 2QRYA 2E1SA 4FATA 3JYRA 4G4PA 1M5CA 4M4GA 1SI1A 2V25A 3SEVA 5AA1A 1XC1A 4DZ1A 4H5GA 4POWA 3TAJA 3TTNA 3K2DA 1SD3A 3RQTA 3IAZA 1N84A 4LZ7A 1LSTA 4P0IA 1LAHE 4H1XA 2HAUA 2ABHA 1Y20A 1EZPA 1Y1MA 4GIZA 3GBBA 4L17A 4QHQA 4OHNA 5H8QA 1ZBMA 3ZKLA 2I6EA 2F6PA 5H8NB 3V89B 3ILTB 3LR1A 1PC3A 5H8HA 5ITOA 2DYXA 1B3HA 2H5YA 3K6VA 3UGWA 3SEYA 5I59A 3FV1A 3MP6A 4G2ZA 5A5XB 4ELPA 4H67A 3WAFA 2XD3A 3VLUA 2XXXA 4IY5A 3PMVA 5CM6A 2QL3A 2R71A 3H6VA 1B6HA 4RXLA 1YAEA 3JV9A 1MY1A 3H6WA 4PQJA 5KDTA 3M3FA 1Z7NE 2XXYA 1QUKA 4G68A 2QMXA 3CG3A 4I1DA 1DSNA 5I58A 4GQOA 4HW8A 4LA9A 3K02A 1JVYA 5IAIA 2OLBA 3IR1A 1O63A 4DCXA 2OWTA 4QFNA 5I56B 1MPBA 5CRYA 1B40A 1R1NA 4MBPA 3MVXA 3A3CA 3MVWA 3PMXA 2VHAA 3CVGA 3KG2A 1OVBA 2I49A 3OXNA 2ZYMA 3UP9A 3KZGA 3FVOA 3PGFA 1BIYA 1NL5A 2I3WA 1SBPA 3PPNA 1PBPA 3M3LA 4R73A 4F1UA 1JETA 1S9TA 1FTMA 5DEXB 1P1UA 3OEKA 3ODBA 4X9TA 2P2AA 1H3DA 2LAOA 1EU8A 1WDNA 1MPDA 4GWOA 1JNFA 2G93A 4XKPA 2I4BA 4YKPA 2P0SA 1AL3A 3UORA 2ANJA 2ONSA 4GRKA 1NH7A 2XX9A 3KJTA 3ECRA 3FJGA 4P11A 1QUIA 3HHGA 3TQWA 1NH8A 4KCDA 1A54A 2Y7IA 2VOZA 5H8NA 4ECFA 3MW0A 3T9VA 4C0RA 1PB7A 1Y4TA 1TXFA 1FQDA 1IQ7A 4XIGQ 3R6UA 4ZEKA 5CMBA 1URGA 4ZZAA 3T9HB 1MQDA 2QPQA 1FQCA 3MBPA 1US5A 3MVZA 2REGA 3FV2A 1B4ZA 3IOWA 3VVFA 4Q30B 2I0BA 3UN6A 4ZEDA 2ESNA 4U2RA 3FXRA 4R2FA 4FE8A 4TOZA 3DP6A 1FQFA 2RKMA 4F19A 1B4HA 5H8SA 2OBGA 4UA8A 3IOVA 5KCJB 1DPPA 2ZMBA 5AA4A 4YU0A 2GHBA 4FIMA 3GZGA 2RC7A 4MFIA 1B1XA 1H45A 2HFBA 5I56A 4RK9A 4I9DA 2ZYNA 2AIXA 3G3JA 3S9EA 1I6AA 3C32A 2HZLA 1NFTA 2CMOA 2XXVA 3PMWA 4IO4A 1ZTYA 4YKKA 3I5OA 4HCWA 3IL1B 2Q2CA 1HSLA 2PBWA 4H65A 3H4ZA 3TKDA 1QVSA 2X7PA 3GXAA 4QFOA 4WEPA 5TU0A 3ZKKA 2Z22A 5CBSA 2I0CA 4NE4A 1M5DA 1SDXA 2O69A 2DWIA 1VR5A 1GV8A 3LC8A 3SEUA 3DP4A 1FQEA 1B2HA 4NF8B 4JBZA 4Q5TA 2RC9A 1Y3QA 2F78A 4EDPA 4PFUA 3FXUA 3W9VA 4FEBA 1RYOA 3PUYE 5M2VA 1CE2A 2OJTA 5ITPA 5ISUA 3VE1B 4FECA 2NVUB 2DWHA 1IIWA 3HO7A 1MXZA 3TUSA 1LCTA 3IO6A 1P1OA 5JK4A 2ZNUA 1JW1A 4C1TA 4POXA 4LVQA 4DIGA 5TPAA 2F36A 2I4CA 2I3VA 3WAEA 2B65A 2OK2A 3O6HA 4M1VA 4DDDA 3Q27A 1N04A 4Z7EA 1AMFA 5H8QB 4PE5B 3UIFA 1HSEA 1P1NA 2W7YA 4F39A 2XXRA 4U4SA 5H8HB 4QFKA 5B7DA 3MVYA 4LZ8A 2Q8JA 1R6ZA 2GFEA 1HSJA 1LLSA 5I59B 5JTYA 1GVCA 1LAFE 3O66A 3DELB 3E3KA 5CMKA 3MPKA 2O1MA 3K00A 1ELJA 2D3IA 4ONYA 3RN8A 4GVOA 1UQWA 2Z8EA 4TQUQ 3GLBA 5L8DA 3MZ1A 4GFRA 5KDTB 4TLLB 3H7MA 1M5EA 2OWSA 1EZ9A 3EHUA 1WODA 3O9PA 4Z0IA 2UVIA 4NWCA 5AA2D 3OO9A 3K01A 4RYAA 5I58B 3FD3A 1MPCA 1SW1A 5FHNA 3S4UA 1OLAA 3K1MA 4R6KA 2Q89A 4OFJA 2O7UA 3SERA 3FVGA 1TFAA 3EN3A 4LZ5A 3V83A 3RY3A 4EQ9A 5DVIA 3THIA 3ZS6A 3FUZA 1O7TA 4KD5A 1A8EA 1LAXA 1T0KA 4YB6A 4XTCQ 4F3GA 1A55A 2RF1A 3KGCA 5TP9B 1B3FA 4IO6A 3Q28A 4U21A 4JSDA 3D4CA 4QSDA 1WVJA 3DP8A 4ZECA 1B51A 1RKMA 2RC8A 3PUVE 4FJPA 4ELQA 4RPOA 1LAGE 4OMBA 3CR9A 1MY2A 3M8UA 3HCQA 4QFPA 4ISUA 5I2NB 5CMCA 1OQHA 3QUFA 4JWOA 4WKMA 1B5JA 4IY6A 4EUOA 1Q1KA 3VLVA 2VD2A 2V3UA 1FTKA 1UIUA 3TELA 1SW5A 2V84A 3CFLA 1XVYA 1L5TA 3W9WA 5HM4B 3RTWB 5L9OA 4NEDA 1H76A 1SQYA 1IEJA 3K0VA 4ESXA 2PMSA 5AA2B 1A99A 4X1DA 4JB7A 1DTZA 1JW5A 3C34A 3QSLA 3KOSA 4YMBA 2F35A 3HV1A 4OQOA 3TDJA 2B3FA 3TQLA 3M3KA 1MS7A 2O1LA 3IB2A 1Y3PA 3MUQA 3LSWA 1VE4A 2PYYA 3FJMA 3MC2A 3U92A 1UTHA 1MY4A 3JZJA 2YJPA 3SESA 1MH3A 4G8NA 4DXUA 1DOTA 5DTBA 5AA4B 5JEIA 1DPEA 1B58A 1LB8A 1VFDA 1MQHA 2QS2A 1Y4CA 3T9UA 4ELOA 1B3LA 3QK6A 3L6HA 3VFJA 2NUVA 3B6TA 3HSTA 2QSXA 4YKIA 3MAMA 2F34A 4XKNA 3KSXA 4G68C 3KOTA 1M5FA 1B0HA 3PD9A 2Y7RA 1OQGA 4F1YA 1XHYA 1USYE 3H6UA 2DWAA 4MLQA 4RA1A 3C35A 5TP9A 3H03A 4KYEA 4ESWA 4U22A 1MXXA 2AL5A 4KYDA 4KQPA 3TFLA 2XXPA 3N94A 3P7IA 1B1HA 4YMAA 3TCHA 4K3FA 3PUZE 3HHFA 3FZVA 5I2NA 2QS1A 3N5LA 5DYHA 1TFDA 3RTFB 4ZS9A 2REJA 1SW2A 1XVXA 4F22A 3RNNA 3EPEA 2OCUA 3RUMA 1URSA 3PUWE 1MXVA 3TMGA 1D4NA 1QKBA 2AYSA 3TTKA 4RPNA 5FHOA 4ZEFA 2H9BA 4BLAA 4NTLA 1B52A 1B5IA 5AA2A 2X7QA 1D9VA 4JWYA 3D4GA 5H8FA 4O3CA 1LCFA 3S9NC 2A5SA 5TPAB 2XD2A 1IXCA 3RT8A 4KHZE 4R9GA 3EF7A 4OWDA 4NWDA 5ICQA 4RNSA 2F7CA 3VXCA 5DT6A 4KCCA 2Z8FA 1LFHA 2HQ0A 1NKXA 2F5XA 4ZEIA 3PPPA 5HBCA 3SEXA 1Y3NA 2HZKA 4HCYA 1JW4A 4HTGA 4E0XA 4AQ4A 2V3TA 5HPQA 2KLFA 4R6HA 3PPRA 4X48A 3KFMA 4GL0A 2DVZA 3AXFA 5JTYB 4OFOA 4KYSA 3RT6B 1B7UA 1MDP1 2Y7KA 3B6WA 4OYVA 1PDAA 1FQBA 4GF8A 3EHSA 4MH5A 1OVTA 1A40A 4GXAA 2F8DA 4Q8RA 4F18A 2IA4A 1B3GA 1I69A 4R2BA 2ZYOA 3G3GA 4FORA 1ZLQA 3T66A 1ZMGA 2RCAA 5I57A 1R9LA 4UACA 4QF9A 1FTOA 1LFGA 1FTLA 1IZ1A 1TT1A 2F7AA 3C33A 1CB6A 3PPOA 2ZXTA 2H4IA 2HEUA 2BJJX 3K1NA 4IO2A 5FHMA 5DVJA 3V5AA 1EH3A 2Q9TA 3PU5A 1B3EA 4LUBA 1QJMA 1OMPA 2QMWA 1BKAA 3T96B 4RK2A 2O68A 1JVXA 1YCJA 3CFXA 4U1OA 3T9XB 2O51A 2OZZA 2A5TB 3IJXB 1MQIA 1S7YA 1B9JA 1USYH 3OMBA 3CIJA 4YZZA 4QRZA 3OD7A 4LQ2A 3MP8A 3K6UA 4PFWA 3TCFA 4F1VA 4F2QA 3TEPA 4MF3A 1P1WA 2YPNA 3OENA 3MP1A 1AH5A 1IXGA 3E13X 1QULA 4XKQA 1GTKA 5CI5A 4WEDA 4NF6A 2XX8A 5I2KA 2GH9A 5EYFA 4PFTA 3CSGA 4JSOA 3FATA 2Q88A 5K2XA 4OFLA 2XXQA 3K6XA 4P0GA 4U4XA 2V93A 3FIRA 3W15C 3ZSFA 3LSXA 5BUUA 2UVGA 1YPNA 4GXSB 1II5A 1MRPA 2UYEA 2HCAA 3O28A 4AB6A 3VLWA 1I6QA 4OESA 1JQFA 4I62A 5F1QA 1I6BA 3O6IA 1MXYA 1Z7ME 2B3BA 5K2YA 3KN8A 4U23A 4C1UA 3LUYA 4ZE9A 2O84X 1Y1ZA 2FNCA 2NWJA 4ELRA 1NNPA 2PT2A 4PP0A 1TWYA 2DVCA 4BDQA 3C4MA 4F31B 1UTHB 2VP1A 4U1ZA 4RJZA 1UTBA 5BWJA 2AL4A 4OETA 2WKYA 4X1BA 2F7BA 4H8JA 4OVJA 2XXTA 1FW0A 4BDRA 1DMBA 3EQ1A 1N0TA 3B6QA 5IKBA 1Q35A 1F9BA 4FAJA 4BDMA 2VGQA 4DXCA 5AE4A 1PB8A 3CG1A 3K1PA 3KJ7A 2DWJA 3N6UA 1MY3A 1QUJA 2DXRA 2A5TA 4O3BA 4H8IA 3GBAA 1J1NA 4YB5A 5KZTA 3K6WA 2ZNTA 1MG1A 2O6AA 1JEVA 1QKAA 2ZNSA 2FYIA 4JDFA 4AB5A 3OEMA 4IO5A 2Z8DA 2DSFA 4WXJA 3TPAA 3BKIB 3CFZA 4F3PA 3BFUA 1IXIA 3PV0E 4QSEA 2DE2A 1NNTA 2Q2AA 3PUXE 5L9MA 1NNKA 3H06B 1YTVA 4F3SA 3USDA 3S2VA 1PBQA 4MLVA 1PB9A 2IEEA 3KN3A 2UVJA 2THIA 3A09A 5ICTA 1OLCA 2ONKE 3PD8A 1KWHA 4ZZEA 1RYXA 5H8FB 4EQ7A 1MXWA 2FA7A 4R72A 3VVDA 3LSFB 2M8CA 3LSLA 1D9YA 1B7HA 2R6GE 4NF4B 4OERA 3IOTA 2D5WA 3T93B 2H99A 4N13A 4Q0CA 4RY1A 1VFEA 3I6VA 4EF1A 4NF5A 3S9MC 2GHAA 4YB7A 5DVFA 3IK6B 4YKJA 3R7XA 2YLNA 3IORA 2PT1A 3OSQA 3OSRA 3U94A 4OXVA 4I8CA 3G3FA 4R6YA 2XXIA 3RLFE 4GLIA 1N3XA 5I84A 1URDA 2I48A 2XXUA 1SI0A 2DE4A 2H25A 4FEDA 4OENA 1O64A 1N3WA 4IGTA 3QXMA 4IGRA 3TTMA 1BP5A 2HXWA 3C9HA 3LBSA 1SYHA 3FJ7A 3TCGA 1GGGA 3I3VA 4OTEA 2UYFA 2O7IA 4IB2A 2ALUA 3Q25A 5F7VA 1ZU0A 1P99A 3QAXA 4THIA 5I57B 2QS3A 3VVEA 3IJOB 3QUJA 3S9LC 3ONMA 4PETA 3L6GA 1AIVA 3FVNA 3OOAA 3V8XB 5ELVA 3TZAA 4H5FA 1VSOA 2PX1A 3MPLA 3TTLA 5B70A 1H43A 1MQGA 1IXHA 3OO8A 4JWXA 4BDOA 4ZE8A 3MZBA 5AA3A 2UXAA 3MZ9A 1ANFA 1BTJA 3IB0A 2GRVA 4QFLA 3ILUB 3Q26A 4OEUA 3UK4A 2DXYA 1XS5A 4EXKA 2CZLA 3O29A 4ND9A 1R9QA 1MXUA 3SDFA 3G3KA 3N26A 3F11A 4DXBA 4OZ9A 4KFQA 2G29A 2UVHA 4NF4A 2DS9A 5A5XA 3DM0A 4GD5A 3VDFA 3MQ9A 4E0WA 3O2AA 4NF6B 4LP2B 2NXOA 5I2KB 2I58A 4XXUA 4ZEBA 3OO7A 1LFIA 1US4A 3QYTA 3N6TA 1IUDA 3O97A 3SETA 3VXBA 3A3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MY0 A;  1ZIU A;  2QJE A;  1OIB A;  4XKR A;  2RIN A;  4G8H A;  3TTR A;  4LON B;  4DLD A;  4KI0 E;  4OEV A;  3O6G A;  3BFT A;  1FCK A;  1MQJ A;  3U1O A;  3KN7 A;  2DE3 A;  4HS7 A;  4KR5 A;  4ZDM A;  4JXI A;  1LBB A;  1AOV A;  2P1S A;  4YIC A;  4F29 A;  1LB9 A;  4IO3 A;  1B7Z A;  3U93 A;  1MH4 A;  1N7W A;  5CC2 A;  2ONR A;  5FTH A;  1SW4 A;  2DOJ A;  4LQ5 A;  5L9S A;  3FXQ A;  1MM7 A;  1UTB B;  3OO6 A;  1ZJL A;  1N76 A;  4G8M A;  2QS4 A;  1PEB A;  1EZO A;  5DEX A;  4NMY A;  1N7X A;  1B32 A;  1QW0 A;  1XOC A;  4R9F A;  1MDQ A;  3MJN A;  3T22 A;  3R26 A;  3SEW A;  3C36 A;  1SYI A;  1POT A;  2XXH A;  1B46 A;  1A7L A;  1B0L A;  3RGY A;  3H3G A;  1UIV A;  2PVU A;  3FVK A;  3HN0 A;  2ZYK A;  3CSB A;  1SVX B;  5CMM A;  4H0W A;  4PFY A;  3DLN A;  1NNF A;  4N6P A;  1FQA A;  2XXW A;  2H98 A;  4BDN A;  3FAS A;  3OEL A;  4H6D A;  3IOU A;  3IX1 A;  2D21 A;  1M5B A;  4F2O A;  2X26 A;  3U8Q A;  3K4U A;  4KPT A;  3RPW A;  1POY 1;  1GR2 A;  3QIM A;  4LAT A;  1XT8 A;  4GOT A;  1DTG A;  1MM6 A;  3KEI A;  2DP8 A;  3G3I A;  2E0S A;  3TOD A;  3SKP A;  2F97 A;  3EHT A;  1ZKB A;  5CBR A;  3Q29 A;  4EXL A;  4R75 A;  5KCJ A;  4DE8 A;  3H6T A;  1B5H A;  4TLM B;  3U72 A;  1LBC A;  3IO4 A;  5EHM A;  5LOM A;  3E4R A;  3BBR A;  1JEU A;  1B05 A;  4GL8 A;  4EQB A;  2F6G A;  4N07 A;  4R74 A;  1A8F A;  4QSC A;  4DCY A;  3G3H A;  3PPQ A;  2R9J A;  4NF5 B;  2Y7W A;  4EF2 A;  1ATG A;  3C31 A;  4O3A A;  4IO7 A;  1FTJ A;  4G77 A;  3TYH A;  3VV5 A;  3E9X A;  1IIT A;  1S50 A;  3MWB A;  3CI8 A;  4G68 B;  4NF8 A;  3FGS A;  4YAH X;  4F3B A;  2V3Q A;  3B7D A;  1P1Q A;  3UA8 A;  5FTI A;  2DQV A;  5J1D A;  2Y7P A;  1H44 A;  3CRB A;  3KBR A;  2VD3 A;  3IB1 A;  2XHD A;  2Z23 A;  3HPI A;  4BDL A;  1LGB C;  2XX7 A;  5EHS A;  2HAV A;  2Y84 A;  1BLF A;  2RCB A;  1D3K A;  1Y9U A;  3G7W A;  3KSJ A;  2NOO A;  1NMU A;  2QRY A;  2E1S A;  4FAT A;  3JYR A;  4G4P A;  1M5C A;  4M4G A;  1SI1 A;  2V25 A;  3SEV A;  5AA1 A;  1XC1 A;  4DZ1 A;  4H5G A;  4POW A;  3TAJ A;  3TTN A;  3K2D A;  1SD3 A;  3RQT A;  3IAZ A;  1N84 A;  4LZ7 A;  1LST A;  4P0I A;  1LAH E;  4H1X A;  2HAU A;  2ABH A;  1Y20 A;  1EZP A;  1Y1M A;  4GIZ A;  3GBB A;  4L17 A;  4QHQ A;  4OHN A;  5H8Q A;  1ZBM A;  3ZKL A;  2I6E A;  2F6P A;  5H8N B;  3V89 B;  3ILT B;  3LR1 A;  1PC3 A;  5H8H A;  5ITO A;  2DYX A;  1B3H A;  2H5Y A;  3K6V A;  3UGW A;  3SEY A;  5I59 A;  3FV1 A;  3MP6 A;  4G2Z A;  5A5X B;  4ELP A;  4H67 A;  3WAF A;  2XD3 A;  3VLU A;  2XXX A;  4IY5 A;  3PMV A;  5CM6 A;  2QL3 A;  2R71 A;  3H6V A;  1B6H A;  4RXL A;  1YAE A;  3JV9 A;  1MY1 A;  3H6W A;  4PQJ A;  5KDT A;  3M3F A;  1Z7N E;  2XXY A;  1QUK A;  4G68 A;  2QMX A;  3CG3 A;  4I1D A;  1DSN A;  5I58 A;  4GQO A;  4HW8 A;  4LA9 A;  3K02 A;  1JVY A;  5IAI A;  2OLB A;  3IR1 A;  1O63 A;  4DCX A;  2OWT A;  4QFN A;  5I56 B;  1MPB A;  5CRY A;  1B40 A;  1R1N A;  4MBP A;  3MVX A;  3A3C A;  3MVW A;  3PMX A;  2VHA A;  3CVG A;  3KG2 A;  1OVB A;  2I49 A;  3OXN A;  2ZYM A;  3UP9 A;  3KZG A;  3FVO A;  3PGF A;  1BIY A;  1NL5 A;  2I3W A;  1SBP A;  3PPN A;  1PBP A;  3M3L A;  4R73 A;  4F1U A;  1JET A;  1S9T A;  1FTM A;  5DEX B;  1P1U A;  3OEK A;  3ODB A;  4X9T A;  2P2A A;  1H3D A;  2LAO A;  1EU8 A;  1WDN A;  1MPD A;  4GWO A;  1JNF A;  2G93 A;  4XKP A;  2I4B A;  4YKP A;  2P0S A;  1AL3 A;  3UOR A;  2ANJ A;  2ONS A;  4GRK A;  1NH7 A;  2XX9 A;  3KJT A;  3ECR A;  3FJG A;  4P11 A;  1QUI A;  3HHG A;  3TQW A;  1NH8 A;  4KCD A;  1A54 A;  2Y7I A;  2VOZ A;  5H8N A;  4ECF A;  3MW0 A;  3T9V A;  4C0R A;  1PB7 A;  1Y4T A;  1TXF A;  1FQD A;  1IQ7 A;  4XIG Q;  3R6U A;  4ZEK A;  5CMB A;  1URG A;  4ZZA A;  3T9H B;  1MQD A;  2QPQ A;  1FQC A;  3MBP A;  1US5 A;  3MVZ A;  2REG A;  3FV2 A;  1B4Z A;  3IOW A;  3VVF A;  4Q30 B;  2I0B A;  3UN6 A;  4ZED A;  2ESN A;  4U2R A;  3FXR A;  4R2F A;  4FE8 A;  4TOZ A;  3DP6 A;  1FQF A;  2RKM A;  4F19 A;  1B4H A;  5H8S A;  2OBG A;  4UA8 A;  3IOV A;  5KCJ B;  1DPP A;  2ZMB A;  5AA4 A;  4YU0 A;  2GHB A;  4FIM A;  3GZG A;  2RC7 A;  4MFI A;  1B1X A;  1H45 A;  2HFB A;  5I56 A;  4RK9 A;  4I9D A;  2ZYN A;  2AIX A;  3G3J A;  3S9E A;  1I6A A;  3C32 A;  2HZL A;  1NFT A;  2CMO A;  2XXV A;  3PMW A;  4IO4 A;  1ZTY A;  4YKK A;  3I5O A;  4HCW A;  3IL1 B;  2Q2C A;  1HSL A;  2PBW A;  4H65 A;  3H4Z A;  3TKD A;  1QVS A;  2X7P A;  3GXA A;  4QFO A;  4WEP A;  5TU0 A;  3ZKK A;  2Z22 A;  5CBS A;  2I0C A;  4NE4 A;  1M5D A;  1SDX A;  2O69 A;  2DWI A;  1VR5 A;  1GV8 A;  3LC8 A;  3SEU A;  3DP4 A;  1FQE A;  1B2H A;  4NF8 B;  4JBZ A;  4Q5T A;  2RC9 A;  1Y3Q A;  2F78 A;  4EDP A;  4PFU A;  3FXU A;  3W9V A;  4FEB A;  1RYO A;  3PUY E;  5M2V A;  1CE2 A;  2OJT A;  5ITP A;  5ISU A;  3VE1 B;  4FEC A;  2NVU B;  2DWH A;  1IIW A;  3HO7 A;  1MXZ A;  3TUS A;  1LCT A;  3IO6 A;  1P1O A;  5JK4 A;  2ZNU A;  1JW1 A;  4C1T A;  4POX A;  4LVQ A;  4DIG A;  5TPA A;  2F36 A;  2I4C A;  2I3V A;  3WAE A;  2B65 A;  2OK2 A;  3O6H A;  4M1V A;  4DDD A;  3Q27 A;  1N04 A;  4Z7E A;  1AMF A;  5H8Q B;  4PE5 B;  3UIF A;  1HSE A;  1P1N A;  2W7Y A;  4F39 A;  2XXR A;  4U4S A;  5H8H B;  4QFK A;  5B7D A;  3MVY A;  4LZ8 A;  2Q8J A;  1R6Z A;  2GFE A;  1HSJ A;  1LLS A;  5I59 B;  5JTY A;  1GVC A;  1LAF E;  3O66 A;  3DEL B;  3E3K A;  5CMK A;  3MPK A;  2O1M A;  3K00 A;  1ELJ A;  2D3I A;  4ONY A;  3RN8 A;  4GVO A;  1UQW A;  2Z8E A;  4TQU Q;  3GLB A;  5L8D A;  3MZ1 A;  4GFR A;  5KDT B;  4TLL B;  3H7M A;  1M5E A;  2OWS A;  1EZ9 A;  3EHU A;  1WOD A;  3O9P A;  4Z0I A;  2UVI A;  4NWC A;  5AA2 D;  3OO9 A;  3K01 A;  4RYA A;  5I58 B;  3FD3 A;  1MPC A;  1SW1 A;  5FHN A;  3S4U A;  1OLA A;  3K1M A;  4R6K A;  2Q89 A;  4OFJ A;  2O7U A;  3SER A;  3FVG A;  1TFA A;  3EN3 A;  4LZ5 A;  3V83 A;  3RY3 A;  4EQ9 A;  5DVI A;  3THI A;  3ZS6 A;  3FUZ A;  1O7T A;  4KD5 A;  1A8E A;  1LAX A;  1T0K A;  4YB6 A;  4XTC Q;  4F3G A;  1A55 A;  2RF1 A;  3KGC A;  5TP9 B;  1B3F A;  4IO6 A;  3Q28 A;  4U21 A;  4JSD A;  3D4C A;  4QSD A;  1WVJ A;  3DP8 A;  4ZEC A;  1B51 A;  1RKM A;  2RC8 A;  3PUV E;  4FJP A;  4ELQ A;  4RPO A;  1LAG E;  4OMB A;  3CR9 A;  1MY2 A;  3M8U A;  3HCQ A;  4QFP A;  4ISU A;  5I2N B;  5CMC A;  1OQH A;  3QUF A;  4JWO A;  4WKM A;  1B5J A;  4IY6 A;  4EUO A;  1Q1K A;  3VLV A;  2VD2 A;  2V3U A;  1FTK A;  1UIU A;  3TEL A;  1SW5 A;  2V84 A;  3CFL A;  1XVY A;  1L5T A;  3W9W A;  5HM4 B;  3RTW B;  5L9O A;  4NED A;  1H76 A;  1SQY A;  1IEJ A;  3K0V A;  4ESX A;  2PMS A;  5AA2 B;  1A99 A;  4X1D A;  4JB7 A;  1DTZ A;  1JW5 A;  3C34 A;  3QSL A;  3KOS A;  4YMB A;  2F35 A;  3HV1 A;  4OQO A;  3TDJ A;  2B3F A;  3TQL A;  3M3K A;  1MS7 A;  2O1L A;  3IB2 A;  1Y3P A;  3MUQ A;  3LSW A;  1VE4 A;  2PYY A;  3FJM A;  3MC2 A;  3U92 A;  1UTH A;  1MY4 A;  3JZJ A;  2YJP A;  3SES A;  1MH3 A;  4G8N A;  4DXU A;  1DOT A;  5DTB A;  5AA4 B;  5JEI A;  1DPE A;  1B58 A;  1LB8 A;  1VFD A;  1MQH A;  2QS2 A;  1Y4C A;  3T9U A;  4ELO A;  1B3L A;  3QK6 A;  3L6H A;  3VFJ A;  2NUV A;  3B6T A;  3HST A;  2QSX A;  4YKI A;  3MAM A;  2F34 A;  4XKN A;  3KSX A;  4G68 C;  3KOT A;  1M5F A;  1B0H A;  3PD9 A;  2Y7R A;  1OQG A;  4F1Y A;  1XHY A;  1USY E;  3H6U A;  2DWA A;  4MLQ A;  4RA1 A;  3C35 A;  5TP9 A;  3H03 A;  4KYE A;  4ESW A;  4U22 A;  1MXX A;  2AL5 A;  4KYD A;  4KQP A;  3TFL A;  2XXP A;  3N94 A;  3P7I A;  1B1H A;  4YMA A;  3TCH A;  4K3F A;  3PUZ E;  3HHF A;  3FZV A;  5I2N A;  2QS1 A;  3N5L A;  5DYH A;  1TFD A;  3RTF B;  4ZS9 A;  2REJ A;  1SW2 A;  1XVX A;  4F22 A;  3RNN A;  3EPE A;  2OCU A;  3RUM A;  1URS A;  3PUW E;  1MXV A;  3TMG A;  1D4N A;  1QKB A;  2AYS A;  3TTK A;  4RPN A;  5FHO A;  4ZEF A;  2H9B A;  4BLA A;  4NTL A;  1B52 A;  1B5I A;  5AA2 A;  2X7Q A;  1D9V A;  4JWY A;  3D4G A;  5H8F A;  4O3C A;  1LCF A;  3S9N C;  2A5S A;  5TPA B;  2XD2 A;  1IXC A;  3RT8 A;  4KHZ E;  4R9G A;  3EF7 A;  4OWD A;  4NWD A;  5ICQ A;  4RNS A;  2F7C A;  3VXC A;  5DT6 A;  4KCC A;  2Z8F A;  1LFH A;  2HQ0 A;  1NKX A;  2F5X A;  4ZEI A;  3PPP A;  5HBC A;  3SEX A;  1Y3N A;  2HZK A;  4HCY A;  1JW4 A;  4HTG A;  4E0X A;  4AQ4 A;  2V3T A;  5HPQ A;  2KLF A;  4R6H A;  3PPR A;  4X48 A;  3KFM A;  4GL0 A;  2DVZ A;  3AXF A;  5JTY B;  4OFO A;  4KYS A;  3RT6 B;  1B7U A;  1MDP 1;  2Y7K A;  3B6W A;  4OYV A;  1PDA A;  1FQB A;  4GF8 A;  3EHS A;  4MH5 A;  1OVT A;  1A40 A;  4GXA A;  2F8D A;  4Q8R A;  4F18 A;  2IA4 A;  1B3G A;  1I69 A;  4R2B A;  2ZYO A;  3G3G A;  4FOR A;  1ZLQ A;  3T66 A;  1ZMG A;  2RCA A;  5I57 A;  1R9L A;  4UAC A;  4QF9 A;  1FTO A;  1LFG A;  1FTL A;  1IZ1 A;  1TT1 A;  2F7A A;  3C33 A;  1CB6 A;  3PPO A;  2ZXT A;  2H4I A;  2HEU A;  2BJJ X;  3K1N A;  4IO2 A;  5FHM A;  5DVJ A;  3V5A A;  1EH3 A;  2Q9T A;  3PU5 A;  1B3E A;  4LUB A;  1QJM A;  1OMP A;  2QMW A;  1BKA A;  3T96 B;  4RK2 A;  2O68 A;  1JVX A;  1YCJ A;  3CFX A;  4U1O A;  3T9X B;  2O51 A;  2OZZ A;  2A5T B;  3IJX B;  1MQI A;  1S7Y A;  1B9J A;  1USY H;  3OMB A;  3CIJ A;  4YZZ A;  4QRZ A;  3OD7 A;  4LQ2 A;  3MP8 A;  3K6U A;  4PFW A;  3TCF A;  4F1V A;  4F2Q A;  3TEP A;  4MF3 A;  1P1W A;  2YPN A;  3OEN A;  3MP1 A;  1AH5 A;  1IXG A;  3E13 X;  1QUL A;  4XKQ A;  1GTK A;  5CI5 A;  4WED A;  4NF6 A;  2XX8 A;  5I2K A;  2GH9 A;  5EYF A;  4PFT A;  3CSG A;  4JSO A;  3FAT A;  2Q88 A;  5K2X A;  4OFL A;  2XXQ A;  3K6X A;  4P0G A;  4U4X A;  2V93 A;  3FIR A;  3W15 C;  3ZSF A;  3LSX A;  5BUU A;  2UVG A;  1YPN A;  4GXS B;  1II5 A;  1MRP A;  2UYE A;  2HCA A;  3O28 A;  4AB6 A;  3VLW A;  1I6Q A;  4OES A;  1JQF A;  4I62 A;  5F1Q A;  1I6B A;  3O6I A;  1MXY A;  1Z7M E;  2B3B A;  5K2Y A;  3KN8 A;  4U23 A;  4C1U A;  3LUY A;  4ZE9 A;  2O84 X;  1Y1Z A;  2FNC A;  2NWJ A;  4ELR A;  1NNP A;  2PT2 A;  4PP0 A;  1TWY A;  2DVC A;  4BDQ A;  3C4M A;  4F31 B;  1UTH B;  2VP1 A;  4U1Z A;  4RJZ A;  1UTB A;  5BWJ A;  2AL4 A;  4OET A;  2WKY A;  4X1B A;  2F7B A;  4H8J A;  4OVJ A;  2XXT A;  1FW0 A;  4BDR A;  1DMB A;  3EQ1 A;  1N0T A;  3B6Q A;  5IKB A;  1Q35 A;  1F9B A;  4FAJ A;  4BDM A;  2VGQ A;  4DXC A;  5AE4 A;  1PB8 A;  3CG1 A;  3K1P A;  3KJ7 A;  2DWJ A;  3N6U A;  1MY3 A;  1QUJ A;  2DXR A;  2A5T A;  4O3B A;  4H8I A;  3GBA A;  1J1N A;  4YB5 A;  5KZT A;  3K6W A;  2ZNT A;  1MG1 A;  2O6A A;  1JEV A;  1QKA A;  2ZNS A;  2FYI A;  4JDF A;  4AB5 A;  3OEM A;  4IO5 A;  2Z8D A;  2DSF A;  4WXJ A;  3TPA A;  3BKI B;  3CFZ A;  4F3P A;  3BFU A;  1IXI A;  3PV0 E;  4QSE A;  2DE2 A;  1NNT A;  2Q2A A;  3PUX E;  5L9M A;  1NNK A;  3H06 B;  1YTV A;  4F3S A;  3USD A;  3S2V A;  1PBQ A;  4MLV A;  1PB9 A;  2IEE A;  3KN3 A;  2UVJ A;  2THI A;  3A09 A;  5ICT A;  1OLC A;  2ONK E;  3PD8 A;  1KWH A;  4ZZE A;  1RYX A;  5H8F B;  4EQ7 A;  1MXW A;  2FA7 A;  4R72 A;  3VVD A;  3LSF B;  2M8C A;  3LSL A;  1D9Y A;  1B7H A;  2R6G E;  4NF4 B;  4OER A;  3IOT A;  2D5W A;  3T93 B;  2H99 A;  4N13 A;  4Q0C A;  4RY1 A;  1VFE A;  3I6V A;  4EF1 A;  4NF5 A;  3S9M C;  2GHA A;  4YB7 A;  5DVF A;  3IK6 B;  4YKJ A;  3R7X A;  2YLN A;  3IOR A;  2PT1 A;  3OSQ A;  3OSR A;  3U94 A;  4OXV A;  4I8C A;  3G3F A;  4R6Y A;  2XXI A;  3RLF E;  4GLI A;  1N3X A;  5I84 A;  1URD A;  2I48 A;  2XXU A;  1SI0 A;  2DE4 A;  2H25 A;  4FED A;  4OEN A;  1O64 A;  1N3W A;  4IGT A;  3QXM A;  4IGR A;  3TTM A;  1BP5 A;  2HXW A;  3C9H A;  3LBS A;  1SYH A;  3FJ7 A;  3TCG A;  1GGG A;  3I3V A;  4OTE A;  2UYF A;  2O7I A;  4IB2 A;  2ALU A;  3Q25 A;  5F7V A;  1ZU0 A;  1P99 A;  3QAX A;  4THI A;  5I57 B;  2QS3 A;  3VVE A;  3IJO B;  3QUJ A;  3S9L C;  3ONM A;  4PET A;  3L6G A;  1AIV A;  3FVN A;  3OOA A;  3V8X B;  5ELV A;  3TZA A;  4H5F A;  1VSO A;  2PX1 A;  3MPL A;  3TTL A;  5B70 A;  1H43 A;  1MQG A;  1IXH A;  3OO8 A;  4JWX A;  4BDO A;  4ZE8 A;  3MZB A;  5AA3 A;  2UXA A;  3MZ9 A;  1ANF A;  1BTJ A;  3IB0 A;  2GRV A;  4QFL A;  3ILU B;  3Q26 A;  4OEU A;  3UK4 A;  2DXY A;  1XS5 A;  4EXK A;  2CZL A;  3O29 A;  4ND9 A;  1R9Q A;  1MXU A;  3SDF A;  3G3K A;  3N26 A;  3F11 A;  4DXB A;  4OZ9 A;  4KFQ A;  2G29 A;  2UVH A;  4NF4 A;  2DS9 A;  5A5X A;  3DM0 A;  4GD5 A;  3VDF A;  3MQ9 A;  4E0W A;  3O2A A;  4NF6 B;  4LP2 B;  2NXO A;  5I2K B;  2I58 A;  4XXU A;  4ZEB A;  3OO7 A;  1LFI A;  1US4 A;  3QYT A;  3N6T A;  1IUD A;  3O97 A;  3SET A;  3VXB A;  3A3U A; 
#chains in the Genus database with same CATH topology
 1MY0 A;  1ZIU A;  2QJE A;  1OIB A;  4XKR A;  2RIN A;  4G8H A;  3TTR A;  4LON B;  4DLD A;  4KI0 E;  4OEV A;  3O6G A;  3BFT A;  5IGA A;  1FCK A;  1MQJ A;  1QGX A;  3U1O A;  3KN7 A;  2DE3 A;  4HS7 A;  4KR5 A;  4ZDM A;  4JXI A;  1LBB A;  3T0J A;  1AOV A;  2P1S A;  4YIC A;  4F29 A;  2DDK A;  1LB9 A;  4IO3 A;  1B7Z A;  3U93 A;  4GBV A;  1MH4 A;  1N7W A;  5CC2 A;  2ONR A;  5FTH A;  1SW4 A;  2DOJ A;  4LQ5 A;  5L9S A;  3FXQ A;  1MM7 A;  1UTB B;  3OO6 A;  1IMB A;  1NUX A;  1ZJL A;  4GBW A;  1N76 A;  4G8M A;  2QS4 A;  1PEB A;  1EZO A;  5DEX A;  4NMY A;  1N7X A;  1B32 A;  1QW0 A;  1XOC A;  3E78 A;  4R9F A;  1MDQ A;  4PTK A;  3MJN A;  3T22 A;  3R26 A;  3SEW A;  3C36 A;  1SYI A;  1POT A;  2XXH A;  4MNC A;  1B46 A;  1A7L A;  1B0L A;  1AWB A;  3RGY A;  3H3G A;  5EQ8 A;  2ZZV A;  1UIV A;  2PVU A;  3ISP A;  3FVK A;  2L5V A;  1IME A;  3HN0 A;  2ZYK A;  3CSB A;  1SVX B;  5CMM A;  4H0W A;  4PFY A;  3DLN A;  4N6K A;  1NNF A;  4N6P A;  1FQA A;  1FBG A;  2XXW A;  2H98 A;  4BDN A;  3FAS A;  3OEL A;  4H6D A;  1YZ0 A;  3IOU A;  3IX1 A;  2D21 A;  1M5B A;  4F2O A;  2X26 A;  3U8Q A;  3K4U A;  4KPT A;  2FIE A;  1RDY A;  3EKI A;  4PFI A;  3RPW A;  1POY 1;  1GR2 A;  3QIM A;  4LAT A;  1XT8 A;  4GOT A;  1DTG A;  1MM6 A;  4OVQ A;  3KEI A;  2DP8 A;  3G3I A;  4N15 A;  2E0S A;  3TOD A;  3SKP A;  2F97 A;  3EHT A;  2FHY A;  1ZKB A;  5CBR A;  3Q29 A;  4PC9 A;  4EXL A;  4R75 A;  5KCJ A;  4DE8 A;  3H6T A;  1B5H A;  4TLM B;  3U72 A;  1LBC A;  3IO4 A;  5EHM A;  5LOM A;  3E4R A;  3BBR A;  1JEU A;  1B05 A;  4GL8 A;  1FJ9 A;  1NUZ A;  4EQB A;  2F6G A;  4N07 A;  4R74 A;  1A8F A;  1IMA A;  4QSC A;  4DCY A;  3G3H A;  3PPQ A;  1EYJ A;  2R9J A;  4NF5 B;  2Y7W A;  4EF2 A;  1ATG A;  3C31 A;  4O3A A;  4IO7 A;  1FTJ A;  4G77 A;  3TYH A;  1FTA A;  3NOH A;  1YYZ A;  4AS4 A;  3VV5 A;  3E9X A;  1IIT A;  1S50 A;  3MWB A;  3CI8 A;  4G68 B;  4NF8 A;  3FGS A;  4YAH X;  4F3B A;  2V3Q A;  3B7D A;  1P1Q A;  3UA8 A;  5FTI A;  2DQV A;  1INP A;  2Y7P A;  5J1D A;  3KBZ A;  5ET5 A;  1H44 A;  1FBC A;  3LUZ A;  1FBF A;  3CRB A;  3KBR A;  5I3S A;  2VD3 A;  2OX3 A;  3IB1 A;  2XHD A;  4NHB A;  2Z23 A;  3HPI A;  1NV4 A;  4BDL A;  1LGB C;  2XX7 A;  5EHS A;  2HAV A;  2Y84 A;  1BLF A;  2RCB A;  1D3K A;  1EYI A;  2CEX A;  1Y9U A;  3G7W A;  3KSJ A;  2NOO A;  1NMU A;  2QRY A;  2E1S A;  4FAT A;  5ESY A;  3JYR A;  4G4P A;  1M5C A;  4M4G A;  1SI1 A;  2V25 A;  3SEV A;  5AA1 A;  3IFC A;  1XC1 A;  4DZ1 A;  4H5G A;  4POW A;  5ET7 A;  3TAJ A;  3TTN A;  3K2D A;  1SD3 A;  3RQT A;  3IAZ A;  1N84 A;  4LZ7 A;  1LST A;  4FBP A;  4OVR A;  4P0I A;  1LAH E;  4H1X A;  2HAU A;  1FBD A;  2ABH A;  1Y20 A;  1EZP A;  1Y1M A;  3QMF A;  4GIZ A;  3GBB A;  4L17 A;  4QHQ A;  4OHN A;  5H8Q A;  1ZBM A;  3ZKL A;  2I6E A;  3FBP A;  2F6P A;  5H8N B;  3V89 B;  3ILT B;  3LR1 A;  1PC3 A;  5H8H A;  5ITO A;  2DYX A;  1B3H A;  2H5Y A;  2Y5K A;  3K6V A;  1LBV A;  3UGW A;  3SEY A;  5I59 A;  3FV1 A;  3MP6 A;  4GWS A;  4G2Z A;  5A5X B;  1NV0 A;  4ELP A;  4H67 A;  3WAF A;  2XD3 A;  3VLU A;  2XXX A;  4IY5 A;  3PMV A;  5CM6 A;  2QL3 A;  2R71 A;  3H6V A;  4OVP A;  1B6H A;  4MEV A;  4RXL A;  1YAE A;  3JV9 A;  1MY1 A;  3H6W A;  2QFL A;  4PQJ A;  5KDT A;  3M3F A;  1Z7N E;  1NV1 A;  4MCO A;  2XXY A;  5DW8 A;  1QUK A;  4G68 A;  2QMX A;  3CG3 A;  2P3N A;  4I1D A;  1DSN A;  5I58 A;  4GQO A;  4HW8 A;  4MAG A;  4LA9 A;  3K02 A;  1JVY A;  5IAI A;  2OLB A;  3IR1 A;  1O63 A;  4DCX A;  2OWT A;  5ET8 A;  4QFN A;  1K9Y A;  5I56 B;  1MPB A;  4OVS A;  2HXR A;  4P8B A;  5CRY A;  5ET6 A;  1B40 A;  1R1N A;  4MBP A;  3MVX A;  5IZ3 B;  3A3C A;  3MVW A;  1NUY A;  3PMX A;  2VHA A;  3CVG A;  3KG2 A;  1OVB A;  1KA1 A;  2I49 A;  3OXN A;  2ZYM A;  3UP9 A;  4GWW A;  3KZG A;  3FVO A;  3PGF A;  1BIY A;  1NL5 A;  2I3W A;  1SBP A;  3PPN A;  1PBP A;  3M3L A;  4R73 A;  4F1U A;  1JET A;  3KC0 A;  1S9T A;  2VT5 A;  1FTM A;  5DEX B;  1P1U A;  3OEK A;  3ODB A;  4X9T A;  1NV5 A;  1H3D A;  2P2A A;  1NV2 A;  2LAO A;  1EU8 A;  4PFR A;  1WDN A;  1MPD A;  4GWO A;  1JNF A;  2G93 A;  4XKP A;  2I4B A;  4YKP A;  5LDZ A;  2P0S A;  1AL3 A;  3UOR A;  2ANJ A;  2ONS A;  4GRK A;  1NH7 A;  2XX9 A;  4PGP A;  3KJT A;  3ECR A;  3FJG A;  1NUW A;  4P11 A;  1QUI A;  3HHG A;  4P9K A;  1G0I A;  3TQW A;  1NH8 A;  4KCD A;  1A54 A;  2Y7I A;  2VOZ A;  5H8N A;  4ECF A;  4PF8 A;  3MW0 A;  3T9V A;  4C0R A;  1PB7 A;  1Y4T A;  1TXF A;  1FQD A;  1IQ7 A;  4XIG Q;  3R6U A;  2XWO A;  4ZEK A;  5CMB A;  1URG A;  4ZZA A;  3T9H B;  4PBH A;  1MQD A;  1EYK A;  2QPQ A;  1FQC A;  3MBP A;  1US5 A;  3MVZ A;  2REG A;  3FV2 A;  5I5P A;  3MST A;  1B4Z A;  3IOW A;  3VVF A;  4Q30 B;  2I0B A;  4O94 A;  3UN6 A;  4ZED A;  2ESN A;  4U2R A;  2CZI A;  3FXR A;  4R2F A;  4FE8 A;  4TOZ A;  4P56 A;  3DP6 A;  4O7M A;  1FQF A;  2RKM A;  4F19 A;  1B4H A;  1FJ6 A;  5H8S A;  2ZZX A;  2B4M A;  2OBG A;  4UA8 A;  3IOV A;  5KCJ B;  1DPP A;  2XA5 A;  2ZMB A;  5AA4 A;  4YU0 A;  2ZZW A;  3D1R A;  2GHB A;  1IMF A;  1FPF A;  4FIM A;  3GZG A;  5EYG A;  5EYH A;  2RC7 A;  4MFI A;  1B1X A;  1H45 A;  2HFB A;  5I56 A;  4RK9 A;  4I9D A;  2ZYN A;  2AIX A;  5IZ3 A;  3G3J A;  3PTY A;  3S9E A;  2FIX A;  1I6A A;  3C32 A;  2HZL A;  1NFT A;  2CMO A;  2XXV A;  2KR0 A;  3PMW A;  4IO4 A;  1ZTY A;  4YKK A;  3I5O A;  4HCW A;  4PDD A;  1FPB A;  3IL1 B;  2Q2C A;  1HSL A;  2PBW A;  4H45 A;  4H65 A;  3H4Z A;  3TKD A;  1QVS A;  2X7P A;  1RDZ A;  3GXA A;  4QFO A;  4WEP A;  5TU0 A;  3ZKK A;  2Z22 A;  5CBS A;  2I0C A;  3LV0 A;  4NE4 A;  1M5D A;  1SDX A;  2O69 A;  2DWI A;  1VR5 A;  1GV8 A;  3LC8 A;  3RYD A;  3SEU A;  3DP4 A;  1FQE A;  1B2H A;  4NF8 B;  4JBZ A;  1LBZ A;  4Q5T A;  2RC9 A;  1Y3Q A;  2F78 A;  4EDP A;  4PFU A;  3FXU A;  3W9V A;  4FEB A;  1RYO A;  4PE3 A;  3PUY E;  5M2V A;  3BIG A;  2VPO A;  1CE2 A;  2OJT A;  5ITP A;  5ISU A;  3VE1 B;  4FEC A;  2NVU B;  2DWH A;  1IIW A;  3HO7 A;  1MXZ A;  3TUS A;  1LCT A;  3IO6 A;  1P1O A;  5JK4 A;  2ZNU A;  1JW1 A;  4C1T A;  4POX A;  3GYY A;  4LVQ A;  3T1B A;  4N91 A;  2WYP A;  4DIG A;  5TPA A;  2F36 A;  2I4C A;  2I3V A;  3WAE A;  2B65 A;  2OK2 A;  3O6H A;  4M1V A;  4DDD A;  3Q27 A;  4N8G A;  2V4C A;  1N04 A;  4Z7E A;  1AMF A;  5H8Q B;  4PE5 B;  3UIF A;  1HSE A;  1P1N A;  2W7Y A;  4HXV A;  4F39 A;  2XXR A;  4U4S A;  2B4L A;  5H8H B;  2OWZ A;  4QFK A;  3MVY A;  5B7D A;  4LZ8 A;  2Q8J A;  1R6Z A;  4XFE A;  2GFE A;  1HSJ A;  1LLS A;  5I59 B;  1FPG A;  4N17 A;  5JTY A;  1GVC A;  1LAF E;  3O66 A;  3DEL B;  4PCD A;  4PGN A;  3E3K A;  4GWZ A;  5CMK A;  3MPK A;  2O1M A;  1CNQ A;  3K00 A;  1ELJ A;  2FBP A;  2D3I A;  4ONY A;  3RN8 A;  2P3V A;  4GVO A;  1UQW A;  4NN3 A;  2CEY A;  2Z8E A;  4TQU Q;  3GLB A;  5L8D A;  3MZ1 A;  4GFR A;  5KDT B;  4TLL B;  3H7M A;  4XEQ A;  1M5E A;  2OWS A;  1EZ9 A;  3EHU A;  1WOD A;  1JP4 A;  3O9P A;  4Z0I A;  1FPE A;  2UVI A;  4NWC A;  5AA2 D;  3OO9 A;  3K01 A;  4QXD A;  4RYA A;  5I58 B;  3FD3 A;  1MPC A;  1SW1 A;  5FHN A;  3S4U A;  1OLA A;  3K1M A;  4R6K A;  2Q89 A;  4OFJ A;  4PAI A;  2O7U A;  1LBY A;  3SER A;  3FVG A;  1TFA A;  3EN3 A;  4LZ5 A;  3V83 A;  3RY3 A;  4EQ9 A;  5DVI A;  3THI A;  3ZS6 A;  3FUZ A;  1O7T A;  4KD5 A;  1A8E A;  1LAX A;  1T0K A;  4YB6 A;  4XTC Q;  4F3G A;  1A55 A;  2RF1 A;  1FBE A;  4JVI A;  3KGC A;  5TP9 B;  1B3F A;  4IO6 A;  3Q28 A;  4U21 A;  5A5L A;  4PBQ A;  4JSD A;  3D4C A;  4QSD A;  1WVJ A;  3DP8 A;  4ZEC A;  4P1L A;  4MJO A;  4GWY A;  1B51 A;  1RKM A;  4AS5 A;  2RC8 A;  3PUV E;  2HHM A;  4FJP A;  4ELQ A;  4RPO A;  1LAG E;  4OMB A;  3CR9 A;  1MY2 A;  3M8U A;  4NX1 A;  3HCQ A;  4QFP A;  4ISU A;  4N81 A;  5I2N B;  5CMC A;  1OQH A;  3QUF A;  4JWO A;  4WKM A;  1B5J A;  4IY6 A;  4EUO A;  1Q1K A;  3VLV A;  2PFY A;  2VD2 A;  2V3U A;  1FTK A;  1UIU A;  3TEL A;  1SW5 A;  2V84 A;  3CFL A;  1XVY A;  1L5T A;  3W9W A;  5HM4 B;  3RTW B;  4O7I A;  5L9O A;  4NED A;  1H76 A;  1XI6 A;  1SQY A;  1IEJ A;  3K0V A;  5EQ7 A;  4JVC A;  2PMS A;  4ESX A;  5AA2 B;  1A99 A;  4X1D A;  4JB7 A;  1DTZ A;  1JW5 A;  3C34 A;  3QSL A;  3E79 A;  3KOS A;  4YMB A;  2F35 A;  4MHF A;  4HE1 A;  3HV1 A;  2XWV A;  4OQO A;  1K9Z A;  3TDJ A;  1FBP A;  2B3F A;  3BIH A;  3TQL A;  3M3K A;  1MS7 A;  2O1L A;  3IB2 A;  1Y3P A;  4MNI A;  3MUQ A;  3LSW A;  1VE4 A;  2PYY A;  3FJM A;  3MC2 A;  1NV7 A;  3U92 A;  1UTH A;  1MY4 A;  3JZJ A;  2YJP A;  3SES A;  1MH3 A;  4G8N A;  4DXU A;  1DOT A;  5LTC A;  5DTB A;  5AA4 B;  5JEI A;  1DPE A;  1B58 A;  1LB8 A;  1VFD A;  1MQH A;  2QS2 A;  1Y4C A;  2XWK A;  3T9U A;  4ELO A;  1B3L A;  3QK6 A;  3L6H A;  3VFJ A;  2NUV A;  3B6T A;  3HST A;  2QSX A;  4YKI A;  3MAM A;  2F34 A;  4XKN A;  3KSX A;  4G68 C;  3KOT A;  4N6D A;  1M5F A;  1B0H A;  3PD9 A;  2Y7R A;  1OQG A;  4F1Y A;  1XHY A;  1USY E;  2Q8M A;  3H6U A;  4GX4 A;  2DWA A;  4I3E A;  4MLQ A;  4RA1 A;  3C35 A;  5TP9 A;  2WBB A;  3H03 A;  4KYE A;  3A29 A;  4ESW A;  4U22 A;  1MXX A;  2Y5L A;  2AL5 A;  4KYD A;  4KQP A;  3TFL A;  2XXP A;  1LEV A;  3N94 A;  1BK4 A;  3P7I A;  1B1H A;  4O8M A;  4YMA A;  3TCH A;  4K3F A;  3PUZ E;  3HHF A;  1IMD A;  3FZV A;  5I2N A;  2QS1 A;  3N5L A;  5DYH A;  4DI4 B;  1TFD A;  3RTF B;  4ZS9 A;  1KZ8 A;  1SW2 A;  1XVX A;  2REJ A;  4OAN A;  4F22 A;  3RNN A;  5IZZ A;  3EPE A;  2OCU A;  3SZP A;  3RUM A;  1NI9 A;  1URS A;  3PUW E;  1MXV A;  3TMG A;  1D4N A;  1QKB A;  2AYS A;  3TTK A;  4RPN A;  5FHO A;  4ZEF A;  2H9B A;  4BLA A;  4NTL A;  1B52 A;  1B5I A;  5AA2 A;  2X7Q A;  1D9V A;  4JWY A;  3D4G A;  5H8F A;  4O3C A;  1LCF A;  3S9N C;  2A5S A;  4I40 A;  1FPJ A;  5TPA B;  2XD2 A;  1IXC A;  3RT8 A;  4KHZ E;  4R9G A;  3EF7 A;  4OWD A;  4UAB A;  4NWD A;  3MYU A;  5ICQ A;  3ROJ A;  4RNS A;  2F7C A;  3VXC A;  2XWI A;  5DT6 A;  4KCC A;  2Z8F A;  1LFH A;  1FPI A;  2HQ0 A;  1NKX A;  2F5X A;  4ZEI A;  3PPP A;  5HBC A;  3SEX A;  3RPL B;  1Y3N A;  2HZK A;  4HCY A;  4JVD A;  1JW4 A;  4HTG A;  4E0X A;  4AQ4 A;  2V3T A;  5HPQ A;  2KLF A;  4R6H A;  3PPR A;  4X48 A;  3KFM A;  4GL0 A;  2DVZ A;  3AXF A;  5JTY B;  2PCR A;  4OFO A;  4KYS A;  3RT6 B;  2CZK A;  1B7U A;  1MDP 1;  1Q9D A;  2Y7K A;  3B6W A;  4OYV A;  4GX3 A;  1PDA A;  1FQB A;  4GF8 A;  3EHS A;  4MH5 A;  1OVT A;  1A40 A;  4GXA A;  4OA4 A;  2F8D A;  4PAK A;  4Q8R A;  4F18 A;  2IA4 A;  1B3G A;  1I69 A;  4R2B A;  2ZYO A;  4GWX A;  3G3G A;  4FOR A;  1ZLQ A;  1NV3 A;  3T66 A;  1ZMG A;  2RCA A;  5I57 A;  1R9L A;  4NF0 A;  4UAC A;  3HFU A;  4QF9 A;  1FTO A;  1LFG A;  1FTL A;  1IZ1 A;  1TT1 A;  2F7A A;  1YXI A;  3C33 A;  4KXP A;  1CB6 A;  3PPO A;  2ZXT A;  2H4I A;  2HEU A;  2BJJ X;  3K1N A;  4IO2 A;  5FHM A;  5DVJ A;  3V5A A;  1EH3 A;  2Q9T A;  1LBX A;  3PU5 A;  1B3E A;  4LUB A;  1QJM A;  1OMP A;  2QMW A;  1BKA A;  3T96 B;  4RK2 A;  2O68 A;  1JVX A;  1YCJ A;  3CFX A;  4U1O A;  3T9X B;  2R8T A;  2O51 A;  2OZZ A;  2A5T B;  3IJX B;  4N4U A;  1VDW A;  1MQI A;  1S7Y A;  1B9J A;  1USY H;  3OMB A;  3CIJ A;  4YZZ A;  4PF6 A;  3U65 A;  4QRZ A;  3OD7 A;  4LQ2 A;  3KC1 A;  3MP8 A;  3K6U A;  4PFW A;  3TCF A;  4F1V A;  4F2Q A;  3TEP A;  4MF3 A;  1P1W A;  2YPN A;  3OEN A;  3MP1 A;  1AH5 A;  1IXG A;  3E13 X;  1QUL A;  4XKQ A;  1GTK A;  1SPI A;  4XF5 A;  5IZ1 A;  5CI5 A;  4WED A;  4NF6 A;  2XX8 A;  5I2K A;  2GH9 A;  5EYF A;  4PFT A;  3CSG A;  4JSO A;  3FAT A;  2Q88 A;  5K2X A;  3CHG A;  3RPL A;  2F3B A;  3B8B A;  4OFL A;  2XXQ A;  3K6X A;  4P0G A;  4U4X A;  2V93 A;  3FIR A;  3W15 C;  3ZSF A;  3LSX A;  5BUU A;  2UVG A;  1YPN A;  1FBH A;  1FPK A;  4GXS B;  1II5 A;  1MRP A;  2UYE A;  2HCA A;  3O28 A;  4AB6 A;  3VLW A;  1I6Q A;  4OES A;  1JQF A;  4I62 A;  5F1Q A;  4NAP A;  1I6B A;  2WX9 A;  3O6I A;  5T3J A;  2WYK A;  1MXY A;  1Z7M E;  2B3B A;  5K2Y A;  5IM2 A;  5I7I A;  4G61 A;  3KN8 A;  4U23 A;  4C1U A;  3LUY A;  4ZE9 A;  2O84 X;  1Y1Z A;  2FNC A;  2NWJ A;  4ELR A;  1NNP A;  2PT2 A;  4PP0 A;  1TWY A;  4X04 A;  2DVC A;  4BDQ A;  3C4M A;  4F31 B;  1UTH B;  2VP1 A;  4MIJ A;  2XXK A;  4U1Z A;  4RJZ A;  1UTB A;  5BWJ A;  2AL4 A;  4OET A;  2WKY A;  4X1B A;  2F7B A;  4H8J A;  4OVJ A;  2XXT A;  1FW0 A;  4BDR A;  1DMB A;  4GX6 A;  3EQ1 A;  1N0T A;  3FXB A;  3B6Q A;  5IKB A;  1Q35 A;  1F9B A;  4FAJ A;  4BDM A;  2VGQ A;  4DXC A;  4DI3 D;  5AE4 A;  1PB8 A;  1NV6 A;  3CG1 A;  3K1P A;  3KJ7 A;  2DWJ A;  2HPG A;  4HE2 A;  3N6U A;  1MY3 A;  1QUJ A;  2DXR A;  2A5T A;  4O3B A;  4H8I A;  3GBA A;  1KA0 A;  4P3L A;  1J1N A;  4YB5 A;  5KZT A;  3K6W A;  4NG7 A;  2ZNT A;  1MG1 A;  2KQZ A;  2O6A A;  1JEV A;  3B50 A;  1QKA A;  2ZNS A;  2FYI A;  4JDF A;  4AB5 A;  3OEM A;  1RDX A;  4IO5 A;  2Z8D A;  2DSF A;  4WXJ A;  3TPA A;  3BKI B;  3CFZ A;  4F3P A;  3BFU A;  1IXI A;  4N8Y A;  2WEF A;  3PV0 E;  4QSE A;  2DE2 A;  1NNT A;  1DK4 A;  2Q2A A;  3PUX E;  5L9M A;  1NNK A;  4LN5 A;  3H06 B;  1YTV A;  4F3S A;  3USD A;  4X8R A;  1IMC A;  3S2V A;  4MMP A;  1PBQ A;  4MLV A;  1PB9 A;  2IEE A;  3KN3 A;  2UVJ A;  2JJK A;  2THI A;  3A09 A;  4I3Y A;  5ICT A;  2CZH A;  4NGU A;  4H46 A;  1OLC A;  2ONK E;  3PD8 A;  1KWH A;  4ZZE A;  4QBA A;  1RYX A;  5H8F B;  4EQ7 A;  1MXW A;  2VPN A;  2FA7 A;  4R72 A;  3VVD A;  4HE0 A;  3LSF B;  2M8C A;  4P47 A;  1FPD A;  3LSL A;  1D9Y A;  3IFA A;  1B7H A;  2R6G E;  4NF4 B;  4OER A;  3IOT A;  2D5W A;  2QVU A;  3T93 B;  2H99 A;  4N13 A;  4Q0C A;  4RY1 A;  1VFE A;  3I6V A;  4EF1 A;  4NF5 A;  5EQ9 A;  3S9M C;  2GHA A;  2QVV A;  4YB7 A;  5DVF A;  3IK6 B;  4YKJ A;  1D9Q A;  3R7X A;  2YLN A;  3IOR A;  2PT1 A;  3OSQ A;  1FRP A;  3OSR A;  3U94 A;  4OXV A;  4I8C A;  3G3F A;  4R6Y A;  2XXI A;  3RLF E;  4GLI A;  1N3X A;  5I84 A;  1URD A;  4OVT A;  2I48 A;  2XXU A;  1SI0 A;  2DE4 A;  4PDH A;  2BJI A;  2H25 A;  4FED A;  2FVZ A;  4OEN A;  1O64 A;  1N3W A;  4IGT A;  3QXM A;  4IGR A;  3TTM A;  4NQ8 A;  1BP5 A;  4GWU A;  2HXW A;  5FBP A;  3C9H A;  3LBS A;  1SYH A;  3FJ7 A;  4PAF A;  2Q74 A;  3TCG A;  1GGG A;  3I3V A;  4OTE A;  2UYF A;  2O7I A;  2F3D A;  4IB2 A;  2ALU A;  3Q25 A;  5F7V A;  1ZU0 A;  1P99 A;  3QAX A;  4THI A;  1DCU A;  5I57 B;  2QS3 A;  3VVE A;  3IJO B;  3QUJ A;  3S9L C;  3ONM A;  4PET A;  3L6G A;  1AIV A;  3FVN A;  3OOA A;  3V8X B;  1G0H A;  5ELV A;  3TZA A;  4H5F A;  1VSO A;  2PX1 A;  3MPL A;  5J16 A;  3TTL A;  5EQA A;  5B70 A;  1H43 A;  1MQG A;  1IXH A;  3OO8 A;  1FSA A;  4JWX A;  4BDO A;  4ZE8 A;  3MZB A;  5AA3 A;  2UXA A;  3MZ9 A;  1ANF A;  1BTJ A;  1DBZ A;  3IB0 A;  2GRV A;  4QFL A;  3ILU B;  3Q26 A;  4OEU A;  3UK4 A;  2DXY A;  1XS5 A;  4EXK A;  2CZL A;  2QVR A;  3O29 A;  4ND9 A;  1R9Q A;  1MXU A;  3SDF A;  2PFZ A;  2WBD A;  3G3K A;  1FPL A;  3N26 A;  3F11 A;  4DXB A;  4OZ9 A;  4KFQ A;  2G29 A;  4PFB A;  2GQ1 A;  2UVH A;  4NF4 A;  2DS9 A;  5A5X A;  3DM0 A;  4GD5 A;  3VDF A;  3MQ9 A;  4E0W A;  3O2A A;  4NF6 B;  4LP2 B;  2NXO A;  5I2K B;  2I58 A;  4XXU A;  4IR8 A;  4ZEB A;  3OO7 A;  4MX6 A;  4MNP A;  2MKZ A;  1LFI A;  1LBW A;  1US4 A;  3QYT A;  5F24 A;  3N6T A;  4P1E A;  1IUD A;  3O97 A;  3SET A;  3VXB A;  3A3U A; 
#chains in the Genus database with same CATH homology
 1MY0 A;  1ZIU A;  2QJE A;  1OIB A;  4XKR A;  2RIN A;  4G8H A;  3TTR A;  4LON B;  4DLD A;  4KI0 E;  4OEV A;  3O6G A;  3BFT A;  1FCK A;  1MQJ A;  3U1O A;  3KN7 A;  2DE3 A;  4HS7 A;  4KR5 A;  4ZDM A;  4JXI A;  1LBB A;  1AOV A;  2P1S A;  4YIC A;  4F29 A;  1LB9 A;  4IO3 A;  1B7Z A;  3U93 A;  1MH4 A;  1N7W A;  5CC2 A;  2ONR A;  5FTH A;  1SW4 A;  2DOJ A;  4LQ5 A;  5L9S A;  3FXQ A;  1MM7 A;  1UTB B;  3OO6 A;  1ZJL A;  1N76 A;  4G8M A;  2QS4 A;  1PEB A;  1EZO A;  5DEX A;  4NMY A;  1N7X A;  1B32 A;  1QW0 A;  1XOC A;  4R9F A;  1MDQ A;  3MJN A;  3T22 A;  3R26 A;  3SEW A;  3C36 A;  1SYI A;  1POT A;  2XXH A;  1B46 A;  1A7L A;  1B0L A;  3RGY A;  3H3G A;  1UIV A;  2PVU A;  3FVK A;  3HN0 A;  2ZYK A;  3CSB A;  1SVX B;  5CMM A;  4H0W A;  4PFY A;  3DLN A;  1NNF A;  4N6P A;  1FQA A;  2XXW A;  2H98 A;  4BDN A;  3FAS A;  3OEL A;  4H6D A;  3IOU A;  3IX1 A;  2D21 A;  1M5B A;  4F2O A;  2X26 A;  3U8Q A;  3K4U A;  4KPT A;  3RPW A;  1POY 1;  1GR2 A;  3QIM A;  4LAT A;  1XT8 A;  4GOT A;  1DTG A;  1MM6 A;  3KEI A;  2DP8 A;  3G3I A;  2E0S A;  3TOD A;  3SKP A;  2F97 A;  3EHT A;  1ZKB A;  5CBR A;  3Q29 A;  4EXL A;  4R75 A;  5KCJ A;  4DE8 A;  3H6T A;  1B5H A;  4TLM B;  3U72 A;  1LBC A;  3IO4 A;  5EHM A;  5LOM A;  3E4R A;  3BBR A;  1JEU A;  1B05 A;  4GL8 A;  4EQB A;  2F6G A;  4N07 A;  4R74 A;  1A8F A;  4QSC A;  4DCY A;  3G3H A;  3PPQ A;  2R9J A;  4NF5 B;  2Y7W A;  4EF2 A;  1ATG A;  3C31 A;  4O3A A;  4IO7 A;  1FTJ A;  4G77 A;  3TYH A;  3VV5 A;  3E9X A;  1IIT A;  1S50 A;  3MWB A;  3CI8 A;  4G68 B;  4NF8 A;  3FGS A;  4YAH X;  4F3B A;  2V3Q A;  3B7D A;  1P1Q A;  3UA8 A;  5FTI A;  2DQV A;  5J1D A;  2Y7P A;  1H44 A;  3CRB A;  3KBR A;  2VD3 A;  3IB1 A;  2XHD A;  2Z23 A;  3HPI A;  4BDL A;  1LGB C;  2XX7 A;  5EHS A;  2HAV A;  2Y84 A;  1BLF A;  2RCB A;  1D3K A;  1Y9U A;  3G7W A;  3KSJ A;  2NOO A;  1NMU A;  2QRY A;  2E1S A;  4FAT A;  3JYR A;  4G4P A;  1M5C A;  4M4G A;  1SI1 A;  2V25 A;  3SEV A;  5AA1 A;  1XC1 A;  4DZ1 A;  4H5G A;  4POW A;  3TAJ A;  3TTN A;  3K2D A;  1SD3 A;  3RQT A;  3IAZ A;  1N84 A;  4LZ7 A;  1LST A;  4P0I A;  1LAH E;  4H1X A;  2HAU A;  2ABH A;  1Y20 A;  1EZP A;  1Y1M A;  4GIZ A;  3GBB A;  4L17 A;  4QHQ A;  4OHN A;  5H8Q A;  1ZBM A;  3ZKL A;  2I6E A;  2F6P A;  5H8N B;  3V89 B;  3ILT B;  3LR1 A;  1PC3 A;  5H8H A;  5ITO A;  2DYX A;  1B3H A;  2H5Y A;  3K6V A;  3UGW A;  3SEY A;  5I59 A;  3FV1 A;  3MP6 A;  4G2Z A;  5A5X B;  4ELP A;  4H67 A;  3WAF A;  2XD3 A;  3VLU A;  2XXX A;  4IY5 A;  3PMV A;  5CM6 A;  2QL3 A;  2R71 A;  3H6V A;  1B6H A;  4RXL A;  1YAE A;  3JV9 A;  1MY1 A;  3H6W A;  4PQJ A;  5KDT A;  3M3F A;  1Z7N E;  2XXY A;  1QUK A;  4G68 A;  2QMX A;  3CG3 A;  4I1D A;  1DSN A;  5I58 A;  4GQO A;  4HW8 A;  4LA9 A;  3K02 A;  1JVY A;  5IAI A;  2OLB A;  3IR1 A;  1O63 A;  4DCX A;  2OWT A;  4QFN A;  5I56 B;  1MPB A;  5CRY A;  1B40 A;  1R1N A;  4MBP A;  3MVX A;  3A3C A;  3MVW A;  3PMX A;  2VHA A;  3CVG A;  3KG2 A;  1OVB A;  2I49 A;  3OXN A;  2ZYM A;  3UP9 A;  3KZG A;  3FVO A;  3PGF A;  1BIY A;  1NL5 A;  2I3W A;  1SBP A;  3PPN A;  1PBP A;  3M3L A;  4R73 A;  4F1U A;  1JET A;  1S9T A;  1FTM A;  5DEX B;  1P1U A;  3OEK A;  3ODB A;  4X9T A;  2P2A A;  1H3D A;  2LAO A;  1EU8 A;  1WDN A;  1MPD A;  4GWO A;  1JNF A;  2G93 A;  4XKP A;  2I4B A;  4YKP A;  2P0S A;  1AL3 A;  3UOR A;  2ANJ A;  2ONS A;  4GRK A;  1NH7 A;  2XX9 A;  3KJT A;  3ECR A;  3FJG A;  4P11 A;  1QUI A;  3HHG A;  3TQW A;  1NH8 A;  4KCD A;  1A54 A;  2Y7I A;  2VOZ A;  5H8N A;  4ECF A;  3MW0 A;  3T9V A;  4C0R A;  1PB7 A;  1Y4T A;  1TXF A;  1FQD A;  1IQ7 A;  4XIG Q;  3R6U A;  4ZEK A;  5CMB A;  1URG A;  4ZZA A;  3T9H B;  1MQD A;  2QPQ A;  1FQC A;  3MBP A;  1US5 A;  3MVZ A;  2REG A;  3FV2 A;  1B4Z A;  3IOW A;  3VVF A;  4Q30 B;  2I0B A;  3UN6 A;  4ZED A;  2ESN A;  4U2R A;  3FXR A;  4R2F A;  4FE8 A;  4TOZ A;  3DP6 A;  1FQF A;  2RKM A;  4F19 A;  1B4H A;  5H8S A;  2OBG A;  4UA8 A;  3IOV A;  5KCJ B;  1DPP A;  2ZMB A;  5AA4 A;  4YU0 A;  2GHB A;  4FIM A;  3GZG A;  2RC7 A;  4MFI A;  1B1X A;  1H45 A;  2HFB A;  5I56 A;  4RK9 A;  4I9D A;  2ZYN A;  2AIX A;  3G3J A;  3S9E A;  1I6A A;  3C32 A;  2HZL A;  1NFT A;  2CMO A;  2XXV A;  3PMW A;  4IO4 A;  1ZTY A;  4YKK A;  3I5O A;  4HCW A;  3IL1 B;  2Q2C A;  1HSL A;  2PBW A;  4H65 A;  3H4Z A;  3TKD A;  1QVS A;  2X7P A;  3GXA A;  4QFO A;  4WEP A;  5TU0 A;  3ZKK A;  2Z22 A;  5CBS A;  2I0C A;  4NE4 A;  1M5D A;  1SDX A;  2O69 A;  2DWI A;  1VR5 A;  1GV8 A;  3LC8 A;  3SEU A;  3DP4 A;  1FQE A;  1B2H A;  4NF8 B;  4JBZ A;  4Q5T A;  2RC9 A;  1Y3Q A;  2F78 A;  4EDP A;  4PFU A;  3FXU A;  3W9V A;  4FEB A;  1RYO A;  3PUY E;  5M2V A;  1CE2 A;  2OJT A;  5ITP A;  5ISU A;  3VE1 B;  4FEC A;  2NVU B;  2DWH A;  1IIW A;  3HO7 A;  1MXZ A;  3TUS A;  1LCT A;  3IO6 A;  1P1O A;  5JK4 A;  2ZNU A;  1JW1 A;  4C1T A;  4POX A;  4LVQ A;  4DIG A;  5TPA A;  2F36 A;  2I4C A;  2I3V A;  3WAE A;  2B65 A;  2OK2 A;  3O6H A;  4M1V A;  4DDD A;  3Q27 A;  1N04 A;  4Z7E A;  1AMF A;  5H8Q B;  4PE5 B;  3UIF A;  1HSE A;  1P1N A;  2W7Y A;  4F39 A;  2XXR A;  4U4S A;  5H8H B;  4QFK A;  5B7D A;  3MVY A;  4LZ8 A;  2Q8J A;  1R6Z A;  2GFE A;  1HSJ A;  1LLS A;  5I59 B;  5JTY A;  1GVC A;  1LAF E;  3O66 A;  3DEL B;  3E3K A;  5CMK A;  3MPK A;  2O1M A;  3K00 A;  1ELJ A;  2D3I A;  4ONY A;  3RN8 A;  4GVO A;  1UQW A;  2Z8E A;  4TQU Q;  3GLB A;  5L8D A;  3MZ1 A;  4GFR A;  5KDT B;  4TLL B;  3H7M A;  1M5E A;  2OWS A;  1EZ9 A;  3EHU A;  1WOD A;  3O9P A;  4Z0I A;  2UVI A;  4NWC A;  5AA2 D;  3OO9 A;  3K01 A;  4RYA A;  5I58 B;  3FD3 A;  1MPC A;  1SW1 A;  5FHN A;  3S4U A;  1OLA A;  3K1M A;  4R6K A;  2Q89 A;  4OFJ A;  2O7U A;  3SER A;  3FVG A;  1TFA A;  3EN3 A;  4LZ5 A;  3V83 A;  3RY3 A;  4EQ9 A;  5DVI A;  3THI A;  3ZS6 A;  3FUZ A;  1O7T A;  4KD5 A;  1A8E A;  1LAX A;  1T0K A;  4YB6 A;  4XTC Q;  4F3G A;  1A55 A;  2RF1 A;  3KGC A;  5TP9 B;  1B3F A;  4IO6 A;  3Q28 A;  4U21 A;  4JSD A;  3D4C A;  4QSD A;  1WVJ A;  3DP8 A;  4ZEC A;  1B51 A;  1RKM A;  2RC8 A;  3PUV E;  4FJP A;  4ELQ A;  4RPO A;  1LAG E;  4OMB A;  3CR9 A;  1MY2 A;  3M8U A;  3HCQ A;  4QFP A;  4ISU A;  5I2N B;  5CMC A;  1OQH A;  3QUF A;  4JWO A;  4WKM A;  1B5J A;  4IY6 A;  4EUO A;  1Q1K A;  3VLV A;  2VD2 A;  2V3U A;  1FTK A;  1UIU A;  3TEL A;  1SW5 A;  2V84 A;  3CFL A;  1XVY A;  1L5T A;  3W9W A;  5HM4 B;  3RTW B;  5L9O A;  4NED A;  1H76 A;  1SQY A;  1IEJ A;  3K0V A;  4ESX A;  2PMS A;  5AA2 B;  1A99 A;  4X1D A;  4JB7 A;  1DTZ A;  1JW5 A;  3C34 A;  3QSL A;  3KOS A;  4YMB A;  2F35 A;  3HV1 A;  4OQO A;  3TDJ A;  2B3F A;  3TQL A;  3M3K A;  1MS7 A;  2O1L A;  3IB2 A;  1Y3P A;  3MUQ A;  3LSW A;  1VE4 A;  2PYY A;  3FJM A;  3MC2 A;  3U92 A;  1UTH A;  1MY4 A;  3JZJ A;  2YJP A;  3SES A;  1MH3 A;  4G8N A;  4DXU A;  1DOT A;  5DTB A;  5AA4 B;  5JEI A;  1DPE A;  1B58 A;  1LB8 A;  1VFD A;  1MQH A;  2QS2 A;  1Y4C A;  3T9U A;  4ELO A;  1B3L A;  3QK6 A;  3L6H A;  3VFJ A;  2NUV A;  3B6T A;  3HST A;  2QSX A;  4YKI A;  3MAM A;  2F34 A;  4XKN A;  3KSX A;  4G68 C;  3KOT A;  1M5F A;  1B0H A;  3PD9 A;  2Y7R A;  1OQG A;  4F1Y A;  1XHY A;  1USY E;  3H6U A;  2DWA A;  4MLQ A;  4RA1 A;  3C35 A;  5TP9 A;  3H03 A;  4KYE A;  4ESW A;  4U22 A;  1MXX A;  2AL5 A;  4KYD A;  4KQP A;  3TFL A;  2XXP A;  3N94 A;  3P7I A;  1B1H A;  4YMA A;  3TCH A;  4K3F A;  3PUZ E;  3HHF A;  3FZV A;  5I2N A;  2QS1 A;  3N5L A;  5DYH A;  1TFD A;  3RTF B;  4ZS9 A;  2REJ A;  1SW2 A;  1XVX A;  4F22 A;  3RNN A;  3EPE A;  2OCU A;  3RUM A;  1URS A;  3PUW E;  1MXV A;  3TMG A;  1D4N A;  1QKB A;  2AYS A;  3TTK A;  4RPN A;  5FHO A;  4ZEF A;  2H9B A;  4BLA A;  4NTL A;  1B52 A;  1B5I A;  5AA2 A;  2X7Q A;  1D9V A;  4JWY A;  3D4G A;  5H8F A;  4O3C A;  1LCF A;  3S9N C;  2A5S A;  5TPA B;  2XD2 A;  1IXC A;  3RT8 A;  4KHZ E;  4R9G A;  3EF7 A;  4OWD A;  4NWD A;  5ICQ A;  4RNS A;  2F7C A;  3VXC A;  5DT6 A;  4KCC A;  2Z8F A;  1LFH A;  2HQ0 A;  1NKX A;  2F5X A;  4ZEI A;  3PPP A;  5HBC A;  3SEX A;  1Y3N A;  2HZK A;  4HCY A;  1JW4 A;  4HTG A;  4E0X A;  4AQ4 A;  2V3T A;  5HPQ A;  2KLF A;  4R6H A;  3PPR A;  4X48 A;  3KFM A;  4GL0 A;  2DVZ A;  3AXF A;  5JTY B;  4OFO A;  4KYS A;  3RT6 B;  1B7U A;  1MDP 1;  2Y7K A;  3B6W A;  4OYV A;  1PDA A;  1FQB A;  4GF8 A;  3EHS A;  4MH5 A;  1OVT A;  1A40 A;  4GXA A;  2F8D A;  4Q8R A;  4F18 A;  2IA4 A;  1B3G A;  1I69 A;  4R2B A;  2ZYO A;  3G3G A;  4FOR A;  1ZLQ A;  3T66 A;  1ZMG A;  2RCA A;  5I57 A;  1R9L A;  4UAC A;  4QF9 A;  1FTO A;  1LFG A;  1FTL A;  1IZ1 A;  1TT1 A;  2F7A A;  3C33 A;  1CB6 A;  3PPO A;  2ZXT A;  2H4I A;  2HEU A;  2BJJ X;  3K1N A;  4IO2 A;  5FHM A;  5DVJ A;  3V5A A;  1EH3 A;  2Q9T A;  3PU5 A;  1B3E A;  4LUB A;  1QJM A;  1OMP A;  2QMW A;  1BKA A;  3T96 B;  4RK2 A;  2O68 A;  1JVX A;  1YCJ A;  3CFX A;  4U1O A;  3T9X B;  2O51 A;  2OZZ A;  2A5T B;  3IJX B;  1MQI A;  1S7Y A;  1B9J A;  1USY H;  3OMB A;  3CIJ A;  4YZZ A;  4QRZ A;  3OD7 A;  4LQ2 A;  3MP8 A;  3K6U A;  4PFW A;  3TCF A;  4F1V A;  4F2Q A;  3TEP A;  4MF3 A;  1P1W A;  2YPN A;  3OEN A;  3MP1 A;  1AH5 A;  1IXG A;  3E13 X;  1QUL A;  4XKQ A;  1GTK A;  5CI5 A;  4WED A;  4NF6 A;  2XX8 A;  5I2K A;  2GH9 A;  5EYF A;  4PFT A;  3CSG A;  4JSO A;  3FAT A;  2Q88 A;  5K2X A;  4OFL A;  2XXQ A;  3K6X A;  4P0G A;  4U4X A;  2V93 A;  3FIR A;  3W15 C;  3ZSF A;  3LSX A;  5BUU A;  2UVG A;  1YPN A;  4GXS B;  1II5 A;  1MRP A;  2UYE A;  2HCA A;  3O28 A;  4AB6 A;  3VLW A;  1I6Q A;  4OES A;  1JQF A;  4I62 A;  5F1Q A;  1I6B A;  3O6I A;  1MXY A;  1Z7M E;  2B3B A;  5K2Y A;  3KN8 A;  4U23 A;  4C1U A;  3LUY A;  4ZE9 A;  2O84 X;  1Y1Z A;  2FNC A;  2NWJ A;  4ELR A;  1NNP A;  2PT2 A;  4PP0 A;  1TWY A;  2DVC A;  4BDQ A;  3C4M A;  4F31 B;  1UTH B;  2VP1 A;  4U1Z A;  4RJZ A;  1UTB A;  5BWJ A;  2AL4 A;  4OET A;  2WKY A;  4X1B A;  2F7B A;  4H8J A;  4OVJ A;  2XXT A;  1FW0 A;  4BDR A;  1DMB A;  3EQ1 A;  1N0T A;  3B6Q A;  5IKB A;  1Q35 A;  1F9B A;  4FAJ A;  4BDM A;  2VGQ A;  4DXC A;  5AE4 A;  1PB8 A;  3CG1 A;  3K1P A;  3KJ7 A;  2DWJ A;  3N6U A;  1MY3 A;  1QUJ A;  2DXR A;  2A5T A;  4O3B A;  4H8I A;  3GBA A;  1J1N A;  4YB5 A;  5KZT A;  3K6W A;  2ZNT A;  1MG1 A;  2O6A A;  1JEV A;  1QKA A;  2ZNS A;  2FYI A;  4JDF A;  4AB5 A;  3OEM A;  4IO5 A;  2Z8D A;  2DSF A;  4WXJ A;  3TPA A;  3BKI B;  3CFZ A;  4F3P A;  3BFU A;  1IXI A;  3PV0 E;  4QSE A;  2DE2 A;  1NNT A;  2Q2A A;  3PUX E;  5L9M A;  1NNK A;  3H06 B;  1YTV A;  4F3S A;  3USD A;  3S2V A;  1PBQ A;  4MLV A;  1PB9 A;  2IEE A;  3KN3 A;  2UVJ A;  2THI A;  3A09 A;  5ICT A;  1OLC A;  2ONK E;  3PD8 A;  1KWH A;  4ZZE A;  1RYX A;  5H8F B;  4EQ7 A;  1MXW A;  2FA7 A;  4R72 A;  3VVD A;  3LSF B;  2M8C A;  3LSL A;  1D9Y A;  1B7H A;  2R6G E;  4NF4 B;  4OER A;  3IOT A;  2D5W A;  3T93 B;  2H99 A;  4N13 A;  4Q0C A;  4RY1 A;  1VFE A;  3I6V A;  4EF1 A;  4NF5 A;  3S9M C;  2GHA A;  4YB7 A;  5DVF A;  3IK6 B;  4YKJ A;  3R7X A;  2YLN A;  3IOR A;  2PT1 A;  3OSQ A;  3OSR A;  3U94 A;  4OXV A;  4I8C A;  3G3F A;  4R6Y A;  2XXI A;  3RLF E;  4GLI A;  1N3X A;  5I84 A;  1URD A;  2I48 A;  2XXU A;  1SI0 A;  2DE4 A;  2H25 A;  4FED A;  4OEN A;  1O64 A;  1N3W A;  4IGT A;  3QXM A;  4IGR A;  3TTM A;  1BP5 A;  2HXW A;  3C9H A;  3LBS A;  1SYH A;  3FJ7 A;  3TCG A;  1GGG A;  3I3V A;  4OTE A;  2UYF A;  2O7I A;  4IB2 A;  2ALU A;  3Q25 A;  5F7V A;  1ZU0 A;  1P99 A;  3QAX A;  4THI A;  5I57 B;  2QS3 A;  3VVE A;  3IJO B;  3QUJ A;  3S9L C;  3ONM A;  4PET A;  3L6G A;  1AIV A;  3FVN A;  3OOA A;  3V8X B;  5ELV A;  3TZA A;  4H5F A;  1VSO A;  2PX1 A;  3MPL A;  3TTL A;  5B70 A;  1H43 A;  1MQG A;  1IXH A;  3OO8 A;  4JWX A;  4BDO A;  4ZE8 A;  3MZB A;  5AA3 A;  2UXA A;  3MZ9 A;  1ANF A;  1BTJ A;  3IB0 A;  2GRV A;  4QFL A;  3ILU B;  3Q26 A;  4OEU A;  3UK4 A;  2DXY A;  1XS5 A;  4EXK A;  2CZL A;  3O29 A;  4ND9 A;  1R9Q A;  1MXU A;  3SDF A;  3G3K A;  3N26 A;  3F11 A;  4DXB A;  4OZ9 A;  4KFQ A;  2G29 A;  2UVH A;  4NF4 A;  2DS9 A;  5A5X A;  3DM0 A;  4GD5 A;  3VDF A;  3MQ9 A;  4E0W A;  3O2A A;  4NF6 B;  4LP2 B;  2NXO A;  5I2K B;  2I58 A;  4XXU A;  4ZEB A;  3OO7 A;  1LFI A;  1US4 A;  3QYT A;  3N6T A;  1IUD A;  3O97 A;  3SET A;  3VXB A;  3A3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...