3ZKLA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with xylotriose
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
b'DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 143
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3zklA02
4OETA 3RT6B 1GGGA 3PU5A 2E1SA 3IOWA 1PC3A 1N0TA 4PQJA 2Y7KA 4DDDA 5H8HB 5H8HA 5DVFA 1D9VA 2VHAA 3C31A 3FVOA 1FTJA 2NXOA 3MZ9A 4OVJA 4XKQA 3MPLA 2I0CA 3PPRA 4U1OA 2DQVA 1TXFA 3O6GA 4QSEA 4H6DA 4KFQA 4QFLA 4MH5A 2X7PA 1DPPA 3KJ7A 1TFAA 3RY3A 1MY1A 1B5JA 3KN7A 4QSCA 1ANFA 5IAIA 2QS3A 3PMVA 3EQ1A 4ISUA 4U4XA 3SKPA 2VP1A 5AA4B 1IXHA 4IO2A 3H6WA 4XKNA 4JBZA 2D5WA 4OEUA 5DVJA 1H3DA 4MFIA 4ELRA 4IO4A 1T0KA 2UVHA 2HZKA 3H6TA 4RNSA 2NWJA 4NTLA 4ELPA 1AH5A 1QUIA 1B3GA 4JXIA 2PT1A 3HO7A 1SD3A 1YAEA 3D4GA 4LZ7A 5EHSA 1A40A 3FXQA 4XKPA 4F19A 2REGA 4F3PA 5I2NB 5I2NA 3GBAA 1VFEA 3PUVE 3QUJA 2XXQA 4NMYA 1LSTA 1Y4TA 1F9BA 4TLLB 1JNFA 3M8UA 3CFZA 3FVNA 3M3LA 2PMSA 4ND9A 5A5XB 1EZOA 5A5XA 2VD2A 4JWOA 2RINA 4IO7A 1B52A 4GF8A 2FYIA 4PFYA 4LP2B 2GHAA 4BLAA 3JZJA 4ZDMA 1Z7NE 1Q1KA 2QPQA 1QJMA 1MPDA 5ISUA 3RTWB 3TTRA 2XXXA 3QAXA 1NNTA 1DSNA 2PYYA 3VLVA 5L8DA 5CI5A 1SDXA 2ZYOA 3PGFA 1IEJA 1BLFA 2XXPA 3E9XA 5I58B 1GR2A 2G93A 2O1MA 5I58A 4E0WA 3FASA 3MAMA 2P1SA 2NUVA 1SI1A 1JVXA 3H6UA 2HCAA 3PUXE 3K1MA 1MY3A 3VVEA 3CSBA 1FTLA 5JTYB 2V3TA 2Z8EA 5JTYA 4RYAA 1LBCA 2P2AA 3C35A 1Y9UA 4FEBA 1Y1ZA 4O3BA 2RC9A 3C34A 3IO4A 2HAVA 3TQLA 2OK2A 3QK6A 2AYSA 2V84A 2H99A 3OO8A 1Z7ME 1ATGA 4YB5A 1O7TA 2Y7IA 5AA1A 2ABHA 1BIYA 3RT8A 1USYE 3T22A 4ZZAA 2H4IA 3S9EA 3FVGA 1TT1A 4F31B 1P1WA 1GTKA 3EHTA 4BDNA 3KBRA 4G8HA 2ZYMA 2Z22A 1NNPA 4JDFA 3K02A 5CC2A 1LAHE 5HM4B 1JETA 2CMOA 2REJA 2VOZA 4R2BA 1FTKA 5CBRA 3SESA 1H44A 5HPQA 4O3CA 2A5TB 1Y3NA 2A5TA 2I58A 4I1DA 1B4HA 3MBPA 3OSQA 3FGSA 3TCFA 2DOJA 3WAEA 3P7IA 1B0HA 4N07A 4XIGQ 4R6KA 4H65A 5DT6A 3MC2A 4WKMA 2F7AA 4F1VA 4G68B 1S9TA 4G68A 3KFMA 4GL8A 3JYRA 3PD9A 3FUZA 5B7DA 3TTNA 1IUDA 3IOVA 3O66A 4DXCA 4LQ2A 5HBCA 1CE2A 1URDA 1MY4A 2Z8DA 3FJMA 3V5AA 1R9LA 2OLBA 3TTMA 4ZS9A 2E0SA 3OSRA 3HHFA 4DCXA 1IIWA 2DWJA 1XHYA 4Q8RA 5I56B 3VE1B 5CMKA 5I56A 1ZLQA 1DTZA 4RPOA 3LSWA 4IO3A 2I3VA 3LC8A 1IQ7A 2HFBA 2R6GE 4DCYA 2I0BA 1LFHA 1I69A 2DXRA 4C1TA 3H4ZA 4KPTA 3A09A 3OMBA 4KCCA 5DYHA 3MW0A 5DTBA 4QFPA 4KYSA 4OHNA 3UIFA 3G3GA 3IK6B 1M5BA 5ICTA 4YAHX 1SQYA 5ELVA 3ZKLA 2F8DA 4OMBA 3HV1A 2VD3A 1MY2A 3K1PA 1AL3A 2GRVA 3VXCA 4YKJA 4OWDA 1ZTYA 3TEPA 4F39A 3MVZA 3RGYA 3KSJA 2I3WA 1D9YA 1MQGA 1GV8A 2F36A 4Z0IA 3QYTA 1H43A 4RPNA 3RUMA 1MQIA 1PB9A 3BKIB 3ZKKA 1HSJA 1B05A 3SEWA 4GVOA 1FQAA 2UVJA 5I84A 4KYDA 2R71A 4NF8B 5H8FB 3Q29A 3IAZA 4NF8A 1KWHA 4YKKA 5H8FA 1A55A 1EU8A 4LZ5A 4F1YA 1NH8A 2QMXA 3SEVA 2XXVA 1RYXA 4Q30B 4ELQA 1R9QA 4FJPA 1NL5A 3DP6A 3H03A 2XXHA 3B6TA 3LR1A 4H0WA 5F1QA 3PPOA 5KDTB 2XXRA 1OQGA 1A8FA 5KDTA 3TZAA 3LSLA 3O2AA 5F7VA 5EHMA 4BDOA 1TFDA 2Z23A 2O6AA 2UYFA 3MVWA 5DVIA 3RLFE 3TAJA 2B65A 1LB8A 4OFJA 3ONMA 3O6IA 2Q8JA 3I3VA 1EZ9A 3CI8A 2DE4A 1US4A 2F6GA 3PPPA 3JV9A 1B7ZA 4ZE8A 4F18A 2LAOA 2XD3A 3GBBA 2HEUA 4PETA 4PE5B 1MM6A 4UACA 4NF5B 4F3BA 4TOZA 4NF5A 4FE8A 2V3QA 2RCBA 4ZEFA 1DPEA 3G3FA 4R9GA 4HCYA 2XX7A 4KQPA 1MDQA 2DWHA 3O28A 2NOOA 1N3WA 3USDA 5CMBA 4L17A 4ESWA 1RKMA 5KZTA 2YLNA 4ONYA 1HSLA 1FCKA 4R72A 4MF3A 3IB1A 4KHZE 3T9UA 1R1NA 4JB7A 2YJPA 4U4SA 1MXVA 3FATA 3OELA 4QFKA 2V93A 4ZECA 3KG2A 5K2YA 5AA4A 3FZVA 5KCJB 4WEPA 5KCJA 1NH7A 3KSXA 3C4MA 4GXAA 2Q9TA 4QFOA 3ZS6A 4H67A 1EZPA 4NWDA 3OO6A 4NWCA 3G3JA 4QRZA 2F35A 1N3XA 3MVYA 1Y3QA 1AIVA 3VVFA 3VV5A 2FA7A 3SDFA 2Q2CA 4ESXA 2XX8A 3ODBA 1POY1 1M5CA 3OEMA 3K1NA 2AL4A 4IGRA 4LVQA 1YPNA 4OFLA 4GFRA 2OBGA 3SEUA 3TCGA 4JSDA 2HQ0A 5I59B 3FV1A 4OEVA 4QHQA 5I59A 1DTGA 2I6EA 3DM0A 4XKRA 2DYXA 3CFXA 2PBWA 3K6XA 1IXIA 3MP6A 3PMXA 1B1XA 2F5XA 5I57B 4OQOA 5I57A 1LAXA 4AQ4A 1FQEA 3T96B 4PP0A 4OZ9A 4BDQA 1EH3A 1VFDA 2BJJX 1P99A 3MP1A 4P11A 1ZIUA 2H9BA 3H6VA 1IXGA 4NF4B 4NF4A 3SEXA 1BP5A 1N76A 3HSTA 4FATA 3E4RA 1Y4CA 4F3GA 5CMMA 1VSOA 3WAFA 4THIA 1UIUA 4X48A 2Y7WA 4FORA 2DE2A 2ZNSA 4G68C 3DLNA 3KOTA 1JEVA 3FIRA 1QUKA 1I6BA 3Q25A 1GVCA 3K6WA 2ZMBA 4RK2A 4Q5TA 4LQ5A 4U22A 1MM7A 2QRYA 4BDRA 3VVDA 1UTBB 1ZKBA 3O29A 1SYHA 1UTBA 3T66A 2IEEA 4GXSB 2F6PA 2XXIA 3K0VA 4QSDA 1O64A 4GRKA 5M2VA 3IJXB 2DWAA 2Y7PA 3EPEA 1IZ1A 3QUFA 1SBPA 2XHDA 2YPNA 4X1DA 4DXUA 2PVUA 4XTCQ 1HSEA 1B58A 1B4ZA 3F11A 5TU0A 1JW4A 4ZEKA 2F97A 4X1BA 3PD8A 3UGWA 3C32A 2GFEA 1CB6A 4G8MA 3HHGA 4FIMA 4EQ7A 1JW1A 4KD5A 3N6TA 4G8NA 2DS9A 2O7UA 3UK4A 4TQUQ 2PX1A 4GD5A 3A3CA 4YU0A 3RNNA 3SEYA 3H06B 4C0RA 1MY0A 4IO5A 1SVXB 3OEKA 4F22A 1B6HA 4IB2A 3H3GA 3VFJA 4MLQA 4IO6A 1A54A 1XC1A 1BTJA 4NEDA 3GZGA 3IOTA 1PBQA 4ZE9A 1XVYA 2ZNUA 4EQ9A 5TP9B 3PUYE 4JWXA 5TP9A 3B6WA 1B51A 3L6HA 1PB7A 4XXUA 5I2KB 3C33A 3KEIA 5I2KA 3V89B 4ECFA 3E13X 2F34A 4MBPA 3L6GA 4U21A 1XS5A 3OD7A 2DXYA 1SW1A 4R74A 1NMUA 1LLSA 1N7XA 1OMPA 3TQWA 1OLCA 2W7YA 1US5A 1URSA 5JK4A 3R6UA 4GQOA 4KCDA 3LUYA 3B6QA 4EXLA 3E3KA 5JEIA 3G3IA 2ZNTA 4ZEDA 3HN0A 1LFGA 2I4CA 2ALUA 4R73A 1ZJLA 2O7IA 2VGQA 4POWA 2ESNA 5L9MA 1LBBA 2DP8A 5AE4A 3Q28A 2DVCA 1IXCA 1QVSA 4R6HA 4KYEA 1R6ZA 2XXYA 2P0SA 1SW5A 2Y84A 4F2QA 1WVJA 4QFNA 1H45A 3K2DA 4YMAA 2Q88A 4P0GA 4N13A 4HS7A 2XD2A 5FHOA 4HW8A 4WXJA 1MDP1 1P1UA 3FVKA 4YKPA 1MQDA 1QULA 3SERA 1ZMGA 1FQCA 4EF2A 1B40A 3EN3A 4ZEIA 1XVXA 1MQJA 4GOTA 4OTEA 5L9SA 4AB5A 2R9JA 1A8EA 2QSXA 1DMBA 2DE3A 2O51A 3TMGA 4G2ZA 4O3AA 2RC7A 3FJGA 1WODA 1H76A 2QMWA 3TUSA 1PB8A 1A7LA 1I6AA 2HZLA 1MXXA 4DZ1A 3O97A 3V83A 1B3EA 1FTOA 1AOVA 4WEDA 5K2XA 4F3SA 3THIA 1A99A 3VLWA 2UXAA 4KI0E 3TCHA 2ZXTA 2WKYA 4EF1A 3O9PA 5BUUA 3G3HA 4R2FA 3PUWE 3IR1A 1LCTA 3VLUA 5H8QB 2M8CA 3R26A 2XXWA 4H8JA 5H8QA 1I6QA 3T9XB 1B0LA 1XT8A 1YTVA 3TFLA 2O84X 2F7BA 4M1VA 1B3FA 2B3FA 3FXUA 4HCWA 4YICA 1VE4A 2CZLA 1P1QA 4M4GA 4F2OA 4GL0A 3ILUB 3UN6A 1RYOA 3S9NC 3CRBA 2UVIA 4Z7EA 3UA8A 1ZU0A 2PT2A 4EQBA 2A5SA 3W9WA 3W15C 3U94A 1MRPA 3IL1B 1Q35A 1B3HA 4U23A 1MPBA 2FNCA 4GIZA 2X26A 5H8SA 3K6UA 2DWIA 3EF7A 2V25A 3B7DA 3G3KA 1FQDA 4MLVA 3OO7A 3TKDA 3BBRA 2ONRA 3MWBA 4YB7A 4DXBA 2O68A 4RK9A 1FTMA 1XOCA 1VR5A 3S4UA 3CR9A 1D3KA 2KLFA 3OO9A 4BDMA 3H7MA 3O6HA 3Q27A 1B5HA 4G77A 4FEDA 3MP8A 3N5LA 4HTGA 3U1OA 1B7HA 2H25A 1DOTA 1AMFA 4OXVA 1NNFA 3U93A 3FV2A 1Y20A 4ELOA 5AA2D 4Q0CA 3T9VA 2OWSA 1J1NA 1UTHB 1UTHA 1LFIA 2DSFA 3D4CA 3CVGA 3IORA 3GLBA 4YZZA 4YMBA 2RCAA 3M3KA 2OWTA 2XXUA 4K3FA 1O63A 2D3IA 4EUOA 1MH4A 3UP9A 1P1NA 1MS7A 3VXBA 3CIJA 4H8IA 3SETA 3HPIA 3IJOB 1JEUA 1N84A 4I62A 1ZBMA 4EXKA 1SW2A 1NNKA 4LUBA 3KN3A 1POTA 1B32A 1URGA 2ZYKA 1B3LA 5J1DA 1P1OA 3RN8A 4YB6A 3ZSFA 3CG3A 1USYH 4H5GA 3IO6A 3TTLA 4UA8A 1MH3A 2I48A 2ONKE 3BFTA 2OZZA 1NKXA 2XX9A 3N26A 5CBSA 1OVBA 5ITOA 2G29A 3S9MC 1L5TA 1B9JA 3DP8A 4FECA 2QJEA 2DVZA 3HCQA 4OFOA 4R75A 3I6VA 3PPNA 4IY5A 2HXWA 4PFUA 1Y1MA 2I49A 2Y7RA 3QSLA 4P0IA 3W9VA 4GLIA 2IA4A 2RC8A 3EHSA 3OENA 5B70A 3KGCA 4U1ZA 5FTHA 3K01A 3MZBA 1OIBA 3KOSA 3Q26A 2Q2AA 3GXAA 4OENA 2B3BA 2ZYNA 1Y3PA 3QIMA 1JVYA 3G7WA 3TPAA 3U72A 2OJTA 1SW4A 3N94A 3V8XB 1UQWA 3TELA 4ZEBA 2D21A 4QF9A 2XXTA 3K00A 3LSXA 1MXUA 5IKBA 1MXWA 4DE8A 2AIXA 2RF1A 3VDFA 3PV0E 5L9OA 2UYEA 5H8NB 5FHNA 5H8NA 1B1HA 2UVGA 2ONSA 3MZ1A 2QL3A 1PEBA 4F29A 4R9FA 1QKBA 1QKAA 3KJTA 1II5A 3PMWA 3PPQA 2NVUB 4H5FA 3N6UA 3ECRA 5FTIA 1SYIA 2GH9A 1FQBA 1LAGE 1QUJA 4RJZA 4N6PA 1S7YA 3U92A 4OYVA 4R6YA 4AB6A 2O69A 1B2HA 3TDJA 4LATA 3C36A 1MPCA 4KR5A 3RPWA 3TYHA 4IY6A 4RY1A 3CFLA 3MQ9A 1QW0A 4G4PA 5TPAB 4F1UA 5TPAA 1MXZA 4NF6B 1S50A 1OQHA 2OCUA 4NF6A 3R7XA 3KZGA 1PDAA 1MG1A 4H1XA 3KN8A 1TWYA 1B7UA 1JW5A 2I4BA 3MPKA 4LONB 5AA3A 4LZ8A 4RA1A 5LOMA 1MXYA 3UORA 1B46A 3I5OA 2HAUA 1B5IA 1LCFA 3CSGA 2F78A 3OOAA 3IOUA 5FHMA 2X7QA 1WDNA 4BDLA 1LGBC 2GHBA 3TODA 2QS2A 5CM6A 4TLMB 1YCJA 1FW0A 4FAJA 3T9HB 3BFUA 2Z8FA 5BWJA 1M5EA 3MUQA 4JWYA 3S9LC 1M5FA 4U2RA 3OXNA 3IB2A 1LAFE 4IGTA 5AA2B 1OLAA 5AA2A 1ELJA 4RXLA 1PBPA 2V3UA 5DEXB 2H5YA 5DEXA 3PUZE 3MVXA 3EHUA 4DLDA 3DELB 3C9HA 5CRYA 4YKIA 1LB9A 1UIVA 5EYFA 2O1LA 4PFTA 1NFTA 2Q89A 1JQFA 4JSOA 3A3UA 3MJNA 3U8QA 4DIGA 1D4NA 3IX1A 4EDPA 1N04A 3RTFB 2AL5A 4X9TA 2QS4A 4I9DA 4POXA 4GWOA 1OVTA 1BKAA 2RKMA 3ILTB 3K4UA 5CMCA 4PFWA 3TTKA 4E0XA 1N7WA 2ANJA 3FXRA 3LSFB 3S2VA 2F7CA 4I8CA 1FQFA 2THIA 3K6VA 3FJ7A 2QS1A 5ICQA 3CG1A 4NE4A 1IITA 1M5DA 3FD3A 4ZZEA 4LA9A 3QXMA 3M3FA 3T93B 3DP4A 4OERA 2H98A 1SI0A 1MQHA 3LBSA 3RQTA 4C1UA 4OESA 3AXFA 3IB0A 5ITPA
chains in the Genus database with same CATH superfamily
4OETA 3RT6B 1GGGA 3PU5A 2E1SA 3IOWA 1PC3A 1N0TA 4PQJA 2Y7KA 4DDDA 4P47A 5H8HB 5H8HA 5DVFA 1D9VA 2VHAA 3C31A 3FVOA 1KA1A 4FBPA 1FTJA 2NXOA 3MZ9A 4OVJA 4XKQA 3MPLA 2I0CA 3PPRA 4U1OA 2Y5KA 2DQVA 1EYJA 1TXFA 4P9KA 3O6GA 4QSEA 4H6DA 4KFQA 4QFLA 4MH5A 2X7PA 1DPPA 3KJ7A 1YZ0A 5EQ9A 1TFAA 3RY3A 1MY1A 1B5JA 3KN7A 4QSCA 2Q74A 2F3DA 2B4MA 1ANFA 5IAIA 2QS3A 3PMVA 3EQ1A 4ISUA 4U4XA 3SKPA 2VP1A 5AA4B 1IXHA 4IO2A 3H6WA 4OVPA 4XKNA 4JBZA 2D5WA 4OEUA 2V4CA 5DVJA 3BIHA 4GWSA 1H3DA 2CZKA 4MFIA 4ELRA 4IO4A 1T0KA 2UVHA 2HZKA 3H6TA 4RNSA 2NWJA 4NTLA 4ELPA 1AH5A 1QUIA 1B3GA 4JXIA 2PT1A 3HO7A 1SD3A 1YAEA 3D4GA 1FJ9A 4LZ7A 5EHSA 1A40A 3FXQA 4XKPA 4F19A 2REGA 4F3PA 5F24A 5I2NB 5I2NA 1NV5A 3GBAA 1VFEA 5ET6A 3PUVE 3QUJA 2XXQA 3ROJA 4NMYA 1LSTA 4I3EA 1Y4TA 1F9BA 2PCRA 4TLLB 1JNFA 3M8UA 3CFZA 3FVNA 3M3LA 2PMSA 4ND9A 5A5XB 1EZOA 5A5XA 2VD2A 4JWOA 4PE3A 2RINA 4IO7A 2FIXA 1B52A 4GF8A 1FBFA 2FYIA 4PFYA 4LP2B 2GHAA 4BLAA 3JZJA 4I3YA 3B8BA 4ZDMA 1Z7NE 1Q1KA 4PBHA 2QPQA 1QJMA 1MPDA 5ISUA 3FBPA 1YXIA 3RTWB 4MCOA 1IMFA 3TTRA 2XXXA 1YYZA 3QAXA 1NNTA 4HE1A 4HXVA 1DSNA 4NG7A 2PYYA 3VLVA 5L8DA 5CI5A 3GYYA 1SDXA 2ZYOA 3PGFA 1IEJA 1BLFA 2XXPA 3E9XA 5I58B 1GR2A 2R8TA 3KC0A 1FRPA 2G93A 2O1MA 4E0WA 5I58A 4OANA 3FASA 3MAMA 2P1SA 1NV6A 2NUVA 1SI1A 1JVXA 3H6UA 2HCAA 3PUXE 3K1MA 1MY3A 2DDKA 3VVEA 3CSBA 1FTLA 5JTYB 2V3TA 2Z8EA 5JTYA 4RYAA 1LBCA 2P2AA 3C35A 1Y9UA 2QVVA 4FEBA 1Y1ZA 4O3BA 2RC9A 3C34A 3IO4A 2HAVA 3TQLA 2OK2A 3QK6A 1NUZA 2AYSA 2V84A 2H99A 2OX3A 3OO8A 1Z7ME 1KZ8A 3NOHA 1ATGA 4YB5A 1O7TA 2Y7IA 5AA1A 2ABHA 1BIYA 3RT8A 1USYE 3T22A 4ZZAA 2H4IA 4PAKA 5T3JA 3S9EA 3FVGA 1TT1A 4F31B 1P1WA 1GTKA 3EHTA 4BDNA 5EQ8A 3KBRA 4G8HA 2ZYMA 2Z22A 1NNPA 4JDFA 3K02A 2WBBA 5CC2A 4PBQA 1LAHE 5HM4B 1JETA 4XF5A 2CMOA 2REJA 2VOZA 4R2BA 4AS4A 1FTKA 5CBRA 2JJKA 3SESA 1H44A 5HPQA 4O3CA 2A5TB 1Y3NA 2A5TA 2I58A 4I1DA 1B4HA 1FBCA 1RDXA 3MBPA 3OSQA 3FGSA 3TCFA 2DOJA 3WAEA 4PFIA 1INPA 2PFYA 3P7IA 1B0HA 4NN3A 4N07A 4XIGQ 4R6KA 4H65A 5DT6A 3MC2A 4WKMA 2F7AA 4F1VA 4G68B 1S9TA 4G68A 3KFMA 4GL8A 3JYRA 3PD9A 3FUZA 5B7DA 3TTNA 4MIJA 1IUDA 1KA0A 3IOVA 3O66A 4DXCA 4I40A 1Q9DA 4LQ2A 5HBCA 1CE2A 1URDA 4N4UA 4O94A 1MY4A 2Z8DA 3FJMA 3V5AA 1R9LA 2OLBA 4NGUA 3TTMA 4ZS9A 2E0SA 3OSRA 1LBZA 3HHFA 4DCXA 1IIWA 2QVRA 1LBXA 2DWJA 1NV2A 1XHYA 4Q8RA 5I56B 3VE1B 5CMKA 5I56A 1ZLQA 1DTZA 4RPOA 3LSWA 4IO3A 2I3VA 3LC8A 1IQ7A 2HFBA 2R6GE 4DCYA 2I0BA 3MYUA 1LFHA 3KC1A 1I69A 2DXRA 4C1TA 3H4ZA 4KPTA 3A09A 3OMBA 2FHYA 4KCCA 2XWOA 5DYHA 3MW0A 5DTBA 4QFPA 4KYSA 1FPGA 4OHNA 3UIFA 3G3GA 3IK6B 2HXRA 1M5BA 5ET8A 1NV0A 5ICTA 4YAHX 1SQYA 5ELVA 3ZKLA 2F8DA 4OMBA 3HV1A 2VD3A 1MY2A 3K1PA 1AL3A 2GRVA 3VXCA 4YKJA 4OWDA 1ZTYA 3TEPA 4F39A 3MVZA 5DW8A 4HE0A 3RGYA 3KSJA 2I3WA 1D9YA 1MQGA 5EQ7A 4GWWA 1EYIA 1GV8A 2F36A 4Z0IA 3QYTA 1H43A 4RPNA 3RUMA 5A5LA 1MQIA 1PB9A 3BKIB 3ZKKA 1HSJA 1B05A 4JVDA 2CEXA 3SEWA 4GVOA 1FQAA 2UVJA 3FXBA 5I84A 4KYDA 2R71A 4NF8B 4HE2A 5H8FB 3Q29A 3IAZA 4NF8A 1KWHA 1FJ6A 4YKKA 5H8FA 1A55A 1EU8A 4LZ5A 4F1YA 4MJOA 1NH8A 2QMXA 3SEVA 2P3NA 2XXVA 1RYXA 4Q30B 4ELQA 1R9QA 4FJPA 1NL5A 3DP6A 3H03A 2XXHA 3B6TA 3LR1A 4H0WA 5F1QA 3PPOA 5KDTB 2XXRA 1OQGA 1A8FA 2ZZVA 3TZAA 5KDTA 3LSLA 3O2AA 5F7VA 4XEQA 5EHMA 4BDOA 1TFDA 4O7IA 2Z23A 2O6AA 2UYFA 3MVWA 5DVIA 3RLFE 5LTCA 3TAJA 2B65A 1LB8A 4OFJA 3ONMA 1FPLA 3O6IA 2Q8JA 2QFLA 3IFCA 3I3VA 1EZ9A 3CI8A 5EYGA 2DE4A 1US4A 2F6GA 3PPPA 3JV9A 1B7ZA 4P3LA 4ZE8A 4F18A 1IMBA 5FBPA 2LAOA 2XD3A 3GBBA 2HEUA 4PETA 4PE5B 1MM6A 4UACA 4NF5B 4F3BA 4TOZA 4NF5A 4FE8A 2V3QA 2RCBA 4ZEFA 1DPEA 3G3FA 4R9GA 4HCYA 2XX7A 2BJIA 4KQPA 4NQ8A 1MDQA 2DWHA 3O28A 2NOOA 2ZZWA 3SZPA 5ET5A 1N3WA 3USDA 5CMBA 4L17A 4ESWA 2KQZA 1RKMA 5KZTA 2YLNA 4ONYA 1HSLA 1FCKA 3LV0A 4R72A 4MF3A 4OA4A 4PDHA 3IB1A 4KHZE 3T9UA 4P56A 1R1NA 4JB7A 4GWUA 2YJPA 4U4SA 1MXVA 3FATA 3OELA 4QFKA 3EKIA 2V93A 4ZECA 3KG2A 5K2YA 5AA4A 3FZVA 5KCJB 4WEPA 5KCJA 4P1LA 1NH7A 1NI9A 3KSXA 3C4MA 4GXAA 2Q9TA 4QFOA 1FPJA 4N6KA 1JP4A 3HFUA 1IMEA 3ZS6A 4H67A 5EQAA 1EZPA 4NWDA 1XI6A 1DBZA 3OO6A 4NWCA 3G3JA 1BK4A 4QRZA 1NUXA 2F35A 1N3XA 3MVYA 4LN5A 1Y3QA 1AIVA 3BIGA 3VVFA 3VV5A 3E79A 2FA7A 3SDFA 2Q2CA 4ESXA 2XX8A 3ODBA 1POY1 1M5CA 3OEMA 3K1NA 2AL4A 4IGRA 4LVQA 1YPNA 4OFLA 4GFRA 2OBGA 3SEUA 3TCGA 3IFAA 4JSDA 2HQ0A 5I59B 3FV1A 4OEVA 4QHQA 5I59A 1LBWA 1DTGA 2I6EA 3DM0A 4XKRA 2DYXA 3CFXA 2PBWA 3K6XA 1IXIA 3MP6A 3PMXA 1B1XA 2F5XA 5I57B 4OQOA 5I57A 1K9YA 1LAXA 4AQ4A 1FQEA 1RDYA 3T96B 1LBYA 4PP0A 4OZ9A 4BDQA 5ESYA 1EH3A 1VFDA 2BJJX 1P99A 3MP1A 4P11A 1ZIUA 2H9BA 3H6VA 5ET7A 1IXGA 4NF4B 4NF4A 3SEXA 1BP5A 1N76A 3HSTA 4FATA 3E4RA 1Y4CA 4F3GA 5CMMA 1VSOA 2B4LA 3WAFA 4THIA 2CZHA 1UIUA 4X48A 2Y7WA 4FORA 4MMPA 2DE2A 2ZNSA 4QBAA 4G68C 3DLNA 3KOTA 4DI4B 1JEVA 3FIRA 1QUKA 1I6BA 3Q25A 1GVCA 3K6WA 2ZMBA 4RK2A 4Q5TA 4LQ5A 4U22A 1NUWA 1MM7A 2QRYA 4BDRA 3VVDA 1UTBB 1FPFA 1ZKBA 3O29A 1SYHA 1UTBA 3T66A 2IEEA 4GXSB 2F6PA 2XXIA 3K0VA 4GX6A 4QSDA 4X8RA 1O64A 4GRKA 5M2VA 3IJXB 2DWAA 2Y7PA 1G0HA 3EPEA 1IZ1A 3QUFA 1SBPA 3RPLB 3RPLA 2XHDA 2YPNA 1LBVA 4PFBA 4X1DA 4DXUA 2PVUA 4XTCQ 1HSEA 1B58A 1B4ZA 4MNPA 3F11A 5TU0A 4N15A 1JW4A 4ZEKA 2F97A 1FPDA 4X1BA 3PD8A 2QVUA 3UGWA 4MX6A 3C32A 2GFEA 4H46A 1CB6A 4G8MA 3HHGA 4FIMA 4EQ7A 1JW1A 1FBHA 4KD5A 3N6TA 4G8NA 2DS9A 2O7UA 3UK4A 4MHFA 4TQUQ 2PX1A 3PTYA 4GD5A 3A3CA 4YU0A 3RNNA 3SEYA 3H06B 4C0RA 1MY0A 4IO5A 1SVXB 2KR0A 4P8BA 3OEKA 4F22A 1B6HA 4UABA 4PDDA 4IB2A 3H3GA 3VFJA 4MLQA 2ZZXA 4IO6A 1A54A 3KBZA 1XC1A 1BTJA 4NEDA 3GZGA 3IOTA 1PBQA 4ZE9A 1XVYA 2ZNUA 4PF6A 4EQ9A 5TP9B 3PUYE 4JWXA 5TP9A 3B6WA 4OVQA 1B51A 3L6HA 3U65A 1PB7A 4XXUA 5I2KB 3C33A 3KEIA 3QMFA 5I2KA 3V89B 4ECFA 3E13X 2F34A 2FBPA 4MBPA 3L6GA 1FPKA 4U21A 1XS5A 3OD7A 2DXYA 1SW1A 1CNQA 1FPBA 4R74A 1EYKA 1NMUA 4GX3A 1LLSA 1N7XA 1OMPA 3TQWA 1OLCA 2W7YA 1US5A 1URSA 5JK4A 3R6UA 2L5VA 2CEYA 4GQOA 4KCDA 3LUYA 3B6QA 5LDZA 4EXLA 3E3KA 5JEIA 3G3IA 4PFRA 3D1RA 2ZNTA 4PGNA 4MEVA 4ZEDA 3HN0A 4QXDA 1LFGA 2I4CA 2ALUA 4R73A 3B50A 1ZJLA 2O7IA 2VGQA 3ISPA 1NV3A 4POWA 2ESNA 5L9MA 1LBBA 1FBEA 2DP8A 5AE4A 3Q28A 4NAPA 2DVCA 2FVZA 1IXCA 1QVSA 4R6HA 4KYEA 1R6ZA 2XXYA 2P0SA 1SW5A 2Y84A 1D9QA 1IMDA 4F2QA 1WVJA 4QFNA 1H45A 3K2DA 4YMAA 2Q88A 4P0GA 4N13A 4HS7A 2XD2A 5FHOA 4HW8A 4WXJA 1MDP1 1P1UA 3FVKA 4YKPA 1MQDA 1QULA 3SERA 1ZMGA 1FQCA 4EF2A 1B40A 2CZIA 3A29A 3EN3A 4ZEIA 1XVXA 1MQJA 4GOTA 4OTEA 5L9SA 4AB5A 2R9JA 1A8EA 2QSXA 1DMBA 2DE3A 2PFZA 2O51A 2VPOA 3TMGA 4G2ZA 4GWZA 4O3AA 2RC7A 3FJGA 1WODA 1H76A 2QMWA 3TUSA 1PB8A 1A7LA 1I6AA 2HZLA 1MXXA 4DZ1A 3O97A 3V83A 1B3EA 4GBVA 1FTOA 1AOVA 4X04A 4WEDA 5K2XA 4F3SA 3THIA 1A99A 3VLWA 2XA5A 2UXAA 4KI0E 3TCHA 2ZXTA 2WKYA 4EF1A 2XWIA 3O9PA 5BUUA 2XWKA 3G3HA 4R2FA 3PUWE 5IGAA 3IR1A 1LCTA 3VLUA 5H8QB 2M8CA 3R26A 2XXWA 4H8JA 5H8QA 1I6QA 3T9XB 1FSAA 1B0LA 1XT8A 2F3BA 1YTVA 3TFLA 2O84X 4PTKA 2F7BA 4M1VA 1B3FA 4GWXA 2B3FA 3FXUA 4HCWA 4YICA 1VE4A 2CZLA 1P1QA 4M4GA 4F2OA 4GL0A 3ILUB 1AWBA 3UN6A 1RYOA 3S9NC 3CRBA 2UVIA 4Z7EA 3UA8A 1ZU0A 5IM2A 2PT2A 4EQBA 3CHGA 2A5SA 3W9WA 3W15C 3U94A 1MRPA 3IL1B 1Q35A 1B3HA 4U23A 1MPBA 2FNCA 4GIZA 2X26A 5H8SA 3K6UA 2DWIA 3EF7A 2V25A 3B7DA 3G3KA 1FQDA 4MLVA 3OO7A 3TKDA 3BBRA 2ONRA 1RDZA 4PAIA 3MWBA 4YB7A 4DXBA 2O68A 4RK9A 1FTMA 1XOCA 1VR5A 3S4UA 3CR9A 1D3KA 2KLFA 3OO9A 4BDMA 3H7MA 3O6HA 3Q27A 1B5HA 4G77A 4HTGA 3MP8A 3N5LA 4FEDA 2XXKA 3U1OA 1B7HA 2H25A 1DOTA 4NX1A 1AMFA 4OXVA 4NF0A 1NNFA 3U93A 3FV2A 1FTAA 1Y20A 4ELOA 5AA2D 4XFEA 4Q0CA 3T9VA 2OWSA 1J1NA 1UTHB 1UTHA 1LFIA 1FBPA 2DSFA 3D4CA 1NUYA 3CVGA 1NV1A 3IORA 3GLBA 4YZZA 4YMBA 2RCAA 3M3KA 2OWTA 2XXUA 1NV7A 4K3FA 1O63A 2D3IA 4EUOA 1MH4A 3UP9A 1P1NA 1MS7A 3VXBA 3CIJA 4H8IA 4OVTA 3SETA 3HPIA 3IJOB 1JEUA 1N84A 4I62A 1ZBMA 4P1EA 2WX9A 4EXKA 4PGPA 1SW2A 1NNKA 4LUBA 3KN3A 1POTA 3E78A 4O8MA 2XWVA 1B32A 1URGA 2ZYKA 1IMAA 1B3LA 5J1DA 1P1OA 3RN8A 4YB6A 3ZSFA 3CG3A 1USYH 4H5GA 3IO6A 4IR8A 4OVSA 3TTLA 4UA8A 1MH3A 2I48A 2ONKE 3BFTA 2OZZA 1NKXA 2XX9A 3N26A 2Y5LA 5CBSA 4MAGA 1OVBA 5ITOA 2G29A 3S9MC 4GX4A 1L5TA 4OVRA 1B9JA 3DP8A 4FECA 2Q8MA 2QJEA 2DVZA 3HCQA 4OFOA 4R75A 4G61A 3I6VA 3PPNA 4IY5A 2HXWA 4PFUA 1Y1MA 2I49A 2Y7RA 3QSLA 4P0IA 3W9VA 4GLIA 4PF8A 2IA4A 5IZZA 2RC8A 2MKZA 4N8YA 3EHSA 3OENA 5B70A 3KGCA 4U1ZA 5FTHA 3K01A 4N17A 3MZBA 1OIBA 3KOSA 3Q26A 2Q2AA 4PAFA 3GXAA 4OENA 2B3BA 2ZYNA 1Y3PA 3QIMA 1JVYA 3G7WA 4H45A 3TPAA 3U72A 2OJTA 1SW4A 3N94A 1NV4A 3V8XB 1UQWA 5I5PA 3TELA 4ZEBA 2D21A 4QF9A 2XXTA 1SPIA 3K00A 3LSXA 1FBGA 1MXUA 5IZ3B 5IKBA 5IZ3A 1MXWA 4DE8A 2AIXA 2RF1A 3VDFA 3PV0E 5L9OA 2UYEA 5H8NB 5FHNA 5H8NA 1B1HA 2UVGA 1FPIA 4GBWA 2ONSA 3MZ1A 2QL3A 1PEBA 4F29A 4R9FA 1QKBA 1QKAA 3KJTA 1II5A 3T1BA 3PMWA 3PPQA 2NVUB 4H5FA 3N6UA 3ECRA 5FTIA 1SYIA 4JVCA 2GH9A 1FQBA 1LAGE 3LUZA 1QUJA 4RJZA 4N6PA 1S7YA 3U92A 4OYVA 2HPGA 4R6YA 4AB6A 2O69A 1B2HA 3TDJA 1K9ZA 4LATA 3C36A 1MPCA 4KR5A 3RPWA 3TYHA 4IY6A 4RY1A 3CFLA 3MQ9A 1QW0A 4G4PA 5TPAB 4F1UA 5TPAA 1MXZA 4NF6B 1S50A 1OQHA 5I7IA 2OCUA 4NF6A 3R7XA 3KZGA 1LEVA 2OWZA 1PDAA 1MG1A 4H1XA 3KN8A 1TWYA 1B7UA 1JW5A 2I4BA 3MPKA 4LONB 5AA3A 4LZ8A 4RA1A 5LOMA 1MXYA 5IZ1A 2FIEA 3UORA 1B46A 3I5OA 2HAUA 1B5IA 1LCFA 3CSGA 1IMCA 2F78A 3OOAA 3IOUA 5FHMA 3MSTA 4AS5A 2X7QA 1WDNA 4KXPA 5EYHA 4BDLA 1LGBC 2GHBA 3TODA 4N8GA 2QS2A 5CM6A 4TLMB 1YCJA 1FW0A 4FAJA 3T9HB 3BFUA 2WEFA 3RYDA 1FBDA 2Z8FA 5BWJA 1M5EA 3MUQA 3T0JA 4JWYA 4GWYA 2VPNA 3S9LC 1M5FA 4U2RA 3OXNA 3IB2A 1DK4A 1LAFE 4IGTA 5AA2B 1OLAA 5J16A 5AA2A 1ELJA 4RXLA 2WYPA 1PBPA 2V3UA 5DEXB 2H5YA 5DEXA 3PUZE 1G0IA 4MNCA 3MVXA 3EHUA 4DLDA 3DELB 4N81A 3C9HA 5CRYA 4YKIA 1LB9A 1UIVA 5EYFA 2O1LA 4PFTA 1NFTA 2Q89A 1FPEA 1JQFA 4O7MA 4JSOA 3A3UA 4MNIA 3MJNA 3U8QA 4DIGA 1D4NA 2VT5A 1VDWA 4JVIA 3IX1A 4EDPA 1N04A 3RTFB 2AL5A 4X9TA 2QS4A 4I9DA 4POXA 4GWOA 1OVTA 1BKAA 2RKMA 3ILTB 3K4UA 4NHBA 5CMCA 4PFWA 3TTKA 4E0XA 1N7WA 2ANJA 3FXRA 2GQ1A 3LSFB 3S2VA 2F7CA 2WYKA 4I8CA 5I3SA 1FQFA 2THIA 3K6VA 3FJ7A 2QS1A 5ICQA 3CG1A 2HHMA 4DI3D 4NE4A 1IITA 2WBDA 1M5DA 1DCUA 4N91A 3FD3A 4ZZEA 4LA9A 3QXMA 2P3VA 3M3FA 3T93B 3DP4A 4OERA 2H98A 1SI0A 1MQHA 3LBSA 4N6DA 4PC9A 3RQTA 4C1UA 1QGXA 4OESA 3AXFA 4PCDA 3IB0A 5ITPA
chains in the Genus database with same CATH topology
4OETA 3RT6B 1GGGA 3PU5A 2E1SA 3IOWA 1PC3A 1N0TA 4PQJA 2Y7KA 4DDDA 5H8HB 5H8HA 5DVFA 1D9VA 2VHAA 3C31A 3FVOA 1FTJA 2NXOA 3MZ9A 4OVJA 4XKQA 3MPLA 2I0CA 3PPRA 4U1OA 2DQVA 1TXFA 3O6GA 4QSEA 4H6DA 4KFQA 4QFLA 4MH5A 2X7PA 1DPPA 3KJ7A 1TFAA 3RY3A 1MY1A 1B5JA 3KN7A 4QSCA 1ANFA 5IAIA 2QS3A 3PMVA 3EQ1A 4ISUA 4U4XA 3SKPA 2VP1A 5AA4B 1IXHA 4IO2A 3H6WA 4XKNA 4JBZA 2D5WA 4OEUA 5DVJA 1H3DA 4MFIA 4ELRA 4IO4A 1T0KA 2UVHA 2HZKA 3H6TA 4RNSA 2NWJA 4NTLA 4ELPA 1AH5A 1QUIA 1B3GA 4JXIA 2PT1A 3HO7A 1SD3A 1YAEA 3D4GA 4LZ7A 5EHSA 1A40A 3FXQA 4XKPA 4F19A 2REGA 4F3PA 5I2NB 5I2NA 3GBAA 1VFEA 3PUVE 3QUJA 2XXQA 4NMYA 1LSTA 1Y4TA 1F9BA 4TLLB 1JNFA 3M8UA 3CFZA 3FVNA 3M3LA 2PMSA 4ND9A 5A5XB 1EZOA 5A5XA 2VD2A 4JWOA 2RINA 4IO7A 1B52A 4GF8A 2FYIA 4PFYA 4LP2B 2GHAA 4BLAA 3JZJA 4ZDMA 1Z7NE 1Q1KA 2QPQA 1QJMA 1MPDA 5ISUA 3RTWB 3TTRA 2XXXA 3QAXA 1NNTA 1DSNA 2PYYA 3VLVA 5L8DA 5CI5A 1SDXA 2ZYOA 3PGFA 1IEJA 1BLFA 2XXPA 3E9XA 5I58B 1GR2A 2G93A 2O1MA 5I58A 4E0WA 3FASA 3MAMA 2P1SA 2NUVA 1SI1A 1JVXA 3H6UA 2HCAA 3PUXE 3K1MA 1MY3A 3VVEA 3CSBA 1FTLA 5JTYB 2V3TA 2Z8EA 5JTYA 4RYAA 1LBCA 2P2AA 3C35A 1Y9UA 4FEBA 1Y1ZA 4O3BA 2RC9A 3C34A 3IO4A 2HAVA 3TQLA 2OK2A 3QK6A 2AYSA 2V84A 2H99A 3OO8A 1Z7ME 1ATGA 4YB5A 1O7TA 2Y7IA 5AA1A 2ABHA 1BIYA 3RT8A 1USYE 3T22A 4ZZAA 2H4IA 3S9EA 3FVGA 1TT1A 4F31B 1P1WA 1GTKA 3EHTA 4BDNA 3KBRA 4G8HA 2ZYMA 2Z22A 1NNPA 4JDFA 3K02A 5CC2A 1LAHE 5HM4B 1JETA 2CMOA 2REJA 2VOZA 4R2BA 1FTKA 5CBRA 3SESA 1H44A 5HPQA 4O3CA 2A5TB 1Y3NA 2A5TA 2I58A 4I1DA 1B4HA 3MBPA 3OSQA 3FGSA 3TCFA 2DOJA 3WAEA 3P7IA 1B0HA 4N07A 4XIGQ 4R6KA 4H65A 5DT6A 3MC2A 4WKMA 2F7AA 4F1VA 4G68B 1S9TA 4G68A 3KFMA 4GL8A 3JYRA 3PD9A 3FUZA 5B7DA 3TTNA 1IUDA 3IOVA 3O66A 4DXCA 4LQ2A 5HBCA 1CE2A 1URDA 1MY4A 2Z8DA 3FJMA 3V5AA 1R9LA 2OLBA 3TTMA 4ZS9A 2E0SA 3OSRA 3HHFA 4DCXA 1IIWA 2DWJA 1XHYA 4Q8RA 5I56B 3VE1B 5CMKA 5I56A 1ZLQA 1DTZA 4RPOA 3LSWA 4IO3A 2I3VA 3LC8A 1IQ7A 2HFBA 2R6GE 4DCYA 2I0BA 1LFHA 1I69A 2DXRA 4C1TA 3H4ZA 4KPTA 3A09A 3OMBA 4KCCA 5DYHA 3MW0A 5DTBA 4QFPA 4KYSA 4OHNA 3UIFA 3G3GA 3IK6B 1M5BA 5ICTA 4YAHX 1SQYA 5ELVA 3ZKLA 2F8DA 4OMBA 3HV1A 2VD3A 1MY2A 3K1PA 1AL3A 2GRVA 3VXCA 4YKJA 4OWDA 1ZTYA 3TEPA 4F39A 3MVZA 3RGYA 3KSJA 2I3WA 1D9YA 1MQGA 1GV8A 2F36A 4Z0IA 3QYTA 1H43A 4RPNA 3RUMA 1MQIA 1PB9A 3BKIB 3ZKKA 1HSJA 1B05A 3SEWA 4GVOA 1FQAA 2UVJA 5I84A 4KYDA 2R71A 4NF8B 5H8FB 3Q29A 3IAZA 4NF8A 1KWHA 4YKKA 5H8FA 1A55A 1EU8A 4LZ5A 4F1YA 1NH8A 2QMXA 3SEVA 2XXVA 1RYXA 4Q30B 4ELQA 1R9QA 4FJPA 1NL5A 3DP6A 3H03A 2XXHA 3B6TA 3LR1A 4H0WA 5F1QA 3PPOA 5KDTB 2XXRA 1OQGA 1A8FA 5KDTA 3TZAA 3LSLA 3O2AA 5F7VA 5EHMA 4BDOA 1TFDA 2Z23A 2O6AA 2UYFA 3MVWA 5DVIA 3RLFE 3TAJA 2B65A 1LB8A 4OFJA 3ONMA 3O6IA 2Q8JA 3I3VA 1EZ9A 3CI8A 2DE4A 1US4A 2F6GA 3PPPA 3JV9A 1B7ZA 4ZE8A 4F18A 2LAOA 2XD3A 3GBBA 2HEUA 4PETA 4PE5B 1MM6A 4UACA 4NF5B 4F3BA 4TOZA 4NF5A 4FE8A 2V3QA 2RCBA 4ZEFA 1DPEA 3G3FA 4R9GA 4HCYA 2XX7A 4KQPA 1MDQA 2DWHA 3O28A 2NOOA 1N3WA 3USDA 5CMBA 4L17A 4ESWA 1RKMA 5KZTA 2YLNA 4ONYA 1HSLA 1FCKA 4R72A 4MF3A 3IB1A 4KHZE 3T9UA 1R1NA 4JB7A 2YJPA 4U4SA 1MXVA 3FATA 3OELA 4QFKA 2V93A 4ZECA 3KG2A 5K2YA 5AA4A 3FZVA 5KCJB 4WEPA 5KCJA 1NH7A 3KSXA 3C4MA 4GXAA 2Q9TA 4QFOA 3ZS6A 4H67A 1EZPA 4NWDA 3OO6A 4NWCA 3G3JA 4QRZA 2F35A 1N3XA 3MVYA 1Y3QA 1AIVA 3VVFA 3VV5A 2FA7A 3SDFA 2Q2CA 4ESXA 2XX8A 3ODBA 1POY1 1M5CA 3OEMA 3K1NA 2AL4A 4IGRA 4LVQA 1YPNA 4OFLA 4GFRA 2OBGA 3SEUA 3TCGA 4JSDA 2HQ0A 5I59B 3FV1A 4OEVA 4QHQA 5I59A 1DTGA 2I6EA 3DM0A 4XKRA 2DYXA 3CFXA 2PBWA 3K6XA 1IXIA 3MP6A 3PMXA 1B1XA 2F5XA 5I57B 4OQOA 5I57A 1LAXA 4AQ4A 1FQEA 3T96B 4PP0A 4OZ9A 4BDQA 1EH3A 1VFDA 2BJJX 1P99A 3MP1A 4P11A 1ZIUA 2H9BA 3H6VA 1IXGA 4NF4B 4NF4A 3SEXA 1BP5A 1N76A 3HSTA 4FATA 3E4RA 1Y4CA 4F3GA 5CMMA 1VSOA 3WAFA 4THIA 1UIUA 4X48A 2Y7WA 4FORA 2DE2A 2ZNSA 4G68C 3DLNA 3KOTA 1JEVA 3FIRA 1QUKA 1I6BA 3Q25A 1GVCA 3K6WA 2ZMBA 4RK2A 4Q5TA 4LQ5A 4U22A 1MM7A 2QRYA 4BDRA 3VVDA 1UTBB 1ZKBA 3O29A 1SYHA 1UTBA 3T66A 2IEEA 4GXSB 2F6PA 2XXIA 3K0VA 4QSDA 1O64A 4GRKA 5M2VA 3IJXB 2DWAA 2Y7PA 3EPEA 1IZ1A 3QUFA 1SBPA 2XHDA 2YPNA 4X1DA 4DXUA 2PVUA 4XTCQ 1HSEA 1B58A 1B4ZA 3F11A 5TU0A 1JW4A 4ZEKA 2F97A 4X1BA 3PD8A 3UGWA 3C32A 2GFEA 1CB6A 4G8MA 3HHGA 4FIMA 4EQ7A 1JW1A 4KD5A 3N6TA 4G8NA 2DS9A 2O7UA 3UK4A 4TQUQ 2PX1A 4GD5A 3A3CA 4YU0A 3RNNA 3SEYA 3H06B 4C0RA 1MY0A 4IO5A 1SVXB 3OEKA 4F22A 1B6HA 4IB2A 3H3GA 3VFJA 4MLQA 4IO6A 1A54A 1XC1A 1BTJA 4NEDA 3GZGA 3IOTA 1PBQA 4ZE9A 1XVYA 2ZNUA 4EQ9A 5TP9B 3PUYE 4JWXA 5TP9A 3B6WA 1B51A 3L6HA 1PB7A 4XXUA 5I2KB 3C33A 3KEIA 5I2KA 3V89B 4ECFA 3E13X 2F34A 4MBPA 3L6GA 4U21A 1XS5A 3OD7A 2DXYA 1SW1A 4R74A 1NMUA 1LLSA 1N7XA 1OMPA 3TQWA 1OLCA 2W7YA 1US5A 1URSA 5JK4A 3R6UA 4GQOA 4KCDA 3LUYA 3B6QA 4EXLA 3E3KA 5JEIA 3G3IA 2ZNTA 4ZEDA 3HN0A 1LFGA 2I4CA 2ALUA 4R73A 1ZJLA 2O7IA 2VGQA 4POWA 2ESNA 5L9MA 1LBBA 2DP8A 5AE4A 3Q28A 2DVCA 1IXCA 1QVSA 4R6HA 4KYEA 1R6ZA 2XXYA 2P0SA 1SW5A 2Y84A 4F2QA 1WVJA 4QFNA 1H45A 3K2DA 4YMAA 2Q88A 4P0GA 4N13A 4HS7A 2XD2A 5FHOA 4HW8A 4WXJA 1MDP1 1P1UA 3FVKA 4YKPA 1MQDA 1QULA 3SERA 1ZMGA 1FQCA 4EF2A 1B40A 3EN3A 4ZEIA 1XVXA 1MQJA 4GOTA 4OTEA 5L9SA 4AB5A 2R9JA 1A8EA 2QSXA 1DMBA 2DE3A 2O51A 3TMGA 4G2ZA 4O3AA 2RC7A 3FJGA 1WODA 1H76A 2QMWA 3TUSA 1PB8A 1A7LA 1I6AA 2HZLA 1MXXA 4DZ1A 3O97A 3V83A 1B3EA 1FTOA 1AOVA 4WEDA 5K2XA 4F3SA 3THIA 1A99A 3VLWA 2UXAA 4KI0E 3TCHA 2ZXTA 2WKYA 4EF1A 3O9PA 5BUUA 3G3HA 4R2FA 3PUWE 3IR1A 1LCTA 3VLUA 5H8QB 2M8CA 3R26A 2XXWA 4H8JA 5H8QA 1I6QA 3T9XB 1B0LA 1XT8A 1YTVA 3TFLA 2O84X 2F7BA 4M1VA 1B3FA 2B3FA 3FXUA 4HCWA 4YICA 1VE4A 2CZLA 1P1QA 4M4GA 4F2OA 4GL0A 3ILUB 3UN6A 1RYOA 3S9NC 3CRBA 2UVIA 4Z7EA 3UA8A 1ZU0A 2PT2A 4EQBA 2A5SA 3W9WA 3W15C 3U94A 1MRPA 3IL1B 1Q35A 1B3HA 4U23A 1MPBA 2FNCA 4GIZA 2X26A 5H8SA 3K6UA 2DWIA 3EF7A 2V25A 3B7DA 3G3KA 1FQDA 4MLVA 3OO7A 3TKDA 3BBRA 2ONRA 3MWBA 4YB7A 4DXBA 2O68A 4RK9A 1FTMA 1XOCA 1VR5A 3S4UA 3CR9A 1D3KA 2KLFA 3OO9A 4BDMA 3H7MA 3O6HA 3Q27A 1B5HA 4G77A 4FEDA 3MP8A 3N5LA 4HTGA 3U1OA 1B7HA 2H25A 1DOTA 1AMFA 4OXVA 1NNFA 3U93A 3FV2A 1Y20A 4ELOA 5AA2D 4Q0CA 3T9VA 2OWSA 1J1NA 1UTHB 1UTHA 1LFIA 2DSFA 3D4CA 3CVGA 3IORA 3GLBA 4YZZA 4YMBA 2RCAA 3M3KA 2OWTA 2XXUA 4K3FA 1O63A 2D3IA 4EUOA 1MH4A 3UP9A 1P1NA 1MS7A 3VXBA 3CIJA 4H8IA 3SETA 3HPIA 3IJOB 1JEUA 1N84A 4I62A 1ZBMA 4EXKA 1SW2A 1NNKA 4LUBA 3KN3A 1POTA 1B32A 1URGA 2ZYKA 1B3LA 5J1DA 1P1OA 3RN8A 4YB6A 3ZSFA 3CG3A 1USYH 4H5GA 3IO6A 3TTLA 4UA8A 1MH3A 2I48A 2ONKE 3BFTA 2OZZA 1NKXA 2XX9A 3N26A 5CBSA 1OVBA 5ITOA 2G29A 3S9MC 1L5TA 1B9JA 3DP8A 4FECA 2QJEA 2DVZA 3HCQA 4OFOA 4R75A 3I6VA 3PPNA 4IY5A 2HXWA 4PFUA 1Y1MA 2I49A 2Y7RA 3QSLA 4P0IA 3W9VA 4GLIA 2IA4A 2RC8A 3EHSA 3OENA 5B70A 3KGCA 4U1ZA 5FTHA 3K01A 3MZBA 1OIBA 3KOSA 3Q26A 2Q2AA 3GXAA 4OENA 2B3BA 2ZYNA 1Y3PA 3QIMA 1JVYA 3G7WA 3TPAA 3U72A 2OJTA 1SW4A 3N94A 3V8XB 1UQWA 3TELA 4ZEBA 2D21A 4QF9A 2XXTA 3K00A 3LSXA 1MXUA 5IKBA 1MXWA 4DE8A 2AIXA 2RF1A 3VDFA 3PV0E 5L9OA 2UYEA 5H8NB 5FHNA 5H8NA 1B1HA 2UVGA 2ONSA 3MZ1A 2QL3A 1PEBA 4F29A 4R9FA 1QKBA 1QKAA 3KJTA 1II5A 3PMWA 3PPQA 2NVUB 4H5FA 3N6UA 3ECRA 5FTIA 1SYIA 2GH9A 1FQBA 1LAGE 1QUJA 4RJZA 4N6PA 1S7YA 3U92A 4OYVA 4R6YA 4AB6A 2O69A 1B2HA 3TDJA 4LATA 3C36A 1MPCA 4KR5A 3RPWA 3TYHA 4IY6A 4RY1A 3CFLA 3MQ9A 1QW0A 4G4PA 5TPAB 4F1UA 5TPAA 1MXZA 4NF6B 1S50A 1OQHA 2OCUA 4NF6A 3R7XA 3KZGA 1PDAA 1MG1A 4H1XA 3KN8A 1TWYA 1B7UA 1JW5A 2I4BA 3MPKA 4LONB 5AA3A 4LZ8A 4RA1A 5LOMA 1MXYA 3UORA 1B46A 3I5OA 2HAUA 1B5IA 1LCFA 3CSGA 2F78A 3OOAA 3IOUA 5FHMA 2X7QA 1WDNA 4BDLA 1LGBC 2GHBA 3TODA 2QS2A 5CM6A 4TLMB 1YCJA 1FW0A 4FAJA 3T9HB 3BFUA 2Z8FA 5BWJA 1M5EA 3MUQA 4JWYA 3S9LC 1M5FA 4U2RA 3OXNA 3IB2A 1LAFE 4IGTA 5AA2B 1OLAA 5AA2A 1ELJA 4RXLA 1PBPA 2V3UA 5DEXB 2H5YA 5DEXA 3PUZE 3MVXA 3EHUA 4DLDA 3DELB 3C9HA 5CRYA 4YKIA 1LB9A 1UIVA 5EYFA 2O1LA 4PFTA 1NFTA 2Q89A 1JQFA 4JSOA 3A3UA 3MJNA 3U8QA 4DIGA 1D4NA 3IX1A 4EDPA 1N04A 3RTFB 2AL5A 4X9TA 2QS4A 4I9DA 4POXA 4GWOA 1OVTA 1BKAA 2RKMA 3ILTB 3K4UA 5CMCA 4PFWA 3TTKA 4E0XA 1N7WA 2ANJA 3FXRA 3LSFB 3S2VA 2F7CA 4I8CA 1FQFA 2THIA 3K6VA 3FJ7A 2QS1A 5ICQA 3CG1A 4NE4A 1IITA 1M5DA 3FD3A 4ZZEA 4LA9A 3QXMA 3M3FA 3T93B 3DP4A 4OERA 2H98A 1SI0A 1MQHA 3LBSA 3RQTA 4C1UA 4OESA 3AXFA 3IB0A 5ITPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OET A;  3RT6 B;  1GGG A;  3PU5 A;  2E1S A;  3IOW A;  1PC3 A;  1N0T A;  4PQJ A;  2Y7K A;  4DDD A;  5H8H B;  5H8H A;  5DVF A;  1D9V A;  2VHA A;  3C31 A;  3FVO A;  1FTJ A;  2NXO A;  3MZ9 A;  4OVJ A;  4XKQ A;  3MPL A;  2I0C A;  3PPR A;  4U1O A;  2DQV A;  1TXF A;  3O6G A;  4QSE A;  4H6D A;  4KFQ A;  4QFL A;  4MH5 A;  2X7P A;  1DPP A;  3KJ7 A;  1TFA A;  3RY3 A;  1MY1 A;  1B5J A;  3KN7 A;  4QSC A;  1ANF A;  5IAI A;  2QS3 A;  3PMV A;  3EQ1 A;  4ISU A;  4U4X A;  3SKP A;  2VP1 A;  5AA4 B;  1IXH A;  4IO2 A;  3H6W A;  4XKN A;  4JBZ A;  2D5W A;  4OEU A;  5DVJ A;  1H3D A;  4MFI A;  4ELR A;  4IO4 A;  1T0K A;  2UVH A;  2HZK A;  3H6T A;  4RNS A;  2NWJ A;  4NTL A;  4ELP A;  1AH5 A;  1QUI A;  1B3G A;  4JXI A;  2PT1 A;  3HO7 A;  1SD3 A;  1YAE A;  3D4G A;  4LZ7 A;  5EHS A;  1A40 A;  3FXQ A;  4XKP A;  4F19 A;  2REG A;  4F3P A;  5I2N B;  5I2N A;  3GBA A;  1VFE A;  3PUV E;  3QUJ A;  2XXQ A;  4NMY A;  1LST A;  1Y4T A;  1F9B A;  4TLL B;  1JNF A;  3M8U A;  3CFZ A;  3FVN A;  3M3L A;  2PMS A;  4ND9 A;  5A5X B;  1EZO A;  5A5X A;  2VD2 A;  4JWO A;  2RIN A;  4IO7 A;  1B52 A;  4GF8 A;  2FYI A;  4PFY A;  4LP2 B;  2GHA A;  4BLA A;  3JZJ A;  4ZDM A;  1Z7N E;  1Q1K A;  2QPQ A;  1QJM A;  1MPD A;  5ISU A;  3RTW B;  3TTR A;  2XXX A;  3QAX A;  1NNT A;  1DSN A;  2PYY A;  3VLV A;  5L8D A;  5CI5 A;  1SDX A;  2ZYO A;  3PGF A;  1IEJ A;  1BLF A;  2XXP A;  3E9X A;  5I58 B;  1GR2 A;  2G93 A;  2O1M A;  5I58 A;  4E0W A;  3FAS A;  3MAM A;  2P1S A;  2NUV A;  1SI1 A;  1JVX A;  3H6U A;  2HCA A;  3PUX E;  3K1M A;  1MY3 A;  3VVE A;  3CSB A;  1FTL A;  5JTY B;  2V3T A;  2Z8E A;  5JTY A;  4RYA A;  1LBC A;  2P2A A;  3C35 A;  1Y9U A;  4FEB A;  1Y1Z A;  4O3B A;  2RC9 A;  3C34 A;  3IO4 A;  2HAV A;  3TQL A;  2OK2 A;  3QK6 A;  2AYS A;  2V84 A;  2H99 A;  3OO8 A;  1Z7M E;  1ATG A;  4YB5 A;  1O7T A;  2Y7I A;  5AA1 A;  2ABH A;  1BIY A;  3RT8 A;  1USY E;  3T22 A;  4ZZA A;  2H4I A;  3S9E A;  3FVG A;  1TT1 A;  4F31 B;  1P1W A;  1GTK A;  3EHT A;  4BDN A;  3KBR A;  4G8H A;  2ZYM A;  2Z22 A;  1NNP A;  4JDF A;  3K02 A;  5CC2 A;  1LAH E;  5HM4 B;  1JET A;  2CMO A;  2REJ A;  2VOZ A;  4R2B A;  1FTK A;  5CBR A;  3SES A;  1H44 A;  5HPQ A;  4O3C A;  2A5T B;  1Y3N A;  2A5T A;  2I58 A;  4I1D A;  1B4H A;  3MBP A;  3OSQ A;  3FGS A;  3TCF A;  2DOJ A;  3WAE A;  3P7I A;  1B0H A;  4N07 A;  4XIG Q;  4R6K A;  4H65 A;  5DT6 A;  3MC2 A;  4WKM A;  2F7A A;  4F1V A;  4G68 B;  1S9T A;  4G68 A;  3KFM A;  4GL8 A;  3JYR A;  3PD9 A;  3FUZ A;  5B7D A;  3TTN A;  1IUD A;  3IOV A;  3O66 A;  4DXC A;  4LQ2 A;  5HBC A;  1CE2 A;  1URD A;  1MY4 A;  2Z8D A;  3FJM A;  3V5A A;  1R9L A;  2OLB A;  3TTM A;  4ZS9 A;  2E0S A;  3OSR A;  3HHF A;  4DCX A;  1IIW A;  2DWJ A;  1XHY A;  4Q8R A;  5I56 B;  3VE1 B;  5CMK A;  5I56 A;  1ZLQ A;  1DTZ A;  4RPO A;  3LSW A;  4IO3 A;  2I3V A;  3LC8 A;  1IQ7 A;  2HFB A;  2R6G E;  4DCY A;  2I0B A;  1LFH A;  1I69 A;  2DXR A;  4C1T A;  3H4Z A;  4KPT A;  3A09 A;  3OMB A;  4KCC A;  5DYH A;  3MW0 A;  5DTB A;  4QFP A;  4KYS A;  4OHN A;  3UIF A;  3G3G A;  3IK6 B;  1M5B A;  5ICT A;  4YAH X;  1SQY A;  5ELV A;  3ZKL A;  2F8D A;  4OMB A;  3HV1 A;  2VD3 A;  1MY2 A;  3K1P A;  1AL3 A;  2GRV A;  3VXC A;  4YKJ A;  4OWD A;  1ZTY A;  3TEP A;  4F39 A;  3MVZ A;  3RGY A;  3KSJ A;  2I3W A;  1D9Y A;  1MQG A;  1GV8 A;  2F36 A;  4Z0I A;  3QYT A;  1H43 A;  4RPN A;  3RUM A;  1MQI A;  1PB9 A;  3BKI B;  3ZKK A;  1HSJ A;  1B05 A;  3SEW A;  4GVO A;  1FQA A;  2UVJ A;  5I84 A;  4KYD A;  2R71 A;  4NF8 B;  5H8F B;  3Q29 A;  3IAZ A;  4NF8 A;  1KWH A;  4YKK A;  5H8F A;  1A55 A;  1EU8 A;  4LZ5 A;  4F1Y A;  1NH8 A;  2QMX A;  3SEV A;  2XXV A;  1RYX A;  4Q30 B;  4ELQ A;  1R9Q A;  4FJP A;  1NL5 A;  3DP6 A;  3H03 A;  2XXH A;  3B6T A;  3LR1 A;  4H0W A;  5F1Q A;  3PPO A;  5KDT B;  2XXR A;  1OQG A;  1A8F A;  5KDT A;  3TZA A;  3LSL A;  3O2A A;  5F7V A;  5EHM A;  4BDO A;  1TFD A;  2Z23 A;  2O6A A;  2UYF A;  3MVW A;  5DVI A;  3RLF E;  3TAJ A;  2B65 A;  1LB8 A;  4OFJ A;  3ONM A;  3O6I A;  2Q8J A;  3I3V A;  1EZ9 A;  3CI8 A;  2DE4 A;  1US4 A;  2F6G A;  3PPP A;  3JV9 A;  1B7Z A;  4ZE8 A;  4F18 A;  2LAO A;  2XD3 A;  3GBB A;  2HEU A;  4PET A;  4PE5 B;  1MM6 A;  4UAC A;  4NF5 B;  4F3B A;  4TOZ A;  4NF5 A;  4FE8 A;  2V3Q A;  2RCB A;  4ZEF A;  1DPE A;  3G3F A;  4R9G A;  4HCY A;  2XX7 A;  4KQP A;  1MDQ A;  2DWH A;  3O28 A;  2NOO A;  1N3W A;  3USD A;  5CMB A;  4L17 A;  4ESW A;  1RKM A;  5KZT A;  2YLN A;  4ONY A;  1HSL A;  1FCK A;  4R72 A;  4MF3 A;  3IB1 A;  4KHZ E;  3T9U A;  1R1N A;  4JB7 A;  2YJP A;  4U4S A;  1MXV A;  3FAT A;  3OEL A;  4QFK A;  2V93 A;  4ZEC A;  3KG2 A;  5K2Y A;  5AA4 A;  3FZV A;  5KCJ B;  4WEP A;  5KCJ A;  1NH7 A;  3KSX A;  3C4M A;  4GXA A;  2Q9T A;  4QFO A;  3ZS6 A;  4H67 A;  1EZP A;  4NWD A;  3OO6 A;  4NWC A;  3G3J A;  4QRZ A;  2F35 A;  1N3X A;  3MVY A;  1Y3Q A;  1AIV A;  3VVF A;  3VV5 A;  2FA7 A;  3SDF A;  2Q2C A;  4ESX A;  2XX8 A;  3ODB A;  1POY 1;  1M5C A;  3OEM A;  3K1N A;  2AL4 A;  4IGR A;  4LVQ A;  1YPN A;  4OFL A;  4GFR A;  2OBG A;  3SEU A;  3TCG A;  4JSD A;  2HQ0 A;  5I59 B;  3FV1 A;  4OEV A;  4QHQ A;  5I59 A;  1DTG A;  2I6E A;  3DM0 A;  4XKR A;  2DYX A;  3CFX A;  2PBW A;  3K6X A;  1IXI A;  3MP6 A;  3PMX A;  1B1X A;  2F5X A;  5I57 B;  4OQO A;  5I57 A;  1LAX A;  4AQ4 A;  1FQE A;  3T96 B;  4PP0 A;  4OZ9 A;  4BDQ A;  1EH3 A;  1VFD A;  2BJJ X;  1P99 A;  3MP1 A;  4P11 A;  1ZIU A;  2H9B A;  3H6V A;  1IXG A;  4NF4 B;  4NF4 A;  3SEX A;  1BP5 A;  1N76 A;  3HST A;  4FAT A;  3E4R A;  1Y4C A;  4F3G A;  5CMM A;  1VSO A;  3WAF A;  4THI A;  1UIU A;  4X48 A;  2Y7W A;  4FOR A;  2DE2 A;  2ZNS A;  4G68 C;  3DLN A;  3KOT A;  1JEV A;  3FIR A;  1QUK A;  1I6B A;  3Q25 A;  1GVC A;  3K6W A;  2ZMB A;  4RK2 A;  4Q5T A;  4LQ5 A;  4U22 A;  1MM7 A;  2QRY A;  4BDR A;  3VVD A;  1UTB B;  1ZKB A;  3O29 A;  1SYH A;  1UTB A;  3T66 A;  2IEE A;  4GXS B;  2F6P A;  2XXI A;  3K0V A;  4QSD A;  1O64 A;  4GRK A;  5M2V A;  3IJX B;  2DWA A;  2Y7P A;  3EPE A;  1IZ1 A;  3QUF A;  1SBP A;  2XHD A;  2YPN A;  4X1D A;  4DXU A;  2PVU A;  4XTC Q;  1HSE A;  1B58 A;  1B4Z A;  3F11 A;  5TU0 A;  1JW4 A;  4ZEK A;  2F97 A;  4X1B A;  3PD8 A;  3UGW A;  3C32 A;  2GFE A;  1CB6 A;  4G8M A;  3HHG A;  4FIM A;  4EQ7 A;  1JW1 A;  4KD5 A;  3N6T A;  4G8N A;  2DS9 A;  2O7U A;  3UK4 A;  4TQU Q;  2PX1 A;  4GD5 A;  3A3C A;  4YU0 A;  3RNN A;  3SEY A;  3H06 B;  4C0R A;  1MY0 A;  4IO5 A;  1SVX B;  3OEK A;  4F22 A;  1B6H A;  4IB2 A;  3H3G A;  3VFJ A;  4MLQ A;  4IO6 A;  1A54 A;  1XC1 A;  1BTJ A;  4NED A;  3GZG A;  3IOT A;  1PBQ A;  4ZE9 A;  1XVY A;  2ZNU A;  4EQ9 A;  5TP9 B;  3PUY E;  4JWX A;  5TP9 A;  3B6W A;  1B51 A;  3L6H A;  1PB7 A;  4XXU A;  5I2K B;  3C33 A;  3KEI A;  5I2K A;  3V89 B;  4ECF A;  3E13 X;  2F34 A;  4MBP A;  3L6G A;  4U21 A;  1XS5 A;  3OD7 A;  2DXY A;  1SW1 A;  4R74 A;  1NMU A;  1LLS A;  1N7X A;  1OMP A;  3TQW A;  1OLC A;  2W7Y A;  1US5 A;  1URS A;  5JK4 A;  3R6U A;  4GQO A;  4KCD A;  3LUY A;  3B6Q A;  4EXL A;  3E3K A;  5JEI A;  3G3I A;  2ZNT A;  4ZED A;  3HN0 A;  1LFG A;  2I4C A;  2ALU A;  4R73 A;  1ZJL A;  2O7I A;  2VGQ A;  4POW A;  2ESN A;  5L9M A;  1LBB A;  2DP8 A;  5AE4 A;  3Q28 A;  2DVC A;  1IXC A;  1QVS A;  4R6H A;  4KYE A;  1R6Z A;  2XXY A;  2P0S A;  1SW5 A;  2Y84 A;  4F2Q A;  1WVJ A;  4QFN A;  1H45 A;  3K2D A;  4YMA A;  2Q88 A;  4P0G A;  4N13 A;  4HS7 A;  2XD2 A;  5FHO A;  4HW8 A;  4WXJ A;  1MDP 1;  1P1U A;  3FVK A;  4YKP A;  1MQD A;  1QUL A;  3SER A;  1ZMG A;  1FQC A;  4EF2 A;  1B40 A;  3EN3 A;  4ZEI A;  1XVX A;  1MQJ A;  4GOT A;  4OTE A;  5L9S A;  4AB5 A;  2R9J A;  1A8E A;  2QSX A;  1DMB A;  2DE3 A;  2O51 A;  3TMG A;  4G2Z A;  4O3A A;  2RC7 A;  3FJG A;  1WOD A;  1H76 A;  2QMW A;  3TUS A;  1PB8 A;  1A7L A;  1I6A A;  2HZL A;  1MXX A;  4DZ1 A;  3O97 A;  3V83 A;  1B3E A;  1FTO A;  1AOV A;  4WED A;  5K2X A;  4F3S A;  3THI A;  1A99 A;  3VLW A;  2UXA A;  4KI0 E;  3TCH A;  2ZXT A;  2WKY A;  4EF1 A;  3O9P A;  5BUU A;  3G3H A;  4R2F A;  3PUW E;  3IR1 A;  1LCT A;  3VLU A;  5H8Q B;  2M8C A;  3R26 A;  2XXW A;  4H8J A;  5H8Q A;  1I6Q A;  3T9X B;  1B0L A;  1XT8 A;  1YTV A;  3TFL A;  2O84 X;  2F7B A;  4M1V A;  1B3F A;  2B3F A;  3FXU A;  4HCW A;  4YIC A;  1VE4 A;  2CZL A;  1P1Q A;  4M4G A;  4F2O A;  4GL0 A;  3ILU B;  3UN6 A;  1RYO A;  3S9N C;  3CRB A;  2UVI A;  4Z7E A;  3UA8 A;  1ZU0 A;  2PT2 A;  4EQB A;  2A5S A;  3W9W A;  3W15 C;  3U94 A;  1MRP A;  3IL1 B;  1Q35 A;  1B3H A;  4U23 A;  1MPB A;  2FNC A;  4GIZ A;  2X26 A;  5H8S A;  3K6U A;  2DWI A;  3EF7 A;  2V25 A;  3B7D A;  3G3K A;  1FQD A;  4MLV A;  3OO7 A;  3TKD A;  3BBR A;  2ONR A;  3MWB A;  4YB7 A;  4DXB A;  2O68 A;  4RK9 A;  1FTM A;  1XOC A;  1VR5 A;  3S4U A;  3CR9 A;  1D3K A;  2KLF A;  3OO9 A;  4BDM A;  3H7M A;  3O6H A;  3Q27 A;  1B5H A;  4G77 A;  4FED A;  3MP8 A;  3N5L A;  4HTG A;  3U1O A;  1B7H A;  2H25 A;  1DOT A;  1AMF A;  4OXV A;  1NNF A;  3U93 A;  3FV2 A;  1Y20 A;  4ELO A;  5AA2 D;  4Q0C A;  3T9V A;  2OWS A;  1J1N A;  1UTH B;  1UTH A;  1LFI A;  2DSF A;  3D4C A;  3CVG A;  3IOR A;  3GLB A;  4YZZ A;  4YMB A;  2RCA A;  3M3K A;  2OWT A;  2XXU A;  4K3F A;  1O63 A;  2D3I A;  4EUO A;  1MH4 A;  3UP9 A;  1P1N A;  1MS7 A;  3VXB A;  3CIJ A;  4H8I A;  3SET A;  3HPI A;  3IJO B;  1JEU A;  1N84 A;  4I62 A;  1ZBM A;  4EXK A;  1SW2 A;  1NNK A;  4LUB A;  3KN3 A;  1POT A;  1B32 A;  1URG A;  2ZYK A;  1B3L A;  5J1D A;  1P1O A;  3RN8 A;  4YB6 A;  3ZSF A;  3CG3 A;  1USY H;  4H5G A;  3IO6 A;  3TTL A;  4UA8 A;  1MH3 A;  2I48 A;  2ONK E;  3BFT A;  2OZZ A;  1NKX A;  2XX9 A;  3N26 A;  5CBS A;  1OVB A;  5ITO A;  2G29 A;  3S9M C;  1L5T A;  1B9J A;  3DP8 A;  4FEC A;  2QJE A;  2DVZ A;  3HCQ A;  4OFO A;  4R75 A;  3I6V A;  3PPN A;  4IY5 A;  2HXW A;  4PFU A;  1Y1M A;  2I49 A;  2Y7R A;  3QSL A;  4P0I A;  3W9V A;  4GLI A;  2IA4 A;  2RC8 A;  3EHS A;  3OEN A;  5B70 A;  3KGC A;  4U1Z A;  5FTH A;  3K01 A;  3MZB A;  1OIB A;  3KOS A;  3Q26 A;  2Q2A A;  3GXA A;  4OEN A;  2B3B A;  2ZYN A;  1Y3P A;  3QIM A;  1JVY A;  3G7W A;  3TPA A;  3U72 A;  2OJT A;  1SW4 A;  3N94 A;  3V8X B;  1UQW A;  3TEL A;  4ZEB A;  2D21 A;  4QF9 A;  2XXT A;  3K00 A;  3LSX A;  1MXU A;  5IKB A;  1MXW A;  4DE8 A;  2AIX A;  2RF1 A;  3VDF A;  3PV0 E;  5L9O A;  2UYE A;  5H8N B;  5FHN A;  5H8N A;  1B1H A;  2UVG A;  2ONS A;  3MZ1 A;  2QL3 A;  1PEB A;  4F29 A;  4R9F A;  1QKB A;  1QKA A;  3KJT A;  1II5 A;  3PMW A;  3PPQ A;  2NVU B;  4H5F A;  3N6U A;  3ECR A;  5FTI A;  1SYI A;  2GH9 A;  1FQB A;  1LAG E;  1QUJ A;  4RJZ A;  4N6P A;  1S7Y A;  3U92 A;  4OYV A;  4R6Y A;  4AB6 A;  2O69 A;  1B2H A;  3TDJ A;  4LAT A;  3C36 A;  1MPC A;  4KR5 A;  3RPW A;  3TYH A;  4IY6 A;  4RY1 A;  3CFL A;  3MQ9 A;  1QW0 A;  4G4P A;  5TPA B;  4F1U A;  5TPA A;  1MXZ A;  4NF6 B;  1S50 A;  1OQH A;  2OCU A;  4NF6 A;  3R7X A;  3KZG A;  1PDA A;  1MG1 A;  4H1X A;  3KN8 A;  1TWY A;  1B7U A;  1JW5 A;  2I4B A;  3MPK A;  4LON B;  5AA3 A;  4LZ8 A;  4RA1 A;  5LOM A;  1MXY A;  3UOR A;  1B46 A;  3I5O A;  2HAU A;  1B5I A;  1LCF A;  3CSG A;  2F78 A;  3OOA A;  3IOU A;  5FHM A;  2X7Q A;  1WDN A;  4BDL A;  1LGB C;  2GHB A;  3TOD A;  2QS2 A;  5CM6 A;  4TLM B;  1YCJ A;  1FW0 A;  4FAJ A;  3T9H B;  3BFU A;  2Z8F A;  5BWJ A;  1M5E A;  3MUQ A;  4JWY A;  3S9L C;  1M5F A;  4U2R A;  3OXN A;  3IB2 A;  1LAF E;  4IGT A;  5AA2 B;  1OLA A;  5AA2 A;  1ELJ A;  4RXL A;  1PBP A;  2V3U A;  5DEX B;  2H5Y A;  5DEX A;  3PUZ E;  3MVX A;  3EHU A;  4DLD A;  3DEL B;  3C9H A;  5CRY A;  4YKI A;  1LB9 A;  1UIV A;  5EYF A;  2O1L A;  4PFT A;  1NFT A;  2Q89 A;  1JQF A;  4JSO A;  3A3U A;  3MJN A;  3U8Q A;  4DIG A;  1D4N A;  3IX1 A;  4EDP A;  1N04 A;  3RTF B;  2AL5 A;  4X9T A;  2QS4 A;  4I9D A;  4POX A;  4GWO A;  1OVT A;  1BKA A;  2RKM A;  3ILT B;  3K4U A;  5CMC A;  4PFW A;  3TTK A;  4E0X A;  1N7W A;  2ANJ A;  3FXR A;  3LSF B;  3S2V A;  2F7C A;  4I8C A;  1FQF A;  2THI A;  3K6V A;  3FJ7 A;  2QS1 A;  5ICQ A;  3CG1 A;  4NE4 A;  1IIT A;  1M5D A;  3FD3 A;  4ZZE A;  4LA9 A;  3QXM A;  3M3F A;  3T93 B;  3DP4 A;  4OER A;  2H98 A;  1SI0 A;  1MQH A;  3LBS A;  3RQT A;  4C1U A;  4OES A;  3AXF A;  3IB0 A;  5ITP A; 
#chains in the Genus database with same CATH topology
 4OET A;  3RT6 B;  1GGG A;  3PU5 A;  2E1S A;  3IOW A;  1PC3 A;  1N0T A;  4PQJ A;  2Y7K A;  4DDD A;  4P47 A;  5H8H B;  5H8H A;  5DVF A;  1D9V A;  2VHA A;  3C31 A;  3FVO A;  1KA1 A;  4FBP A;  1FTJ A;  2NXO A;  3MZ9 A;  4OVJ A;  4XKQ A;  3MPL A;  2I0C A;  3PPR A;  4U1O A;  2Y5K A;  2DQV A;  1EYJ A;  1TXF A;  4P9K A;  3O6G A;  4QSE A;  4H6D A;  4KFQ A;  4QFL A;  4MH5 A;  2X7P A;  1DPP A;  3KJ7 A;  1YZ0 A;  5EQ9 A;  1TFA A;  3RY3 A;  1MY1 A;  1B5J A;  3KN7 A;  4QSC A;  2Q74 A;  2F3D A;  2B4M A;  1ANF A;  5IAI A;  2QS3 A;  3PMV A;  3EQ1 A;  4ISU A;  4U4X A;  3SKP A;  2VP1 A;  5AA4 B;  1IXH A;  4IO2 A;  3H6W A;  4OVP A;  4XKN A;  4JBZ A;  2D5W A;  4OEU A;  2V4C A;  5DVJ A;  3BIH A;  4GWS A;  1H3D A;  2CZK A;  4MFI A;  4ELR A;  4IO4 A;  1T0K A;  2UVH A;  2HZK A;  3H6T A;  4RNS A;  2NWJ A;  4NTL A;  4ELP A;  1AH5 A;  1QUI A;  1B3G A;  4JXI A;  2PT1 A;  3HO7 A;  1SD3 A;  1YAE A;  3D4G A;  1FJ9 A;  4LZ7 A;  5EHS A;  1A40 A;  3FXQ A;  4XKP A;  4F19 A;  2REG A;  4F3P A;  5F24 A;  5I2N B;  5I2N A;  1NV5 A;  3GBA A;  1VFE A;  5ET6 A;  3PUV E;  3QUJ A;  2XXQ A;  3ROJ A;  4NMY A;  1LST A;  4I3E A;  1Y4T A;  1F9B A;  2PCR A;  4TLL B;  1JNF A;  3M8U A;  3CFZ A;  3FVN A;  3M3L A;  2PMS A;  4ND9 A;  5A5X B;  1EZO A;  5A5X A;  2VD2 A;  4JWO A;  4PE3 A;  2RIN A;  4IO7 A;  2FIX A;  1B52 A;  4GF8 A;  1FBF A;  2FYI A;  4PFY A;  4LP2 B;  2GHA A;  4BLA A;  3JZJ A;  4I3Y A;  3B8B A;  4ZDM A;  1Z7N E;  1Q1K A;  4PBH A;  2QPQ A;  1QJM A;  1MPD A;  5ISU A;  3FBP A;  1YXI A;  3RTW B;  4MCO A;  1IMF A;  3TTR A;  2XXX A;  1YYZ A;  3QAX A;  1NNT A;  4HE1 A;  4HXV A;  1DSN A;  4NG7 A;  2PYY A;  3VLV A;  5L8D A;  5CI5 A;  3GYY A;  1SDX A;  2ZYO A;  3PGF A;  1IEJ A;  1BLF A;  2XXP A;  3E9X A;  5I58 B;  1GR2 A;  2R8T A;  3KC0 A;  1FRP A;  2G93 A;  2O1M A;  4E0W A;  5I58 A;  4OAN A;  3FAS A;  3MAM A;  2P1S A;  1NV6 A;  2NUV A;  1SI1 A;  1JVX A;  3H6U A;  2HCA A;  3PUX E;  3K1M A;  1MY3 A;  2DDK A;  3VVE A;  3CSB A;  1FTL A;  5JTY B;  2V3T A;  2Z8E A;  5JTY A;  4RYA A;  1LBC A;  2P2A A;  3C35 A;  1Y9U A;  2QVV A;  4FEB A;  1Y1Z A;  4O3B A;  2RC9 A;  3C34 A;  3IO4 A;  2HAV A;  3TQL A;  2OK2 A;  3QK6 A;  1NUZ A;  2AYS A;  2V84 A;  2H99 A;  2OX3 A;  3OO8 A;  1Z7M E;  1KZ8 A;  3NOH A;  1ATG A;  4YB5 A;  1O7T A;  2Y7I A;  5AA1 A;  2ABH A;  1BIY A;  3RT8 A;  1USY E;  3T22 A;  4ZZA A;  2H4I A;  4PAK A;  5T3J A;  3S9E A;  3FVG A;  1TT1 A;  4F31 B;  1P1W A;  1GTK A;  3EHT A;  4BDN A;  5EQ8 A;  3KBR A;  4G8H A;  2ZYM A;  2Z22 A;  1NNP A;  4JDF A;  3K02 A;  2WBB A;  5CC2 A;  4PBQ A;  1LAH E;  5HM4 B;  1JET A;  4XF5 A;  2CMO A;  2REJ A;  2VOZ A;  4R2B A;  4AS4 A;  1FTK A;  5CBR A;  2JJK A;  3SES A;  1H44 A;  5HPQ A;  4O3C A;  2A5T B;  1Y3N A;  2A5T A;  2I58 A;  4I1D A;  1B4H A;  1FBC A;  1RDX A;  3MBP A;  3OSQ A;  3FGS A;  3TCF A;  2DOJ A;  3WAE A;  4PFI A;  1INP A;  2PFY A;  3P7I A;  1B0H A;  4NN3 A;  4N07 A;  4XIG Q;  4R6K A;  4H65 A;  5DT6 A;  3MC2 A;  4WKM A;  2F7A A;  4F1V A;  4G68 B;  1S9T A;  4G68 A;  3KFM A;  4GL8 A;  3JYR A;  3PD9 A;  3FUZ A;  5B7D A;  3TTN A;  4MIJ A;  1IUD A;  1KA0 A;  3IOV A;  3O66 A;  4DXC A;  4I40 A;  1Q9D A;  4LQ2 A;  5HBC A;  1CE2 A;  1URD A;  4N4U A;  4O94 A;  1MY4 A;  2Z8D A;  3FJM A;  3V5A A;  1R9L A;  2OLB A;  4NGU A;  3TTM A;  4ZS9 A;  2E0S A;  3OSR A;  1LBZ A;  3HHF A;  4DCX A;  1IIW A;  2QVR A;  1LBX A;  2DWJ A;  1NV2 A;  1XHY A;  4Q8R A;  5I56 B;  3VE1 B;  5CMK A;  5I56 A;  1ZLQ A;  1DTZ A;  4RPO A;  3LSW A;  4IO3 A;  2I3V A;  3LC8 A;  1IQ7 A;  2HFB A;  2R6G E;  4DCY A;  2I0B A;  3MYU A;  1LFH A;  3KC1 A;  1I69 A;  2DXR A;  4C1T A;  3H4Z A;  4KPT A;  3A09 A;  3OMB A;  2FHY A;  4KCC A;  2XWO A;  5DYH A;  3MW0 A;  5DTB A;  4QFP A;  4KYS A;  1FPG A;  4OHN A;  3UIF A;  3G3G A;  3IK6 B;  2HXR A;  1M5B A;  5ET8 A;  1NV0 A;  5ICT A;  4YAH X;  1SQY A;  5ELV A;  3ZKL A;  2F8D A;  4OMB A;  3HV1 A;  2VD3 A;  1MY2 A;  3K1P A;  1AL3 A;  2GRV A;  3VXC A;  4YKJ A;  4OWD A;  1ZTY A;  3TEP A;  4F39 A;  3MVZ A;  5DW8 A;  4HE0 A;  3RGY A;  3KSJ A;  2I3W A;  1D9Y A;  1MQG A;  5EQ7 A;  4GWW A;  1EYI A;  1GV8 A;  2F36 A;  4Z0I A;  3QYT A;  1H43 A;  4RPN A;  3RUM A;  5A5L A;  1MQI A;  1PB9 A;  3BKI B;  3ZKK A;  1HSJ A;  1B05 A;  4JVD A;  2CEX A;  3SEW A;  4GVO A;  1FQA A;  2UVJ A;  3FXB A;  5I84 A;  4KYD A;  2R71 A;  4NF8 B;  4HE2 A;  5H8F B;  3Q29 A;  3IAZ A;  4NF8 A;  1KWH A;  1FJ6 A;  4YKK A;  5H8F A;  1A55 A;  1EU8 A;  4LZ5 A;  4F1Y A;  4MJO A;  1NH8 A;  2QMX A;  3SEV A;  2P3N A;  2XXV A;  1RYX A;  4Q30 B;  4ELQ A;  1R9Q A;  4FJP A;  1NL5 A;  3DP6 A;  3H03 A;  2XXH A;  3B6T A;  3LR1 A;  4H0W A;  5F1Q A;  3PPO A;  5KDT B;  2XXR A;  1OQG A;  1A8F A;  2ZZV A;  3TZA A;  5KDT A;  3LSL A;  3O2A A;  5F7V A;  4XEQ A;  5EHM A;  4BDO A;  1TFD A;  4O7I A;  2Z23 A;  2O6A A;  2UYF A;  3MVW A;  5DVI A;  3RLF E;  5LTC A;  3TAJ A;  2B65 A;  1LB8 A;  4OFJ A;  3ONM A;  1FPL A;  3O6I A;  2Q8J A;  2QFL A;  3IFC A;  3I3V A;  1EZ9 A;  3CI8 A;  5EYG A;  2DE4 A;  1US4 A;  2F6G A;  3PPP A;  3JV9 A;  1B7Z A;  4P3L A;  4ZE8 A;  4F18 A;  1IMB A;  5FBP A;  2LAO A;  2XD3 A;  3GBB A;  2HEU A;  4PET A;  4PE5 B;  1MM6 A;  4UAC A;  4NF5 B;  4F3B A;  4TOZ A;  4NF5 A;  4FE8 A;  2V3Q A;  2RCB A;  4ZEF A;  1DPE A;  3G3F A;  4R9G A;  4HCY A;  2XX7 A;  2BJI A;  4KQP A;  4NQ8 A;  1MDQ A;  2DWH A;  3O28 A;  2NOO A;  2ZZW A;  3SZP A;  5ET5 A;  1N3W A;  3USD A;  5CMB A;  4L17 A;  4ESW A;  2KQZ A;  1RKM A;  5KZT A;  2YLN A;  4ONY A;  1HSL A;  1FCK A;  3LV0 A;  4R72 A;  4MF3 A;  4OA4 A;  4PDH A;  3IB1 A;  4KHZ E;  3T9U A;  4P56 A;  1R1N A;  4JB7 A;  4GWU A;  2YJP A;  4U4S A;  1MXV A;  3FAT A;  3OEL A;  4QFK A;  3EKI A;  2V93 A;  4ZEC A;  3KG2 A;  5K2Y A;  5AA4 A;  3FZV A;  5KCJ B;  4WEP A;  5KCJ A;  4P1L A;  1NH7 A;  1NI9 A;  3KSX A;  3C4M A;  4GXA A;  2Q9T A;  4QFO A;  1FPJ A;  4N6K A;  1JP4 A;  3HFU A;  1IME A;  3ZS6 A;  4H67 A;  5EQA A;  1EZP A;  4NWD A;  1XI6 A;  1DBZ A;  3OO6 A;  4NWC A;  3G3J A;  1BK4 A;  4QRZ A;  1NUX A;  2F35 A;  1N3X A;  3MVY A;  4LN5 A;  1Y3Q A;  1AIV A;  3BIG A;  3VVF A;  3VV5 A;  3E79 A;  2FA7 A;  3SDF A;  2Q2C A;  4ESX A;  2XX8 A;  3ODB A;  1POY 1;  1M5C A;  3OEM A;  3K1N A;  2AL4 A;  4IGR A;  4LVQ A;  1YPN A;  4OFL A;  4GFR A;  2OBG A;  3SEU A;  3TCG A;  3IFA A;  4JSD A;  2HQ0 A;  5I59 B;  3FV1 A;  4OEV A;  4QHQ A;  5I59 A;  1LBW A;  1DTG A;  2I6E A;  3DM0 A;  4XKR A;  2DYX A;  3CFX A;  2PBW A;  3K6X A;  1IXI A;  3MP6 A;  3PMX A;  1B1X A;  2F5X A;  5I57 B;  4OQO A;  5I57 A;  1K9Y A;  1LAX A;  4AQ4 A;  1FQE A;  1RDY A;  3T96 B;  1LBY A;  4PP0 A;  4OZ9 A;  4BDQ A;  5ESY A;  1EH3 A;  1VFD A;  2BJJ X;  1P99 A;  3MP1 A;  4P11 A;  1ZIU A;  2H9B A;  3H6V A;  5ET7 A;  1IXG A;  4NF4 B;  4NF4 A;  3SEX A;  1BP5 A;  1N76 A;  3HST A;  4FAT A;  3E4R A;  1Y4C A;  4F3G A;  5CMM A;  1VSO A;  2B4L A;  3WAF A;  4THI A;  2CZH A;  1UIU A;  4X48 A;  2Y7W A;  4FOR A;  4MMP A;  2DE2 A;  2ZNS A;  4QBA A;  4G68 C;  3DLN A;  3KOT A;  4DI4 B;  1JEV A;  3FIR A;  1QUK A;  1I6B A;  3Q25 A;  1GVC A;  3K6W A;  2ZMB A;  4RK2 A;  4Q5T A;  4LQ5 A;  4U22 A;  1NUW A;  1MM7 A;  2QRY A;  4BDR A;  3VVD A;  1UTB B;  1FPF A;  1ZKB A;  3O29 A;  1SYH A;  1UTB A;  3T66 A;  2IEE A;  4GXS B;  2F6P A;  2XXI A;  3K0V A;  4GX6 A;  4QSD A;  4X8R A;  1O64 A;  4GRK A;  5M2V A;  3IJX B;  2DWA A;  2Y7P A;  1G0H A;  3EPE A;  1IZ1 A;  3QUF A;  1SBP A;  3RPL B;  3RPL A;  2XHD A;  2YPN A;  1LBV A;  4PFB A;  4X1D A;  4DXU A;  2PVU A;  4XTC Q;  1HSE A;  1B58 A;  1B4Z A;  4MNP A;  3F11 A;  5TU0 A;  4N15 A;  1JW4 A;  4ZEK A;  2F97 A;  1FPD A;  4X1B A;  3PD8 A;  2QVU A;  3UGW A;  4MX6 A;  3C32 A;  2GFE A;  4H46 A;  1CB6 A;  4G8M A;  3HHG A;  4FIM A;  4EQ7 A;  1JW1 A;  1FBH A;  4KD5 A;  3N6T A;  4G8N A;  2DS9 A;  2O7U A;  3UK4 A;  4MHF A;  4TQU Q;  2PX1 A;  3PTY A;  4GD5 A;  3A3C A;  4YU0 A;  3RNN A;  3SEY A;  3H06 B;  4C0R A;  1MY0 A;  4IO5 A;  1SVX B;  2KR0 A;  4P8B A;  3OEK A;  4F22 A;  1B6H A;  4UAB A;  4PDD A;  4IB2 A;  3H3G A;  3VFJ A;  4MLQ A;  2ZZX A;  4IO6 A;  1A54 A;  3KBZ A;  1XC1 A;  1BTJ A;  4NED A;  3GZG A;  3IOT A;  1PBQ A;  4ZE9 A;  1XVY A;  2ZNU A;  4PF6 A;  4EQ9 A;  5TP9 B;  3PUY E;  4JWX A;  5TP9 A;  3B6W A;  4OVQ A;  1B51 A;  3L6H A;  3U65 A;  1PB7 A;  4XXU A;  5I2K B;  3C33 A;  3KEI A;  3QMF A;  5I2K A;  3V89 B;  4ECF A;  3E13 X;  2F34 A;  2FBP A;  4MBP A;  3L6G A;  1FPK A;  4U21 A;  1XS5 A;  3OD7 A;  2DXY A;  1SW1 A;  1CNQ A;  1FPB A;  4R74 A;  1EYK A;  1NMU A;  4GX3 A;  1LLS A;  1N7X A;  1OMP A;  3TQW A;  1OLC A;  2W7Y A;  1US5 A;  1URS A;  5JK4 A;  3R6U A;  2L5V A;  2CEY A;  4GQO A;  4KCD A;  3LUY A;  3B6Q A;  5LDZ A;  4EXL A;  3E3K A;  5JEI A;  3G3I A;  4PFR A;  3D1R A;  2ZNT A;  4PGN A;  4MEV A;  4ZED A;  3HN0 A;  4QXD A;  1LFG A;  2I4C A;  2ALU A;  4R73 A;  3B50 A;  1ZJL A;  2O7I A;  2VGQ A;  3ISP A;  1NV3 A;  4POW A;  2ESN A;  5L9M A;  1LBB A;  1FBE A;  2DP8 A;  5AE4 A;  3Q28 A;  4NAP A;  2DVC A;  2FVZ A;  1IXC A;  1QVS A;  4R6H A;  4KYE A;  1R6Z A;  2XXY A;  2P0S A;  1SW5 A;  2Y84 A;  1D9Q A;  1IMD A;  4F2Q A;  1WVJ A;  4QFN A;  1H45 A;  3K2D A;  4YMA A;  2Q88 A;  4P0G A;  4N13 A;  4HS7 A;  2XD2 A;  5FHO A;  4HW8 A;  4WXJ A;  1MDP 1;  1P1U A;  3FVK A;  4YKP A;  1MQD A;  1QUL A;  3SER A;  1ZMG A;  1FQC A;  4EF2 A;  1B40 A;  2CZI A;  3A29 A;  3EN3 A;  4ZEI A;  1XVX A;  1MQJ A;  4GOT A;  4OTE A;  5L9S A;  4AB5 A;  2R9J A;  1A8E A;  2QSX A;  1DMB A;  2DE3 A;  2PFZ A;  2O51 A;  2VPO A;  3TMG A;  4G2Z A;  4GWZ A;  4O3A A;  2RC7 A;  3FJG A;  1WOD A;  1H76 A;  2QMW A;  3TUS A;  1PB8 A;  1A7L A;  1I6A A;  2HZL A;  1MXX A;  4DZ1 A;  3O97 A;  3V83 A;  1B3E A;  4GBV A;  1FTO A;  1AOV A;  4X04 A;  4WED A;  5K2X A;  4F3S A;  3THI A;  1A99 A;  3VLW A;  2XA5 A;  2UXA A;  4KI0 E;  3TCH A;  2ZXT A;  2WKY A;  4EF1 A;  2XWI A;  3O9P A;  5BUU A;  2XWK A;  3G3H A;  4R2F A;  3PUW E;  5IGA A;  3IR1 A;  1LCT A;  3VLU A;  5H8Q B;  2M8C A;  3R26 A;  2XXW A;  4H8J A;  5H8Q A;  1I6Q A;  3T9X B;  1FSA A;  1B0L A;  1XT8 A;  2F3B A;  1YTV A;  3TFL A;  2O84 X;  4PTK A;  2F7B A;  4M1V A;  1B3F A;  4GWX A;  2B3F A;  3FXU A;  4HCW A;  4YIC A;  1VE4 A;  2CZL A;  1P1Q A;  4M4G A;  4F2O A;  4GL0 A;  3ILU B;  1AWB A;  3UN6 A;  1RYO A;  3S9N C;  3CRB A;  2UVI A;  4Z7E A;  3UA8 A;  1ZU0 A;  5IM2 A;  2PT2 A;  4EQB A;  3CHG A;  2A5S A;  3W9W A;  3W15 C;  3U94 A;  1MRP A;  3IL1 B;  1Q35 A;  1B3H A;  4U23 A;  1MPB A;  2FNC A;  4GIZ A;  2X26 A;  5H8S A;  3K6U A;  2DWI A;  3EF7 A;  2V25 A;  3B7D A;  3G3K A;  1FQD A;  4MLV A;  3OO7 A;  3TKD A;  3BBR A;  2ONR A;  1RDZ A;  4PAI A;  3MWB A;  4YB7 A;  4DXB A;  2O68 A;  4RK9 A;  1FTM A;  1XOC A;  1VR5 A;  3S4U A;  3CR9 A;  1D3K A;  2KLF A;  3OO9 A;  4BDM A;  3H7M A;  3O6H A;  3Q27 A;  1B5H A;  4G77 A;  4HTG A;  3MP8 A;  3N5L A;  4FED A;  2XXK A;  3U1O A;  1B7H A;  2H25 A;  1DOT A;  4NX1 A;  1AMF A;  4OXV A;  4NF0 A;  1NNF A;  3U93 A;  3FV2 A;  1FTA A;  1Y20 A;  4ELO A;  5AA2 D;  4XFE A;  4Q0C A;  3T9V A;  2OWS A;  1J1N A;  1UTH B;  1UTH A;  1LFI A;  1FBP A;  2DSF A;  3D4C A;  1NUY A;  3CVG A;  1NV1 A;  3IOR A;  3GLB A;  4YZZ A;  4YMB A;  2RCA A;  3M3K A;  2OWT A;  2XXU A;  1NV7 A;  4K3F A;  1O63 A;  2D3I A;  4EUO A;  1MH4 A;  3UP9 A;  1P1N A;  1MS7 A;  3VXB A;  3CIJ A;  4H8I A;  4OVT A;  3SET A;  3HPI A;  3IJO B;  1JEU A;  1N84 A;  4I62 A;  1ZBM A;  4P1E A;  2WX9 A;  4EXK A;  4PGP A;  1SW2 A;  1NNK A;  4LUB A;  3KN3 A;  1POT A;  3E78 A;  4O8M A;  2XWV A;  1B32 A;  1URG A;  2ZYK A;  1IMA A;  1B3L A;  5J1D A;  1P1O A;  3RN8 A;  4YB6 A;  3ZSF A;  3CG3 A;  1USY H;  4H5G A;  3IO6 A;  4IR8 A;  4OVS A;  3TTL A;  4UA8 A;  1MH3 A;  2I48 A;  2ONK E;  3BFT A;  2OZZ A;  1NKX A;  2XX9 A;  3N26 A;  2Y5L A;  5CBS A;  4MAG A;  1OVB A;  5ITO A;  2G29 A;  3S9M C;  4GX4 A;  1L5T A;  4OVR A;  1B9J A;  3DP8 A;  4FEC A;  2Q8M A;  2QJE A;  2DVZ A;  3HCQ A;  4OFO A;  4R75 A;  4G61 A;  3I6V A;  3PPN A;  4IY5 A;  2HXW A;  4PFU A;  1Y1M A;  2I49 A;  2Y7R A;  3QSL A;  4P0I A;  3W9V A;  4GLI A;  4PF8 A;  2IA4 A;  5IZZ A;  2RC8 A;  2MKZ A;  4N8Y A;  3EHS A;  3OEN A;  5B70 A;  3KGC A;  4U1Z A;  5FTH A;  3K01 A;  4N17 A;  3MZB A;  1OIB A;  3KOS A;  3Q26 A;  2Q2A A;  4PAF A;  3GXA A;  4OEN A;  2B3B A;  2ZYN A;  1Y3P A;  3QIM A;  1JVY A;  3G7W A;  4H45 A;  3TPA A;  3U72 A;  2OJT A;  1SW4 A;  3N94 A;  1NV4 A;  3V8X B;  1UQW A;  5I5P A;  3TEL A;  4ZEB A;  2D21 A;  4QF9 A;  2XXT A;  1SPI A;  3K00 A;  3LSX A;  1FBG A;  1MXU A;  5IZ3 B;  5IKB A;  5IZ3 A;  1MXW A;  4DE8 A;  2AIX A;  2RF1 A;  3VDF A;  3PV0 E;  5L9O A;  2UYE A;  5H8N B;  5FHN A;  5H8N A;  1B1H A;  2UVG A;  1FPI A;  4GBW A;  2ONS A;  3MZ1 A;  2QL3 A;  1PEB A;  4F29 A;  4R9F A;  1QKB A;  1QKA A;  3KJT A;  1II5 A;  3T1B A;  3PMW A;  3PPQ A;  2NVU B;  4H5F A;  3N6U A;  3ECR A;  5FTI A;  1SYI A;  4JVC A;  2GH9 A;  1FQB A;  1LAG E;  3LUZ A;  1QUJ A;  4RJZ A;  4N6P A;  1S7Y A;  3U92 A;  4OYV A;  2HPG A;  4R6Y A;  4AB6 A;  2O69 A;  1B2H A;  3TDJ A;  1K9Z A;  4LAT A;  3C36 A;  1MPC A;  4KR5 A;  3RPW A;  3TYH A;  4IY6 A;  4RY1 A;  3CFL A;  3MQ9 A;  1QW0 A;  4G4P A;  5TPA B;  4F1U A;  5TPA A;  1MXZ A;  4NF6 B;  1S50 A;  1OQH A;  5I7I A;  2OCU A;  4NF6 A;  3R7X A;  3KZG A;  1LEV A;  2OWZ A;  1PDA A;  1MG1 A;  4H1X A;  3KN8 A;  1TWY A;  1B7U A;  1JW5 A;  2I4B A;  3MPK A;  4LON B;  5AA3 A;  4LZ8 A;  4RA1 A;  5LOM A;  1MXY A;  5IZ1 A;  2FIE A;  3UOR A;  1B46 A;  3I5O A;  2HAU A;  1B5I A;  1LCF A;  3CSG A;  1IMC A;  2F78 A;  3OOA A;  3IOU A;  5FHM A;  3MST A;  4AS5 A;  2X7Q A;  1WDN A;  4KXP A;  5EYH A;  4BDL A;  1LGB C;  2GHB A;  3TOD A;  4N8G A;  2QS2 A;  5CM6 A;  4TLM B;  1YCJ A;  1FW0 A;  4FAJ A;  3T9H B;  3BFU A;  2WEF A;  3RYD A;  1FBD A;  2Z8F A;  5BWJ A;  1M5E A;  3MUQ A;  3T0J A;  4JWY A;  4GWY A;  2VPN A;  3S9L C;  1M5F A;  4U2R A;  3OXN A;  3IB2 A;  1DK4 A;  1LAF E;  4IGT A;  5AA2 B;  1OLA A;  5J16 A;  5AA2 A;  1ELJ A;  4RXL A;  2WYP A;  1PBP A;  2V3U A;  5DEX B;  2H5Y A;  5DEX A;  3PUZ E;  1G0I A;  4MNC A;  3MVX A;  3EHU A;  4DLD A;  3DEL B;  4N81 A;  3C9H A;  5CRY A;  4YKI A;  1LB9 A;  1UIV A;  5EYF A;  2O1L A;  4PFT A;  1NFT A;  2Q89 A;  1FPE A;  1JQF A;  4O7M A;  4JSO A;  3A3U A;  4MNI A;  3MJN A;  3U8Q A;  4DIG A;  1D4N A;  2VT5 A;  1VDW A;  4JVI A;  3IX1 A;  4EDP A;  1N04 A;  3RTF B;  2AL5 A;  4X9T A;  2QS4 A;  4I9D A;  4POX A;  4GWO A;  1OVT A;  1BKA A;  2RKM A;  3ILT B;  3K4U A;  4NHB A;  5CMC A;  4PFW A;  3TTK A;  4E0X A;  1N7W A;  2ANJ A;  3FXR A;  2GQ1 A;  3LSF B;  3S2V A;  2F7C A;  2WYK A;  4I8C A;  5I3S A;  1FQF A;  2THI A;  3K6V A;  3FJ7 A;  2QS1 A;  5ICQ A;  3CG1 A;  2HHM A;  4DI3 D;  4NE4 A;  1IIT A;  2WBD A;  1M5D A;  1DCU A;  4N91 A;  3FD3 A;  4ZZE A;  4LA9 A;  3QXM A;  2P3V A;  3M3F A;  3T93 B;  3DP4 A;  4OER A;  2H98 A;  1SI0 A;  1MQH A;  3LBS A;  4N6D A;  4PC9 A;  3RQT A;  4C1U A;  1QGX A;  4OES A;  3AXF A;  4PCD A;  3IB0 A;  5ITP A; 
#chains in the Genus database with same CATH homology
 4OET A;  3RT6 B;  1GGG A;  3PU5 A;  2E1S A;  3IOW A;  1PC3 A;  1N0T A;  4PQJ A;  2Y7K A;  4DDD A;  5H8H B;  5H8H A;  5DVF A;  1D9V A;  2VHA A;  3C31 A;  3FVO A;  1FTJ A;  2NXO A;  3MZ9 A;  4OVJ A;  4XKQ A;  3MPL A;  2I0C A;  3PPR A;  4U1O A;  2DQV A;  1TXF A;  3O6G A;  4QSE A;  4H6D A;  4KFQ A;  4QFL A;  4MH5 A;  2X7P A;  1DPP A;  3KJ7 A;  1TFA A;  3RY3 A;  1MY1 A;  1B5J A;  3KN7 A;  4QSC A;  1ANF A;  5IAI A;  2QS3 A;  3PMV A;  3EQ1 A;  4ISU A;  4U4X A;  3SKP A;  2VP1 A;  5AA4 B;  1IXH A;  4IO2 A;  3H6W A;  4XKN A;  4JBZ A;  2D5W A;  4OEU A;  5DVJ A;  1H3D A;  4MFI A;  4ELR A;  4IO4 A;  1T0K A;  2UVH A;  2HZK A;  3H6T A;  4RNS A;  2NWJ A;  4NTL A;  4ELP A;  1AH5 A;  1QUI A;  1B3G A;  4JXI A;  2PT1 A;  3HO7 A;  1SD3 A;  1YAE A;  3D4G A;  4LZ7 A;  5EHS A;  1A40 A;  3FXQ A;  4XKP A;  4F19 A;  2REG A;  4F3P A;  5I2N B;  5I2N A;  3GBA A;  1VFE A;  3PUV E;  3QUJ A;  2XXQ A;  4NMY A;  1LST A;  1Y4T A;  1F9B A;  4TLL B;  1JNF A;  3M8U A;  3CFZ A;  3FVN A;  3M3L A;  2PMS A;  4ND9 A;  5A5X B;  1EZO A;  5A5X A;  2VD2 A;  4JWO A;  2RIN A;  4IO7 A;  1B52 A;  4GF8 A;  2FYI A;  4PFY A;  4LP2 B;  2GHA A;  4BLA A;  3JZJ A;  4ZDM A;  1Z7N E;  1Q1K A;  2QPQ A;  1QJM A;  1MPD A;  5ISU A;  3RTW B;  3TTR A;  2XXX A;  3QAX A;  1NNT A;  1DSN A;  2PYY A;  3VLV A;  5L8D A;  5CI5 A;  1SDX A;  2ZYO A;  3PGF A;  1IEJ A;  1BLF A;  2XXP A;  3E9X A;  5I58 B;  1GR2 A;  2G93 A;  2O1M A;  5I58 A;  4E0W A;  3FAS A;  3MAM A;  2P1S A;  2NUV A;  1SI1 A;  1JVX A;  3H6U A;  2HCA A;  3PUX E;  3K1M A;  1MY3 A;  3VVE A;  3CSB A;  1FTL A;  5JTY B;  2V3T A;  2Z8E A;  5JTY A;  4RYA A;  1LBC A;  2P2A A;  3C35 A;  1Y9U A;  4FEB A;  1Y1Z A;  4O3B A;  2RC9 A;  3C34 A;  3IO4 A;  2HAV A;  3TQL A;  2OK2 A;  3QK6 A;  2AYS A;  2V84 A;  2H99 A;  3OO8 A;  1Z7M E;  1ATG A;  4YB5 A;  1O7T A;  2Y7I A;  5AA1 A;  2ABH A;  1BIY A;  3RT8 A;  1USY E;  3T22 A;  4ZZA A;  2H4I A;  3S9E A;  3FVG A;  1TT1 A;  4F31 B;  1P1W A;  1GTK A;  3EHT A;  4BDN A;  3KBR A;  4G8H A;  2ZYM A;  2Z22 A;  1NNP A;  4JDF A;  3K02 A;  5CC2 A;  1LAH E;  5HM4 B;  1JET A;  2CMO A;  2REJ A;  2VOZ A;  4R2B A;  1FTK A;  5CBR A;  3SES A;  1H44 A;  5HPQ A;  4O3C A;  2A5T B;  1Y3N A;  2A5T A;  2I58 A;  4I1D A;  1B4H A;  3MBP A;  3OSQ A;  3FGS A;  3TCF A;  2DOJ A;  3WAE A;  3P7I A;  1B0H A;  4N07 A;  4XIG Q;  4R6K A;  4H65 A;  5DT6 A;  3MC2 A;  4WKM A;  2F7A A;  4F1V A;  4G68 B;  1S9T A;  4G68 A;  3KFM A;  4GL8 A;  3JYR A;  3PD9 A;  3FUZ A;  5B7D A;  3TTN A;  1IUD A;  3IOV A;  3O66 A;  4DXC A;  4LQ2 A;  5HBC A;  1CE2 A;  1URD A;  1MY4 A;  2Z8D A;  3FJM A;  3V5A A;  1R9L A;  2OLB A;  3TTM A;  4ZS9 A;  2E0S A;  3OSR A;  3HHF A;  4DCX A;  1IIW A;  2DWJ A;  1XHY A;  4Q8R A;  5I56 B;  3VE1 B;  5CMK A;  5I56 A;  1ZLQ A;  1DTZ A;  4RPO A;  3LSW A;  4IO3 A;  2I3V A;  3LC8 A;  1IQ7 A;  2HFB A;  2R6G E;  4DCY A;  2I0B A;  1LFH A;  1I69 A;  2DXR A;  4C1T A;  3H4Z A;  4KPT A;  3A09 A;  3OMB A;  4KCC A;  5DYH A;  3MW0 A;  5DTB A;  4QFP A;  4KYS A;  4OHN A;  3UIF A;  3G3G A;  3IK6 B;  1M5B A;  5ICT A;  4YAH X;  1SQY A;  5ELV A;  3ZKL A;  2F8D A;  4OMB A;  3HV1 A;  2VD3 A;  1MY2 A;  3K1P A;  1AL3 A;  2GRV A;  3VXC A;  4YKJ A;  4OWD A;  1ZTY A;  3TEP A;  4F39 A;  3MVZ A;  3RGY A;  3KSJ A;  2I3W A;  1D9Y A;  1MQG A;  1GV8 A;  2F36 A;  4Z0I A;  3QYT A;  1H43 A;  4RPN A;  3RUM A;  1MQI A;  1PB9 A;  3BKI B;  3ZKK A;  1HSJ A;  1B05 A;  3SEW A;  4GVO A;  1FQA A;  2UVJ A;  5I84 A;  4KYD A;  2R71 A;  4NF8 B;  5H8F B;  3Q29 A;  3IAZ A;  4NF8 A;  1KWH A;  4YKK A;  5H8F A;  1A55 A;  1EU8 A;  4LZ5 A;  4F1Y A;  1NH8 A;  2QMX A;  3SEV A;  2XXV A;  1RYX A;  4Q30 B;  4ELQ A;  1R9Q A;  4FJP A;  1NL5 A;  3DP6 A;  3H03 A;  2XXH A;  3B6T A;  3LR1 A;  4H0W A;  5F1Q A;  3PPO A;  5KDT B;  2XXR A;  1OQG A;  1A8F A;  5KDT A;  3TZA A;  3LSL A;  3O2A A;  5F7V A;  5EHM A;  4BDO A;  1TFD A;  2Z23 A;  2O6A A;  2UYF A;  3MVW A;  5DVI A;  3RLF E;  3TAJ A;  2B65 A;  1LB8 A;  4OFJ A;  3ONM A;  3O6I A;  2Q8J A;  3I3V A;  1EZ9 A;  3CI8 A;  2DE4 A;  1US4 A;  2F6G A;  3PPP A;  3JV9 A;  1B7Z A;  4ZE8 A;  4F18 A;  2LAO A;  2XD3 A;  3GBB A;  2HEU A;  4PET A;  4PE5 B;  1MM6 A;  4UAC A;  4NF5 B;  4F3B A;  4TOZ A;  4NF5 A;  4FE8 A;  2V3Q A;  2RCB A;  4ZEF A;  1DPE A;  3G3F A;  4R9G A;  4HCY A;  2XX7 A;  4KQP A;  1MDQ A;  2DWH A;  3O28 A;  2NOO A;  1N3W A;  3USD A;  5CMB A;  4L17 A;  4ESW A;  1RKM A;  5KZT A;  2YLN A;  4ONY A;  1HSL A;  1FCK A;  4R72 A;  4MF3 A;  3IB1 A;  4KHZ E;  3T9U A;  1R1N A;  4JB7 A;  2YJP A;  4U4S A;  1MXV A;  3FAT A;  3OEL A;  4QFK A;  2V93 A;  4ZEC A;  3KG2 A;  5K2Y A;  5AA4 A;  3FZV A;  5KCJ B;  4WEP A;  5KCJ A;  1NH7 A;  3KSX A;  3C4M A;  4GXA A;  2Q9T A;  4QFO A;  3ZS6 A;  4H67 A;  1EZP A;  4NWD A;  3OO6 A;  4NWC A;  3G3J A;  4QRZ A;  2F35 A;  1N3X A;  3MVY A;  1Y3Q A;  1AIV A;  3VVF A;  3VV5 A;  2FA7 A;  3SDF A;  2Q2C A;  4ESX A;  2XX8 A;  3ODB A;  1POY 1;  1M5C A;  3OEM A;  3K1N A;  2AL4 A;  4IGR A;  4LVQ A;  1YPN A;  4OFL A;  4GFR A;  2OBG A;  3SEU A;  3TCG A;  4JSD A;  2HQ0 A;  5I59 B;  3FV1 A;  4OEV A;  4QHQ A;  5I59 A;  1DTG A;  2I6E A;  3DM0 A;  4XKR A;  2DYX A;  3CFX A;  2PBW A;  3K6X A;  1IXI A;  3MP6 A;  3PMX A;  1B1X A;  2F5X A;  5I57 B;  4OQO A;  5I57 A;  1LAX A;  4AQ4 A;  1FQE A;  3T96 B;  4PP0 A;  4OZ9 A;  4BDQ A;  1EH3 A;  1VFD A;  2BJJ X;  1P99 A;  3MP1 A;  4P11 A;  1ZIU A;  2H9B A;  3H6V A;  1IXG A;  4NF4 B;  4NF4 A;  3SEX A;  1BP5 A;  1N76 A;  3HST A;  4FAT A;  3E4R A;  1Y4C A;  4F3G A;  5CMM A;  1VSO A;  3WAF A;  4THI A;  1UIU A;  4X48 A;  2Y7W A;  4FOR A;  2DE2 A;  2ZNS A;  4G68 C;  3DLN A;  3KOT A;  1JEV A;  3FIR A;  1QUK A;  1I6B A;  3Q25 A;  1GVC A;  3K6W A;  2ZMB A;  4RK2 A;  4Q5T A;  4LQ5 A;  4U22 A;  1MM7 A;  2QRY A;  4BDR A;  3VVD A;  1UTB B;  1ZKB A;  3O29 A;  1SYH A;  1UTB A;  3T66 A;  2IEE A;  4GXS B;  2F6P A;  2XXI A;  3K0V A;  4QSD A;  1O64 A;  4GRK A;  5M2V A;  3IJX B;  2DWA A;  2Y7P A;  3EPE A;  1IZ1 A;  3QUF A;  1SBP A;  2XHD A;  2YPN A;  4X1D A;  4DXU A;  2PVU A;  4XTC Q;  1HSE A;  1B58 A;  1B4Z A;  3F11 A;  5TU0 A;  1JW4 A;  4ZEK A;  2F97 A;  4X1B A;  3PD8 A;  3UGW A;  3C32 A;  2GFE A;  1CB6 A;  4G8M A;  3HHG A;  4FIM A;  4EQ7 A;  1JW1 A;  4KD5 A;  3N6T A;  4G8N A;  2DS9 A;  2O7U A;  3UK4 A;  4TQU Q;  2PX1 A;  4GD5 A;  3A3C A;  4YU0 A;  3RNN A;  3SEY A;  3H06 B;  4C0R A;  1MY0 A;  4IO5 A;  1SVX B;  3OEK A;  4F22 A;  1B6H A;  4IB2 A;  3H3G A;  3VFJ A;  4MLQ A;  4IO6 A;  1A54 A;  1XC1 A;  1BTJ A;  4NED A;  3GZG A;  3IOT A;  1PBQ A;  4ZE9 A;  1XVY A;  2ZNU A;  4EQ9 A;  5TP9 B;  3PUY E;  4JWX A;  5TP9 A;  3B6W A;  1B51 A;  3L6H A;  1PB7 A;  4XXU A;  5I2K B;  3C33 A;  3KEI A;  5I2K A;  3V89 B;  4ECF A;  3E13 X;  2F34 A;  4MBP A;  3L6G A;  4U21 A;  1XS5 A;  3OD7 A;  2DXY A;  1SW1 A;  4R74 A;  1NMU A;  1LLS A;  1N7X A;  1OMP A;  3TQW A;  1OLC A;  2W7Y A;  1US5 A;  1URS A;  5JK4 A;  3R6U A;  4GQO A;  4KCD A;  3LUY A;  3B6Q A;  4EXL A;  3E3K A;  5JEI A;  3G3I A;  2ZNT A;  4ZED A;  3HN0 A;  1LFG A;  2I4C A;  2ALU A;  4R73 A;  1ZJL A;  2O7I A;  2VGQ A;  4POW A;  2ESN A;  5L9M A;  1LBB A;  2DP8 A;  5AE4 A;  3Q28 A;  2DVC A;  1IXC A;  1QVS A;  4R6H A;  4KYE A;  1R6Z A;  2XXY A;  2P0S A;  1SW5 A;  2Y84 A;  4F2Q A;  1WVJ A;  4QFN A;  1H45 A;  3K2D A;  4YMA A;  2Q88 A;  4P0G A;  4N13 A;  4HS7 A;  2XD2 A;  5FHO A;  4HW8 A;  4WXJ A;  1MDP 1;  1P1U A;  3FVK A;  4YKP A;  1MQD A;  1QUL A;  3SER A;  1ZMG A;  1FQC A;  4EF2 A;  1B40 A;  3EN3 A;  4ZEI A;  1XVX A;  1MQJ A;  4GOT A;  4OTE A;  5L9S A;  4AB5 A;  2R9J A;  1A8E A;  2QSX A;  1DMB A;  2DE3 A;  2O51 A;  3TMG A;  4G2Z A;  4O3A A;  2RC7 A;  3FJG A;  1WOD A;  1H76 A;  2QMW A;  3TUS A;  1PB8 A;  1A7L A;  1I6A A;  2HZL A;  1MXX A;  4DZ1 A;  3O97 A;  3V83 A;  1B3E A;  1FTO A;  1AOV A;  4WED A;  5K2X A;  4F3S A;  3THI A;  1A99 A;  3VLW A;  2UXA A;  4KI0 E;  3TCH A;  2ZXT A;  2WKY A;  4EF1 A;  3O9P A;  5BUU A;  3G3H A;  4R2F A;  3PUW E;  3IR1 A;  1LCT A;  3VLU A;  5H8Q B;  2M8C A;  3R26 A;  2XXW A;  4H8J A;  5H8Q A;  1I6Q A;  3T9X B;  1B0L A;  1XT8 A;  1YTV A;  3TFL A;  2O84 X;  2F7B A;  4M1V A;  1B3F A;  2B3F A;  3FXU A;  4HCW A;  4YIC A;  1VE4 A;  2CZL A;  1P1Q A;  4M4G A;  4F2O A;  4GL0 A;  3ILU B;  3UN6 A;  1RYO A;  3S9N C;  3CRB A;  2UVI A;  4Z7E A;  3UA8 A;  1ZU0 A;  2PT2 A;  4EQB A;  2A5S A;  3W9W A;  3W15 C;  3U94 A;  1MRP A;  3IL1 B;  1Q35 A;  1B3H A;  4U23 A;  1MPB A;  2FNC A;  4GIZ A;  2X26 A;  5H8S A;  3K6U A;  2DWI A;  3EF7 A;  2V25 A;  3B7D A;  3G3K A;  1FQD A;  4MLV A;  3OO7 A;  3TKD A;  3BBR A;  2ONR A;  3MWB A;  4YB7 A;  4DXB A;  2O68 A;  4RK9 A;  1FTM A;  1XOC A;  1VR5 A;  3S4U A;  3CR9 A;  1D3K A;  2KLF A;  3OO9 A;  4BDM A;  3H7M A;  3O6H A;  3Q27 A;  1B5H A;  4G77 A;  4FED A;  3MP8 A;  3N5L A;  4HTG A;  3U1O A;  1B7H A;  2H25 A;  1DOT A;  1AMF A;  4OXV A;  1NNF A;  3U93 A;  3FV2 A;  1Y20 A;  4ELO A;  5AA2 D;  4Q0C A;  3T9V A;  2OWS A;  1J1N A;  1UTH B;  1UTH A;  1LFI A;  2DSF A;  3D4C A;  3CVG A;  3IOR A;  3GLB A;  4YZZ A;  4YMB A;  2RCA A;  3M3K A;  2OWT A;  2XXU A;  4K3F A;  1O63 A;  2D3I A;  4EUO A;  1MH4 A;  3UP9 A;  1P1N A;  1MS7 A;  3VXB A;  3CIJ A;  4H8I A;  3SET A;  3HPI A;  3IJO B;  1JEU A;  1N84 A;  4I62 A;  1ZBM A;  4EXK A;  1SW2 A;  1NNK A;  4LUB A;  3KN3 A;  1POT A;  1B32 A;  1URG A;  2ZYK A;  1B3L A;  5J1D A;  1P1O A;  3RN8 A;  4YB6 A;  3ZSF A;  3CG3 A;  1USY H;  4H5G A;  3IO6 A;  3TTL A;  4UA8 A;  1MH3 A;  2I48 A;  2ONK E;  3BFT A;  2OZZ A;  1NKX A;  2XX9 A;  3N26 A;  5CBS A;  1OVB A;  5ITO A;  2G29 A;  3S9M C;  1L5T A;  1B9J A;  3DP8 A;  4FEC A;  2QJE A;  2DVZ A;  3HCQ A;  4OFO A;  4R75 A;  3I6V A;  3PPN A;  4IY5 A;  2HXW A;  4PFU A;  1Y1M A;  2I49 A;  2Y7R A;  3QSL A;  4P0I A;  3W9V A;  4GLI A;  2IA4 A;  2RC8 A;  3EHS A;  3OEN A;  5B70 A;  3KGC A;  4U1Z A;  5FTH A;  3K01 A;  3MZB A;  1OIB A;  3KOS A;  3Q26 A;  2Q2A A;  3GXA A;  4OEN A;  2B3B A;  2ZYN A;  1Y3P A;  3QIM A;  1JVY A;  3G7W A;  3TPA A;  3U72 A;  2OJT A;  1SW4 A;  3N94 A;  3V8X B;  1UQW A;  3TEL A;  4ZEB A;  2D21 A;  4QF9 A;  2XXT A;  3K00 A;  3LSX A;  1MXU A;  5IKB A;  1MXW A;  4DE8 A;  2AIX A;  2RF1 A;  3VDF A;  3PV0 E;  5L9O A;  2UYE A;  5H8N B;  5FHN A;  5H8N A;  1B1H A;  2UVG A;  2ONS A;  3MZ1 A;  2QL3 A;  1PEB A;  4F29 A;  4R9F A;  1QKB A;  1QKA A;  3KJT A;  1II5 A;  3PMW A;  3PPQ A;  2NVU B;  4H5F A;  3N6U A;  3ECR A;  5FTI A;  1SYI A;  2GH9 A;  1FQB A;  1LAG E;  1QUJ A;  4RJZ A;  4N6P A;  1S7Y A;  3U92 A;  4OYV A;  4R6Y A;  4AB6 A;  2O69 A;  1B2H A;  3TDJ A;  4LAT A;  3C36 A;  1MPC A;  4KR5 A;  3RPW A;  3TYH A;  4IY6 A;  4RY1 A;  3CFL A;  3MQ9 A;  1QW0 A;  4G4P A;  5TPA B;  4F1U A;  5TPA A;  1MXZ A;  4NF6 B;  1S50 A;  1OQH A;  2OCU A;  4NF6 A;  3R7X A;  3KZG A;  1PDA A;  1MG1 A;  4H1X A;  3KN8 A;  1TWY A;  1B7U A;  1JW5 A;  2I4B A;  3MPK A;  4LON B;  5AA3 A;  4LZ8 A;  4RA1 A;  5LOM A;  1MXY A;  3UOR A;  1B46 A;  3I5O A;  2HAU A;  1B5I A;  1LCF A;  3CSG A;  2F78 A;  3OOA A;  3IOU A;  5FHM A;  2X7Q A;  1WDN A;  4BDL A;  1LGB C;  2GHB A;  3TOD A;  2QS2 A;  5CM6 A;  4TLM B;  1YCJ A;  1FW0 A;  4FAJ A;  3T9H B;  3BFU A;  2Z8F A;  5BWJ A;  1M5E A;  3MUQ A;  4JWY A;  3S9L C;  1M5F A;  4U2R A;  3OXN A;  3IB2 A;  1LAF E;  4IGT A;  5AA2 B;  1OLA A;  5AA2 A;  1ELJ A;  4RXL A;  1PBP A;  2V3U A;  5DEX B;  2H5Y A;  5DEX A;  3PUZ E;  3MVX A;  3EHU A;  4DLD A;  3DEL B;  3C9H A;  5CRY A;  4YKI A;  1LB9 A;  1UIV A;  5EYF A;  2O1L A;  4PFT A;  1NFT A;  2Q89 A;  1JQF A;  4JSO A;  3A3U A;  3MJN A;  3U8Q A;  4DIG A;  1D4N A;  3IX1 A;  4EDP A;  1N04 A;  3RTF B;  2AL5 A;  4X9T A;  2QS4 A;  4I9D A;  4POX A;  4GWO A;  1OVT A;  1BKA A;  2RKM A;  3ILT B;  3K4U A;  5CMC A;  4PFW A;  3TTK A;  4E0X A;  1N7W A;  2ANJ A;  3FXR A;  3LSF B;  3S2V A;  2F7C A;  4I8C A;  1FQF A;  2THI A;  3K6V A;  3FJ7 A;  2QS1 A;  5ICQ A;  3CG1 A;  4NE4 A;  1IIT A;  1M5D A;  3FD3 A;  4ZZE A;  4LA9 A;  3QXM A;  3M3F A;  3T93 B;  3DP4 A;  4OER A;  2H98 A;  1SI0 A;  1MQH A;  3LBS A;  3RQT A;  4C1U A;  4OES A;  3AXF A;  3IB0 A;  5ITP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...