3ZKXC

Ternary bace2 xaperone complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
LQESGGGLVQAGGSLRLSCAASGFTFSRAAMRWVRRAPERGLEWVANINAGDGSASYADFVKGRFTASRDKAGNRLYLQMDNLRPNDTAVYYCIYNGHRGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zkxC00
3GMQA 4FFWC 3U0TA 4L4VE 1BM3L 1KCKA 5E2VH 3V6OA 3MGOA 5JLZB 2YA0A 2VITB 1KEML 3HC3L 2VIRA 2QL1A 5KG9A 1WZ1L 1F8TL 5JXAL 3LEVH 1RULH 1AGCB 4X6FB 3ZDYF 3DETC 1MFEL 3QG6A 4YHZH 1K5NB 1NH6A 3KWWB 4HC1L 1J9CT 4ELME 1T0NB 2FIKA 4KPHL 4JFPA 1TZIA 2AJ3B 1I4FB 1TVBB 3DX7A 2VXSH 2X4PA 1TENA 5KVEL 1BQHB 1ZKAA 3HCVB 3L5WB 4YAQA 5I18L 4N90E 3QCUL 1I7ZB 1LVEA 1MIMH 4IOFC 3DTXA 5DD1H 3EOTH 1ZV5A 3FN9A 4U1JA 1I85C 4Z7VF 5EU6E 3OKLB 3OV6A 1PZUB 3QFDB 3DVGA 3VI4E 2V5SA 4R9HA 3L6FA 4XCNA 4OLZL 1KYOJ 4YHIA 3TZVB 5EBWA 2CDEA 5HY9A 3OJDB 3VMPA 3OR6B 2DJSA 1ZMYA 5C6PB 2WLZA 1CGTA 1HI6B 1FSKB 1U8MA 5K9KA 1D6EB 3U48A 2X9XA 3ECBA 5GZND 1P4IL 4EZMA 3MUY1 4KJQD 4V1DE 4Y1AE 5DO2C 3O3BA 2AI0H 5SX5K 4PV8B 2YBRB 1NSNH 3V5DB 1SVCP 2C1PB 1LEGA 1RUML 1RK1B 2VR4A 2H6PB 5HYJD 4O02L 3GSRB 1OTUC 2QADD 3W0WB 3O41A 2OK0H 5GGVH 5HHOA 5EWIL 4IMLA 1ZLVK 3KS0J 3IFOB 5EA0H 2CUMA 2DLFH 3RUGE 1QSEE 4HPYH 2NXZC 1NGZA 2F5BH 3GMNB 3KPSD 2VZUA 2Z8RA 4UT6H 4LRIC 3EOAB 2X40A 4CW1A 4HK0A 4KAQH 3MBEA 5DJZB 4FQJL 3U0WL 4IOIB 1FH5L 5D4QA 4XPFL 5JORB 5F1OB 1Z5LB 2OS7A 1ZVYA 3SDXB 5LCVH 2QHRH 4PJDF 3H7BB 3LSOB 2P43B 4JKPH 3WKML 1DFBH 3O81A 3TF7C 3MRDA 4U1KB 2H32H 4J3OC 3GSQA 1LNUA 2BFVH 5DA0B 1YJDC 1A7BA 1OPGL 2D3VA 4AL8L 3B8YA 4LKCB 3DX7B 3NFPA 5JXEA 1KLUB 3CD4A 1FO0A 1IRAY 1NFIA 4ODTH 3VFMB 4KVCL 1ACYL 1DQLH 3ALPA 4MS8D 4PB0L 5E8PA 4PUBH 2WP3O 4GKSA 5DFWH 1X4YA 4GO6B 2MHAB 2Q7NA 4QRRE 1Z9OA 3NAAL 1BIIA 2D9CA 5L2JB 2GY5A 4RISL 4LQFL 5D8JL 4XTRD 3KNBB 3OMZA 3P4MB 3WIIL 4W68A 2XKUA 4TOYH 3SCMD 4MSWA 4WTZG 4ZDHB 1CFTA 1Q0YL 3DECA 3MMEA 5BJTA 1HOCB 2V9QA 2NY0B 3HMXA 4PJ8A 2D31A 4LLWB 1VADB 4IRSB 4AZ8A 3RVWD 5HGAA 3R8QA 1U8MB 2VE6B 2EZ0D 2YHGA 2JCCB 1S7SA 5C07E 3DO3A 1YQVL 3MV9D 4M61B 4FNLH 5CWSA 3PGDA 4LLAA 4U0RC 2A74B 4L29A 1EHLH 1AY1H 4JLRA 4XMLH 3DO7A 3B6SA 1FZOB 4RGMB 3QG7L 4Z7UE 1XF3B 1DL7L 4FZ8L 1SM3L 1TZGH 2AJXH 3L3GA 3FB7A 1CTNA 5F96L 5D7JC 3REVA 3BPOB 4X99B 5SV3A 4IBLT 4BFIB 3QUMA 1N0XL 4JZOB 4ELMF 4GW5B 4QTIL 1UGNA 3QEGL 5AYUL 4DGYH 2HH0H 4JPWH 1J8HD 5FO9B 4I77L 5MI0B 1I8IA 4XVUC 3UTSA 1XZ0A 3UZQA 4LP4A 2OR8A 3SDYH 1LO5B 2MWCA 2J6EA 1KJMB 2ZCHL 4DAGH 1INEH 2IGFL 3CVHA 2PF6A 2HJKA 2OTPA 2Z8WC 3LD8C 2ED9A 1PKQA 3MRDB 5FGBA 2NY1C 5BOZG 1IJ9A 1RZFH 3IKKA 1ADQA 3X14B 1X4XA 5FYKL 1QOKA 2Q87A 2VLJE 4JM4H 3BW9B 1DQDH 5J1SC 1QLRA 4WHYG 1E4XL 1ZA6A 3NPZB 4NN6B 4OZGB 1A5FH 3QXAB 1ZAGA 5C0NC 3IF1B 5KVDL 3CX2A 4EBQL 3QJFA 2WANA 5C0EA 1MY5A 2EO1A 2AXFB 3NPSC 3HRZA 2E5EA 1EXUB 1KCVH 5I8OH 4B5EA 3SGEH 1SEQL 5I76B 3RAJL 4N0UA 1YZZA 1HHJA 4FQLH 2E7CA 5EOCJ 4ACPA 2RFXB 3ARVA 3QO1B 2XN9E 4GKZA 4PY8J 4YC2B 1SYVA 1R3HA 3RUGF 3VFGH 3IVKA 1KTDA 3QNZB 1KXVC 1JWUB 1AO7B 1WFTA 1MIEL 4KRPC 5F3HB 3S34L 4BELD 4CUCA 3MYJB 3BGFB 1AKJB 1Y18B 1J0KA 3QDJA 3VFNA 3JTTA 2H3NA 5HPMA 3IJSB 4NHUA 3B9KA 1NEUA 4M7JL 5HYQB 2BVOB 4PRPE 3SE9L 5SWQB 1L9MA 4HWEH 3NGBC 1W0WB 3LEXA 2HWZL 3R0NA 4GKOA 3L95A 1HYSD 3Q5OA 4NO5B 1CZ8L 4LCUB 3D25B 3CH8A 4XVTL 4G8IB 1BX2A 3UBXI 5FGRA 1EUUA 3RGVB 5IFAH 5DQDL 3QWOA 5IJVA 1CFBA 3B3IB 1K8DA 3BP6B 5IBTH 4P3DA 5DJYA 3HI5L 4JFOB 3VRJA 1PAMA 4RMUA 4HJGA 1HQRA 5C3TA 5ANMA 2P45B 2CO6B 3BD5A 4KHXH 3P9MA 4NP4L 3SGJC 5J11C 1BF8A 5C0CA 4O5LH 2X4NA 3GMOA 4MAYC 4PV9A 4WW2A 2DM7A 3DHJA 3AREB 1HSAA 1TJGH 3BPCB 1KJVA 4U2ZA 1J1XH 4WWKC 1B0RB 4Y4KB 5I8CA 1A47A 4YDIH 1L4IA 1CVSC 3ARBD 5MEOA 4KQ3H 1NDMA 4HKBA 5IR1B 1JI1A 3C9NA 1GPOH 3V95A 5C9KA 1A6TA 5GGTL 1GVIA 3VD7A 1B0WA 2VH5H 2ITCA 4LCCC 4XPTL 3PDDA 1BOYA 1JI2A 3MRJA 3TO4B 3JV4B 1HINL 4Z7UF 3SDDD 3FFCE 3GMPA 5DT1L 3TBVA 3HG1E 5CAYB 4LNVA 2VLRE 1YNKL 5HHMD 1H3VA 5GJSL 3GMRA 3P3YA 3UTTB 1U58B 2EXYD 2FCBA 3AM8A 4PJ5A 3VXSD 3EFDL 1JZ2A 1KB5L 4JRXE 1WZKA 4S2SB 3ULVE 1KFAH 4LLQA 1GAFL 1CFNB 3H3PL 3ZO0A 2HLFC 1YNLH 1HZHH 4APQB 5DDHB 4JN1H 4NZRL 5CP7B 5CLWA 2RCSL 5GISH 3FQNB 4K3EH 3V6FA 4Y4HB 4LSPL 4FFWD 3EFFB 1L7TH 4JCMA 3FL7A 4XNYL 2G5BA 2ZNXA 5CILH 2VZ3A 3LHPH 4QRPA 3TIEB 4NCDA 3NZHH 3U4AA 4DJMA 3MLXH 5EG6C 5TPWL 3DETD 4BFBD 3GHBH 2NTFB 4Z78B 1IZKA 1U95A 3F58L 4ZO8A 2P7TA 5BVPL 2EE6A 1CGUA 1EEZB 3OKNA 1ROWA 4M7ZB 4F2MB 4OTXL 1GXEA 3SE8H 4L3EE 2A6KB 1BFSA 5I1JH 5GS1B 2I9TA 1HQRB 5ANMB 1FNEB 1MVUB 1QLFB 4ZSOA 2JKXA 1OAZL 1CQYA 2YPKB 1RZKC 4L3CA 4FTVD 5K9JL 4LF3A 1T1WA 4IOFD 4ZUWB 1YPZB 2BNRA 2NY6C 3WNMA 3KHOA 3QDMA 2D03H 5CEXA 5D7LA 4E41D 3RZCB 2L4OA 1U8QA 1FVCB 3JWNC 4FFZL 5DMJB 4F3FB 5D7IB 3NCFB 1A6TB 1F5WA 5DJXA 4HJ0D 2QV2A 4NQCD 4QXUH 2FBOJ 4CVWA 1HHIB 4XCCL 4UV4H 3C08H 2OXGA 1FRGH 5SWZD 4P2RA 2I07B 4XMKL 2PKDA 3MSPA 5DO2D 1WQVT 2APWA 1OD9A 5M95B 2E27H 4UTAH 2YZ1A 1JNHB 3GZKA 5AYQA 3SHSA 1KCRH 1OTUD 1J12A 2VXQL 2ZUUA 4JFEE 1C16B 4I9WD 5T3XH 2Z4QB 3VFWB 2X09A 4L8SB 4UTBH 1JV5B 5F97E 3Q6GL 3IFNH 4PGCB 3FTGA 1FL6B 4DTGL 3SO5A 2EDFA 4PRNA 4J8RB 1D5MA 3O6FC 2OMNA 2PR4L 3GJFB 1CT8A 1JN6A 3EOBB 2D7TH 3G6AB 4I2XA 3QULA 3UDWA 4G42B 1FC1A 1Z3GH 5IHBA 1AXTL 2R0WL 2Y5TA 4U33A 5C2BH 1RAMA 2P46B 1NC2D 5ISZA 3F7QA 1S78C 5FM4A 3QIWC 3RX8A 3ARPA 2IALB 1A1MA 4CDHA 2WSKA 3ETBF 4NFCA 5I15H 3KLDA 1BAFL 2KH2B 2YA1A 1CICA 3DV4B 3T04D 5IKCB 1U3JA 3KJ6L 2R69H 3QCVH 3GKWH 1F58H 3QFJD 5KOMC 3HE7B 1DE4A 1JWMA 3CXHJ 4X98B 5J12B 5C09D 4JG0H 1EZVX 3T2NH 2VLLA 1WC7B 4YPGA 2BSRB 3DOSA 4DOHE 2P5WB 3GSNH 2X5PA 2BZDA 3QP3A 5F88B 3EYVB 3VXTB 2DLHA 2GFBA 4NO0A 3ULVF 5F7KC 2FX8L 2VDNL 5IMOB 3MUGA 3LKPB 4UOW0 4R3SB 4HPOH 1JTTA 5E9DB 5C0BA 5H8DA 5A2FA 3LDBC 4YXLH 3V52L 4OZFG 1I1CA 3JZ7A 4M8VA 4PG2C 5F7NC 3C09C 1XR9A 5T5NG 5DMIH 4HBCH 5I1LA 3OX8A 4I3SL 1MFCH 2P42B 4NBZB 2PUQT 5FCUH 3IU4L 5D7JD 3C6SB 3IKCB 4JREB 5ITFB 4DGVL 1BMGA 4OV5A 2OZ4L 1D5MB 1I8MA 4UB0H 5IQ7L 4LLVA 3VXME 4HC1A 4O58H 4UDTA 5C0GA 4TUOA 5DJ8A 1DQQB 3HE6A 5EH1A 4LIQL 5DMYA 3FOMA 2GJ6A 4XVUD 2WUCH 1C5BL 4G8GE 1UEMA 5E08H 3WFHA 1BFTA 2X10A 2R39A 3STZA 3EUUA 1RUPH 1U42A 1H5BB 2NY1D 4N8VG 4AM0A 4PRHB 4OZFB 2UYLB 3RIFK 2N7BA 3M07A 5JW3H 3KGRA 3KPPA 3T4YA 2AK1H 4JQXA 4IRZL 1DE4B 5C0IA 1EAPA 3IJYA 5IP4A 3LS5H 4PS4L 4JQVC 1BLNB 3IS0X 5HHPA 5C0ND 1RJZA 1J0HA 2W9DH 1TQCB 2V2TB 5K93A 3BKML 1NLBH 3H0TA 3CFEA 5F9DC 2GSGA 5EN2A 1KGCE 1KCUH 3U4BL 3MRBA 1WEJH 3LKRB 1WIOA 2A2QT 1OGAD 1DBKL 4TTGA 1CGYA 3RA7H 1IGYA 1A6PA 2OJEB 3CDFA 3SDXE 1KB9J 1YMHB 3EBAA 1LO3H 3GEWB 5KSAC 4OCRL 5D5MB 4N8VB 4OLVL 3WXVH 2MNUA 4BZ2H 3SOBL 4W4OA 5E8OA 3OX8B 4M6OL 3ARFB 5LGHL 5TE4H 1KPUB 4Z7QE 5EBLB 2OTWA 4YGAB 4HIIB 3K0WA 3B5HA 2ZUXA 4LRNL 5D6DC 5MEQA 3CFDB 2HLAB 2WMPA 2WIIB 4WWID 1A64A 5GRXG 4YR6A 3V4PH 4LSVH 3L3HA 4E42B 4GT7A 2XWBA 3VI3E 1P53A 3VCLA 2DI7A 5DVOA 3I2CL 2B5IB 4D9RD 5JR1L 2FBJL 2CXKA 3EOYG 1NUFA 1UWXK 2XI9A 3DNKA 4DW2L 5CBAB 1QSFB 5LBSH 4P49A 2ITDA 3T0DA 2YD4A 3BP7A 2FX9H 2F74A 3M17A 4K71C 2E7LA 3STZB 1MLCB 3RDTD 4NQXA 1WZMA 4QOKB 3EDFA 4XH2B 3GSXA 5CUSH 4MJIA 4WW1B 5TDOA 5DI8A 4DK3A 4MA8L 1UQSB 1F42A 4HGMA 3HNVL 4MAYD 2JCCE 2J2ZA 5J6HA 3EDKA 1AQDA 3GUTA 4Y16A 3DROB 1HIMH 5C9JB 4WWKD 2VO5A 2DKSA 4KRNA 4CU6A 4RIRA 1MF2L 2XG5A 2CRIA 4D9LH 2YXFA 3FHAA 3M1BB 2R29H 4P57A 2YD5A 4Z77A 3D3VD 1Q72L 3RVXD 1WT5C 4NNYA 3OXSB 3KPMA 2OP4L 1LMKA 1KN4L 2GITA 4BM7A 4CU7A 5KOVC 5DD0H 2VLKD 1S5HA 3AS3A 3VXRA 3GMLB 5IB4B 5M94B 3TVMA 5JIIA 2D7OA 4NKDB 1S9KC 1AP2B 4TVPH 4AQOA 3O11A 2HVKB 2GSIA 3CZFA 1ZS8A 5EOQH 2HN7A 3RWDA 3K4DA 3T1FB 4NQDD 4HIXH 1X5JA 3ZSSA 2HLFD 5IM7A 3KPRB 3QAZC 5E8OB 2FB4H 1CFVH 3LS4L 4RAVB 1YMMA 5JDSA 3PL6A 4Q6IC 2X89D 5C3LD 3IDUA 2G60L 2QQKL 4M43L 2V7NB 4U6HA 2NXYC 2X70B 3ZTNH 5DD5L 3JWDL 5JO5A 3KYNB 4MCZB 1U91B 3L3HB 4IDLA 5I30L 5IFHH 3WFBL 1CE6B 3GBML 4YHYC 2DWDA 4QGYA 1GSMA 3WLWC 1D7FA 2WWMC 2QSCH 2VDLL 1KLGA 3LMJL 2JELL 4Z7NF 4OZGE 4UNUA 3HC0B 2R4RL 4U1LB 5T1LD 5ITBH 1A6AA 3SDCB 2C1OA 2F53A 4NQUA 4YHOL 3BWAA 1W0YT 4NWUL 4CJ1A 4YXHH 2XTLA 3P0VL 4NQXB 4HD9A 4P2QB 4EQ2A 2YD7A 3FN0L 2PYFA 4FFYL 4M7KH 3PHOB 5HYIA 5J6HB 2ZUVA 5E6YA 4S0TD 5IMMB 4U1IB 3T77B 5EIIB 3RWJB 5T1KA 3QEUB 1DQJA 2W65A 3VDBA 2B4CH 3ARUA 4NQTA 2WM0A 2NY6D 3E8UH 1AO7E 4W70A 2BXZA 1NLDL 3V0WH 3F5WB 2XKNA 4JZNB 3UC0L 3O3EA 4G9FD 3WFEH 1F3DH 2L7JA 2BSSA 4LSSH 3NH7H 1G9NH 4FXKB 2NY3B 2D2OA 2FX7L 1X5ZA 1RMFH 3SDXF 4NNYB 4GSDH 2VOTA 5CFHA 4HKXA 5EPMB 3I6KA 3MJ9L 1S7UA 2ESVB 1FV1B 1DBBL 1TFHA 4AT6A 4JFHD 4LCYB 2XKSA 4ZXBC 3VWKB 4XX1G 3BP5A 3GSVA 1DTUA 3HC4H 4Z7QF 2DTML 3ARGC 3FO0H 4NYLB 4RWYH 2DF3A 5HDLA 5HGGS 5C08A 3CC5B 2NY4B 3B5TA 3GJEB 1XGPA 2Y4SA 2V9RA 5ICYB 3JV6A 4ONHA 1JYWA 2QR0A 4OCMC 3VI3F 3MXWH 4BFGA 5ETUB 5I73C 4GJTB 4DWHA 2ZSVB 3KYOA 2YPVL 4HS3A 3CXDL 4J6RH 4LHUG 4PREB 2P8MB 3VXUA 3V5KA 4GRLC 4HUNB 1KTKE 4Y2DC 5K9OB 1LEIA 5T1DL 2KZ1B 3IDNB 5GRJH 4C4KO 4P2CG 4Q2ZB 4PJGE 3O6FD 3UROR 4LHQB 4FP8L 1C7TA 3KVQA 5D1QC 1XGRA 5T33L 1UM4H 2DDQL 4UILL 3OKDB 1F3JA 2EIEA 3EW3B 1S78D 2JCCF 3C6LA 2W9EH 4PJHF 1T1YA 5HGHB 4HLJA 4YH6A 4YNYB 4JRYA 4AEFA 4U2YA 1UB5A 2P24B 1V3MA 1IGIL 4JFDA 2O5ZL 1QNZL 2KZWA 1RFDH 4N9GA 1KOAA 2B1AH 4MXVF 3BZEA 4YX2L 3CDCA 1MHEA 5GGTA 2FHBA 6FABH 4G3YH 4LHUB 3OR7A 4EI5B 4WJ5B 4R7DA 1U6AL 4UUJA 3AB0B 2YD1A 1LHZA 2EDYA 4AENB 2VN4A 4H5SA 4DZBA 1QRND 4NRZB 3MFFB 2GTWA 3I3BA 3WFDH 1M6OA 4YDLB 1IGTA 4A6YL 4AEHH 4M5YL 1A3RL 1T22B 3PP4L 3O9WB 3WNKA 1EEYA 4RFEA 4NM8H 2Q1EA 1KB5A 4AT6B 4OFYA 5MENA 1R0AH 1DN2A 4GRWH 2HVJA 1AGBA 2Z92B 3PWJB 1VESA 3CK0L 2R1XA 3DPBA 1T04A 4ODHL 5F7EL 3EIFA 2AK4A 3Q5TA 3V8CA 2Z35B 1TVHB 2VDPL 2QR0B 3U2SB 4DZ8A 4YQXH 3CDGA 1ZOXA 3ZKND 3V5HA 3QQ4B 2CRMA 2X1XR 5AAMA 4Z5RB 1HDMA 3BUYB 1HSBB 3V0VA 1HH9B 43CAA 1W72L 4XMPH 3LQAC 3QEHB 4MD4B 4QXGH 3IRZA 1EFXB 2PXYC 1I8KB 1LEKB 4XPAH 1YPZE 4MJ5A 3NVQA 3X3GH 5JUEH 4N9OB 3C5ZC 4YHNB 3ESVF 3MJ8A 4B53A 3CFIC 5HHQA 3G6DL 1MFBH 4OCLC 5D7IE 2IADB 4PTTB 1YEKL 1ITCA 2AW2A 1R3JB 3U6RB 4OKVA 3ME0A 2NW3B 4Q9RL 4JFFB 4OD2B 3PWLA 3QIBB 1CFQA 2J4WH 2BNQB 3TPKA 1JGVL 5E95B 1KF9B 2DOCA 2UY7A 1MQKL 3G5XB 4WI7A 3SDAB 2EE3A 3BZEB 1AHWC 1S9XA 4QT5B 1FZKA 1QHPA 3S35H 2HT3D 2JB6B 4QHKI 3MLWH 3O3UN 3UJJH 1RHFA 1ZT7A 5F7YC 1CYGA 5FKAA 3G6JF 4RAUA 2DD8H 1W0VB 1RUAL 25C8H 2K3TA 4DFHA 4CVZA 2G2RB 5ALCH 3F7PC 1K6QH 2Q8AH 3V2AR 1G7QB 1QVOA 1ZLWH 1SBBA 4EXKA 5DSCB 1KIPA 2QJDA 1U92B 4TN9A 4M1CC 2RQ8A 2CIIA 4MD5B 2XRAL 1XH3A 1A14H 1T4KA 2W0FA 1ZLWK 1N5YH 1I3UA 1AC0A 1HEZA 3QZWG 5KSAD 4PJGF 3RWCB 5ICXB 4XAWH 3DV6B 1INQB 2Y06L 3N1GC 1MCNA 3O6LH 1UJ3A 1Y0LA 5JHDA 2UVFA 2CRYA 4CVUA 4PY7B 5IHZA 5F7UA 4YHLH 1ETZA 4HS8L 1MCBA 5DQ9A 3SKOB 3IT8D 2N7AA 2DM3A 2R23A 1S9YA 5DVKA 4OCYH 1WLHA 2FJGA 5HYJA 2EH8H 2YXMA 2Q7YA 3P4LA 1UCBL 2DWEA 2P5WE 1U0QA 1DQML 2XT1B 1MHPH 1Q9KB 2R0ZH 1F4WH 4IDJH 1DDHA 3ULVC 2O5XL 1QTYT 3IDMB 4XRCA 3KPSA 4ETYA 3B5GA 4K2UH 2IG2H 4LVOB 3WLBA 2HTKC 4AH2A 5HDQL 1J0JA 1H3PH 2YWZA 3Q6FB 3UCRA 3AU1B 3QZWB 3E2HB 2APFA 5E9DE 2YD8A 1ORSA 3BEVA 4YFLI 4L4VD 5F9WB 4G7VH 5EO1B 5D71L 1S9XB 1FZKB 2AGJH 2DN7A 3Q0HA 5ACZB 1A22B 1VFBA 4ERSL 4PTUA 5I1CH 43C9B 2W92A 5J3HC 1G7JB 2V9TA 4LARL 3BVNB 4OGZA 2YEZB 3QXWA 3UTQB 3NZ8B 4JQIH 1BQSA 1NDGA 4LKXA 3Q1SL 5FKAB 3PGCB 5ECJE 4ZO7A 2FR4B 4ZD3L 3WKNA 3FQRA 4KKCC 2GAZA 2I25N 1PW3A 1UWGL 1GGCL 3PABB 1FG9C 1NBYB 2AXGB 3V4UL 2LVCA 3MNVA 1FL3A 4U1MB 4N90D 4NRXA 2Y6SC 3WSQH 1JPFB 1JGUL 1VGEH 1Q9WB 3PWUB 2AEPH 5EU6D 5HJ3A 2X7LB 4OZ4A 4WY7L 2BXYA 5T1MB 2OZ4A 2GK0B 2VKWA 1EAJA 2V17L 1YPZF 3VFOA 1WAAF 3SKNB 2ZOLA 4F15C 2ICES 5CGYC 2H9GA 2X4QB 3OPZL 4PRHE 2ZG1A 1XT5A 3NTCH 3N9GL 1GJIA 2WBJC 2NXYD 1J18A 4XP1H 5GS0H 5D9SB 1KN2H 5D7IF 1NGQL 1UB6A 1R5IA 1UZ8A 4ZO6A 2R2EB 2ZUQC 5IVNA 2GYSA 1Q1JL 1VHPA 4OF6A 2VDRH 3WLWD 2WWMD 5EZOH 2H1PH 4C4KT 4UBDC 4EOWH 4KZDL 1OWRM 2NY2D 1XCQB 4V1DD 2OL3H 4Y1AD 5D1ZA 4GG6B 3SY0B 5EIQA 5AZEH 1T0PB 4TUKH 5E5RB 1MFDL 4XNMA 5DZOA 1X3DA 4XC3L 1NANH 5IJKA 3DYOA 4D2NA 3ARTA 4E0RB 1PLGH 5L0QC 1NAKL 3AFLA 1VB9A 1AI1L 1QSED 1U8OB 4WEMB 3ULSA 1T0MB 1H0DA 3SEPA 3S37L 3UX9B 2HFGH 2LTQC 1QSZA 1J8HA 1YEGH 1DUYA 3PWPA 2JK5A 4OSUH 5C0RH 3SKJH 2ZP0T 5F6IB 3BH9A 1MWAA 2I26N 3AMLA 2EO9A 2X1OA 3S6CA 1FFOB 4WI3A 3NA9H 1NDGB 5C2UB 4X6DB 3VFTB 2X1WL 1FNLA 3G08B 1CBVH 4LAQL 4M9OA 4H1LH 2BX5A 1RZGA 4UAOC 1GH7A 2XXCB 4R97C 2R2BB 1VPOH 4YDVA 1JHTB 3LKOB 4ZXBD 5FM8A 2HFTA 2WLYA 4D0CA 2WIMA 2H26A 1FYHB 1CF8H 1YYLL 1LP9B 1Q0XH 3ARGD 5IVXA 3EYOA 3C5SA 4J3WA 2DMKA 2X4RA 1FZJA 2VKXA 4QRRD 2YPLB 3WJJA 3SCMB 4YHML 5CLTA 2AERT 3O4LB 4L4JA 3AAZA 5D2LA 5EZIH 5HJ3B 32C2B 3CUPA 4OZ4B 3BDXA 2EYTB 5JOPE 3UO1H 1R3LA 4QOKE 1NCAH 4GRLD 4RBPH 4NO2A 1OGTB 4Y2DD 4YE4L 4KJPC 4O2EA 4HXAH 1OAXL 2C4XA 1KACB 4OFIA 5EUOB 4CN6A 1N4XH 2BNUA 3MV9B 5D1QD 1R5IB 2ADFL 2HJFA 1E4KA 2ICWB 4J1UB 3HB3C 5C07D 2PW1B 3P2TA 3MLYH 4KMTL 5IBLC 1KIRB 1SBSL 4PYHA 1MNUL 4P4KC 4X6CB 1OY3B 2BHUA 3RWHB 1L0YA 3EHBC 3GRWH 3L5XL 1TETL 3CZJA 4XNUL 4HMEA 1H8NA 1QFUL 2DQDH 3X17A 2IBGA 2CLZA 3OG4B 4PRDA 4YFLF 4AG4H 4WFEE 1HHHB 3OHXA 2P5EE 2ZZUT 4XP4L 1R3IL 3N0PB 1LQSR 1YC8A 3G04A 4L8BA 1AQKH 4OIBA 4NCC1 2CRZA 2AJSL 3IETB 3S36H 3VD4A 2NY7H 3ZT5A 4NKMA 4YUEL 3KPRE 2C3GA 1F45A 2XZQH 3ZKXC 5JQHC 1T1XA 1I1FB 3MLSH 4DKFL 3TZVC 4X4MA 3SQOH 3FQWB 4P2OB 2FWOB 3HZKB 1FCCA 3U36A 1AGFA 5E99H 3S88L 2CD0A 3L3IB 1FSKC 3K80A 4GBXB 3VG9C 2OQJA 4MA1B 3UTZA 2VLJD 3CFCH 3HNSH 4D0CB 4Q9QL 4HUWA 3W39A 4GAJH 1IQWL 4CN4A 1PJ9A 3QH3B 5T5NF 4HUKB 3N06B 1RIHL 3X13A 3C2AH 1H3WM 5DQJA 5H94A 3RZWA 4KKAC 4QNPE 1ZVHA 4TNWF 2B8OT 3NCYP 4RRPG 4ONGH 3F62A 4CADB 5C70A 2ZJSL 3SDDA 1F97A 2ZOKA 3VXPA 4Y5XB 4JFQB 1B2WL 3PE9A 4YIQA 1A4JB 4Z9KB 3LEYH 4OZIF 2UZIH 3VXSA 3EYSL 4D0BA 3R0MA 2VAJA 4LVHB 3IXAB 2DKUA 5IOPB 3MA7A 1QO3B 1H8OA 3C5ZD 1MI5B 5B3JE 2ADIA 1FVEB 3LZFL 4EUPG 1G7HB 4IIQA 3H9SE 4QRQB 4JO2L 1KTRL 6CGTA 3BMWA 3DVFA 2BJMH 4BZ1H 4PJ7B 3X11B 4CVXA 1JNNH 3JTSB 3MRQA 3MOAH 4S1SH 1IEAB 3FCTB 2D7PA 4FQCL 5IEKB 1FBIL 1JHLH 3NFNB 3VXNA 4TQEL 2VDKL 1ZGLM 1FVDA 2XTJE 3SE4C 4D3CH 2E7MA 2IAMA 2DQHH 4OBRA 4G6JH 3MJ9A 3LRSB 1P9MC 5JTWA 3HTLX 4KTYA 4NPYA 1M7IA 3LN5A 5JZ7C 4N5UA 5IVZA 2AKRA 3OKMA 2ZCLL 3CFJB 4M1GH 2IQAB 3TBYB 2GUOB 2NY0C 1LILA 1AIFA 1BPVA 4OLUH 3RTQB 4IRSC 4V2BA 5F89A 1RI8A 4HDIA 4X6BA 4EUPB 1LO0L 1O0VA 4ODXA 1WBZA 3RWFA 4LSQL 2WQRA 4Y5YA 4E41A 3ARBB 5IG7A 3O8XD 1I7UB 5DJ2B 3MLZH 1JFQL 1CR9H 2LVEA 4NQCA 3WIHL 4XX1E 5CKAA 1GZPA 1DBMH 1CVRA 3RY5A 1KPRB 4MVBC 1J8KA 1QBML 2GI7A 5DC4B 3TBTB 3MRPA 2DQTL 1I1YB 5SWZA 3OXRA 1KJ2B 3TBSA 5CIPB 1S9VA 4JDVB 3MBXH 4MHHI 1QLEL 5HHMB 1W2KT 2CKBL 2RJMA 3QJHB 3KXFE 3TM6A 3FFCD 4PP2A 1BBJA 3C60B 3HG1D 3VFUA 2AJUH 2VLRD 4O00A 3BGMB 1DVFC 3MA9L 5E2UH 4G8FA 2HRPH 5ESAB 3ELAT 4HIEB 3I6GB 4JY5H 1FCGA 3D39D 5DRXA 4ZQKB 5EU7E 2GJJA 1EMTH 2IC2A 5LJYH 1JIBA 4JG1H 1VKXB 2MCPH 3ULVD 4WFFE 3D9AH 4KDTA 3TH4T 1XGTA 1R5WA 2HTKD 1F13A 3VD5A 5ILTH 3BXNA 3KR3L 1BD2A 3JV5A 5J13C 2LQRA 4F7EB 3T2OA 4B41A 2PO6A 3P0YL 1NC2A 1FAIH 2VAAA 3OB0K 1D9KB 1WF5A 3KPQB 5I1GL 5J3HD 2KPNA 4HWBH 1OW0C 3FO1A 1IL1A 3REWB 5KS9A 1CLOH 5EULV 5ADPL 5HVHC 3STBA 1EEUA 3O3AB 4KKCD 4ZODA 1F90H 4PJCB 4L3ED 3RPKA 3QFJA 2ICCA 5EU3A 1CN4A 5DJDA 4NN5B 2KQNA 4XGZB 3KPOB 4FTVB 4Z95H 4UU9A 1NGWA 4G5ZH 1EZVY 4ODXB 2Y6SD 1EJOL 2R2HA 4L5FL 4JR9L 3V7MA 4JVPA 5CJXC 3E3QE 3DYMA 3WN5C 4OM0L 1RHHB 3P9LB 1W72A 1QEWA 4YHPB 4LSRL 4WU5B 4NQCB 2R1WA 2R0KH 4L4TA 2RB8A 5CGYD 4JFFE 2O93L 3R4DA 4ZYKB 5B3JF 2WBJD 1FJ1A 2XPGB 5B8CC 2BVQA 3HPJA 5I2IA 5E94A 4R26L 4TNVF 3QWRD 4HUUB 4NNXB 1ONQB 4HFWA 1PQZA 2Y9RT 4UBDD 3O3DA 3MC0A 5CCKL 3AXLB 1A6UL 4G6AC 1BREA 1Z2KA 5FUOL 4YGVB 5GJTH 5DRXB 2G75A 3SGDH 1JRHI 3RGVC 5D7JA 1T89A 3ZE1E 1DLHA 3MRIB 2NXZB 4M7LL 4JFED 2FGWH 4M6NH 1LDPL 2IFFH 4X5XB 4KFZC 1ED3B 4ZG1A 1V7NL 4OIIL 3I50L 1QYGH 4KJYB 4NO3B 3BH8B 5EZLA 4HJJL 3H42L 3WFZA 3DBXB 4DGIH 1UYWH 4LEXL 4KH2A 4F7PB 1VDGA 1P4LA 4OZHF 5BZDA 4NSKB 4P9HC 1A7RH 4BH8B 5JIKA 3HZVA 3HZMB 3HUJE 4A6YB 4OCWH 5LXGL 1VERA 1EGJL 4XC1H 4NNPL 4U6VL 5E24E 3IU3B 3VXQA 1EVTC 1MJUH 3RL2A 2IBZY 3TO4C 1GIGH 2E6PA 4PJFB 1MPAL 3W9DA 4WI5A 1A7QH 4OUUA 3QQ9C 5DS8A 5IB2A 4JHZA 5EORL 1KLFA 4OB5L 1WCQA 2EECA 5C09B 2MQ0A 4M93C 1MREL 3U82B 3NCJL 4DKEL 5L88L 2BDNL 3FQXA 4KU1A 5FGCE 5L8LB 3O2WH 1A6VL 3S35X 5C0FB 1A8JH 1G6RL 5I16A 5IWLC 2X4SA 3S5LA 3WHE0 5F7FA 1INDL 1OAYL 3QIUC 1JYXA 4UDUA 3V6ZA 3KPLB 3MCKA 2R8SH 2DYPB 2O5YH 4KJPD 2D7QA 1LO2H 1OGAA 2PW2A 2A9ML 3ULUH 5TQ2H 1FE8L 4Z7OE 3QUZA 3MRFB 1DBAL 2YD9A 3NBNA 1L9NA 4K3GA 4U0RB 1MHCA 2AXJA 4D0DB 1BOGB 5IBLD 2XV6B 3GGWA 2YD2A 1XCTB 4P4KD 3EHBD 1FFPA 2CLVB 3PJSB 3JV0A 4K7FA 3WNLA 4LBEB 4S1RH 2IFGA 5D7JB 3UMTA 1G7LB 3BYYA 3HI6H 3L7FA 4RCAA 4UT9L 5GS1C 1GCFA 3AVEA 2IH3A 4QRTB 2W60B 1FO0H 3P30L 3MCLL 2YC1B 5TFSL 5DUMH 5DLMH 4N5EC 4DFIA 1G9ML 1I3GH 3IFPB 2VSCA 4XNXL 3CSBA 3VXMD 1RJLA 2VDOL 5IQ9A 4J3UA 4M8QB 2XG4A 4QY8B 4ODVL 4JPIA 5BZDB 5IB5B 1A9BB 3RDTA 2CO7B 4GQPH 5GGVY 1QBLL 4Z0BL 3WDHA 3A6OA 4G8GD 3LD8B 3DIFB 4PB9L 2GTZB 2JJTC 2NY1B 3TZVD 5HYEA 2B4CC 5E2VL 3GSUA 3DUUB 1FYTB 1LE9B 35C8H 1ERNA 4XAKE 4XPGH 3FFDA 1F02I 5JW4Q 4IRJA 3FT3B 3HPLB 3FRPG 3T0EC 1D5ZB 4UIKH 4YHZL 4JKMA 1PYWB 3Q3GB 4YDJB 1C08B 4GG6E 2Z31C 4GMTH 1U8PA 4Q6YA 4R96A 1EHXA 3NPSB 5GHWL 1FNSH 2ATKB 4P59L 5I1HH 5DK0B 2VXSL 5L2KB 4KKAD 4RQQA 4ZFZB 1SYSA 2VLKA 4O51B 5TF1L 1KGCD 4NZTL 3RWEB 2W1NA 5J1AB 1OGAB 2C3XA 1PSKL 4HHAB 3MLTA 3BT2H 3QUMH 4FZEL 4QHNB 4L8CB 3RP1A 3V6BR 2EXWC 4HV8A 3MPCA 5IROA 1S7QB 1B6DA 4NQDA 4UOW1 4KRPB 5J4MA 3D2UA 5EU4B 1GZQA 5AWNL 3ZYIA 5LGJA 4WU7A 1S7TA 4X6DE 1HK6A 4Y88A 2VDMH 4O2FB 3OZ9H 4JM2A 2A73A 3CVHH 1J1OH 5A2IH 4O2CA 1TDQA 2HP4A 5MERB 3AY4C 3HUJF 4BQ8A 3LKQB 4QHUA 3MRNB 5I19L 2CDFA 3TT3L 1NSNL 2OCFD 1E6JH 3RBGA 1LP9E 2Z0BA 3F12B 3LQAL 5T1LA 4TSCL 1JGEA 2IPTH 2A9NH 2YPLE 1D5BA 4XXDA 4JFXA 3S4SG 1WWCA 3O4LE 4EN3C 4TYUA 5FB8A 1U8KA 4LGRB 4HPYL 1AE6H 2WBKA 1DN0B 5DC0A 5GIRB 3MRHB 4WUKL 4NFBA 1YA5A 5T5FL 4X8XA 1IFHL 2ICWI 2NY0D 4MAYB 4ETQA 4IRSD 5EUOE 1OCWL 2OR7A 3MV9E 4X8JB 4PBVC 4WWKB 2X4OB 3TCLB 3C2SA 5ICZB 5MEPA 2QHRL 5DMGD 3CPLB 2NW2A 2ZSWA 2F5AH 1EUTA 3ULUE 4G9FA 3G9VA 2IH1B 3MNWB 4IHOA 2BFVL 2J5LB 5HD8C 1IAII 5DD3H 4Z7OF 2FYYA 3D3VB 3CFBB 4LCCB 2AJZB 1OHQA 5E00A 4MVBD 5F3BA 1LD9B 4ZPTA 1YEHL 2EKSA 4ODTL 4JY6A 3RVUC 1T7XA 4XBEH 1YEIH 1MRFH 3EYFB 2VLKB 1H3UA 1ZHNA 3S4SB 5FDWB 1KIQA 3B2VL 4HS6B 4M62H 3BAEH 3KDMB 5GRVL 4MDIB 3STLB 1MJ7H 12E8L 1L7IH 3KHQA 5FECB 4R6UA 3PHQB 4YLQT 1NC4D 4PP1C 1DVFD 2A1WL 3GI9L 3LRGA 4PG9A 4LLMA 1A3LL 3VFRB 1HH6A 4MB4A 5JPMA 5KW9L 2HT2D 1G0XA 4L8DA 3GB7B 2ZUSA 4PGDA 3ZDXE 1H5BC 2BVEA 1BQLL 2VISA 3FB6B 4LQ1A 1RU9L 1OB1A 4FNLL 3U1SH 3NFSH 1RZIB 3TLRA 1KG0B 3T65A 4MNHB 2W38A 4OQTL 4YDKL 5HHVL 1I1AC 5EZJA 5CBEA 3GM0A 4OFKA 2J3SA 4I0PA 2I60H 4MA7L 1IM3B 1T1ZA 1Y6MR 3F7VA 1MUJB 1CE1H 3DX8A 1ODAA 3OGCA 1JF6A 4EVNA 3L3JB 1F2XK 3ULVL 1ZLUH 4JPWL 3FZUC 4C55A 3KYMB 2CGRL 4ZAKC 1RK0B 4X4YB 2NY6B 5E7FA 3B4NA 3O45B 5BQ7A 1INEL 1ZLUK 2C7UB 1MI5E 5B38A 2BVPB 2ORBL 1EPFA 5KSVA 5I66B 1QRNA 1AO7D 2X4TA 1VSCA 4XPHH 4GW4A 1RZFL 3NIDE 5HBBA 4KTDL 5FO7B 4FA8A 1AKJD 4CMMB 5F3BB 1M7DB 4TRPH 1OT1A 1G7IA 4LLUA 1FN4A 4ZPVA 3SE3C 5IGXL 3BO8A 1IKNC 3IDJA 4JZJA 3TEUA 4OCXH 5IVOA 3RBSA 4P2YA 4C83B 4C56B 1PKQE 2A83B 1VGKA 5FOJA 1D5XA 1SHMA 3MOQA 2OLDA 3HAEA 3GJFK 5ERWA 4G6AD 3BI9X 2V5YA 3RGVD 2BMKB 3QHTC 4R4NC 4ALAH 4TUJA 3V4VH 3ABZA 4ZFFB 5C0AA 4Y2OA 1NCDL 1YY9C 1JYNA 2GCYB 3I3DA 4NJ9H 4KKNA 3O6FB 2J8HA 4Z7VA 5CJOL 1B9ZA 4N0YL 4F9PC 3BESR 2VC2H 4F9LC 4M6AA 4Y19B 4X7SH 1VFAB 4UV7H 1SEBA 3HS0A 1I3RA 1Z0NA 2GT9A 5GGQL 2AVGA 2AXHA 2ZUTA 3QIWB 5E0QA 4N0UE 5EUOF 1DANU 3GIVB 1IAMA 3IAGC 3X3FH 1QQDA 3C5JB 4FQXB 5TGBA 1X5GA 4UI2A 5ESVB 3ULUF 1NCBL 4X80H 1NGPL 3QDHA 5CJ8A 4XVSH 4I5BA 3TO4D 5M7QA 3HZYA 2CJUL 4H88L 3W2DL 3QQ9D 4LDOB 4PLOB 5C0JA 1HN1A 3WIHA 4N8CL 3DVNB 3FONA 1UM5H 1K3ZA 1Z9LA 3U7YL 2P44B 3D0VB 3EGSA 1NAMB 3QEQA 1JPTH 3WIFB 1IGCL 1UKSA 3DX9B 3PG2A 3TO2A 3PWVA 5DRZB 2CKBA 1VA9A 5DJCB 1YEEH 4H20L 3QIUD 4Q9BA 4U4BA 5EO0B 5DWUL 1NBZB 5BV7L 1NGYB 4H8WH 1OP3K 5E70A 1C5DA 1C12A 4LMQE 2P8PB 3MO1B 3LDBB 1P7KA 2UV3A 4EDWL 1XGQB 4U7MA 4D8PB 5KN5B 4LLDB 3PNWB 5DUBA 1IC7H 5CMAB 4KHTH 4HX1A 5GS0C 2I9LA 4Z7WA 2AABL 3LN4B 3CLFH 4HGWB 1Y6KR 2CMRL 1KBGH 4P5TB 4XVJL 4TUJB 3RVVC 5E6IA 1ZA3B 3N85H 2CIKA 4POZC 3FQTA 4PJBA 4DVRH 1C8PA 1AC6A 1R6VA 5GZOC 1OAUL 3G5ZA 1DBJH 4G8EA 4N5ED 4LLYA 2I5YH 1TIUA 4TTDC 1YNLL 1HZHL 1S7XA 1CDCA 4WUUB 3WNNA 1CGVA 1QFOA 4JN1L 4JHWH 5I6XB 2Y36L 3OAUH 4XP9H 1OOAA 1RUKH 5FA4B 4Z8FL 2AAVA 4K3EL 4F80A 4MDJA 4MNQB 2EIZA 2Q6WA 3ARZA 3VFPA 4QXTB 2NY3C 5FYLE 4FQPA 4I18C 3LHPL 3QT2A 4KY1H 4ZO9A 4QO1A 4HKJA 3NIDF 4AYFA 2DL2A 1JE6A 1R5VB 3VWKC 3GHBL 4NWTH 2PYEB 2VWEE 4PR5A 4GLRH 5FO8A 3D18B 3U7WH 4FMFA 2Z31D 1A6ZB 4FABH 4GUPA 2XTJC 3EGSB 2NY5H 2MSPA 2Y5EA 1ZHLA 4OAWA 3TO2B 4ELMA 3BEWB 4BQ9A 4N0FA 1MEXL 2CKBB 3OJVC 1ZVSA 4NOBA 2N4IA 4XCFH 5TE7H 7FABL 1IQDA 2UZXB 5I1DA 3T8XB 4N0RA 1KEMH 3HC3H 1HE7A 3L3KB 4MX7B 2V2XB 1WZ1H 1E27B 1F8TH 4KUCD 5JXAH 4WI4A 4PJDB 3IDXL 3F7YA 4ORZC 5DYOA 3GM8A 2D03L 5EIVA 1MFEH 4ISVA 1JBJA 5D2NC 2EXWD 1JK8A 3TNNA 5KSAB 4HC1H 5EU6A 3QSKB 4KPHH 4PYGA 3WD5L 3DRTB 2Q76A 4OI8A 4Q6IA 2DLIA 5T3ZE 2VYRE 5KVEH 3WS3B 5I18H 3QCUH 4UMGA 5DEFB 2BNRE 1ORQA 2JIXB 1CG9A 5D7LE 1VFMA 2E8ZA 3D69A 3BDYL 5EU5B 4EDXB 4ODBD 3OKEB 3GSOA 1MCHA 1IGJB 1EGJA 3PHSA 1DANT 4Y1AA 1KEGL 1J1PL 4CNIA 2JJSA 3ROOA 3LAFA 2Y25A 1KNOB 4N1HB 4NKQB 4WI2A 1G7PA 3BJ91 1MAJA 5DURB 4P2RE 3VRIA 1JWSA 4K71B 3AB0C 1A4KA 2P5WD 1BP3B 4QRUB 1Q9LA 4XBGB 2ATPB 5EU7C 2VSDA 3BSZL 4JHAL 2D7TL 3BIAX 3ZTJG 2X1PA 1KT2A 5GGRY 1P4IH 1H3XA 4YDLC 1F4YL 3FHQA 2F54B 4L4VB 3WHXB 3U46B 1SVZA 3RHWK 1RUMH 3GNML 1G6RA 4O02H 1RZ8A 3TA3C 5E9DD 4XXCA 2HFFB 2M8XA 5FKPA 2UWEE 1X6LA 5HD8D 2AJVL 4YBQD 4WFGE 3VW3L 1TZHA 4Z18A 2R69L 4F7MA 3ZHDA 3GKWL 1F58L 1RZJC 3RVUD 3QUXC 1WFUA 5IW6A 3IS1X 2FJFA 4GQ9L 1E28B 3T3ME 3U0WH 1OSZB 1IAKA 5EB9A 3GIZL 3DWTA 5J6GA 5E1AA 1J7VR 1TTFA 4PP1D 1N3NB 1D6VL 1V05A 5EC2A 1TCRA 3TNNB 3WKMH 2BCKA 3ZKSD 1FDLH 3FT4B 4HZAA 3QAZB 4AL8H 5ID0A 3QRGL 5IV2B 5D6CA 4HUMB 1ACYH 4HLZH 1FYTE 1CD1B 2NXYB 1A7NL 1J11A 1FNAA 4J4PA 4MA3A 4PRHD 3QIBC 3U9PL 4YHYB 1RVFL 2IANA 2HYMA 1CI5A 1N2RB 4LQFH 5D8JH 3GSOB 5C07A 1YUHA 1GGYA 4HBCL 4OGYH 4V1DB 1I1AD 1F4XH 1MHHB 3BRFA 3EO1A 1Q0YH 5CZXC 1U3HC 1MCFA 5I1AA 4Z7UA 4JN2B 2BC4B 2OR9L 1DEEB 5L2KE 5SX4I 1S5IL 2A6DA 5JIPA 3MXVL 1MCRA 1DR9A 4ZNCD 2Q20A 3RUGB 1QSEB 5E8EA 2HKHL 1KT2B 3E6FA 1YQVH 4P5MA 4WV1C 1U8HA 4X0KA 4O58L 4X6EA 1YDPA 4ELKA 1AXIB 3FZUD 5SWSA 5GRUL 1G6RB 3QG7H 3JBG7 1BQUA 3T1WA 4U1HB 4FQHB 4FZ8H 1RJYA 5CZVL 4G9DA 1RUPL 4MQTB 3MLRL 2ZNWA 2VR9A 3ARSA 3MV8B 3FQUA 3CSPA 4GKNA 3CX5K 3ARFD 4NKIL 3MGTB 5JW3L 1A9EB 1N0XH 4OF3A 1NUDA 4Z76A 2EICA 2GJ6E 4M7LT 2XFXA 4QTIH 1I7RA 4ZXBB 2HFEA 2Q3ZA 4H26B 3TFKC 5F6HJ 5DK2B 1KTLB 3ARGB 4I77H 4MXQC 4R2GB 1JZ4A 3OF6D 4N0CC 3UZEA 4QRRB 2IGFH 5E2JA 3RVTC 3WEXB 3ZE2E 1MRCL 4GRLB 1DUZA 3G5VA 4R4ND 1WEJL 1WUNT 3HLAB 4Y2DB 1XGUB 1UVQA 2AQ3A 3U0PB 2MPAH 4HMCA 1YY9D 5JOPD 4QOKD 3QUYA 1JZ3A 3JUYA 3R06B 3VG0L 3RA7L 4P0DA 4LVOC 5D1QB 2V2WA 1ZANH 2XN9A 5DTFA 3IDYB 5KVDH 4EBQH 3NMEA 4JY4B 1M71A 2W9LA 5TE4L 1CD8A 3D3VE 3F6IA 4PY8I 4JPKH 3QQ3B 2GW5A 1SEQH 2YN5A 3RAJH 3V4PL 1P7QB 4LSVL 5FUCC 1EFQA 2UWEF 4OI9A 1SY6L 1AHWA 4X6EB 4PRPA 4YK4B 1AXSA 5FHAL 5H2BB 4MQSB 1ZT4B 4Z0XB 1MJ8H 4WFED 2HG5A 1SJHA 5LBSL 5LG1A 1MIEH 2P5ED 3S34H 2XZCL 5CHNA 4AY0A 4JVWA 3MRRA 1RIVL 1U8NA 3T3MF 4GS7C 4MZ3A 5IW1B 1NFKA 3LIZL 1DP0A 1JGDA 4PRBB 3KPRD 3QNYB 4P9HL 1FIEA 1CIUA 1P5UA 4M7JH 4U6YA 5D93B 3SE9H 2HWZH 1HIML 1NEZA 2Q86B 1M4KA 1AD0A 3O0RL 3TPUB 1CZ8H 2VLJB 1A1OB 2BY1A 3O8XA 4XVTH 4PJXB 3WE6B 2FJHB 4GXVL 5DQDH 4KI1A 1ZWIA 3T2PA 4GG8B 3HI5H 4B50A 5IEHB 5HHXH 1P2CA 3AS0A 1I7TB 1UM6L 5GS0D 3RPIA 1IE5A 3PQYA 3VWJA 3QXDB 4GAYA 4OQTA 8CGTA 1N5AA 3RVVD 2HMIC 4FQ2L 2FO4A 4P4RA 3MRKA 4POZD 2PXYB 3FFCA 3HFMH 3HG1A 3TC9A 2VLRA 3X12B 5GZOD 1P7HL 4Q0XL 3BPNC 3DX6A 4FXGA 4KTEH 1ES0A 3UBXG 4MAUL 3C5ZB 3I02B 4TTDD 5GGTH 1N64L 8FABA 3TIDB 1IEBB 5TE6L 4JRXA 1M71B 4XPTH 5F6IC 4BKLA 1EK3A 1C7SA 1HINH 3BIKB 5DT1H 1NCWL 1S7RA 3H9SD 1YNKH 2NY3D 2BSTB 3HNTL 5GJSH 4YO0A 3PP3H 3ZLQC 2QSCL 4U49A 1IGML 5ALBH 2H32B 1CFSB 3EFDH 4ODWA 3VFVB 1KB5H 4C56E 3VWKD 5DEGA 4HIHA 1OP5H 3H3PH 1GAFH 5I17A 1U8JB 3PP3K 5I1IL 1CL7I 1EBPA 2VZOA 4NZRH 4TPRL 4CMHC 2XTJD 1OP5K 3DUSB 3SKMA 4LSPH 4QHLA 1K8IA 5HDBE 3L7EA 4L3EA 2XWJB 3ZHKA 4M7KL 3QUKB 4XNYH 5C0DA 5FK9A 3UBXB 3BUTA 1FL5B 2NZ9D 4EEEA 4NM4L 3SPVA 4Y19E 4I4WA 3ZE2F 4U6XA 2GJZB 3T08A 1B6UA 2GHWB 2V5TA 2ZPKL 5TPWH 4F33B 4HFUL 3F58H 2XA8H 5BVPH 1K4DB 3FT2A 5DD6B 2NR6C 1JHKL 2FATL 4WDIB 5FV2A 3WFEL 4OTXH 3WJLC 5IHUL 1FG2B 3MACL 4NQVA 3IDIA 3RNQA 1HXMB 2VTFA 3ULUC 2NMSA 3S97C 5IIEA 4KK8C 1CDHA 3LV3A 3DMMA 3HRPA 3MBEC 1OAZH 3W81A 1WBYA 3RL1A 5K9JH 2EH7L 1HHGA 4KJWC 3UYPA 3TNMA 2VL5A 1KELL 1D5IH 4JFZL 3F6LA 4ZOCA 1F6AA 1NFDA 3KXFD 3MJ7A 4KROC 4R0LA 3RNKA 4FFZH 5FUZL 2PTUA 4LHUD 8FABB 3D39B 1J05B 4NGHH 4MQXC 3ILPB 4XCCH 3QBTB 2WINB 5JXEC 4JFEA 4F37F 1K2DA 2F8VA 5GRJL 2Q8BL 4WFFD 5GSRB 5CEZE 5E2TL 4DK6A 4P2OC 4XNZC 4YEFA 5FAAA 1FLTX 3VE0A 4H25B 1XGYL 1AJ7L 4PRIB 4GBXC 2C26A 3VXUE 5AUMB 4XZUA 2VXQH 4HH9B 1KC5H 3BQUC 3W9EA 4PJ8C 4O9HH 3WUWG 3H9HB 5AD0B 5F7DA 5I74C 3EJZC 3PDOA 4K23L 4DTGH 3B9AA 4MNGA 2GY7B 4QHLB 2QLVB 1I9IL 1I9RH 1OSPL 3QUXD 5C8JB 4ZOBA 1DSFL 2DI9A 1N59B 4Y5XC 5KSUA 4OT1H 5ENWA 3C8KA 3ES6A 4NQSA 5EUKB 2R0WH 1RSFA 1GGBH 4K7PY 1MCSA 5IB3A 1NCUA 3MV7D 1EFXD 4XNQA 4LVHC 2AV7B 4JRYE 2FEDC 4WUUE 3WS6A 1JF5A 5ADOL 1K4CA 1BAFH 4JFDE 4W6YB 3CDYA 1KCLA 3NA4A 3KJ4B 4MNQE 3ROLB 5I1KL 2I27N 3I6LE 5GGSY 1OF2B 4S10A 4JHBA 2WBJB 1R0AL 2DAVA 3U4EB 4F7TB 4ZTOL 2ZUQB 2RAMA 3QIBD 1KPVB 5JLZA 2DL9A 2VITA 3WUWB 5A1AA 2VL5B 2JJWA 2PYEE 1MOEA 2F19L 1F6AB 4WEBL 1AGCA 3OKKB 4X6FA 3FAWA 4TVSa 5FGBC 3DSFL 5CZXD 1U3HD 1K5NA 4K3HA 3KWWA 1T0NA 2QSTA 3NABL 4JKKA 2FX8H 2VDNH 4XMPL 5L0QB 4JANB 4Y7MA 2AJ3A 1I4FA 1TVBA 5E03A 3TN0B 1LK2B 2QSQA 1BQHA 3HCVA 3L5WA 2AK4E 3L9RB 4XPAL 3V52H 3X3GL 2LTQB 3RTQC 1I7ZA 4BQBA 5HDBF 5IMLB 3QDAA 4L1DA 5CP3A 4I3SH 1MFBL 3OKLA 2LAAA 4KRLB 3QFDA 4X4XB 3QI9C 2VZ1A 3IU4H 2FNBA 2JE8A 4LSTL 1ND0B 3TZVA 4YFDB 5DA4A 4PJAB 1OM3L 2J4WL 3OJDA 2OZ4H 4R97B 5JW4N 2IPKB 3DURB 2VUYA 3K8KA 3OR6A 4HIJB 5IQ7H 3BISA 2H45A 4K7PL 1HI6A 4DN4L 1D6EA 3TFKD 1HNGA 4AJ0A 5KSUB 1NKOA 5ENWB 4LIQH 3IFLL 3S35L 1C5BH 1E4JA 1J86A 2DQFB 5IT2L 4MXQD 4OD3L 4PV8A 2YBRA 2VN7A 2DQCH 3C60C 2C1PA 3RY6C 1RK1A 2H6PA 4M48L 25C8L 5F9JA 3GSRA 2FECI 1XF1A 1N6QL 3RVTD 4UIMB 4A2LA 1B3JA 1J87A 1WK0A 3B9KC 3IFOA 3WXWL 1RURL 3ZYZA 1UACL 3KLHC 5J9PB 2DMBA 4OV6F 3GMNA 4WCYL 4KQ4H 1FNHA 4IRZH 3EOAA 2F54E 1JF1B 5LQBH 2OYPA 2VL4A 2A6IB 4PS4H 1BVLB 1QFWL 2H2SC 5DJZA 3MRGB 3GSWB 2AV1B 4IOIA 5JORA 1Z5LA 1R24B 3BKMH 3SDXA 3O6LL 1LK3L 5DHYA 1T03L 1GHFL 4P4KB 4U3CA 3H7BA 3LSOA 5A16B 1D9KC 1MWAH 4YHLL 4U1KA 3U4BH 1A21A 5EC1B 2H2PC 4LKCA 4K3JL 2EYRB 1QUNA 1DBKH 2DQJL 4OCYL 1KLUA 4AIZA 3VFMA 4LHJB 4GW1B 3BMVA 5JHDE 4NN5C 4OCRH 4OLVH 2X1QA 4GXUN 3U83A 2MHAA 4MXWH 4CJ0A 3VXMB 1CU4L 1MHPL 4U05A 3EO0B 5L2JA 4MZ2A 2VQTA 5LGHH 1P9MA 1DLFL 2FSEA 1SQ2N 3RWIB 4EIGB 3KNBA 3P4MA 3FKUS 4G8GB 4LRNH 1BFVL 1VACB 1ZTXL 3ZKXB 5INDB 4XWOC 4ZDHA 3K7UA 1CQKA 5JPNB 5L9DL 3OGOE 1HOCA 4EXPX 1S8DB 4LLWA 5HHNB 4LPWA 1VADA 5AZ2L 4IRSA 3AM8C 3ARRA 5SX5H 1NL0L 1D3CA 3I2CH 1WCBB 4K9EL 4GFTB 5JR1H 2VE6A 3VGBA 1FFNB 2JCCA 1FLRL 3VG9B 4OM1L 4XAKD 1OAQH 2AGJL 4WHTB 3VMOA 1V7MH 4DW2H 3J7HA 4M61A 4OD1L 2DQGL 2A74A 1GYAA 3P4NB 1ZLVH 4O4YL 1UXWB 2VWEC 1FZOA 3EKCA 3DUHA 3FO9A 1XF3A 5F9JB 1QPXA 3W5MA 3MV11 4KI5F 2BOCB 4MA8H 1ZSDB 3LOWA 4RZCB 3GMMB 4EQ3A 4W6WB 2HMID 4X99A 4BFIA 2B7DT 3UXFA 1MF2H 4JZOA 4GW5A 3MUJA 1I8LA 4WTZA 4U3HA 5FO9A 3LRHA 1Q72H 5DHYB 1H3GA 3MV8E 1LO5A 2EEBA 1KJMA 4AQ1B 1YEJL 5DJ0B 2OP4H 1KN4H 4R90L 4ZFOB 4KGJA 5F1IB 4XP1L 5GS0L 3O2DL 1KN2L 4KC3B 4G80A 3S96B 4B7LA 1HWGB 5CS7A 3X14A 1FIGL 4ODSL 5GQBA 4HUXB 1HWHB 5EZOL 3BW9A 4HWNA 4OFDA 1QA9A 2VQ1B 4P99A 2ZKHL 4P3CL 5J8OA 3LKNB 4PPTA 4OZGA 5ESQB 3LS4H 3QXAA 3MRCB 3KLSA 1OW0A 3IF1A 2FSEB 2O61A 4X7TB 5JQ6L 2AXFA 2G60H 2QQKH 2YPLD 2NLJB 3O4LD 4RX4A 4NQEB 5DD5H 3JWDH 4G7YH 4HQQH 5K9QG 1EXUA 3BD3A 4NKOB 5I30H 3WFBH 3GBMH 5D7KE 5H35B 5I76A 1GC1L 2VDLH 1NMBL 1YEGL 2RFXA 3A6BH 3LMJH 3QO1A 1A2YB 5KZCD 2JELH 4NDMB 3D6GA 1YEFL 2R4RH 4E5XB 1KXQE 1JJUA 5HHOD 4H0HB 4YHOH 2NR6D 2VNCA 3QNZA 4PJHB 4NWUH 1JWUA 2EDKA 1AO7A 3NA9L 5F3HA 1AR2A 1M1SA 4H8WC 3FO9B 5IHLB 3P0VH 3ULUD 3MYJA 4HZLB 1AKJA 1T80A 1SJEB 4KK8D 2MMXA 3FN0H 1Y18A 4FFYH 3U79A 4AEIH 1HKLL 3MBED 4KK6C 1CXFA 5L8JB 1B0GB 3IJSA 2AEWA 3LCYA 1Q0XL 5HYQA 2BVOA 5SWQA 1P4BL 1W0WA 3QHFL 1NLDH 1NC4B 1H8SA 1DVFB 4NO5A 3UC0H 4LCUA 3D25A 4KROD 5EZIL 5GGRB 4PLNC 4G8IA 2PCPB 4OJFL 1CICC 3RGVA 2FX7H 4MQXD 1SY6A 3B3IA 3BP6A 5JXED 3MJ9H 4JFOA 2MJWA 4X5LA 1DBBH 4PD4K 3VFSA 5J06A 1MCKA 1EO7A 4YWGH 4G80B 4NRYB 2DTMH 1V3JA 1BBDL 4P2OD 5C71A 5J13B 3WDJA 3AREA 3BPCA 2D0GA 4PJXE 2F8OA 1QA9B 4OFPA 1B0RA 4PGBB 4Y4KA 4GBXD 3TESA 1LE5B 3GRWL 3BQUD 2YPVH 5IR1A 2CLRB 2WBWB 4LCWB 2O61B 2DQDL 4ZS7L 1SMAA 4X7FC 4OLYH 3EJZD 1FORH 3LY6A 5HVHB 5TDPB 4FP8H 3TO4A 3U9UB 3JV4A 4RNRB 2PTTB 1HQ4B 4DCQB 4NOFA 5F8RC 4QCIA 3BGAA 2DDQH 4UILH 2NX5B 1NJ9B 3UTTA 2HTLD 1U58A 1TJHH 5A3IC 2FEDD 3WN5B 1RZ7H 1IM9B 2NQCA 4S2SA 1CFNA 5I0ZA 1U41A 2YMXL 1MI5D 4APQA 1GOHA 5I8EB 5DDHA 5CP7A 1HYRC 1JPGB 1IGIH 3FQNA 2O5ZH 4CL7A 4Y4HA 4YX2H 3BZFB 4F7CB 3ZKQD 3EFFA 3CFCL 3HNSL 4F57L 5B8CB 3O6ML 3DARA 1RZJL 2NZIA 2FRGP 1U6AH 3TIEA 3G6JB 15C8L 4M6ML 3FB5B 4Z78A 2NTFA 1WV7T 1U8LB 2ED7A 3T0BA 4ONGL 1K85A 1EEZA 4F2MA 3TBWB 4M5YH 2A6KA 3PP4H 3DRQB 3VFSB 5GS1A 4M1DH 2CPCA 4QRSB 1FNEA 1MVUA 4ZMAT 2BK8A 1QLFA 1NGXB 1Q9OB 4PJGB 2YPKA 4G6MH 3CK0H 3RTQD 5FM5M 1B4JL 4ODHH 1YEDB 4ZUWA 1YPZA 2K9UA 2YK1L 3M45A 5TH2B 4GRMB 3RZCA 1IAOB 1CLZL 3QI9D 2E9WA 1IARB 1FVCA 2BOBB 2BJML 4LDLB 2J5LC 4F3FA 5D7IA 5I0DA 1W72H 4OLWH 2XNAA 5HSFA 1HHIA 3MX0A 5IBUG 4GMSL 5E2WL 5INCB 2OI9C 1T20B 2Y23A 1OTTC 2Y07L 3CX5J 3BJLA 1WFNA 2I07A 2ID5A 3PGFL 4QCIB 4M93B 1WBXB 3G6DH 3C60D 4LPTA 1JRHL 3D39E 1YEKH 3QDJD 1JNHA 5DK3A 3K74B 2YOCA 3FOLB 1IC1A 4WENB 2Z93B 4Q9RH 3QIUB 1C16A 1JGLL 2Z4QA 3B9KD 3VFWA 4XI5D 4OLUL 5KSBE 1JGVH 4L8SA 1JV5A 3RKDD 4PGCA 5DHXB 4MWFB 1MQKH 3KLHD 1FL6A 1QBBA 3E6HB 4XP5L 4OBSA 4J8RA 5F21B 3GJFA 3EYQC 3EOBA 4P46B 3G6AA 1YY8B 2FGZA 3MLZL 4PRIE 4G42A 3U7AA 2H2SD 3FO2A 3THML 2E7LC 3BN9C 1P1ZA 1CR9L 4XP6H 5IBUB 1RUAH 4M5ZL 1JL8A 5D2LF 1T21B 3UTOA 1B4RA 2IALA 2OXHA 1D9KD 4PJXF 3ZDZF 1IEHA 3D85B 4KVNL 5IKCA 3DV4A 2WV3A 2H2PD 3SGEI 4U6TA 2VABA 2XRAH 2AJUL 3L3OB 2A77L 1B88A 3HE7A 4DVBB 4X9BA 2Y1VA 2DQEL 1YN6B 4X98A 2CK0L 1T5XB 5LWYH 4JB9L 1WC7A 4JG1L 2BSRA 4K8RH 2EEDA 2P5WA 5IW3A 2AQ2A 2WP3T 5I1EH 1EA9C 4XWOD 5F88A 1IC5L 5JHLL 4HS8H 3SN6N 3EYVA 5CSZB 4HUVB 5ILTL 1JUFB 4JDZA 3TVMC 3VXTA 2XNAB 1U36A 1P6AB 4PJ5D 3GHEL 2Y7QB 5IMOA 3LKPA 4R3SA 3CU1A 5FYLD 3TV3L 5E9DA 3T0EB 3FMGL 3LPGA 3KPNB 3PV6A 2J8UB 1DQMH 5CEYB 3T4AB 1URLA 2Z31B 3IGAB 3PL6C 1T6VN 2O5XH 4ORGB 4DUVA 1JCKA 2MQ3A 3MTRA 2B0SL 1BD2E 1TCMA 3MODL 4G43B 3SBWC 3DVIA 2ADGB 5HDQH 1H15B 4RA0C 1JP5A 2DKMA 3C6SA 3IKCA 4QRPD 2NXZD 5ITFA 1HILB 1XR8B 5D71H 2ARJB 3WFCL 1JNJA 4RFNC 4PLKC 3I9GL 3BP4B 4ERSH 1XF4B 3ZHLA 5KS9E 2FD6L 1UXSB 1DQQA 3FO2B 2B20A 3Q1SH 4IOSD 1P1ZB 4ZD3H 2BY0A 3FB8B 3UJIH 3RWGB 4HXBL 3ZT6A 3VRLF 4PJAE 4MCYB 1H5BA 1GGCH 5FA3B 4PJEB 3V4UH 3IJHB 2D4FA 1Y6NR 5T3ZD 4FQXC 4PRHA 4F58L 4OZFA 1T5WB 4LSUL 5F9OL 2UYLA 2YUXA 5HYSG 2ERJC 2VLME 2BNRD 2VABB 5D7LD 3BKYL 4X9FA 1O7VA 3V9FA 5DFVC 5DMKA 2XYCA 2MOVA 1ITBB 2FZ3B 3VH8G 5GJTL 1BLNA 4WY7H 1VEOA 4RFOL 4EN3B 2V17H 4MMZC 4QTHB 4HG4K 2V2TA 4KZEL 3OPZH 4NBYB 4P23C 1FGNL 4YPJA 1XF5B 3N9GH 4P2RD 3QDGB 5MP6H 4JGUA 4JDZB 1NGQH 5FYJH 5F7HA 3NCYS 4P9ML 1QYGL 1Q1JH 2XY2A 1EHNA 3LKRA 2YSSB 2DYPD 3EJYC 3OSKA 1S9WB 2VR5A 1S7VB 3PWNB 4KZDH 3DGGB 4DGIL 1QR1B 2C3VA 1QKZH 5KSBF 5GGUB 1T83C 2OJEA 5DRWB 3PV6B 3DXAB 1YMHA 1MFDH 5CGMA 5JW5B 5D5MA 4N8VA 2LE9A 4TULL 4XC3H 1R3KB 4Y5VB 5HYSB 4GRWB 3DHMA 3ARFA 1NAKH 2Z91B 1MJUL 1KPUA 5EBLA 5HGBB 4HIIA 4WFGD 3CFDA 4KK6D 3SE3A 3VH8B 2HLAA 4P5TC 3S37H 1A7QL 2WIIA 4KWUA 5JOFB 4HGKC 3SJVB 1X5HA 4E42A 4QHMB 4XB7A 5ISZD 3OF6A 5BXFB 3P0GB 4LNRB 2E6JA 1ZLSH 5HGDB 3O2WL 4MB5A 5L8KB 5CBAA 1QSFA 4M3KB 3U30C 3TH2T 1CICD 4LAQH 2FH6A 5I6XC 1MLCA 2DBJA 1EO8L 3EO9H 5L7XL 4QOKA 3ULUL 4XH2A 4JE4B 3WO4C 3CFKB 4F9PA 4WW1A 4F9LA 2Q3AA 3VGEA 4Z7NE 1UQSA 2NNAB 1YYLH 4WVRA 1FYTD 5DHVA 4L1HA 4MGXA 3DROA 2M2DA 5C9JA 2I24N 1OQXA 3TGXA 5DMKB 1IAIL 1IBGL 1I1AB 4KI5C 4RGNE 4HWZB 5C6TL 3M1BA 1Z9MA 1GGUA 4NO0D 5IF0B 4OZIB 4YE4H 4TSAL 3R8BB 3OXSA 5L2KD 1PX4A 5KVFL 2EIDA 3UZVB 1F3RB 2ADFH 5AEAA 5DUML 5IB1B 1T7YA 5IB4A 3GMLA 3UJTL 4ZAKB 5T3XE 4NKDA 1ZHBB 1AP2A 4KMTH 2C3VB 1SBSH 5GGSB 1MNUH 1PG7L 2HVKA 3F8UB 5A3ID 3L5XH 2VXUL 1X4ZA 4XNUH 5FEBA 1XIWB 3T1FA 1HXYA 3ARWA 4KRPD 2FO1A 3KPRA 5FF6B 5KVGL 3N1QC 1X7QA 5KS9F 4RAVA 35C8L 3HMXL 4HT1H 4J3TA 2V7NA 1R3IH 2X70A 1NCCL 3KYNA 4MCZA 1U91A 1UWXH 2XWTB 2GJ6D 2YZ8A 1CE6A 4X7CC 4PJAF 1QD0A 3VDCA 5ABDE 4YUEH 5FOBB 2SEBB 3HC0A 3O2DA 4U1LA 3SDCA 4DKFH 3MROB 4WFHE 3ARXA 3ZL4H 4M4RA 4IJ3C 1F4HA 4NQEE 3S88H 4KUZL 4P2QA 4FQIH 3PIQB 2VXTH 3PHOA 2KL6A 4Q9QH 3QNXB 5DHVB 3GO1L 2ZCKH 5IMMA 4U1IA 3T77A 5FYJE 3RWJA 5EIIA 3QEUA 4PJHE 1RIHH 1UFUA 2D0HA 3MR9B 3S7GA 2DMCA 1OARH 2J6EL 3F5WA 1FNFA 2VDML 4JZNA 3E0GA 3OZ9L 2ZJSH 4LASL 4PJIB 3BZDA 4FXKA 4MXVE 2QQNL 3I85A 2WNGA 5ID1B 2JJUA 4MLSA 1ADQL 5EPMA 3EYSH 3LKSB 5K9QI 2ESVA 1FV1A 1OTTD 4OF8A 1PY9A 1PX3A 4LCYA 3VWKA 5CJQL 1E4WL 2P5EB 3G9AB 4L3AA 4NYLA 1UJ3C 1A1NB 3I75B 3TYFB 3CC5A 1AE6L 3KLAB 3GJEA 4JO2H 2WQ8A 5ICYA 4LCIL 1NPUA 3HAEH 1HXYB 2J88L 5ETUA 2ZSVA 1MCOL 2G9HA 1X7QB 2P8MA 4PREA 3FAXA 3G5YB 5K9OA 4FQCH 3IDNA 2WK2A 4Q2ZA 3CCHB 3CSYA 4ZTPL 1RIUL 4IEFB 4TQEH 2VDKH 3EYQD 4HKZB 2QADC 1KJ2L 4KDWA 5DRNA 5EFIB 3MCG1 3BN9D 4OCSL 2QHLA 5FYKU 1VEMA 3OKDA 1MFAH 4LCWE 2X4UB 2ZCLH 4U0QB 1BZ9B 3CU7A 4H1LG 5HGHA 2W59A 4YNYA 4EIZC 2OL3B 3H7LA 5DJ6B 1LO0H 2Y72A 2P24A 4LSQH 2VXVL 1CLYL 2NX5E 1RUQH 3P77B 4PJ9B 5JOEA 4LHUA 1JFQH 4EI5A 1J10A 4WJ5A 3WIHH 2CUHA 4K55A 1XAUA 4AENA 4XWGH 2DQTH 4NRZA 3MFFA 5CSGA 3H9SB 1QLEH 3TVMD 2CKBH 4NUJB 5E6ZA 2YD6A 4I18B 1T22A 2K7PA 3OJ2C 3O9WA 3MA9H 4MLIA 3G6JE 2Z92A 3PWJA 3T3PE 2ICEB 4R2GC 4C56D 3PL6D 5CD3B 1Q38A 2XTJB 1IZJA 1TVHA 2Z35A 2C3WA 2EZ0C 3U2SA 4ZUVB 1OD7A 3QQ4A 2VRAA 2G9HB 4Z5RA 3KR3H 3BUYA 1HSBA 3D0LB 4JAMB 3JWOH 4MHHG 4TSBH 2FH8A 3RQ3A 1HH9A 2ADJB 4OLEA 1ZGLB 1S7WB 3QEHA 4MD4A 1J0ZA 3QA3B 3ZYOA 3CSYB 3P0YH 4K3DL 4MJ6B 4OZHB 1EFXA 5D1ZC 1I8KA 4PLKD 1LEKA 2BRRL 4Y19D 5D2NB 3HI1A 1RQ5A 2WZPD 5FYLL 3NN8A 4NZUL 5BMFH 1T2QL 5DRNB 3IDYC 4YHNA 4ENEC 2AJYH 2ARJQ 1X5YA 3WCYA 5ADPH 4MQ7B 1GL4B 5EO9B 3QIWD 2IADA 4PTTA 1N7ML 3LQZB 1R3JA 3U6RA 5CINH 2NW3A 1LGVA 4WO4B 5IFJB 4JFFA 4OD2A 4FQXD 5T1KD 3QIBA 3LH2L 2BNQA 1TJIL 1BJ1H 1HCFX 4L5FH 3G5XA 3BPLC 4KXZH 3OKOB 4R4BB 3SDAA 4NUGL 3GKZA 3KXFB 4YK4C 5DFVD 4OM0H 2P8LB 4BH7B 4QT5A 1XF2B 4BQ6A 3RGHA 3D5OF 3IDGB 4LSRH 2JB6A 1YN7B 5BO1L 5D72L 1W0VA 4TVPE 4P23D 7CGTA 5B39G 3JSSA 4JM2F 2G2RA 1P5VA 1EHAA 2E7BA 4FFVC 1G7QA 1JNLL 4R26H 5D93C 5DSCA 1KCSL 1YJDL 4R7NB 4IS6B 5T3ZL 1U92A 5CEZD 5EBMB 5GRWA 3WJJC 1S3KH 4MD5A 3TA3B 1A6UH 3AROA 1MAMH 5FUOH 5C0AE 4WHDA 5IESL 1O5DT 3VXUD 3MNZB 1OQOA 3RIFF 3RWCA 5ICXA 2B2XL 3DV6A 4BZYA 1INQA 2WWKO 3OG6B 2DQUL 1LDPH 5B4MC 1AD9B 1AGDB 3UYRH 1B90A 3CLEL 1V7NH 3QUXB 1PEZA 3P4OA 4PY7A 3I50H 4P5TD 3SKOA 4JVUA 1GOGA 2VZSA 3VXOB 3H42H 3MV7B 4LEXH 2DLEA 1UM5L 4BA8A 4LPCA 3HI1B 4JPVH 5B39B 2ENSA 1BFOB 1JPTL 1WAAE 5E8NB 4XCEB 3NN8B 1EGJH 1TQBC 1JPSL 4NNPH 1YEEL 5H37H 4JRYD 1IKFL 2EYSB 1Q9KA 4WUUD 2HJLB 4UQ3B 5D7SH 3IDMA 3R1GL 4JFDD 4ZUUB 1MCDA 3MREB 1MPAH 4MNQD 1VFUA 1AGEB 3I6LD 4M4PA 3C8HA 4PD4J 3Q6FA 5EORH 3ZZ1A 4OB5H 3AU1A 3QZWA 4QYOB 1T3FB 3QEQE 3T0EE 3UPRB 1UWEL 3K4ZA 3SGKA 3MLVL 4CBPA 5L88H 4U1GB 5GSVB 5EO1A 2J8UE 4OLXH 1A6VH 3IXTB 4CAGA 1G6RH 3EDEA 3A67L 1KENL 5ACZA 1U3HB 2PYED 3CLFL 1IGFH 1Z6JT 1FPTH 4IMKC 43C9A 1OAYH 5IMKB 1G7JA 4FQQB 3BVNA 2YEZA 3UTQA 4X7EC 3NZ8A 3ARDC 4YXKL 3PGCA 2FR4A 1MFNA 3T3PF 3N85L 2A9MH 3MRMB 1NBVL 4DVRL 3O4OC 5BW7A 4WV1B 4EI6B 3H8NA 1DBAH 3PABA 2V7HB 1NBYA 4J3VA 4NJAL 3SO3B 2AXGA 5KTEL 1NUNB 4BSVB 4JO1L 4U1MA 2EDDA 4R4FL 3HR5A 2AK4D 4XCYA 2LV4A 3JWDC 1JPFA 3OAUL 4Y4FB 1EV2E 2X42A 2W91A 1Q9WA 3PWUA 2A6JB 3SDDC 2B1HL 2X7LA 4NT6B 5T1MA 3HUJB 1WFOA 2GK0A 4L9LB 3TT1H 4K94H 4UT9H 4PJEE 3SKNA 2EXYC 4LPYA 3M8OH 3VJ6B 2XQYG 4BSWB 2X4QA 2BVTA 4JFYB 3P4OB 3P30H 3MCLH 5TFSH 2R1YA 4KK5C 5D9SA 1BJ8A 3VA6A 2JIXD 3PF2A 1G9MH 2R2EA 4XNXH 5HI3C 3U7WL 1AH1A 4ODVH 3FRUB 4WNQB 1BZ7B 2OSLB 1QBLH 4Z0BH 5EOTB 1XCQA 4MD0B 4GG6A 2APVA 4PB9H 2CDGB 4X4ZA 1YYML 3P73B 1IC4L 3SY0A 1A02N 5FGCB 4XCFL 5TE7L 5CD5C 2BY3A 5DURD 1FAKT 3QO0B 3QDGE 2YS4A 2RHEA 4U7KA 2OM5A 4E0RA 1JZ6A 2KKQA 5TDNB 1U8OA 5D96C 2RBLA 5GS2H 1T0MA 2IAMC 2F54D 1PD6A 3BZ4B 2G5RA 3DXAE 3CGTA 5GHWH 3QHZL 4JRWA 1NCTA 4P59H 1P84K 3UPAA 4P5KB 1CDBA 1C1EL 2OTUA 1TMCB 5BVJB 3NCBB 4GRWE 3ARQA 1FFOA 2RIKA 4I48B 1BEYH 4X6DA 5TF1H 4NZTH 3VFTA 3G08A 1X5XA 1PSKH 2R2BA 3SJVE 4Y5YC 1JHTA 4FZEH 3LKOA 4ZFGH 2NYYC 1JZ7A 1Q94B 1N8ZB 5BZWB 1BVKB 1LP9A 3HR5B 4LPUA 4XCYB 5IK3B 3CH1B 4HJ0C 5AWNH 3RU8L 4XBPB 4DQOH 5JHDD 3CSGA 5JNYB 4GS7B 4A2MA 2YPLA 3SCMA 1AFVL 3BRDA 3O4LA 1L6ZA 4LEOB 32C2A 4BK4A 1ZT1B 2EYTA 3KJ4C 3ET9F 5I75C 1UADC 5I19H 1OGTA 3TT3H 3QXUA 2XICA 3QPXL 4PRAB 2FL5A 2R1YB 3LQAH 3OJMB 5EUOA 1ZEAL 3MV9A 4TSCH 1F11B 2IPUG 2H8PB 4ZUTB 4S0SD 1EVUA 5EOCL 5TF0A 3WJLA 2ICWA 4J1UA 4U1SB 3PXJA 1E6OL 2PW1A 4YHKL 4KDTC 1FNGB 1KIRA 4WUKH 3GMQB 4X6CA 3RWHA 3U0TB 5T5FH 4OZIE 5HYFA 1IFHH 2J8UF 4XPBH 3MGOB 2VIRB 1OCWH 3B9EA 4QLRA 5CKGA 5KG9B 4LAJH 5J57B 4QF1A 4CN1A 9CGTA 5L6YL 2PO6C 3KYAA 4JKWA 3CVIH 3S37X 3TN0C 1HHHA 3QG6B 2DB8A 1PVHA 3BPNB 1OWWA 1KSRA 1FDLL 2FIKB 1YC7A 2MKWA 4JFPB 3IETA 3V79C 5I8KH 1TZIB 3L5HA 5JA9A 2X4PB 2OTUB 1YEHH 2F58L 4YAQB 4Z7WF 3BKCL 2EC9T 5B21A 1HKFA 3MV8D 1I1FA 2KDGA 2XQBL 3DTXB 3FQWA 4P2OA 2FWOA 2R4SH 5DR5L 3HZKA 3B2VH 4U1JB 3MOBL 1BHGA 4PJBF 12E8H 3L3IA 1U8IA 3DVGB 2YR3A 4ZNEE 2A1WH 2EE2A 3GI9H 4OGYL 4GBXA 3L6FB 1A3LH 1F4XL 2QSVA 2XZZA 4PJEF 4XCNB 4YHIB 2DTSA 3RX5A 3BQUA 5EBWB 2CDEB 5HY9B 5GRVK 4B7IA 4R2GD 5KW9H 1RZKL 3QH3A 4CMHB 3P9WB 4DN3H 5K9KB 1IT9L 2IANE 1BQLH 3BE1L 3BD4A 4UT7H 1RU9H 5HI4C 3GFUA 3ECBB 4LK4A 4CADA 3O3BB 4Y5XA 4JFQA 2WWKT 4JO3H 2QKIA 1A4JA 3L3DA 4OQTH 5KANG 1LEGB 4YDKH 5C7XL 3HMWL 1CGWA 5KZCB 2COQA 3QCTL 2FL5B 5D7KD 5HHVH 5D1ZD 3TYGL 3O41B 5HHOB 3IXAA 2YRZA 4IMLB 4BK5A 3WNPA 5IOPA 1T89C 1QO3A 5E4EC 4MA7H 5E8DL 4ENED 1MI5A 1NGZB 1FVEA 3CMOL 3EZJB 1G7HA 4PJIE 2DLGA 2YN3A 4CW1B 4QRQA 3JVGA 5FHBH 5SWSE 3ULVH 1X5IA 4HK0B 3TJEL 3MBEB 4PJ7A 3V8OA 3X11A 1P7QD 3JTSA 4QF1B 4EKXA 2CGRH 4KKBC 3QQNA 1IEAA 3FCTA 3PWPD 4GRWF 5IEKA 1H3TA 3S3JA 3GBLA 3H3BC 3NFNA 1CL7L 2ORBH 4KROB 1OAKL 3GSQB 1LNUB 4NHCL 4OF7A 4RRPA 3L1OL 2BERA 4BFEA 4KTDH 3VI4F 4RMRA 3LRSA 3NFPB 2MPAL 1FO0B 2X9YA 1NFIB 3IAPA 3ZMRA 5E8PB 3GK8L 1L0QA 3ZYJA 4GKSB 3DYPA 4HG4J 5IGXH 1F6LL 3CFJA 2IQAA 3TBYA 1ZANL 2GUOA 4FFVD 4XNZB 1BIIB 3RTQA 1KJ3H 4K8RC 3DGCR 1U8IB 5ACLA 4EUPA 4MSWB 3P40A 1CFTB 2DBLH 3ARBA 4I0KA 3MMEB 1I7UA 3BQUB 5DJ2A 3QI9A 3MLUL 5BJTB 4JPKL 4PJ8B 2D31B 4RGNC 5HGAB 5I74B 2DQIL 1NCDH 1A7PL 5B4MD 5F7LB 5CJOH 5E5UB 1KPRA 1S7SB 3J8F7 4N0YH 3QUZC 3TBTA 3VGHA 1NANI 5CWSB 1I1YA 3PGDB 1KJ2A 1I9JH 1NAML 3DI3B 4L29B 3BKJH 5CIPA 1MJ8L 4JDVA 4JLRB 1GGIH 2QKIB 4LU5L 3L3DB 3B6SB 4AMKL 3DO7B 2E7HA 1A0QL 2PTVA 3QJHA 5GGQH 5DUPL 2PXYD 3GBNL 3C60A 1QR4A 3RY6A 3BGMA 3L3GB 5CEZL 1JMZA 3FB7B 5JDJA 2V5MA 3REVB 2C5DC 5ESAA 2QQLL 3I6GA 4HIEA 4BSJA 3AUVA 5KJRL 4ZQKA 1VKXA 1NCBH 3QUMB 1NGPH 4I3GA 1EDQA 2CJUH 2P4AB 4H88H 3W2DH 1I8IB 2OJZL 1OLZA 3UTSB 1XZ0B 5TQ0L 5A43C 4N8CH 2DJ4A 4F7EA 4D94A 3U7YH 1CDGA 3RDTC 2BHZA 5KVMC 3CVHB 1MCPL 4UINL 5HHXL 2HJKB 3EJJX 1PKQB 1IGCH 2WUBL 2IQ9L 4H20H 1D9KA 3KPQA 5DWUH 5BV7H 3NCCB 3O2VH 3ARDD 3REWA 1A7OL 3WL9A 1QLRB 4Q9CA 4P3WA 4IRJC 3HFML 3O3AA 1ZA6B 4PJCA 1V8HA 4EDWH 4OZHE 4KTEL 4XGZA 3KPOA 3HKFA 4FTVA 3QJFB 3PQYE 4M1CD 5D2NE 5C0EB 3VGAC 1T6WA 4RDQG 3RVXC 1I85A 3HRZB 3TWCL 2AABH 3QI9B 3S8WA 1QHOA 1RHHA 2CMRH 3P9LA 4XVJH 4N0UB 1HHJB 4JCLA 4YHPA 4WU5A 4GKZB 3P11H 3K3QA 1SYVB 1R3HB 2VDQH 2L0DA 5ALBL 4ZYKA 1OAUH 3IVKB 1KTDB 5IROC 4KK5D 2R9HC 2XPGA 4PJIF 2BSED 4YBLC 5HI3D 4HUUA 4NNXA 1MY7A 1ONQA 2R2CA 4PFEA 2Y36H 1UKQA 3QDJB 4Z8FH 3VFNB 1BGXL 3JTTB 2H3NB 5HPMB 3AXLA 4JM2C 4YGVA 4NHUB 5CD5D 3B9KB 3T0VA 1C5CL 3MRIA 3LEXB 2YKLL 3L95B 4LRIA 4X5XA 1ED3A 1BX2B 2XA8L 3OB0H 4KJYA 3QWOB 2IAMD 5IJVB 3FJTA 4NO3A 3BH8A 1DZBA 2R56L 1K8DB 2J8OA 4P3DB 1FGVL 5DJYB 3VRJB 3DBXA 4PRID 4HJGB 4F7PA 1N26A 5CP3H 4NSKA 1MEXH 3P9MB 1YECL 4BH8A 1UH2A 5C0CB 3HZMA 3RKPA 3T0AA 7FABH 2X4NB 4A6YA 3GMOB 4PV9B 4WW2B 2LAGB 1HSAB 4RMSA