3ZKXC

Ternary bace2 xaperone complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
LQESGGGLVQAGGSLRLSCAASGFTFSRAAMRWVRRAPERGLEWVANINAGDGSASYADFVKGRFTASRDKAGNRLYLQMDNLRPNDTAVYYCIYNGHRGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zkxC00
3UROR 4HGWB 3WS3B 2R9HC 1LD9A 2DTMH 3LRSB 4H0GA 4IOFC 3RWHA 3MROA 5C1MB 4KWUA 2ERJB 3LB6C 1S7VB 3TIDB 2IBZY 3VMNA 3NZHH 2JJSA 4HMCA 4NKQB 2J6EL 2Z91B 4TTGA 5FYJU 1AXSB 5DDHB 1OD9A 3NFNB 4MAYB 3SO3C 1EUUA 1U8QA 4XNZB 3T65B 4ZUWB 1BEYL 4GBXD 1WTLA 43CAA 1LO2H 4OGXH 4KMQA 3VXRD 1LO4H 1LEGB 1MCWM 5L9DH 1T5WB 5E56A 2R2CA 3HCVA 3TBVA 1IGJA 2IGFH 1HNGA 2J5LB 3AS0A 2IADA 1S9VA 1TNNA 3OAUL 4KRPD 4H88L 1JHLH 4OCWH 1UADC 2R2HA 4FFZH 2NZIA 2MHAB 4ODUB 3B8YA 4JANA 1VCAA 3G6JE 4QHUA 1RK1B 2VXSH 1J8HA 3VFMA 4ESKA 5ETUB 7FABH 3W2DH 3KPPA 4LPUA 2Q76B 3F5WA 1VKXA 4DTGL 4OZFB 5F89B 4HHAA 4XCCH 3FB7A 4ZUUA 5CCKL 3FQXB 3RGVB 2V5TA 1CE6A 3WKML 4Q9RH 1SBSL 4V1DB 2F74A 3GUTB 1H3TA 1KJVB 3DMMA 1QPXA 3DGGB 3EOBB 1OD7A 1FG9C 3MREA 1R24B 2EZ0D 3GSXA 3S37X 2XA3A 2D7TH 2RIKA 3JV4B 5E6IC 5HI4C 5F3BA 5TDOB 1SQ2N 4YDKL 5E8NB 3GNMH 3L3IB 1UCBL 1OGAE 4KHTL 4G6KL 5SV4A 4OZFG 5IVXA 4P4RB 3I2CL 5FA4B 4ACPA 4LSSH 1PKQB 1AGEA 2Y36L 1B0RA 4FQCH 1MEXL 4ZO6A 3ZL4H 3SE3A 1NAKL 1S9YA 1TJHH 2OXGA 4UUJA 4YC2B 5CP3H 2ADJB 2UUDK 1T7WA 1QHPA 3L3DA 4PLKD 4UNUA 1RIHH 1S7XA 5D7LD 3IVKB 3BGMA 4ERSH 5DUPH 5CJBA 2CDEA 4OF5A 1G84A 1G9NL 3RTQC 3T3MF 4LSQL 5L2KA 4M43L 5JXAH 5FHAL 4YDLB 2V2WB 3NIFF 5B8CC 5D1ZC 1NCDH 4WUKL 4DOHE 3H2WA 1ZWIB 2EH8L 3IDXL 3THMH 5D6DA 3V4VH 4H1LA 3WXWL 4HS3B 3VXRE 1AGFB 4PJXF 3MRGA 2DDQL 1IKFH 5HPMA 4POUB 1MCPL 3BP5A 4JFHD 4JFZL 1OARL 4PJXB 2Q3ZA 1UKSA 5EG6C 4KHXL 3SDCD 4P4KD 1W72B 4HFWB 4F3FB 4L4TB 4PG9A 1JHKH 2WWMC 5DMGD 1QD0A 2JK5A 4YHKH 4XP1H 2HN7B 3AXLB 5KS9E 4GAGH 1G7QA 2GK0B 5J8OA 1RIUL 1IBGL 1OPGL 4DVRL 2Q7YA 2X4UA 2KZWA 4M7ZC 4NKDA 2A83B 4LPWA 4RAUB 5GRUL 1XF5A 1DLHA 4L3EA 2ADGA 4DKEL 3UZEA 3BPLC 4TPRL 2A6JB 4LFHG 1KN4L 4ZTPH 3LHPH 4PGJA 4EOWH 3NFPB 4BH8A 2NNAB 2WZPD 2DBLL 1FV1A 4OZ4A 4Z78A 3LB6D 3QNZB 2I5YL 5J1AB 2BSTB 2ESVA 1AIFA 4UQ2B 5KVFL 3ZKQD 4JHBA 4NSKA 3VDAA 4GW4A 1N3NB 4WO4A 3MJ9L 2XTJB 1BGXH 1PY9A 4G9FA 3BZ4A 3EYVB 5SWZD 2CRIA 3ARDC 5DQDL 3CH1A 4I3RL 4YHLH 1WT5C 5DLMH 2EIDA 4R90L 3O0RH 3B2VL 3WCYA 4RGOL 4GUPB 4YIQA 2O5XL 3LH2L 2NW2A 3MMEB 4KUZL 2BVPB 5I73B 1TXKA 4Y4HA 5D5MF 4O9HL 5T1MA 1N2RA 5IB1A 2ZSWB 3G6DH 3TESA 5D5MB 3MLUL 4MWFA 1J86A 5D7LE 1JPFB 2W65B 5ITBL 2YHGA 2ICES 2VDOL 3VI3E 4DUVA 1AGBA 3MV7A 5H94B 5K9OB 5TQ2L 4PRIB 1FFNB 1KJ2L 5IT2H 3QULA 1QFWI 4LSPL 3Q1SL 2VE6B 2YOCA 3WFCH 3CFCL 4RISL 1JNLL 5I1GL 3FQTA 1I85A 3MV8A 4R4FL 2EEAA 5KG9A 1Z5LA 4NWUH 4JFHE 4UTAL 43C9B 2J8OA 2BRRH 2I9TB 3OR6A 4KI1A 5BO1H 1L0XA 4KVNL 2XXMB 2CKBB 4YHPA 3VD7A 4PJ7A 4NN6B 4AK1A 5I19H 4Z77B 2EDOA 4C83A 4I4WA 3FHQA 4Z7UA 3T09A 3PE9A 1IEAA 2VWEE 3TYGL 3MLXL 1ZK9A 4NYLA 5MHSD 5KSAB 3K1DA 2XG5A 3PL6B 5JOFA 3ULSA 4D0DB 1F6FB 4RMQA 2EEBA 2NQCA 3J8F7 5FO8B 1QLFB 3LN4A 5C3LD 1CGWA 4WW1B 3RTQD 4LOUC 4WU7B 2W0FA 4X6FB 1YEDB 1OCWH 1CXKA 5SWZE 5FGBA 1PG7H 1UJ3C 3OXSB 4JPIA 1NGXA 2W9EL 3OGOE 1OAYL 4TUJB 3TC9A 3RAJL 4JKLA 2BOBA 5DFVC 4ZQKB 3GI9H 5F9JB 5E8OA 3O4OB 2V5YA 3HPJB 5KZCD 5GIRB 5EO9B 2X5PA 4ZUVA 1YMMA 2YUWA 3CSYA 2DS4A 4LPTA 2P44B 6CGTA 4LSVL 1LP9A 4LLDB 4JREB 4M61B 1FL3B 1HINH 3ULUF 3O6LH 3WFHA 3FB8B 2ZUTA 3B3IB 1Z9SA 4EUPH 1NGQL 3STLA 4BYHA 5IW3A 2MOVA 4P46C 4J3UA 1KNOB 4PUBL 5HHMB 1G9EA 2R2BB 1DQML 4NUJA 4S1SL 3H9HA 4XC1H 4YHML 5C0CD 5ACZB 1XGPB 5CJXC 3WE6B 4XPTH 1U95A 3LSOB 7CGTA 5ADOH 5LBSL 1RURH 4X0KB 1P4IL 2X4QA 2DWDA 1BZ9B 4XVTL 4QRQA 1QTYT 5IQ7L 4G43B 5FM5O 5BXFB 3WD5L 4NNPL 4R7NA 4A6YL 1FVDA 5FO7A 2W38A 3KLAB 3DVGB 4LLQB 1MLBA 3B9KD 3O81A 3QIBC 4Q9CA 5MI0C 1S9WA 3WV0A 3HMXL 4M5ZL 5ALCL 3VXSA 5DZLA 3FAWA 4CDGC 3TIEB 2R23A 4HC1H 5C0NC 1VERA 4PRNA 2PYFB 4MCYA 4WI5A 4E0RA 4KPHL 5E0QA 5FECA 1A3QA 1CGXA 3DUSB 5JPNB 1LE9B 2HT4C 2RFXA 4ZSOB 3MRCB 2ILLA 3VFPB 3BPNC 5MHSE 3P77A 1ZHNB 5D72L 4PTUB 1YUHB 3G5ZA 1SVCP 4DUXA 4BQ6A 4HEME 3VCLB 1UQSB 4ZAKC 3CJJA 4LL9A 4BSWA 2QSQA 5I1AA 3MRPA 4Y4KA 1T66D 5MEQA 2KQMA 3D18A 2VMFA 1YYLH 5MP6L 3TO4D 1FFPB 1KJMB 3C5JA 2AV7B 3OF6D 1E27A 1D9KA 3G5VB 3OKKB 3PXHA 4DQOL 4LVNB 3T0EB 2E7BA 3WNKA 4FABH 3BN3B 1KLUB 1NFKA 5I74C 2SEBA 2YA1A 5D8JH 4G3YH 1B0GB 1XF1A 4O2EA 3O3AB 4KK8C 1EHXA 3GSUA 2OZ4H 4ZNEA 5IUSA 4XNMB 1CICA 1J18A 1RVFL 4PJFA 5AUMA 3DRQA 3MNZB 3M8OH 3WDJA 5INCB 3KYAA 3SE4A 4H26A 2VQ1A 3QUZB 2P7TA 3OV6A 3TPKA 5C0CE 1P4LB 1A1OB 2KDGA 4X7CC 3ZYOA 4JLRB 4OLUL 3WFDH 5E6YA 2H8PA 4K94L 2NPLX 3LKOB 2K7QA 3BO8B 3ABZA 3GMMA 5TE6L 1LVEA 3D3VB 4KUCD 4DKFL 1X6NA 4LOUD 3WXVH 2BNUB 3UCRA 4U1KB 2DQTL 5CILH 1QBMH 1J5OL 3DV6A 4Y2DA 4XP6L 1I1AA 2YR3A 3MACL 3SEPA 2BHUA 4PJCA 4WWKA 1VACA 3ES6B 4TSAH 1P2CB 4L9LA 4Z8FH 2OP4H 5AEAA 1XF4A 1V7NH 1MVUB 2O26U 3I84A 4G6ML 4NZDA 3MGTA 2VDLL 5GGQH 4R9HA 1JUFA 2Z92A 4KC3B 4LVHC 3SO3B 3BH8B 3MGOA 1LK2A 4JQXC 1F13A 3F6IA 3VFNB 4G6FD 3WJJA 4NQXB 1D6VL 3G5XB 2YPKA 4GH7B 4TUKL 5MEOB 2ICWA 1KOAA 5GGUB 5DTFB 4JFFA 1KLFA 2XKUA 1MRCL 4YBQD 3RDTD 2PYEA 1JGEB 3I9GL 1HYSD 2F53B 2OCFD 4S1RL 3N06B 2BC4B 2EDEA 1N6QH 1QFWH 2F5AL 1G7HA 2BSSB 5J6HB 5JHDD 1CI5A 4PJ5D 2APBA 3PIQA 1HEZB 3VFRA 3ZHKA 2YN5A 4MXWH 3OKMB 1HCVA 3K74B 3UXFA 3QG7H 4OZIE 5GRYA 4QHKJ 1EO8H 4OLZL 3LQAL 4J4PC 5TFSL 4AEIL 3JUYA 3QDHA 4DN4H 4KZEH 1KACB 4POZD 3HC3L 5I18L 5ACMA 3BDYH 1I8KA 4RRPG 5DJYA 1LE5B 2VLMD 2N7AA 4X9GA 1R3KA 5E6IB 2NY4B 4IIQB 4OIIH 5T3XD 3GSOB 3L95A 5AZ2H 1A5FH 1ZHKA 1JJUA 5F6IC 3IFOA 1IM9A 1AHWC 5C09B 3DWTA 3RU8L 4UV7H 5IB5A 4OCMC 3P73A 4ZFFB 5L88L 1GGYA 4NQEA 3D39B 4FP8L 1FC1A 3P11H 4R96A 3QDJD 5EOCL 3P0YL 4C58B 1HOCB 3JTSA 3IGAB 3DO7B 3U46A 2R39A 3L3KA 5HDQH 5DD0H 5BZWA 1Q38A 1X6LA 3UJTH 3QIUC 2NMSA 4JB9H 3VXUD 1OP9A 2EXYC 3G6AA 1MCLA 1ZXQA 4X9FA 1GGCH 3O9WA 1FGNL 1KF9B 4RWYL 3PV6B 4PBVC 4F9PC 5KVGH 1UXWB 4OLWH 3RL1A 1KCVH 4PPTA 1U3HD 5GZOC 1KXVC 4EQ3A 5D1ZB 2DQDL 2X4OB 3AB0C 3L3JB 3GFUA 3SGKC 5D2NC 1V7MH 2X6MA 3DTXA 3OJ2C 1HSAA 2QR0B 3MRNA 1A1NB 2YPLD 1I9IH 2Z35A 5DRXA 1HHIA 2G5BB 2O5ZH 5I1DA 2ED8A 4QRTB 3MCG1 2EDFA 3EJYC 4X7TA 3L6FA 5IG7A 3UYOD 1A9BA 4DW2H 1MQ8A 2Z8SA 3CFBA 2EDKA 4QGYA 1X5LA 2YKLL 1Q0YL 1Q1JH 5JHDE 2Y9RT 4PJ5E 1BBDL 2OMBA 2KUTA 2GUOA 4NO0B 1JV5B 2B2XH 4UTBL 5D2LF 3HC4H 3RA7H 2UWEA 3UTPD 1XGRB 1H9VA 5KSBA 5L8JB 2MWCA 4B7IA 5D2LB 4QHLA 3T4YB 3BPLB 1EJOL 3LN5A 3N50A 3MFGB 3SO5A 5I75B 4AQ1B 3OKOB 2D0GA 3ARTA 4F58L 4KTDL 5JORB 2C3XA 1HXYA 3I02B 1QG3A 3GBNH 1S5IL 1F4XH 2FSEA 3AROA 1MJ8L 3BEVA 4QYOB 3RZCC 1UC6A 2VLME 4LQFL 1P7QA 2NXYC 3BSZL 3QO1B 5DZOA 1TPXC 2AERT 4JVWA 2EIEA 2DI8A 4IHOB 1BD2A 5T3XE 5ICZB 3ARDB 3ZDZF 3U1SL 3QCUL 2VLKB 3RWFA 1BVKA 2HA1A 1CQKA 1ORSA 1JWUB 5I1EH 1L7TH 2HH0L 4F7CB 3K4AA 4ZFGL 2FX9H 2VR4A 1BM3L 5J3HC 1XIWB 3BKCH 4YK4C 4AT6B 5DGQA 4Y0GA 5IB3B 3MFFA 4KQ3H 3O4LA 1A4JA 2WMPA 1NCBH 4CW1A 1SYVA 3VXUE 5F9WC 5IMLA 2PW2B 2NTFA 1YNLH 4HWBH 3I50L 3MBEB 4ZD3L 4PGEA 3ULVH 2DYPD 3CVHL 4WW2A 1GPOH 1DDHB 1AD9B 4OLEA 2HJKA 4RMUA 1HDMA 4J4PD 5ANME 3I6LD 5HHVH 2YPLE 2QQLL 1SY6H 1TCRA 1RI8A 2WUCH 3KYKH 5TGBB 1CFVH 1NCCL 4OFIA 2D31A 4OTXH 3BZDA 4FXGB 3HB3D 1U91B 5DJAB 3TFKC 3GHEL 3E3QE 3ET9F 4KROC 3GSNL 4M62L 4KTEH 1A7PL 1TETH 2KQNA 5IQ9B 1B4JH 4HUKB 3IDGA 5FA3B 3U0WL 3BUYA 3DSFH 4L3CB 4RNRA 3GSWB 1BP3B 3ZKMC 4G6AD 1QFUH 1NCUA 5D1XC 4R4NC 3UTPE 4MMZC 4PGZA 2PXYA 3DMMC 2GCYB 5B4MC 2VITB 3GJEB 1EVUA 1KB5L 3S98A 4JCMA 4HIHB 4MDIB 1CD1A 4M9OA 3OKEA 2B5IC 1W2KT 3FT2B 2RAMA 4X6EA 3MTRA 4MD5B 1ZAGA 4ZOEA 3BGAA 3DIFA 4URTB 4EQ2A 2R1XA 4HAGA 4PRPA 4P5KA 4HUWB 1HIML 2DM3A 3D6GA 2BERA 2XN9A 4UB0H 2UV3A 5I1KH 3HAEA 1FGVH 2E8YA 2HVJB 2O5YH 1RUAL 1UA6H 4PJGA 2M26A 3SE3C 5HYEA 2CLZB 2Q6WB 3BP6A 3D85A 1NC4B 4EUPB 2VZVA 5C9JB 4JQIL 4XCNB 4UOJA 1PQZB 1BQUA 3MA7A 2B1AL 2UZIL 4U1LA 1GGIH 3O45A 1XGUB 4EN3A 3QUKA 3NIDE 4EDXA 2D03H 3QUXD 2HFGH 3OKLA 5CGYD 4P46B 3CFDB 2BVTA 2CK2A 1MI5E 4M7KH 5KVEL 3FT4A 1MIEL 3VDCA 4M02A 2VIRB 1FZOB 4J3WA 3AAZB 2JCCA 3RBSA 4NHCH 2CIIA 4LF3A 4PG2C 1RJZA 5KVDH 4NZRH 5D7SL 3B5TA 4XC3H 1RMFH 3OR7A 3VFTB 4YXKL 4H1LH 3I6LE 1TZHA 5I8KL 2A6DA 4Z9KB 2CIKA 5FUOL 5F7YC 3MV9A 4GKNB 4I2XB 3ZSSA 4EUPG 4WJ5A 4JRYB 2X9WA 1FH5H 2JJVA 4OLVH 1A6UH 1MCQA 1JNNL 1NCWH 1Z9OA 3WSQH 3QIBB 2VAAB 2HFFB 2GFBB 5MI0B 3M45A 3ARFA 5TQ0H 2R0ZL 4L8BA 5EUOA 2QSTA 4JY5L 1KPVB 3L9RB 3FOMB 2BNRD 3QWOB 5IV2B 2YEZB 3N1FC 1EGJH 1NL0L 4W6YB 4NIKB 4NFDA 2MKWA 5KBNC 2HLFD 1QSED 5J56B 4OAWA 3GMQA 1KCRH 5I2IB 1OTTC 3BPNB 1WBZB 1RZ7L 4UDTB 2X10A 4KY1H 3EFDH 4QRSB 4EJ1C 3RPIA 4ZG1A 4JFDD 2E8ZA 1WCBB 1D5IH 2EDLA 4ZAKB 4WO4C 1S7UA 5HTSA 5CEXB 3CMOL 1WUNT 4OJFH 3HI5H 1V3JA 2X05A 4Y5VA 3F7PC 2L7JA 3HUJE 3MRHA 5ALBH 1Q9LB 3H7BA 1P6FA 5DEFB 4H25B 2FWOB 3LPWA 2LE9A 3LS5H 2WM0A 5JW4M 4PB0L 3MLSL 2EH7H 5GQBA 5I74B 4LCIH 4YXHL 1A9EA 5E9DB 4HK0A 3OJDB 3LDBB 4KJYA 3DJ9A 2A9NL 4KROD 4AEEA 2ZWLT 4HX1B 1NGZB 3GSRB 3EYFA 2Q8AH 1DZBA 5C08D 4E42A 1MI5A 3ZKMD 1I1YA 4R4BA 4ELKB 1DVFA 3KG5A 3P0GB 2IMMA 5D1XD 5DMKB 4R4ND 2X4PB 3I6GB 3QFJB 1SMOA 4WUUD 5B4MD 2R29L 3OSKA 4HXAH 3SJVD 3DX9A 1LGVA 4KJPC 25C8H 5GGRB 4HWEH 4OM1L 2PW1A 3MLVH 1OSPL 3GSVA 5GGSY 5SWQB 4GXVH 2ORBL 2X4SA 1BOYA 5A3IC 2VC2L 5IW6A 1JGDA 4M4RA 3VH8B 4AY0A 4FZEL 2I26N 3MXVL 5GS2D 3HR6A 3KPTA 2Z31B 2FL5B 2AI0L 3RRQA 2CDGA 3P4LA 5F3HA 2X1QA 2VH5L 3ARRA 3BD3A 3P9LA 3MLZH 2DQEL 4QXGH 2EKJA 4JDZB 1V5JA 1YEEH 2AJVL 4Y5YA 3VG9C 3WDHA 3QNYB 2BNRE 4FQLL 5GS1A 5JQ6L 5JW3L 4G8GA 3V5KA 3ZYIA 4NUGH 5FDWB 3FRUA 4WNQB 3V4PL 1KENH 4FA8A 1DN0B 4U1JB 4Z7WE 4ELMA 2P43B 4QRUA 5I71C 4LVHB 4R26L 1QSEE 5F97E 4RGNE 3WYRA 4N90E 4XRCB 3VXQA 3FO1A 5DHXB 2YD5A 3HA0A 1U42A 3BN9C 3MA9H 4JM2A 4X98A 2FYYB 2VXVL 4JFDE 1F90L 5I1JH 2BVOA 4MA1C 1UWGL 4WRLA 3VH8G 5JW4Q 3W0WB 3U4BL 1G9MH 5FGBC 1TQCC 2DD8L 4LNRA 4YUEH 4M3KB 4MJ2A 5EORH 3TVMC 3HUJA 4N0FA 2QQNH 5F7WC 3QJFB 2AK4D 3KWWA 4KH2A 4UZGA 3PWPD 3ZE1F 2IH3B 3KXFA 3SDYH 3SE9H 2FDBP 1N8ZB 1AI1H 2CKNA 1BX2B 4KKBD 1J1OH 5DHVA 3WFEL 5FYKU 1HQRB 3X12A 1FNEA 5EWIL 2G60H 5JHLH 1D5XB 3RUGF 2EDDA 5DD1H 1JP5A 3MNWB 3TJEL 1Q8MA 4LHQB 3RUGB 1ZT4B 2BNQB 5J12B 4XNYH 1X7QA 5C08E 2P8PA 5FOJA 1ES0B 1YPZA 2YD4A 1NFIB 4PJIA 5T1LD 1BIIA 4LU5L 5CJOL 1CLYL 4FQJH 4QOKA 1NCAL 4UT6H 4CAGA 3TN0D 4NN7C 4XPBH 3E2HB 4WUUE 4HQQH 4UI2A 3JTTB 1T20A 2CGRH 3HRPA 2R56L 3PWNB 2JJUA 1OTSD 3SJVE 3K8LA 2XPGA 1S7SB 3LKQB 3S5LA 5MEPA 4F57L 1MJUH 3U82B 4OSUL 3FKUS 3TBTA 4ONGH 4L4VD 2GJ6E 3RWEB 4GSDL 4NC0B 5HPOA 5I76A 3OHXB 2FZ3A 4J6RL 3QIUB 2OL3A 3ZT5A 3SDDD 1EFQA 4M6NL 2F19L 4PLJD 4QTHA 4OFYD 1ZLSH 5HYJB 1P7KA 4XNQB 2APWA 1MQKL 1S7RB 5L6YH 4CN4A 2D9QB 2JB6A 2EKSB 2P5EE 4Z7WA 1FNGB 3B8SA 4RA0C 5C07D 4JZNB 2ZOLA 4G8IA 4OUUB 1DQLH 3KPLA 4OFVA 4OIBA 5CINH 4MD4B 4F8TA 4WEMB 3AB0B 3K3QA 5JXEC 5DO2C 5D2NB 1UENA 2BVUA 1QYGH 4Y4KC 1MCJA 4OQTH 3VJ6B 1BMGA 3OKNB 5CSZB 4M6OL 4X6CE 1GHFL 3FT3A 1RZ8A 1U8KB 2XNAA 4PD4K 5DRWB 1KXQE 3CVHA 4LLWB 3UTSE 1Y0LA 5GGTL 3MUHL 1EHLL 2FH8A 3MLRH 1T1XA 1Q9KB 5EO1B 3GB7A 1N6VA 5IFJA 5IMMB 3CH8A 3HFMH 4HIEB 4U2ZA 1YN6B 5I9QC 1B4RA 4U1IA 5ID1B 2YA0A 4WY7L 1DE4B 2KPNA 3FOLA 3PQYD 5HHQA 4N0YL 2R1YA 3MRMA 2P8MB 1MVFA 1VEOA 3D87B 1UM4L 5T33H 4XPHL 3GSNA 2VDMH 2J1KA 4N9GA 3AC0A 2AJUH 3V6BR 3RZCB 5DR5L 1DUZB 4NQSA 2AV1A 2NXYB 3DRTA 1TNMA 3HE7D 1TPXB 2F54D 4MJIA 3GIVB 4WTXA 3T4AA 5IEKA 5CCKH 1BLNB 1BZ7B 1I9RL 3OMZA 4P0DA 3CSGA 1EIBA 4M8QA 5D6CA 5EU7C 3L7FB 2B8OT 4LPVA 3FMGL 3LKRA 3V4UH 1LD9B 4DFIA 1NJ9A 2GJ6A 3L5XH 4Y2DC 3QEQA 1UACH 1I1AC 4L4VE 4YK4B 3RWHB 4WWKC 3ULVF 1B90A 3V8CA 4UAOC 4NQDA 2APVA 4L9LC 5CFHA 2OJEA 3TVMD 3WHXA 5K9JL 4QT5A 4X5LA 4ENEC 1TVDA 5F9WB 4P99A 1N7MH 1U8QB 2P5EA 2A9MH 4GW1A 4MA8L 3HNSL 2EDRA 1ED3A 5C07E 43CAB 1MAML 2MCPH 1FNHA 5DMIH 3HCVB 2NY7L 1IGJB 3BVNA 2P5WD 5ISZA 3QH3A 2IG2H 5J89A 2IADB 5BVPL 1S9VB 3V8OA 1QSFA 1CGVA 3SKOA 5LGHH 1YQVL 4G5ZH 3H9SD 3QCVL 4KKCC 5GS0D 3NCCB 2R2HB 5TH2A 4JANB 3ELAT 3BKJL 3ARWA 3VFVA 5D7JD 1J8HB 1FIGH 1RPQA 2AGJL 3VFMB 4XHJC 1QLRA 3BH9A 3BRDA 5I1IL 3KPPB 2QQKH 3F5WB 4BFIB 1VKXB 4H5SA 4HHAB 1MFCH 3FB7B 4ZUUB 5FFLA 4A2LA 3FQWA 2DDQH 1CE6B 2H41A 2F74B 2XZAH 4DGYL 4RX4A 2PO6C 3P4MA 3DMMB 4KDWA 2BHYA 3PQYE 3VXSD 3L1OH 3ZTNH 4OKVA 3MREB 1ZGLA 2DF3A 2D7MA 1QR1A 5DHYA 3K46A 3GSXB 2FGZA 1MOEA 1YECH 4JDVA 1KCSL 5F3BB 4FXLA 4LSRH 1JGUH 1CDYA 4BQ8A 2F54E 2ZUUA 4FQPA 2JE8A 3G5YA 5IVXB 3OG6B 4KJWD 5JXED 1AGEB 1B0RB 1YC8A 5E2JA 1T1WA 4QTIH 5DRNA 2FECL 1S9YB 4UUJB 2VDKH 4QRPA 3H9YA 5AYQA 1LK3H 1MREL 2J8UA 4YXLH 1BQLL 3UTQA 5HVWA 4YDVA 1V3MA 3MV11 4P23D 2VDRL 3L3DB 5FKPA 1S7XB 3O9WC 3BGMB 1INEH 4M1CC 4HJ0C 3VFUB 2CDEB 3FFDA 2YD2A 2VLJD 1LEIA 3HI6L 1JZ3A 5EFIA 5L2KB 1SEBA 1Q9WA 5TF0A 5T1DH 3RX7A 3SKJL 4YPGA 2B39A 3PDOA 4ALAH 4K3EL 5DSCA 1L9MA 2CD0A 2E5EA 2C4XA 1BWWA 1F2XK 4NM4L 4ZPTA 3TT1H 4H1LB 2O5XH 3LH2H 1MCKA 2CUMA 3MRGB 3IXAB 4G7VH 4KUZH 4UMGA 1J1XH 5HPMB 3BP5B 2P5WE 1FDLH 3IS1X 4M1DL 3JWOC 4YE4H 3R1GL 3ME0A 1F58L 1L0YA 3H9SE 2ITCA 3G6JF 3BYYA 5GGSA 4HK3N 2EE3A 4U6TA 3MRIA 4PG9B 4G9DA 1PBYA 3JWOH 3VGBA 3G6JB 2JK5B 1AD0A 4DAGH 3O8XD 2XT1B 4MSWA 2LU7A 1G6RH 3PGFH 1G7QB 4YGVA 1YEKL 1AXTH 4XWOC 4TSCL 2Q7YB 2X4UB 1FN4A 1RZKL 1JRHH 4NKDB 1W72L 1NANI 3L5WA 1K3IA 1XF5B 4RISH 1DLHB 4L3EB 2ADGB 5I1GH 1A0QL 1A7OL 1CU4H 1KSRA 4H1LG 4E41D 4P2OA 2K3TA 2NY2D 1GAFL 3NVQA 3LZFL 1PVHA 1A7NH 4QHKI 4CU6A 4BH8B 3EJZD 2H6PA 3AY4C 1FV1B 4JY6A 4WWKD 2PCPA 4OZ4B 4JG0L 1N0XL 4Z78B 2EECA 2ESVB 5E4IA 3C5ZA 1AIFB 1SBBA 1MNUH 4NSKB 4GW4B 5D7IA 2EDXA 4WO4B 4GOSA 2GKIA 1CL7L 2HRLA 4G9FB 3GJFA 3BZ4B 5BS0A 3DARA 1FZJA 3CH1B 3WL9A 3ILQC 2I9LA 2VXUH 4ETQA 5D93C 4IMLA 1F4WH 2L0DA 4WDIA 4YIQB 5K9QG 1SEQL 2NW2B 4Y16D 2WAHA 1Y6KR 1C5BH 4Y4HB 4KKCD 5DJ0A 3HZMA 5T1MB 1N2RB 5IB1B 1AQKL 2F58L 3MRKA 3EDKA 1EXUA 4OM0H 4ONFL 4MWFB 1T83A 4I48A 4GRWF 3VGAB 1NBVH 5EU6A 5LGKA 1F2QA 1AGBB 4GRWB 3MV7B 1X5XA 3UTOA 1RZIA 1QEWA 3ARGA 5C0AA 2XRAH 4WW2C 4P59H 2VLJE 5HSFA 4U31A 3QULB 3BWUC 3C8HA 1RZGA 4LHUD 1IQDA 3FQTB 3CXDL 2PO6D 4XWGH 3MV8B 4O4YL 2A0LC 1Z5LB 2R0KL 3DX8A 5HD8D 3QXUA 2L7UA 4JRXA 1JZ2A 3OR6B 2MCG1 1JTPA 1IT9H 4PJ7F 2AP2A 5KS9F 4YHPB 1FFQA 1Q94A 4PJ7B 5EC2A 5KS9B 3CLFH 4Z7UF 2LVCA 4C83B 4I4WB 1KTRL 2V5SA 3CD4A 3VWJA 4HMEA 1F3JA 5DEZA 4Z7UB 1P1ZA 5IMKA 1IEAB 4MZ3A 3VG9B 1R3LA 1P4IH 1RIVH 2C9AA 4P49A 5DFTA 5EZIL 1FJ1A 2YN3A 5E5RB 4NYLB 3FFCD 4Z95H 1FZKA 1OLLA 4E41E 1I9JL 5I71B 4IS6A 1BQHA 3BQUC 3T0WA 3ULSB 5JOFB 1A7RH 1A8JH 1UM5H 1TMCB 4X6DE 2ADFH 1QLEL 3LN4B 1KEML 3D2UD 3QPQD 1OAKL 2W0FB 4TUOA 1M4KA 3FTGA 4F2MA 4IEFB 1ZGLP 3LEXA 1TQCB 4LARL 1BHGA 2JIXD 4K71C 4MX7A 1OQXA 2NY6D 4JPIB 1NGXB 3SGDH 2BOBB 1ZTXH 5DQJA 5T3XH 5EIVA 3HE6D 4U05A 5E8OB 2N7BA 3GHBL 1U8OA 3HAEH 3PP4H 1LP9F 1YMMB 3S9DB 3CSYB 5FEBA 1NKOA 1LP9B 4KXZI 2EO9A 2Q87A 2GK2A 4NZUH 3WFHB 1WEJH 3IB4A 4IRJD 1YEGL 1XGYL 2YA2A 1ONQA 1X5ZA 4EN3C 3NCYS 5FF6A 3TA3A 3HRZA 3STLB 3CC5A 4XWOD 5EOTA 4NUJB 3GMRA 3H9HB 1T5XA 1C5CL 3BP7A 4TVPD 3HZKA 1U95B 3IETA 4DQOH 3ULUL 3LS4L 1ZVHA 4XPFH 2DWDB 4J8RA 4W4NA 4QRQB 4ZNCD 4MS8C 1J0ZA 2DL9A 2HWZL 4ODVH 4XT1C 5DYOB 5CLWA 4R7NB 1XT5A 4MA3A 1FVDB 5FO7B 5BCAA 5KSVA 5IW1A 2DRUA 1ZMYA 3KJ6L 4HKBA 4KK9C 1MLBB 1RZJL 4G7YH 2GW5A 2FEDC 3QIWD 1S9WB 1XCTA 2HFTA 3ARFC 1Q72H 3TH4T 5I1CH 3UBXI 4PRNB 4MCYB 4E0RB 3VRLF 5FECB 1BF8A 2RFXB 2KH2B 4UILL 2XY2A 4TOYH 4K94C 1K5NA 1R3HA 2ITDA 4XAWH 1G1YA 3FFCE 3P77B 4ODTL 3G5ZB 5IJVA 3ZE0F 1J0IA 4K94H 1BPVA 3AS3A 2QSCL 2HMID 1NC2A 3C08L 3KPSE 1JF1B 1TTFA 3CDYA 4BSWB 5I1AB 3QFDA 1JYNA 3MRPB 4Y4KB 5MEQB 4DUWA 3D18B 2WLYA 4YBHA 3R8BB 4UU9A 5LAXA 4G6JL 4Y5VC 1T89A 5F6HJ 4X9BA 3DXAD 3WUWA 3QRFM 5IHLB 5CP7A 3C5JB 4LIQL 2FHFA 4JG1L 2EC9T 1F8TH 4C55A 5K59E 1E27B 1D9KB 1IAIL 4IMKC 4I8DA 3ZE2E 1S7VA 1M71A 5H37H 3QDMD 1BBJA 1NH6A 5T1KD 2NX5D 4MAYA 2XI9A 2QHLA 1YJDH 2Y1VA 4O2EB 1KYOK 2ZPKL 1J0YA 5I9QB 1CD9B 4PLNC 3TF7C 3GSUB 4O02H 4PJFF 4MMXC 2XQYK 5T3ZL 1CICB 5HVGB 1N5YH 1CR9H 4PJFB 5AUMB 3CPLA 5DA0B 3ARBA 4I0KA 1DVFC 2PN5A 4H26B 5FYLD 4N8CH 1YQ2A 2P7TB 2HTLC 1NANH 3WIHL 4KZDL 4TVPE 5KOVC 1AFVH 4ONOA 4OCXL 4NP4L 1AKJA 3FQUA 2VXTH 3LQAC 3BQUD 4S11A 2HKFH 3Q6GH 5F7EH 2H8PB 3U0TB 1AR1D 1T7VA 2A6IB 2PNDA 3GMMB 2ATPA 1CLZL 2YD7A 4NZJA 5F89A 3L5JA 4OIAA 4O5LL 5BMFL 4PJCF 5I18H 2DL2A 3DV6B 4Y2DB 4TVSa 5E8EA 3GIZL 1I1AB 1BQSA 4PJCB 1VACB 4N5EC 4UAOB 1J12A 4Y5YC 4L9LB 5GS1C 1ZHBA 2DTML 1XF4B 1VFUA 3MGTB 2GQHA 4JKMA 5EO0A 5K9QI 2Z92B 1WSST 3A0OA 4KI5C 4JQVC 2I07A 1VESA 3NZHL 3MGOB 3V0WH 1LK2B 4UNVA 2ARJA 4F7TA 2QBWA 3O41A 1TDQA 3MBXH 1WISA 4G80B 2YPKB 4JM2C 3I3DA 2ICWB 3HTLX 4FP8H 3TWCL 1UYWH 3P0YH 4JFFB 4JFPA 5C9KA 1LO2L 4OGXL 3IFNH 1LO4L 3K2MC 1JPSL 2PYEB 2IGFL 1FLTX 4OCSH 4JKPH 1GC1C 3SE8H 3VGEA 1BVLA 4FRWA 4Y5XC 3DXAE 1SJVA 1JHLL 3QA3A 1EJ6A 4A2MA 3BMWA 4RWYH 3HKFA 1P69B 1G7HB 1GC1H 4FFZL 5C0DA 1OT2A 5MEND 1MHCA 4IRZL 3PIQB 1F5WA 3VFRB 2VXSL 4DKDC 5DRZB 3QDME 1F6AA 2NX5E 5DJXA 7FABL 3W2DL 4Q6IC 2DOCA 1JK8A 1QSVA 2LV4A 2FEDD 1WGOA 4XCCL 4OD1H 4WIQA 1P84K 5D70H 4Q9RL 1DJSA 5DJYB 4R8WH 5FYLE 1CDGA 1R3KB 4KQ4H 4L4TA 3L95B 3TBSA 3EZ8A 1A14H 1ZHKB 1KIPA 2NY3D 3IFOB 5JZ7C 1IM9B 1KC5H 5IB5B 3P73B 4NQEB 3GNML 4K9EH 5GJSH 1U8IA 4R96B 3FJTA 2MJWA 3QPXH 3JTSB 5FYJH 3U46B 2IPKA 1J88A 3L3KB 4LSSL 4X4XA 1T6WA 5BZWB 3UJIH 4FQCL 4OB5H 5C0GA 1L7IH 2NTSP 5IBUB 1CGTA 2QSVA 4FZ8H 1MJ8H 3ZL4L 1TJHL 2RGSA 1V3LA 3O9WB 2N1KA 3ARXA 3QI9D 3NN8A 2OL3H 2DIJA 1RIHL 3RL1B 4ERSL 5DUPL 3EYVA 5L7XH 5GGVY 3T3PE 2AXFA 5JXAL 3DTXB 1HSAB 3MRNB 1NCDL 1HK6A 1B0WA 1T03H 5DRXB 2Z35B 1HHIB 4ZTOH 3THML 1PEWA 3EYOA 2CRMA 3V4VL 5I1DB 1J9CT 4OBRA 4KGLA 1IKFL 1FNAA 2QV2A 4X7TB 3L6FB 4P5TA 5IG7B 1CCZA 1A9BB 2IAND 1T80A 3CCHA 2FH6A 5IBUG 3CFBB 3GGWA 1JHKL 4ZD3H 5MENE 4UNTA 5ID0A 3QO0A 2UWEF 4YHKL 5KSBF 2GUOB 4XP1L 4KV5F 1FYTD 5A2LH 3FRPA 4GAGL 2WBJD 2Y25A 1CLOH 3RY5A 2UWEB 4P3DA 3ROLA 5KSBB 3SCMA 1MFEH 2KZ1B 3IDMA 3IJYA 4QHLB 4EI6A 3LN5B 5DFWH 1FIEA 2VKWA 3NPSC 1NCCH 2Y6SC 4HG4J 2VZ3A 3QXAA 1YNKH 1HXYB 4RGMC 1T2XA 4RDQF 3LHPL 4EOWL 3BEVB 2FSEB 3FCTA 4G8GD 4JFED 3DECA 2FX7H 1RUKH 1P7QB 3GSNH 4F7MA 3C6LC 1BD2B 5F7FA 3RWFB 2IBBA 3DX6A 2O61B 4JGMA 1BGXL 2FX8L 1CZ8H 2MSPA 5D93B 5I15H 4YHLL 4KDVA 4F33A 1XEDA 2NY5H 4P9MH 5DLML 4PJ9A 3MODH 3O0RL 1ZS8B 2YRZA 1JWSA 3O2VH 1JZ5A 3MFFB 3MOBH 3O4LB 1A4JB 3K2UH 4CW1B 3QWQB 1SYVB 5GS2H 5IMLB 3G6DL 4R3SA 2NTFB 4WW2F 2MFNA 4HF5H 3KXFD 4RDQG 4H0IA 4MVBD 1NFDE 4PGEB 1I3UA 4WW2B 1CGUA 2YD1A 2COQA 3MPCA 2VLRD 1HDMB 1KIUA 5IT2L 3VXMD 5M94B 5JO5A 3OG4B 4FTVA 3WFCL 1TCRB 3IFLL 4YLQT 2D31B 1A6PA 2VZUA 5DWUH 1UH2A 4NWUL 2BY3A 5HGDA 3RWCA 2Q20A 3RI5F 2BRRL 2IANE 1ZOXA 4RFOH 4LASH 2AABH 3IDGB 3BUYB 4RNRB 1XMWA 5I19L 4U7MA 1FYTE 3V0AC 2VZ1A 4XH2A 4IJ3C 3QR2A 2DQJH 1FYHB 2PXYB 2GY7B 4X0KA 4JPKH 1T7XA 3LD8C 4MXQD 4OGZA 3SN6N 1CD1B 2AQ1A 2DMCA 3WNOA 3OKEB 2FCBA 4V2BA 4NQCA 4X6EB 2P49B 2Y5EA 3C09C 2FATH 3DIFB 1BFOA 4JFEE 2R1XB 4PRPB 2MPAH 2W07A 1OL0A 5FYKE 4JY5H 3GSQA 2XN9B 2OM5A 3HAEB 5F72S 3RKDC 4K3GA 4PJGF 3MNVA 1M7DA 1OCWL 1JNHA 1PG7L 1NMAH 4PJGB 3TM6A 3ROOA 2P24A 3GI9L 3BP6B 3D85B 3CNKA 3PDGA 1KIRA 4KMLB 3VFPA 1II4E 2NY0D 1BREA 2ZUQC 5TE4H 3VWKA 3MA7B 3QQ9D 1G7PA 1W0VA 4U1LB 4C4KT 1HINL 3O45B 3O6LL 4EN3B 3QUKB 4EDXB 2JCCF 3RVTD 4CVZA 3FT4B 5E08H 2XQYG 1I8LA 2JCCB 2CIIB 4LF3B 1MCSA 1RJZB 3HAEG 3R06A 1A6VL 2VLRE 3WS6A 5HI3C 3OR7B 5D1QD 5ESVA 1G7MA 3VXME 2IAMC 2NXZD 4DFHA 1ERNA 4XPTL 4K07A 1TZHB 1RURL 2A6DB 4OD3L 5I17A 3INUH 3MV9B 5C0BE 3CFJA 1KCUH 4N1EA 2EO1A 4WJ5B 4QY8A 1DEEA 5IJKA 1RY7B 5EUOF 4ZXBD 3C6LD 1NUGA 4MJID 3ARFB 4OCNC 4L8BB 5EUOB 1JN6A 2ZCLH 5C2UB 1TTGA 2WANA 5DURB 5CS7A 3DHJA 1U41A 5KW9H 4PJHE 1UM6L 4P2OC 2R29H 2ZSVA 3ZKXC 3QUZA 4HC1L 4OAWB 3GMQB 1VFBA 3NCEB 4CADA 4JO1H 1OTUD 1H5BA 2W91A 2CRZA 1INDH 3C5ZC 3RPIB 1CVRA 1MRFH 5JW4R 4LKXA 1S7UB 3OWEA 3VI4E 2X1WL 3QDGD 3LKOA 2XYCA 4CMHC 3NIGE 5JIHA 3L5HA 3P0VH 4Y5VB 5DVKA 3GJFH 1F02I 1FO0A 1TIUA 3MRHB 3L5IA 1HYRC 3H7BB 1WBYA 4OGAD 1CFQA 3H42H 4PRHD 2F8OA 5A2IH 3EYUL 1EVTC 1KELH 4WWID 1A9EB 2DM7A 3LCYA 5IB4A 4HK0B 4FABL 4KJYB 5DJ8A 4JN1H 3VFNA 3NIDF 3UTTD 4FQQA 2APXA 5D8JL 4K55A 2PUQT 3ARGC 4G3YL 4GQPH 2K9UA 3EYFB 1MI5B 2OZ4L 1OVZA 1I1YB 3DX7A 4JHZA 4R4BB 1DVFB 2ZCKH 3L3HA 4WFFD 4BZ1H 3OB0H 1MFDH 4C56A 4J3XA 3M8OL 2HP4A 4Q0XH 3G9AB 1QBLH 2H32A 2Q86A 3DX9B 4TRPH 9CGTA 1IARB 4BZYA 2X1XR 2PW1B 3GSVB 2XZZA 3MLYH 3RPKA 1J1PH 2X4SB 4WHYH 4HKZA 4OF0A 5EWIH 4M1GH 4XGZA 3WFDL 1VB9A 4NC1E 1JGDB 5IW6B 5GS0H 3A6BH 1FAKT 2LAGB 2CDGB 5F3HB 3P9LB 2CMRH 3KPNA 3QXDA 3RKDD 3WXVL 4OD2A 4LU5H 4Y5YB 5L8KB 5CILL 1QBML 3OKYA 4GG6A 1QBBA 5GS1B 4ELMF 4CGTA 4KI5F 1E4KC 3RHWF 3FRUB 4PJHA 1J87A 3TH3T 2FJFA 3KPQA 4TSAL 4ELMB 4QRUB 4Z8FL 4LSTH 2OP4L 4LRNH 4ZS7H 4U0QB 5DK0A 4JM2F 3ZYJA 5GGQL 3FO1B 1JF6A 1EMTH 4JM2B 4X98B 1EV2E 1N26A 4ZFFA 4FQ2H 2BVOB 1URLA 4IM8A 4QRRD 4DWHA 4MB3A 3QDGE 4MDJA 3HUJF 2APFA 1AY1H 4LNRB 3PWJA 3EOYG 3UDWA 3HUJB 4N0FB 1O0VA 5E1AA 3KWWB 5DD3H 1VGEL 2IAMD 3M07A 1NDMA 1N6QL 3WIFA 1QFWL 4TYUA 4PRHE 3DOSA 4GS7C 1PX4A 5DHVB 1OM3H 2ENYA 5SWSD 4OT1H 3GJFK 3X12B 1FNEB 4MXWL 1NBZA 3D5OF 3QG7L 3O6FA 3HG1A 5FO9A 3TA3C 3UTTE 5DVLA 4GT7A 1A1NA 1YPZF 1GHFH 1EO8L 4PJIF 4KZEL 2G5BA 4D94A 2OTWA 2P8PB 3RFZC 1YPZB 5C0FA 3QWRD 4PJIB 5IBLD 1O7VA 1BIIB 4WFFE 4EEEA 3BDYL 4QOKB 2BVYA 1IJ9A 2FBOJ 4Z6AT 4V2CB 1T20B 4TN9A 2X1OA 1E4WL 2C3HA 2XPGB 4JZJA 4OIIL 5E8DH 4APQA 3CDGA 5AZ2L 5EN2A 1YN7A 1A5FL 5MEPB 3S5LB 3T2QA 2V2XA 3OB0K 3RWGA 3TBTB 1DANT 1XGRA 1CFNA 4UT7L 5EBLA 1MWAH 5I76B 3P11L 2VABA 4LNVA 2FZ3B 3S3SA 2XWTA 2OL3B 3DETD 4MCZA 4QTHB 5DD0L 5DR5H 2XWBA 4Z7WF 1P7KB 5F7LB 3UJTL 1OAQH 1RUPH 1G7JA 4JB9L 5ESQA 2JB6B 4GXUM 3SOBH 3LKPA 4X7FC 4Z7WB 4U6XA 1CGSH 1GGCL 2ZOLB 4G8IB 3OGCA 4RGNB 3KPLB 2G5RA 5KVGL 4HS6A 4OLWL 2WK2A 5ICZA 1KCVL 2CO6B 4K7PY 3S5LG 1JWUA 1V7ML 2UYLA 1T89C 4QRRE 1G6VK 3FT3B 1RZ8B 4GRLD 1I9IL 2YD6A 1MHEA 2XNAB 4EKXA 2O5ZL 1WIUA 1Y0LB 5F1KC 1C7TA 1OAZH 4ZOBA 4PGBA 4BUGA 4X7DC 1T1XB 3HNSH 3IKKA 3GB7B 4U1NA 1S9KC 3TT3H 4DW2L 5GRXG 5IFJB 1U92A 1WCQA 5ERWA 4EI5A 4MAYC 4QGTA 4AMKH 1Q1JL 4XCFL 4U1IB 3FOLB 5HHQB 4ZUTA 3H6JA 3HC4L 2R1YB 3RA7L 3MRMB 1ZT1A 3CSPA 3KR3H 3NPSB 4ORZC 5IP4A 3GSNB 4XBPA 4RGMB 1BF2A 4MNQA 4N9GB 5FIEA 4LLYA 4N8PA 3F8UB 5F1SA 2JELH 2DJ4A 5CUSH 5L2JA 2AV1B 2WUBH 3DRTB 4NO5A 3GBNL 1DBAH 1F4XL 2AEWA 3IDJA 5CSGA 1IQWH 4IOIA 3T4AB 5C8JA 5IEKB 4XB7A 4HUVA 4M8QB 5D6CB 4U1MA 4OF3A 3VXTB 3LKRB 1NLDH 1NJ9B 1P9MA 2GJ6B 4HUMB 5HHOA 3QEQB 2QADB 5I1EL 1MCIA 4Y4FA 1CBVH 4NQDB 3T0AA 3UC0H 3PWLA 2FX9L 5EA0H 4P2QA 2OJEB 3BKCL 4QT5B 4Z7NF 1IEHA 5E70A 4KQ3L 1NCBL 2V2TA 2P5EB 1ED3B 5CZXD 3BEWA 3SDAD 1RUQH 1YNLL 4HWBL 3QB7C 4OQ1A 5DI8A 4IDJH 3ULVL 4KRMB 1GPOL 3BVNB 5ISZB 3QH3B 2EEDA 4LHJB 1QSFB 3RY6A 3SKOB 1H8SA 4Y19A 3F62A 4YZFF 4HMDA 1SJEA 5TH2B 2A2QT 3U6RA 5JTWA 2NLJA 1SY6L 3KYKL 4RWHA 4YC2C 2MQ3A 2LTQC 4AG4H 3VFVB 1CFVL 1I3GH 5F6HI 3UTSB 4OTXL 1AO7D 5JIIA 5AWNH 3UJJH 1QLRB 3BH9B 1X5IA 4ZOAA 3NA9H 4MQ7A 4H5SB 3WDIA 1J05A 2V17H 4KTEL 5BJTA 3VFGH 1TETL 4HWNA 1B4JL 3FQWB 1MAJA 5AG8A 2YSSA 1FE8H 4LEXH 4D8PA 4I9WD 3P4MB 1KG0A 1QFUL 1T21A 2YMXH 4QWWD 4OKVB 2ZG3A 1ZGLB 1QR1B 2G75A 2ZKHH 5DHYB 1RZKC 4JDVB 3C09B 3J7HA 2OYPA 2AXHA 1K85A 1OHQA 3MX0A 2V9QA 4TVPH 8CGTA 5IFAH 3G5YB 1QHOA 2V6HA 2X4NA 2XY1A 4Z7OF 5E95B 4UB0L 3NPZB 5I1KL 1T1WB 4Z7VE 1FGVL 1EFXA 2J8UF 3LZFH 5DRNB 1JE6A 5BZDA 4QRPB 5EDXA 5H35A 2J8UB 2EYSA 3ZT6A 5K9KA 1UA6L 3UTQB 2F5BH 4XZUA 4YDVB 4HH9A 3B83A 5FKPB 3VGHA 4OI9A 2ZUQB 3V5HA 3CFKA 1PD6A 1AJ7H 1TZGH 4DKAA 3JVGA 5GRJH 1LEIB 1JFQH 5EFIB 1SEBB 1C12B 1Q9WB 4YPGB 1CDBA 3QBTB 3PDOB 4MAYD 5DSCB 1GGIL 5JA8B 1DBJH 1Z9MA 3S88H 3L7EA 2M2DA 2D03L 3V52H 1X4YA 2HFGL 4ZPTB 1A2YA 4JRWA 4M7KL 1GXEA 4PJDE 4ZS6D 4NHCL 3NFSH 2HJLA 1A64A 2GJZA 2VSDA 5KVDL 4NZRL 3VG0H 4GKZA 4XC3L 1RMFL 2ITCB 1A4KA 3QQ4A 3BIKA 2B4CH 1UCTA 5GGSB 1A6WH 3MRIB 4UT9H 4G9DB 4P5TC 5E5MA 4ZDHA 2OZ4A 1AD0B 4MSWB 1UB6A 1JMZA 3H3PH 4YGVB 1FH5L 1FN4B 4OLVL 1A6UL 1NCWL 2C3GA 3L5WB 3WSQL 3SCMC 4WCYH 2VISA 1KUMA 5TQ0L 2B0SH 5F7MC 2CLVA 3VFOA 1MCRA 3ZLQC 4P2OB 2R0KH 3ZKXB 1K8IA 4JHWL 1EGJL 3RGVD 4I9WE 4V1DD 1XR9A 2H6PB 2ATKA 4ODSH 4JY6B 3UTZA 2J3SA 2PCPB 4ZPVA 2VL5B 5D7IF 1XZ0A 3C5ZB 1KCRL 2GT9A 5DJ2A 5HDBE 3TBWA 2V9RA 3UYPA 5FCUH 3CX5J 5D7IB 5MERA 2HT2D 1H3GA 4KY1L 3GJFB 3EFDL 5BS0B 2Q1EA 1D5IL 4CMHB 1GZQA 1FZJB 5FYLH 2VLLA 3WL9B 3BDBA 2I9LB 4JR9H 4AIZA 3LQZA 3R4DA 4ETQB 2JKXA 3E8UH 4IMLB 4PV8A 3Q3GA 3HI5L 4P2RA 4WDIB 4EXKA 1QNZH 3C60A 5DJ0B 3HZMB 5ALBL 3IKCA 4YFLF 3MRKB 1EXUB 4ONHA 3M17A 4PJBA 5ENWA 2X89A 3S4SA 4OI7A 3LS5L 1IC5H 4U7SA 1ZT7A 5EU6B 2EH7L 4LCIL 3IJHA 2FYYA 1RZIB 1QEWB 3ARGB 5C0AB 1T7ZA 1KULA 5FUCE 5IROC 2IPUG 3EOAA 3RVVD 3ALWA 4XCEA 3NGBC 1RZGB 1OP3H 1GYAA 3UX9B 1TJGL 2Q8AL 5HGGS 4AEHH 3KPRA 1IQDB 2UVFA 1U8PA 4L29A 4LFHD 3DLQR 4HW6A 3VRIB 4DN3L 3DX8B 3EHBC 1CTOA 3QNXA 1XFPA 1P53A 3Q2CA 4JRXB 5ILTL 3E6HA 4HXAL 1M05A 1YEGH 4OCLC 5J11C 4JREC 25C8L 3SDXE 4HWEL 4L4TD 6FABH 1ZA6A 3B9VA 1LNUA 4I77H 1Q94B 3MLVL 5EC2B 4P3WA 4GXVL 1HQRA 1IGFH 2QKIA 1XGQA 3VWJB 5I1LA 1F3JB 1P1ZB 3NAAH 4BK5A 5IMKB 4D9QE 1C5DA 1ZT4A 1R3LB 5JDSB 2ZUVA 1D6EA 1FJ1B 3MLZL 1KTDA 5C0IA 4QXGL 1FZKB 1YEEL 5DJCA 4IS6B 1BQHB 1RZJC 1KBGH 3NOIA 3UAJC 1CGYA 4NUGL 4V1DE 4WHYG 4J3TA 4WGWB 1KN2H 2AJSH 3QUYA 2IJ0C 1EEYA 4ZFOA 1FQ9C 4KJQD 4TUOB 3MA9L 4RQQA 3FTGB 1WITA 2XTJD 4F2MB 4DGIH 3H0TA 1DQTA 3TP4A 3X11A 3LEXB 1MHPH 5I1JL 4MX7B 1A7QH 5DQJB 1G9ML 4OLXH 4IRSA 1EAJA 1U8OB 2PKDA 4YUEL 3U9UA 1CQYA 35C8H 5EORL 1WC7A 5HYJA 1PKQE 2RHEA 2QQNL 4JFQA 1QRNA 3MRFA 2QSCH 1BQHG 4MJ6A 4DZ8B 3SDYL 3SE9L 4PIRF 1EEQA 3VWKC 1AI1L 3GMPA 1ONQB 2WP3T 5FF6B 5HYSA 1J1OL 3TA3B 3HRZB 4DCQA 2F9BT 3CC5B 2G60L 5JHLL 1G7LA 5EOTB 1I8LC 4PRID 3GMRB 3FN0H 1T5XB 5EBWB 2ED7A 1E4XH 3BP7B 3IETB 4YHZH 3WS6C 4J8RB 4Y8AA 4L3AA 5IB2A 4N0UE 3W81A 4AQOA 4MNGA 1TENA 4FQJL 4KRNA 4MA3B 1F3DJ 4NPYA 5KSVB 4PJXE 2IPTL 2R4SH 4XPBL 5IW1B 4HQQL 1MWAB 4HKBB 4LCWE 5E7BA 4EZMA 5LQBH 2CGRL 5T3ZH 3SDXA 4QCIA 1OP3K 5IJKC 3QISA 4KMTH 3VA6A 5ID1A 1XCTB 3L3OA 4FQXA 1MJUL 4CRPA 3AVEA 2Z4QA 5ECJE 3WNMA 3TZVA 1X5JA 4ONGL 1D5MA 5IK3A 1WF5A 5DS8A 1T0MA 1WAAE 2HTKC 4L4JA 4YH6A 3QUZC 1K5NB 2ITDB 5LGJA 1R5WA 3OPZH 1H5BC 1ZLSL 5I16A 4NKMA 5KSAD 1K2DA 2DQHH 5L6YL 3MJ8B 3PL6D 2BZDA 1NC2B 3X14A 4AIOA 1JZ7A 2HFEA 1FRGL 3U7WL 4NCDA 1R3JB 1DQLL 3QFDB 4PJ8A 4K7PX 4K8RD 3MUY1 5LAXB 1QYGL 4FFVD 3WUWB 4OQTL 2XTJE 5CP7B 1K6QH 5FYKH 1CVSC 1M71B 4HWBA 1JGLH 1FO0H 3GO1H 2Y5TA 4HEPG 3DURA 3EHBD 1BBJB 1P5UA 4K23H 4MB5A 2ZUSA 3SGJA 4OF6A 2YPVL 3MLRL 4J12A 3TWCH 2ADIA 4MGXA 1R5VA 1DTUA 5CD3B 4MJ5A 3HFML 1JPSH 1SY6A 3ULUD 4I3GA 4D0CA 4DK6A 5CJ5A 2OI9B 3CPLB 3ARBB 4R2GC 5CZVH 5BRZA 3V0VA 2C7UA 4NO2A 5HHMD 2VDNL 3WUWG 4PRIE 5CEZE 5FCSH 5T33L 4BFBD 4IRZH 3RIAF 2VDML 1J7VR 4Y1AA 2FNBA 1FHGA 2AJUL 1MCNA 4N0UA 1AKJB 3FQUB 3UAJD 2WBWB 4WGVB 2R1WA 1U2CA 1ETZA 2H32H 3HS0A 4PJAA 1IVLA 1WBXA 4GXUN 4NRZA 4BFIA 2ATPB 4H8WH 3PJSB 5ADPH 3WNPA 3NABH 5E8EB 1S9XA 4X4YA 5I30H 4U49A 1I1FA 1WIPA 4WFED 1IL1A 3V4UL 1ZHBB 3L5XL 4M6MH 1UACL 4WI3A 1WAAA 3OTTA 5EO0B 4PRBA 2I07B 5E03A 2D0HA 2ARJB 2NY4C 4F7TB 4IIQC 2LU4A 3O41B 1N7ML 4X9IA 4JKKA 2A9ML 1UH3A 2C4FT 3NTCH 12E8H 5TE7H 2VXQH 3A6CH 3KPSB 1MRDL 4JFPB 2XACC 2MCPL 5GGVH 3T77A 5DMIL 2IG2L 2XXCB 1BVLB 3V6OE 4P3CH 3ZE2F 3SGEI 5LGHL 2H2SC 3UDWC 4G5ZL 4I0PA 5KANG 3QA3B 2LTQB 1F4YH 1KLGA 5C0DB 4B5EA 1MHCB 1ZV5A 2FIKA 4HUXA 5KJRH 5AZEH 3VFUA 1NUDA 1FIGL 3T0ED 4Y88A 1IAIM 4F37K 1F6AB 4JO3H 2DN7A 5DJXB 5CD5D 5F96H 3T0VA 4UBDC 4M3JA 2CLRA 2QQKL 1JK8B 4NKIH 3G04A 1MFCL 4D9LH 3IXAA 1X44A 1U9KA 3ULUE 4XAKD 1QQDA 2XZAL 4JGJA 4BSJA 4X7EC 4YQXH 3L1OL 1JNJA 5HHME 3ZTNL 3QUZD 1IE5A 3TBSB 4JPWH 3BWAA 3G6JA 1YECL 1KIPB 1VA9A 1A21A 1ZKAA 5HI5D 3T1WA 3O6KH 4JZJC 4APQC 32C2A 4LRIC 1EGJA 3MYZA 4ZO8A 3AREA 4LSRL 1LO0H 3P3YA 1JGUL 3S35X 1A7BA 1U8IB 4GMTH 1LHZA 4JEGB 3QQNA 2C5DC 4KVCH 4LAJH 1NMBH 5J9PA 3K8MA 2IPKB 4JE4B 3D3VD 1WFTA 4X4XB 1AC6A 1NAML 5E2WL 5I75C 4N1HB 4QTIL 4XX1G 3U2SA 1YY9C 5C0GB 2R9HD 5IM7A 2YK1H 3VFWA 4IOFD 2VDKL 3GMOB 4NJ9H 1LK3L 4YXLL 4NKOA 3NN8B 2EYRA 2VTFA 1INEL 4HBQA 4ZSOE 2FX8H 3KYNA 4TNWK 4O51A 1DBKH 2AXFB 2LAAA 5FV2A 5T1DL 5IIEA 3JUZA 3PV7A 3LEVH 1OGAA 4ALAL 1T7YA 4ZO9A 5BW7A 3EYOB 4Y89A 3TT1L 1H3WM 5INDB 1ZA3B 4G7VL 1J1XL 4JO4H 5IHZA 1MCWW 4EDWH 3ARVA 1S7WA 1XIWC 3PXJA 3X3FH 4R0LA 1FDLL 2NY1B 4P5TB 4YE4L 2F53D 3CCHB 1DANU 3FB6A 3EDFA 4H20H 3GGWB 5C0EA 3GKWH 3JWOL 1LWRA 1JI2A 4EI5C 3QO0B 5ID0B 4DAGL 1G6RL 3CLEH 3PGFL 3MBEC 4P57A 5CJ8A 1QZ1A 3T0EE 4XP5H 1IKNA 1AXTL 1CF8H 2YBRA 2VUOA 4P3DB 3ROLB 3SCMB 3IDMB 1JRHL 3IJYB 4EI6B 1H3VA 3VRJA 2W59A 4UIKH 3IFLH 4GBXA 2VZOA 2W1NA 5SX5H 3VXRA 4HKJA 1CU4L 4YHYB 1MIMH 3QXAB 2MMXA 1EH9A 3JBG7 4F80A 4XAKE 3TBYA 1A7NL 3FCTB 5GRZA 4CJ1A 4PTTA 1ITBB 2FLBT 4MJ4A 4F7MB 4F15B 4GAJH 5E6ID 5HI4D 1MNUL 2NY4D 3K4ZA 5EC1A 3I3EA 3DX6B 3ZKSD 5KS9A 1U8HA 1RJLA 5BQ7A 3N1MC 3FRPG 5C09D 3IS0X 4U1HA 3P4NA 1FZMA 1IGMH 3D39D 5DD6A 1BAFH 2VXUL 1H8NA 3ECBA 4F33B 2FJGA 1P9MC 4M5YH 4PJ9B 5HJ3A 4BM7A 5A16A 4Y4FC 1F4WL 1D5ZA 3V2AR 1JWSB 1F42A 3D3VE 1RULH 2WIMA 1C5BL 5HDOA 1U8NA 1NGWA 2QLVB 4NQTA 1I7ZB 4KAQH 4OM0L 4R3SB 4EIGB 4GG8A 4GKOA 2P48B 2WNGA 1KTLA 2IH1A 1NBVL 3BPCB 4U3XA 3CZFA 2D0FA 2XRAL 3NGBB 3QEUA 4UBDD 4P59L 1JPGA 3WLBA 3H3BC 5D1ZD 5EOQH 2IQ9H 5JO5B 3RY6C 4C54A 4FTVB 4KK5C 4Y8DC 2VDPL 1T0PB 4XWGL 4JO2H 2EICA 3F12A 1HXMA 5HGDB 1H3UA 1EERB 3RWCB 5J11B 4EXPX 1VPOH 2F53E 2UZYB 2WWMD 5I8CA 4QLRA 1IT9L 4XMPL 5D7LA 4S0TD 5ITFA 4LCUA 3KYMA 2FD6H 2R8SH 5ICXA 5EZOL 3CLFL 4NO0D 1A6VH 4XH2B 2H2PC 4OZGE 4HUUA 4K3JH 4OD3H 1RIVL 3QXVA 3I3BA 3PDDA 1JTTA 4NRYA 4PR5A 1CTNA 4Z95L 1YY9D 5IGXH 4NQCB 5DYOA 5T5FH 4D2NA 2B20A 4AM0A 1VFAA 1A7RL 2BMKA 1BFOB 3ZDXF 1UM5L 1X5KA 3SDCA 4P4KA 1AGCA 5A2KH 1FNSH 2ADFL 3GSQB 5SX5K 1M7IA 2PF6A 1X5YA 3SQOL 3ARDD 4JFYA 2VLKD 3MNVB 1M7DB 4IBLT 1UM6H 1JNHB 5C09E 1XH3A 1L4IA 3WFBH 2BJMH 4HAFA 3ROOB 4WV1A 2VZSA 1IGIH 3D39E 5I66A 5EU5A 2P24B 1ZTXL 5T3XL 1KIRB 1YDPA 3VGGA 3K4DA 3PP4L 1XIWD 5DUMH 3VWKB 1NFDF 4OQTA 1G7PB 1W0VB 4JY4A 2D7OA 2BY2A 4NZUL 1WEJL 4J1UB 1JF1A 1NFDB 4CVZB 5AAWA 4D3CH 3OBAA 1J11A 3GRWA 3MBED 1IC7H 3T0DA 5SWZA 3R06B 5I1HH 1UEMA 3FN3A 3F58H 5ESVB 1G7MB 4NBYB 5CZKA 4FXKA 4Z7QF 3EYUH 5I17B 4XPFL 1FBIH 3CFJB 1A02N 1CDIA 4ODVL 4QY8B 1DEEB 4G42A 3D25A 4OCYH 5JNYA 3LDBC 1U93A 1HHGA 3GBLA 4M4PA 3UYRH 4G7YL 1JN6B 4YDJA 5I8EA 1WJ3A 5I0ZA 1Q72L 3EDEA 5IOPB 5JQHC 5I1CL 5C71A 1E6OH 2ZSVB 5D7KD 4OCRH 4LMQE 1VFBB 4CADB 1CK0H 2EXWC 1H5BB 2DLEA 4TOYL 1WZMA 5D2LE 3TJHC 1IMHC 1NGPH 4XAWL 4S1DC 3PG2A 3KS0J 4LKXB 3TLRA 3CGTA 3U0TA 1FNFA 2OS7A 2A6IA 2DI9A 1CT8A 2M8XA 4X99A 3VXOA 2EC8A 3BP4A 4U3HA 4ORGB 2Z31C 2X7LA 1FO0B 2WWKO 1WBYB 4N0CC 2VLKE 1CFQB 2R0LH 4KGJA 3C60C 2Z0BA 5DFVD 3ZDZE 1F8TL 3HC0A 4LP5A 3RBGA 5JA9A 5IB4B 1SJXA 5DJ8B 1NC4D 5F7HA 4LDOB 3IXTA 1CL7I 2AEQH 4FQQB 4G80A 3DGCR 3EYSH 1QACA 2HT3C 1HWHB 1YJDL 3BFOA 2VQTA 4HWZA 5DMJB 5FM4A 3B9EA 4O02L 4QXWA 4R2GB 3P30H 3STZA 3DX7B 3L3HB 4P46D 3RTQA 4C56B 1N5YL 1CR9L 3S34H 4Z5RA 1T2QH 1YEHL 2BDNH 1VGEH 4I18A 4NCC1 3WMSA 4XXCC 5B8CA 2H32B 4N8CL 3EO0A 2Q86B 1MCFA 4JFOA 1LO5A 4HZLA 1PAMA 3AU1A 5HXMA 2VN4A 1AFVL 5C0BB 1AC0A 2DM4A 4NRXA 4PJEE 4TNWF 4HKZB 2VXTL 5DRZA 2HKFL 4XGZB 4HIXL 3Q6GL 2BRQA 4JRYD 5F7EL 1B9ZA 4DK3A 3QIBD 4GG6F 2WLZA 5F1IA 3KPNB 3QXDB 1BJ8A 5J12C 5BV7H 1UJTA 4OD2B 4PJHF 3FHAA 3HNVH 4GG6B 2ARWA 3BESR 5C0ND 3SKMA 4HK3J 4PJHB 5FK9A 3T08A 2AKRA 2FJFB 3KPQB 2Z93A 5D7KE 2HT4D 5C0CA 3BXNA 5DK0B 3MJGX 1RZFH 1E4WH 3E2HC 3QUYC 3V0WL 4D0BA 1NAMA 2C3VA 3NIGF 4UT7H 4GRMA 3MBXL 4ZAKD 4K7PH 4X80L 3N85L 4MDJB 1UYWL 4PY8J 4YFDB 4Z76B 3B9KA 3IFNL 3PWJB 3IFPA 1BFVH 1CWVA 5DK3A 4CNIA 4OCSL 4JKPL 3SE8L 4ODHH 5DXWA 5E1AB 1NCNA 3DHMA 4R6UA 1CYGA 1NDMB 3WIFB 5AYUH 2D3VA 1GC1L 3HHRB 4CKVX 3U48A 2IFGA 1MSPA 5GRWA 3X3GH 3PP3H 5E9DD 3DYMA 1NBZB 3ALPA 5FO9B 3O6FB 2W9DH 3HG1B 4KK8D 3C2AH 3HNTH 3WIIH 1PLGH 5C7XH 1J0HA 5I6XC 1MELA 2OTWB 2B1HH 2XOTA 5C0FB 2XKNA 4W4OA 2EDHA 4HCRH 4OD1L 5D70L 1QKZL 1KIQA 1G6RA 3ALXA 4WI7A 5E1HB 4R8WL 3TO4A 3R0MA 3QFJD 1ACZA 3PGCA 2EXWD 4G8EA 1FFOA 5GISH 2CRYA 3OF6A 3TJHD 4KQ4L 1U0QA 4JZJB 4XCFH 4APQB 1EUTA 3CDGB 5EN2B 1YN7B 1A14L 4LGRB 3X13B 5ABDE 2V2XB 1KC5L 3RWGB 2VQUA 4NGHH 3PGDA 4I13B 4OZIA 5EBLB 1CFNB 4I2XE 4FQXC 4JRYE 4K9EL 4E5XA 5GJSL 3NACH 1ADQA 2OK0L 2VABB 3TZVC 3U7YH 2XWTB 2Z31D 3QPXL 5FYJL 2ID5A 3D9AL 1OF2A 5GHWH 4MCZB 5CJQH 2XWBB 3UJIL 4OB5L 4LKCA 1G7JB 5ESQB 1L7IL 4I5BA 4ZOCA 2VJXA 3LKPB 4FZ8L 3S37H 4U6XB 2GJJA 2ENSA 3OGCB 4OZFH 2QHRH 2OL3L 4HS6B 3SKNA 5LCVH 3TPUA 3W11C 4CN1A 5EU4A 1MFBH 4PJ8C 2O61A 5SX4I 2IC2A 3OAZH 5L7XL 2OR8A 1X4XA 3P9MA 2UYLB 1OW0A 3I75A 4BJLA 1T03L 3N1QC 3QDJE 3W0WD 1A3RH 1EK3A 4ZTOL 1MHEB 4C57C 4M9PA 1ZS8A 3HI1B 4J7RA 2EDQA 3O3EA 3D48R 1CIDA 3V5DA 3WBDA 4PGBB 2JJSC 5FHBH 3ULVC 3BHBA 4U1NB 1UJ3A 3PHQA 1U92B 5ERWB 4EI5B 1SM3H 3SGJC 4FOMA 2CO7B 1I8MA 3EUUA 4JJHA 5KVMC 4FQHA 4TTDC 1BECA 4NWTH 4HULB 4AJ0A 15C8H 4ETYA 2QJDA 4ZUTB 2ZCHH 1CLOL 4N68A 5E9DE 3T8XA 1ZT1B 1MFEL 3SBWA 4BQCA 4XVUC 2D9CA 2NCMA 4XBPB 3AMKA 4YHNA 4MNQB 1AQDA 1IAII 2BNQD 2DIBA 4LLYB 5J13B 4UINH 3RDTA 2Z8VC 3VXNA 5L2JB 1YNKL 4NO5B 3PP3K 2AEIT 3IDJB 3KLHC 2FX7L 1RUKL 3QFJE 4HIIA 1RJCA 4IOIB 4DJMA 5C8JB 3DI3B 1H3PH 5JHDA 4PJ5A 3MXWH 4HUVB 2DQUH 5BOZG 3S35H 4DZBA 4U1MB 5EZLA 4Q9QH 1CZ8L 5HHOB 2BXYA 4Y4FB 3HPLA 5I15L 1VENA 3U0PA 3PWLB 4P2QB 2NY5L 4P9ML 3MODL 1D3CA 3OJMB 3EW3B 3O2VL 3QIUD 2EXYD 3MOBL 2L4OA 3K2UL 2V2TB 5HYJD 2XA8H 5TPWH 3ARSA 3ETBF 3BEWB 4HF5L 5DI8B 3CXHJ 3V7AE 3P4OA 5GZOD 5I0DA 4FG6C 4MD0A 5C2BL 4O58H 4M6AA 4L8SA 4JZOA 1RUMH 4Y19B 3K81A 1SJEB 3MR9A 3U6RB 3QDJA 4I0PC 5KAQF 2NLJB 3MYJA 3MRJA 4N0RA 3W0WE 4JJ5A 4M8VA 1N6UA 1PG7X 3EJYD 1ORQA 1HZHH 3RQ3A 4M7JH 3FQRA 5DWUL 3OAZK 5JUEH 4Z18A 4WTZA 3VXUA 3C6SA 3IU3A 4MQ7B 1YNTA 2J12B 1J05B 3ESVF 4YNYA 5DJZA 4RFOL 4KK6C 5BJTB 4LASL 2AABL 3B5HA 2X41A 5CGTA 2YSSB 4B7LA 4D8PB 4WFHD 5D6DC 1U3HA 2UY7A 4X6BA 1KG0B 1T21B 4P5MA 2DQJL 2BP3A 5ANMA 3TZVD 2C4FU 2G75B 1BJ1J 2YPLA 1QRKA 4P2CG 1IGCL 4JPKL 3AS1A 2BNQE 4YFEA 4PREA 2AEPH 1K8DA 3RZCD 5KAQG 1EBPA 3MUJA 2YC1A 3AGVA 5LKNA 4UOW0 5CEZH 2NXYD 1XCQA 2FATL 2VB5A 5DJDA 4LQ1A 3VE0A 1KJ3H 3V95A 2MPAL 3W11D 2X4NB 1F11A 4JHWH 3AFLA 1EFXB 3K7UA 3BKMH 5BZDB 3QJHA 5H35B 2EYSB 3CU7A 1U8JA 3K80A 5EULV 5K9KB 1NMAL 4XZUB 5J3HD 4XMLL 3NH7H 4HH9B 1TZIA 1CXIA 4U6VH 3BOVA 1CDJA 3V5HB 3CFKB 3ULVD 1RD6A 2PETA 2OQJA 4U6YB 5TE4L 1QBAA 3L7EB 5FM8A 4LPXA 3PNWA 4FQ1H 1A2YB 4G8FA 4LLUA 4OZHE 2DQGH 5E08L 2CR3A 5J7CC 5BW7C 3QRGH 2X9YA 2HJLB 2GJZB 4M00A 3IDUA 4GKZB 5D2NE 3DYOA 3Q0HA 1A4KB 2EIBA 2BY0A 2V7NA 3BIKB 3QQ4B 4Y4HC 2DLGA 4R0LC 5E5MB 3VDBA 5JR1L 1YYML 4ZDHB 4PRAA 4K8RH 1SJHA 3INUL 1UB6B 4S1QH 1KCUL 1IM3A 3VGAC 2R2EA 3TFKD 1J8HD 1KB9K 3KLHD 4CVWA 2DIAA 1KPUA 2Z8WC 4LSUH 3VFSA 4OLYH 3RWJA 5JOPD 1TJGH 2VISB 3I6KA 2CLVB 3VFOB 3ZDYF 2GTZA 1FSKC 2DYPA 3DBXA 2Q8BH 2ZCLL 3KPOA 2DKMA 3MCKA 5F1OB 1K8IB 3S96A 4DN3H 4WFHE 1I85C 1XR9B 2ATKB 5KW9L 3DMMD 4LLAA 3UTZB 4ZPVB 1NSNH 2HJFA 1YC7A 5ILTH 1XZ0B 4J4PA 4KRPC 4JO1L 2GT9B 1D5BA 5DJ2B 5CIPA 4LGSB 3TBWB 4S0SD 4CVUA 2OR9H 3TNNA 5MERB 3WN5A 1INDL 1MRFL 3FO2A 1GZQB 2MQ0A 4CN6A 4Q2ZA 3RVUC 2VLLB 2X70A 4AIZB 3LQZB 4ZFZA 3QXTA 3D69A 4PV8B 3Q3GB 4P2RB 2CJUH 1AGDA 3P0VL 1QO3A 1AHWA 3GMNA 3C60B 4PJBF 1FL5A 3IKCB 2E27H 4LMQI 2LVEA 2W0LA 4ONHB 3M17B 4PJBB 5ENWB 1IGTA 1EBAA 3S4SB 3H42L 2JJWA 1ZT7B 1I1CA 4EVNA 1KELL 2AK1H 3IJHB 4RIRA 1G9MC 3IF1A 4JAMA 4JN1L 3EOAB 5L2KD 2VDQH 4KK6D 4XCEB 4F9PA 5FM5M 4M93C 3CX5K 3KPRB 1U8PB 4L29B 2ZCKL 4BZ1L 1MFDL 4ZUSA 3CFEA 4P9HH 3QNXB 3PWUA 1BJMA 2YD8A 4Q0XL 5KSUA 1QBLL 3E6HB 1M05B 4TRPL 1DR9A 3S4SG 4LBEB 1ZA6B 5HVFB 1LNUB 2XZQH 3MCLH 3KPMA 5IBTH 5IF0A 3MLYL 1J1PL 5AD0B 2QKIB 1GIGH 4M1GL 1JPTH 1J8HE 1XGQB 4QHMA 4FHBD 5I1LB 1V8HA 5GS0L 3A6BL 4YWGH 1C5DB 3QUXA 5JOPE 1D6EB 1KTDB 2CMRL 2CSPA 5C0IB 4L3ED 5DJCB 3T0BA 5E2TH 1H15A 5EBMB 4E9LA 4FN0A 2AXGA 2AJZB 4NT6A 1MPAH 2IPTH 1OTTD 4HT1H 4PGCA 4LSTL 4LRNL 4PGDA 4Q97A 4ZS7L 3QUYB 3BT2H 5HVHB 2ESVD 1EEYB 4ZFOB 3SDCC 4P4KC 1EMTL 2P45B 4WO4D 4RQQB 1LDPH 3H0TB 3X11B 2XZCH 4G9FD 2DQFA 5A1AA 1T2JA 4FQ2L 3DROA 4LCYA 2GITA 1WFUA 2P1YA 1DSFH 4IRSB 1A6TA 1AY1L 1UWXH 2VWEC 3U9UB 1IC4H 5IVXE 2BNRA 3LKSA 1WC7B 3BIBX 3RL2A 4XNUH 4JFQB 1QRNB 3MRFB 2D2OA 4HGMA 1FP5A 4Y4HD 4MJ6B 5DD3L 1ZANH 1M7XA 3U7WH 1FRGH 1QSEA 4R7DA 5JPMA 2H9GA 3GMPB 2JB5L 2K7PA 1PW3A 5HYSB 4Q74A 1OM3L 3ARPA 4DCQB 5IHUH 1PKOA 4OT1L 4JFDA 3MV7D 1G7LB 3ZKNC 5I6XB 3LV3A 3K8KA 5L2KE 4HJGA 3DV4A 4W6WB 2PR4H 2X1PA 5F44A 3FO9A 3GRWH 1YA5A 5DJ6A 4XBGA 1D9KC 5IB2B 3OZ9H 4MNGB 3MV8D 2DMBA 2YPVH 1CE1H 4QHNA 2AK4E 3SDXF 4NPYB 1NMCC 2FB4H 4KJPD 3PWPE 3Q5OA 2EE9A 2DQIL 3SDXB 4QCIB 3RNQA 5E8DL 2UY6A 3AUVA 5A3ID 3L3OB 5FXCH 4FQXB 5HYSG 5A2FA 1CICC 3RVUD 2Z4QB 4YEFA 2VDNH 3TZVB 1D5MB 5IK3B 5B3JF 2X42A 1TVHA 1MWAL 5DS8B 1RU9H 1T0MB 4NN5B 3SE4C 3UBXA 4RAVA 2J88L 5F7DA 5C08A 3GI8H 3OKDB 5LGJB 1R5WB 3MLTA 2ZUYA 2PTUA 4L3EE 4HV8A 4U1GC 5I16B 4NKMB 1K2DB 5D1XA 1NBYA 1OAQL 1RUPL 3SOBL 3X14B 4WUUA 1CGSL 2HFEB 1PFCA 1T1YA 3SJVA 5BVJA 1FL6A 4PJ8B 3BN9D 3DUUA 2ESVE 4AZ8A 3RVXC 1PYWA 3VXTA 4LCCA 1W0WA 2H26A 4G9FE 2XFXA 2BK8A 5EH1A 5EU3A 3QUMA 4OFDA 5HY9A 2Y5TB 2IEPA 1Z3GH 3DURB 3DVIA 5AAMA 2EYTA 1YMMD 1OAZL 2HVKA 1IEBA 5CLTA 3S6CA 1JGVH 3SPVA 3TT3L 2ADIB 4XP4H 3WJJC 1MRDH 1CXHA 1R5VB 4XPAH 1G1CA 4N8VA 4MJ5B 2ICWJ 4AMKL 1CFTA 2AJYH 4D0CB 2OJZH 1G7IB 1UWXK 5BRZB 2VRAA 1C8PA 1I3VA 3V0VB 2C7UB 4GRWE 4NO2B 3MV7E 2E9JA 1FLRH 3KR3L 4X6CA 3NZ8A 4I18C 2WW8A 1UZ6F 4Y1AB 3EDDA 2OTUA 4N0UB 4PRDA 3UTSA 4PJAF 4YO0A 4PG2A 2JELL 1PSKH 5E24E 5CUSL 5LJYH 2WUBL 2R1WB 1ETZB 3MV8E 3HS0B 4PJAB 2AK4A 1WBXB 3MGAA 1DBAL 4NRZB 3PWPA 3M1BA 4LCWB 3SHSA 2FR4A 1UB5A 3LIZH 1IQWL 3RWDA 1R3IH 5C6TH 1OWWA 1E6JH 1JTOA 1S9XB 1X3DA 4X4YB 3QCTH 1GGBH 1WAAF 3EO1A 1I1FB 4PJ7E 1IL1B 3U4EA 1NLDL 3QEHA 2GI7A 4YAQA 1CBVL 3UC0L 1EA9C 4Z7UE 4PRBB 5EA0L 1HH9A 4WI2A 4MA7H 5T1LA 2ZUXA 5M7QA 3ISWA 3TV3H 3F6LA 4C4KO 3TN0A 2RCSH 3QHZH 3TH2T 1RUQL 1ZLWH 3T77B 4IDJL 5DO2D 5FUZH 4TSBH 5FOBA 1NAMH 5E2WH 4Y4KD 3ZKND 1ZSDA 3B9KC 1JF5A 1MHHA 1H0DA 1ZE3C 4QXUH 4I0PB 4L4VA 1LMKA 1KLGB 4L1HA 1T4KA 3RP1A 1D9KD 2FIKB 4M7LH 4HUXB 3WJLA 4Q6YA 4OI8A 4AG4L 3NA4A 3SDDA 3T1FA 1I3GL 4OFYA 5AWNL 3UJJL 1C12A 1YMME 2VAJA 1IFHH 5J6GA 2CLRB 3VD3A 3NA9L 1OSZA 4LP4A 1LP9E 5C07A 4AENA 2XICA 4TNVK 2V17L 4HLJA 3G04B 3TYFA 3S36X 4BFGA 3VFGL 4XNXH 2EIZA 4HDIA 1CICD 3C9NA 1FE8L 1U3YA 1QQDB 1MY5A 4LEXL 4MQTB 4NCC2 4W4OC 4RZCA 1EZVX 1T66C 3RNKA 2YMXL 4M48H 1KCKA 3IAGC 2LFGA 5HHXH 3TO4C 2E7LA 1DBBH 2ZKHL 5CKGA 4CVXA 2C3WA 1S7TA 3BWAB 1FVCA 3DVNA 2W0KA 4XXDA 1N64H 32C2B 3HR5B 4WEBH 2DQCH 1HHKA 5D96B 1VDGA 3AREB 2KL6A 2GIYA 4MQSB 4TVPL 4JGUA 5IFAL 5J9PB 4X83A 5J4MA 1ND0A 1GGTA 5IESH 3RVXD 1WZ1H 5IM7B 3U2SB 4Y2DD 3PQYA 3VFWB 1I1AD 2X09A 4DEPB 1U8MA 3VXSE 1HI6A 1ADQH 3MJ6A 2VL5A 4NKOB 2F5BL 2H3NA 3D0VA 2EYRB 5DUBA 4ENED 1TZGL 1AJ7L 3GK8H 2ZOKB 3QXWA 3VRLE 5GRJL 3KYNB 1MJJA 1JFQL 4D9RD 4O51B 4J2XA 5IIEB 1IAMA 3HE7A 4K3DH 2F54A 4DVBA 1OGAB 1NQBA 1DBJL 3S88L 4ISVA 3V52L 5HYIA 3FAXA 5F7KC 4JFFD 3ZE0E 1OW0C 4YR6B 5IHZB 1QOKA 4XP9H 1S7WB 2PYED 3NFSL 1UG9A 4R0LB 1JPST 1UWEH 4PY8I 3VG0L 3FB6B 4LVEA 2AXJA 2B4CL 5TDNA 5EB9A 1A6WL 2G9HA 3CAFA 5C0EB 4UT9L 1HHHA 1ZLWK 1A3LH 1E28A 3TVMA 4XHJD 3WUZA 1MF2H 1K9TA 4P57B 2Y06H 4NNXA 3H3PL 3OL2A 2YBRB 3REVA 1OB1A 5F8RC 1MLCB 1NDGA 1G0DA 3VRJB 2D7NA 4DOHB 1FSKB 2YWYA 3A6OA 4GBXB 3IYLW 2VDPH 4WCYL 4UQ3A 3VXRB 2B0SL 1HH6A 3SBWC 4HKJB 2FJHA 4ZNEE 2P5WA 3VRIA 3TBYB 4KRPB 4WI4A 5DK2B 4PJFE 4YBQC 3RDTC 4XVJH 5CEYA 3H9SA 1XR8A 4ODSL 4PTTB 1I4FB 1HYSC 4XMPH 1RHHA 4L8CA 5FCUL 5EC1B 1X4ZA 1H8OA 5D7JA 5EZOH 1U8HB 3F7YA 1RJLB 5BQ7B 1IM9D 5FYLL 4U1HB 5B22A 3P4NB 1FZMB 4JHAH 4JR9L 1GSMA 4NQED 5DD6B 2XWJA 3ECBB 2FJGB 5JDSA 2OTPA 3E8UL 5HJ3B 5A16B 2PXYC 2DAVA 1D5ZB 2V9TA 4GQ9H 1C16A 4Z0BH 2DWEB 5EU7E 1U8NB 1NGWB 1QNZL 3N9GH 4Z0XA 3FB5A 4POZC 3VA2C 2MQCA 4AL8L 4PJCE 4GG8B 1X5FA 3O9WD 4M1CD 1IC5L 4HJ0D 1KTLB 2IH1B 1KYOJ 3BGFC 1UT9A 3SQOH 1I7RA 1U6AL 3CZFB 3QEUB 3SQBA 1JPGB 3WLBB 4GLRI 3CX2A 4D9RE 3QQ3A 4M93B 4I3SH 4JDTH 4TQEH 5HDLA 4L8SC 5F88A 4AEHL 5IR1B 3SY0A 4JFFE 5JXEA 3B6SA 3F12B 1HXMB 3JWNC 2PYEE 2J6EA 1WV7T 5FV1L 5K93A 3ESUF 3MRRA 4XBEH 1CFBA 4DZ8A 4M03A 5I8CB 3BAEH 3VI3F 4UDUA 3MRBA 4P23A 5CWSA 5D7LB 5ITFB 4LCUB 6FABL 3KYMB 1XF2A 4I77L 2A6KA 5ICXB 5F93C 2YUXA 4HPYH 1PX3A 1IGFL 2VLJA 3T04D 2BY1A 1LO3H 1AP2A 1U3HC 3GEWB 3NAAL 5EBWA 4L9DA 4HUUB 1QUNA 1MCOH 5TF1H 4NRYB 5KTEH 4PR5B 4UIMA 5FKAA 1KEGH 5HGHA 1UZ8A 4AM0B 1KBGL 1VFAB 5F71A 2JF1A 2BMKB 3C5SA 1GH7A 3SDCB 4P4KB 1KN2L 1MWAA 1AGCB 2AJSL 3E3QC 4O2FA 1P7QD 5I8OH 5D4QA 3V6ZA 3RZWA 1M7IB 1I7TA 1TTUA 3O8XA 1BD2D 4LLVA 4JFYB 2H1PH 5DZNA 3O3UN 2J7LA 1NBQA 3ILQD 4DGIL 2GSIA 2QTEA 3BE1H 1XH3B 1MHPL 2N56A 4JPVH 4WV1B 4NQEE 5I66B 5EU5B 1A7QL 1YDPB 4OLXL 3KS0H 4X4ME 3CUPA 35C8L 4E41A 1I75A