3ZL4H

Antibody structural organization: role of kappa - lambda chain constant domain switch in catalytic functionality
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
231
Chain Sequence
QVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTQSSHNDANWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCLAMDYKDHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A17 ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Role of Kappa>Lambda Light-Chain Constant-Domain Switch in the Structure and Functionality of A17 Reactibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zl4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zl4H01
1AHWA 5CHNB 1T5WB 3P40A 4FFYL 2PN5A 4P2QA 3NAAL 2X2YA 4YHNA 4MA8L 5GGSA 1OTSC 5IWLC 4BZ1H 1QRNE 2AQ1A 4ZTPL 1W72H 3STLB 5F9OL 3U7YH 5C0DB 1JHLL 1IGCH 2X4OA 4UU9A 4K8RD 1XZ0A 3L3OA 4OBRA 5D9SB 3G6DH 3BD3A 3TJEH 1R0AL 5CGYC 5F6IC 4RAVB 5DUPL 3DYPA 1WWWX 5I6XC 2I9LA 1A5FL 4MAYB 2NTFB 3C08L 2GFBB 2R15A 4RISL 1I8KA 1RZFL 4BSVB 2PTUA 2R1WA 5K93A 2VNCA 1QFPA 1RMFL 3FFDA 3DBXB 4OCMC 3TN0D 2ITCB 1QR4A 1MHPH 4KHTH 4BFBD 5LAXA 2DMBA 1LEGA 3FO0H 2YZ8A 1J12A 4JREC 4PJCF 3VA2C 5FV2A 4JPVL 1IILE 2G60H 4M6OL 5GZOC 5D6CB 2D2OA 1W72A 3HCVB 1OTSD 3DV6B 3AS3A 2BZDA 3T04D 1HQRA 4O58H 3MMEA 4OCSL 5K9JL 5E9DE 4P3WA 2HKHL 1KIRA 5DI8A 4PLJD 5JDSB 4JFHD 2CDEA 4FQLH 2ZUVA 4NT6A 1S7XB 2IBGA 3T4AA 4L3AA 1EEYB 2WLZA 5C08B 2IH3A 4FMFA 3BRFA 3VMOA 4P59H 4F7TB 1KYOK 4XWGL 4CU6A 1D5XA 5C0CA 4M61B 4Q6IB 1ZK9A 5CEXA 4DZ8A 3ZT7A 2YD2A 3H9ZA 1XR8B 3S34L 2CGRH 5HGHA 5D72L 1D6EB 3TA3A 1LO2L 4HKJB 4WW2C 5CJQL 3TWCL 3VMPA 3R8QA 3UTOA 1PX4A 4OKVB 4HS3B 3MRKA 2A9MH 1G0DA 1IBGL 4MXWH 3F7RA 5TPWH 4YDLC 1G0YR 3UTPD 1NUNB 5K9KA 5I75B 1C7SA 1NSNL 3QUZA 3QO1A 4D3CH 2W65A 1RZ8A 3HRPA 3F7VB 4H8WL 1VESA 2VDKL 5GGUB 3WSQH 4V2CB 3QIUB 3A6OA 5AZ2H 3MTRA 4PGCB 3HZVB 2CLRA 2FH8A 4DN3L 3LS4L 1SMOA 3UBXB 4R3SA 3L3HB 3SDDB 5HHXH 5ITFA 2BNRE 2WQ8A 1BIHA 1WBXB 3ORJA 2WBKA 4XHJD 5DEFA 4EUPB 2P8PA 1UZ8A 1A7PH 1EV2E 5DRXB 3VH8G 4CMHC 1ETZB 1BBDL 4P4KC 4NBYB 3CSPA 5T33L 4OI8A 4KI5E 5E94A 4LPCA 3RKDD 5EIIB 4DUXA 3RTQA 1HHIA 2HH0L 4J3OC 4QF1B 1NMCB 1WCBA 2D4FA 3B6SA 3WFCL 3PGDB 3V4UL 3D3VA 4LGPB 4PRAA 5MI0B 2YD5A 4CVZA 4GRMA 1FZMA 5SWZD 4M7LH 5IJVB 5C09B 4E42B 1A3RL 5I30L 1QUNA 4OV5B 4CNIA 5KN5A 4HIXH 1CICA 1HKLL 4NC0B 5LBSH 2VZUA 2X41A 1RZKC 1TQBB 2X10A 2Y7QB 5DJDA 5MEQB 5TDOB 1CD0A 1CR9H 3M17B 2NMSA 2J8UB 3O3BA 1IAKA 2BHUA 1AH1A 3VWJD 2FO4B 3UYRL 1JGEA 4JFYB 2B5IC 3GIZL 5DD3H 4W4NA 4Z6AT 3O3AB 2X4UB 4NZRH 4ELMB 4DKEL 1J1OH 1ZA6A 3O3DA 2Q8BL 4POUB 3VXRD 1A8JH 3CMGA 4Z7UF 5EBGA 3O2WL 4OUUA 1OAUL 1OAYH 2VABA 5JMOC 2MCPL 1D6VH 1UXSB 1J05A 2XQYK 2E7CA 4HKXA 3UJJH 4YZFF 5TFSH 4OZGA 1G7JB 5B8CB 4XCYB 2XY1A 4FQ2H 4HPOH 1QHOA 4OFIA 4HXAL 3BPOC 5M7QA 4PRBB 4P2RA 5AZEH 3GBMH 2VL5B 1K3IA 1MJ8H 3NFPB 4HC1L 5CS7A 3BWAA 2R9HD 3S35H 2R0WL 4Y4HC 5I8EB 3PL6C 2OJEB 1KBGL 5FECA 2J3SA 2VC2L 2BOBA 2CRMA 2ARWA 1OOAA 3VFOA 2P5WD 3WE6B 4M1DH 3WN5C 1WEJH 4ENED 5E6ID 4PJ8A 1SQ2N 1OF2A 3IDGA 3LZFH 1HN1A 2B20A 1NJ9A 1G9NL 4GKNA 3LEVL 4MCYB 3DSFL 4MGXA 3IFNL 3ES6A 5BW7A 3UTTB 3QG7H 3C5ZC 5F7HA 5I71C 2WNGA 3K46A 2A6IB 1FL5B 1GHFH 1NKOA 3FFCA 4I0PA 4ETQB 3CAFA 1R3HB 2C1OB 3EO1B 2YOCA 4OF5A 1FJ1A 1J0IA 2XACC 2F5BL 5HYJD 3F12B 2BJMH 3REVA 4LLVA 3QUXB 3L5XH 4LHUB 1NGWB 2C3HA 2R0KH 1A14L 1AD9A 3HZKA 1U95A 5FYKL 5IBUB 4J7RA 3ZDZE 4D0BA 2ADIA 2VWEC 4EI6A 1VEMA 1T2JA 3MV7B 1RUMH 3QIWA 1IKFL 5DJ8A 4IOSD 3LRSB 3P77A 4PJ7B 1IGTB 4TPRH 4LAQL 2ADFH 1FBIL 1IGIL 4HQQH 4PRDB 1G7QA 5T3ZL 3CZFA 3MRPA 1R5WA 1CXFA 3SPVA 1DFBL 2P5ED 5SX5K 4HIJB 5I2IA 1AGFB 3AREB 3VXPB 5FYKD 3V5HA 1CU4H 1PKOA 3CVHL 4O2EB 2BSED 4XNQB 3WFHA 3O45A 1KLUA 4Y4FC 2IMMA 5DS8A 5DGRA 1CXIA 4F7MA 1I9EA 5ISZD 4YBQC 1CFNB 2EH7H 5E24E 3O9WD 3VFSA 3DETD 5D2NC 3WBDA 1D5MA 4UV7H 2BC4B 5BVPL 5T3ZD 4WU7A 1F58L 4GKZA 5F1KC 3VE0A 3W0WB 5DZOA 3R0NA 3KPRE 5TE7H 4OFYA 2Q86B 3VXMA 2Z91A 4FTVA 4LCWD 5CP7A 2B4CC 5CZVL 4Z78A 5BOPA 1TJGL 1E6JL 4FQPA 5EWIH 2ZCLL 3T2NL 5FCSH 4DWHA 1XR9B 1D5ZA 1OSPL 4X6CB 2AV7B 1AXTL 2IANE 4Y0GA 2RIKA 1GGIH 2DLHA 2NY6B 5I8KL 3EZ8A 3GNMH 4CVXB 1EO8H 1QRND 5BZWA 4JFZH 2WBJA 4ZD3H 2FGZA 5J13B 5IHZB 4C83A 4DTGL 5C0GB 2D7TL 1U8JB 4Q6YA 2BDNL 4WI7A 3T0WA 2P42B 3W11D 3AS1A 4Y5YB 2FEDC 3TO4D 1U8IA 5I1LA 4YQXH 5GGTL 3OSKA 5CWSA 5J57B 3KPSE 5IT2H 5A16B 2VDLL 3V95A 1J1XH 2HN7A 2OTUA 3GJFB 5FM8A 2XKNA 4K9EC 4PJGB 3LKOB 1XF3B 5BJTB 1T0NA 5DQ9A 2QQKL 3EJZD 2HJLB 5I1EH 4J6RH 2NY3D 4J23A 5LQBL 1FE8L 2RHEA 5FDWA 5T1MB 5AUMA 5IB5B 2E27H 4GAFB 3TO2A 4X5LA 4WCYH 4L3EE 3R8BB 3T3PE 4LCCC 3WJJC 3MYJA 4YFLI 5I76A 2EH8H 5A2FA 2AJUH 3BIKA 3TVMA 3ULSB 5FUCE 2AEIT 4OIBA 1N0XH 4R96B 1EEUA 3EBAA 5ABDE 3FL7A 1DQJA 4H25B 4E0RA 1M7DA 4NO5B 4QXUL 5E1AA 5E9DD 4FQJL 1D5IL 1EJOL 3QFDB 2LAGB 1TZGH 1CK0L 3L3IA 1HYRC 4MVBD 1INEL 5EUKB 4OZFG 1UCBL 4IEFB 4IMLA 2ENYA 4JDVB 3W9EA 2BSSB 4OM0H 5IBTH 1P4IL 1H3GA 2Z93A 4U05A 3D0VB 2AXGB 4N5ED 4OFPA 4R4FH 2H8PA 5INCB 1C5CH 5IESL 3X11B 4ZUSA 3RDTD 5EZLA 1U8MB 1DQDL 1MFBH 5DLMH 1KXTB 2BVPB 4Z95H 4ZFGH 1RJYB 5J6HB 1KJMA 3N1PC 1G7MB 4MNGB 2XZQL 1WBYA 4KI5F 3V5DB 3OTTA 4WI4A 4XVSL 2VN7A 3O2VL 4X98B 3BMVA 1UWEL 2X9WA 3BHBA 3OKMB 4JPWH 3V7AE 2UZIL 4NYLB 2BRRH 1GL4B 5DSCB 4PRHE 3LSOB 3BDYH 1T1ZB 4M3KB 3O4LE 4FG6D 4YPGB 3RX5A 1DQLL 4N8VB 4PJEA 2I60L 4PJFB 1ONQA 3HFMH 2F5AL 1T7ZA 1T5XA 5JW3H 1OQOA 1QBLH 4CN6A 1ZT4A 1N59B 4PREA 1NGYA 1W8NA 2QSTA 3EYFB 1U8OA 4ETYA 2NLJB 1ORQA 2BNRD 1MCFA 4NGHL 1G7HA 4QRRE 4PRNA 4OF6A 4NP4L 3RNQB 2YPLD 4KDTC 3W2DL 5JQHC 4KI5D 5EZOL 4NZUL 2Q8AH 5C9JA 1N4XH 4K3HA 4XPFL 2NYYC 3CVIL 4HEPG 4K3DL 4LLQA 4GOSA 3N1MC 1LO4H 2GYSA 4X4XB 1N2RB 5DJYB 4OBSA 1XGYH 3Q6GH 5ANMA 4JG0L 2XA8H 4WFGE 1R24B 1OB1A 1IM3B 2BX5A 1Z9LA 3RVWC 2YA1A 4MJ5B 4UUJA 3S97C 3FZUC 3HE7D 5HI5D 3U46A 3GSNH 2VLME 4KPHL 2XNAB 4HMDA 3DXAE 4LHQB 3HS0A 5IFHH 1MCHA 5JPMA 4S1SH 1JPFA 3KPPB 5FGCB 4NQCE 1A2YA 1DVFB 1DBBH 3EGSB 5D7LE 5F9WC 5H35B 4KK6D 4NNXA 1XGRA 3C9NA 1QSED 2XQBL 4I9WE 5C0AE 4ZFOA 2NY1D 3DYOA 2DKSA 2QEJA 3RWHB 1BVLA 1J8HB 2XY2A 4P2OC 3VFWB 5E5MA 1ZS8A 5EBMB 1YYLH 2NYYD 3HI1A 1LK2B 4HS8H 1T20A 3QXWA 4YGVA 4F8TA 4OKDA 2AEQL 2B1HH 3VD7A 1JUFB 3BD5A 1EUUA 3O6FD 4DAGL 1DANU 3QPXL 1YEGH 4F9PA 3I9GL 1HEZA 1ZAGA 4K3JL 5DVMA 1PDKA 4OLZL 3VXNA 3GHEL 3VXSA 3QJHB 5D7SL 2V7NB 2F58H 1EAPA 3WYRA 1H8NA 3IVKB 3LKSA 2O61A 5BZDB 3P0GB 1XT5A 3U82B 1G7IA 3LKQA 1VPOH 3P11L 5HTSA 1GVIA 1ADQL 1QLEH 3W5NA 4Q9RL 1HCVA 4FQXA 3IJYA 4OGYL 1GGBH 3IGAB 1BFOA 5CFHA 2ATKA 5GRJL 3MCKB 4Y2DA 3KPOA 2OMNA 4BFEA 2DD8H 3MOQA 1QBML 4H5SA 3MRHB 3BPCB 4R26H 4NN6B 1QA9B 4PV9A 3TBYB 1KIPB 5FA4B 5J89A 5KS9A 4DGIL 1OGTA 3X13B 2DLGA 2GSIB 1UKQA 1BJ1H 1LO0H 1FLRH 3V6FA 4ZYKA 1F97A 4PV8B 4MLSA 4WHYG 2Y1VA 4J2XA 4R7NA 1Q8MA 4JKWA 5F7LB 2DKMA 1S9KC 2CLZA 1C1EH 2AXFA 4RMWA 1H15A 4WW1A 2VKWA 4JFOB 2HVJA 2FX7L 4FXGB 2Y6SC 3U2SA 1UFUA 1BVKB 5ID0A 4X99B 1HSBA 1GZQA 5KBNC 4WY7L 5TH2A 1C16A 5L2JB 5IB4B 1FVEA 4U2ZA 1EUTA 4HDIB 3TN0B 4QRPA 1MREH 5F7NC 2PXYC 1A7QL 1BF8A 1X6NA 1V3JA 5EOQL 4JDTH 3U48A 2O5YL 5EBWB 2ERJC 3BFOA 5DFVD 1XGPB 3LH2L 3MA9H 2PNDA 5DJAA 1E4XL 3VRJA 1JFQL 2IAND 4OGXH 1FVDB 1T1WB 3IF1B 4P23B 4N0UE 4QHUA 1JTTA 3IRPX 3TBWB 4APQC 1RZ7H 1AD0A 1JWMB 3BKJH 3LEXB 1JNHA 5JHDA 1BD2E 1VGEH 2P46B 1GXEA 4RGOH 1MCOL 4QRUB 3DUUA 4QRQB 4ZQKB 4WUUA 4HD9A 2BY1A 1S8DA 2YD3A 5I74B 3H7LA 1EBPA 4XCFH 3I02A 3KPSD 4F57L 3ZE2F 4F58H 4YHOH 2Y6SD 2X09A 2ARJQ 4WIQA 1EO5A 4J4PD 1M05B 4I18A 1PYWA 3JWOL 1A6PA 2R0ZH 4JO1H 3MGOB 3F7QA 3B9VA 3MSPA 1F4AA 4IRJA 1JK8B 2XWTB 1ZLWH 3IXAA 3ZDYE 4KKCC 2C3XA 2VERN 1XF2A 3IDUA 3NCMA 4NQEA 4YUEL 1JN6A 1S9XB 2UZYB 3PQYA 4OT1H 4BUHA 2ESVD 5DJ2B 4NQDA 1QVOB 4L3ED 1PY4A 4YX2H 1QOKA 2PR4L 3K7UA 1FN4B 1YN7B 3IKCB 4KK9D 5DTFA 4OIIH 3X17A 1IEAA 5TDPB 1PG7X 4RMRA 1JHKL 3LN5B 1NEUA 5CBAA 3O11B 1T66C 1AGDB 2A83A 2AI0H 4L4VE 4C4KO 5GZND 3HE6C 3HC3L 5E8OA 3GRWH 2EKSB 3OAZH 5F9JA 2R8SH 2AV1B 2PW1B 4JVUA 1P7QD 1R5VB 2OTWB 4KTYA 4LKXB 4P5TA 5ICZB 4P57A 2YZ1A 3MOAH 1FO0L 3QCTL 4R9HA 1MFEH 2EE9A 1NMBL 5HDQH 4JFFA 3NTCH 1WICA 1YEIL 4HFWB 5C6PB 3VRIB 5EA0L 5T1LB 2FHFA 2ZUYA 5SWZB 5IVXE 1HHKB 5KSAC 4XBPA 1M7XA 4LVOC 1F6FB 4WJ5A 3X14B 1YMMA 2G5RA 4Q0XL 4BFIB 3L5WA 1CGSH 3FOLA 4PRHD 1Q1JH 1NGPL 4RCAA 5HHOB 5I1HH 2IAMC 3O4LD 3ZKMD 4OF0A 1FORL 5F6HJ 2A1WH 2XN9D 4LU5H 4FHBD 5FKAA 1T1XB 3CU1A 3GMMA 5ESVB 3P73B 3CSBA 3NH7L 3VWJB 4D8PB 3IS1X 3WO4B 4V1DB 1T66D 3OX8B 2W9LA 2V17H 3DUSA 3GRWA 3R4DA 3VWKA 3CPLB 3NACH 1MH5B 2J4WL 5I66B 5ID1A 4U6YB 1P7KB 4ZS6C 3WNKA 4Z7VE 3T0EA 2ZG1A 1ZHKB 3VXRB 3MJ8B 3ARWA 3QUKB 3O6ML 4F7PB 4EIGB 3IU4L 4XP1L 4QRRD 2K3TA 3RZCA 1OTTC 1IM9A 1CVRA 4OD1L 3ARDD 1CDGA 1KB9J 1HXMA 2HJFB 4KVNH 4G42A 5DYOA 4NKDB 2VDOH 3PHOB 1DQQB 4PY8J 4Y89A 1EPFA 1JTOA 1I85C 2F8XC 2LQRA 4HBCL 4YO0B 4YHMH 4N0YL 1Q0YL 1KN4H 1YEFL 3QCUL 4UIMB 3SY0A 2EE3A 2P5WB 5DJ6B 3D2UD 2J1KA 3SGEI 1V7MH 4WFGD 5GRZA 5J1AA 5A3IC 1CBVH 5E6IB 2VLKE 4QCIB 4Z0XB 3DSNA 4JZNA 5IKCA 5GS1A 3U0PB 5CHNA 5IW3A 1T5WA 4WO4D 4N0RA 1UQSB 2UWEE 2AXHA 4Z7UB 3RVXD 4M00A 1FCGA 2VLMD 3QAZC 4BELD 2YWZA 3DXAD 3STLA 2MPAH 5C0DA 1I3VA 3LIZH 4HGWB 5CZXC 1NBZB 3FQXB 5C71A 3CXDH 3NCYS 5EPMA 5D9SA 3OF6D 5FGBA 1W8OA 5HYJB 1RIHL 5ALBH 5JUEL 5D7LD 1OAKL 5MERB 4DGVL 4JM2A 4OD3H 4XNUH 4Y5VB 4RAVA 2NZ9D 4RFOH 4GQ9H 4ESKA 5J7CC 2DBJA 3GSRB 2K7PA 4UINL 3BPLB 4I9WD 4MDJB 5C0AD 3RKPA 1N8ZB 4PRIE 3RAJL 3T1WA 3TYGH 2YD1A 5IROA 4MAYA 1FNSH 2NTFA 2GFBA 5DDHB 3EUUA 4PUBL 4BSVA 3CX5J 4UOW0 5F7YC 4L1HA 3DBXA 2ITCA 4S1RH 3GO1L 5FYJH 1E4WH 1AI1H 4ODHH 5GGQH 1SM3L 1WIUA 1F3RB 3O9WB 4MNQE 2HRPL 4Y8AA 5F8QC 1E4XI 3LB6D 4WFHE 5DJXB 3HCVA 2EIDA 3DV6A 2DDQL 2V2TB 1TENA 5KJRH 5JDSA 3L3DB 3DI2B 2FB4H 1S7XA 1YEHH 3CVHB 4PLNC 3TZVD 2VDQH 1LE9B 1EEYA 3HMWH 5C08A 1QBBA 1K6QL 1V7NH 1NFIB 4F7TA 1MCWW 1F3DH 4XPGL 2N7AA 1A0QH 1QRNB 5MP6H 5DWUH 4EDXB 4M61A 1ULVA 4Q6IA 1T89C 5A40E 1FYTE 4EUPH 1XR8A 4ERSL 5JTWA 1TNNA 3HNTH 4WWID 5J9PB 3TO4B 2F8OA 2YUXA 4G3YL 4UBDD 5C0CE 5L2KE 2B2XL 3LDBB 4HKJA 1FFQA 2BVQB 2AGJH 2R1YB 1U91B 4OKVA 4XP6H 1V8HA 4KROC 3M07A 4RGNE 5EH1A 1NC2D 1N5AB 4QO1A 3CLEL 3TNMB 3MLXL 2WUBH 3N85H 4J8RA 2NY3B 1CXHA 3ARUA 2P8LB 3MUZ1 4X7DC 2P7TB 3F7VA 2OI9B 3SOBL 4Z76A 4LHJB 2Z31D 3WIFB 2FL5B 5GGUA 3ZDYF 4KQ4H 3P2TA 3QIUA 1ITCA 3ULVH 4EQ2A 4UTBH 4PGCA 4NCDA 3HZVA 3UJTL 3TM6A 4PG9B 5J1SC 4PTTB 3UBXA 5C0EB 3L3HA 1RUQH 1WZ1L 3AMKA 3JXAA 4U1LB 1FSKB 1WBXA 2AJSH 4GRLA 1U8PB 5E9DB 3K1KC 4EUPA 4W6YB 2CD0A 4ZODA 1R3JB 1I7UB 5DRXA 1FIEA 1UB5B 3HI5L 1BD2D 3DVGA 3Q0HA 1ETZA 3GBLA 4XRCB 4K3EL 5HXMA 2KDGA 4LBEB 3EFDL 4XAKD 5EIIA 5E70A 1F6LL 4QF1A 1U3HC 3LVEA 3KVQA 1A4KB 1JE6A 4XTRC 5IJVA 5C09A 3NCJL 1F11B 2FLRT 3RDTB 5I8OL 4OV5A 2CKBB 1OW0A 2X5PA 5E7BA 5MEQA 2Y7QA 4KUZL 1KCRH 5TDOA 4LAJH 3WHE0 2QJDA 3PP3H 4XMLL 4XWOC 5E00B 1JYNA 3M17A 3MV8E 1JI2A 5DC9B 1J1PH 3O8XC 2J8UA 1IKNC 1MJ7H 2YPVL 3OPZL 2AJVL 35C8H 2I07B 1FH5L 4K71C 3SKJH 5B39G 2FO4A 4OQTA 3TCLB 4JFYA 1E27B 1JVKA 3GMRB 3PDGA 5E5UB 5HJ3B 5LGJB 1UJ3B 4JDZB 3O3AA 2X4UA 4Z0BL 4ELMA 3BYYA 4Q9QL 5IK3B 4OCNC 1B9ZA 2VUYA 4JN1L 1P53A 4AQOA 1B0RB 3A67L 4KKLD 2O5ZL 1YUHB 4P9HC 3D6GA 4HLZH 1AQDB 1FHGA 4S11A 4XMKL 3WFBH 1FAIH 1UXSA 5FHAL 4L4VD 2H45A 2P48B 2FRGP 2EYSB 1EZVX 1QLRB 1G7JA 5B8CA 4XCYA 1T83A 2BNRB 2CRYA 3QUYC 1WFOA 4PRBA 2OCFD 2YBRB 1KB9K 3ZSSA 2QSCL 3RU8H 1LILA 4CKVX 3L9RB 4U0QB 2VL5A 3AMLA 3NFPA 5I9QC 4XH2B 1NCUA 1MAMH 4RMSA 1MAJA 2MCG1 4TN9A 2HT2D 3F7YB 4IIQB 3RWEB 1CT8B 5FYLH 5I8EA 1CDBA 2OJEA 5JQ6L 8CGTA 3BXNB 3GMPB 4JFQB 1GC1C 3TGXA 3ARTA 4G9DB 3WE6A 2EDKA 3VXTB 4FABH 5E2UL 4XWOD 4BH7B 4NO0D 1TVBB 5CZKA 2I9TA 3U9UB 5KZCB 3ARGD 4MCYA 2ZUXA 1BECA 2XG5A 4PGJA 3UTTA 5ELIA 4S1DD 3GSQB 3I3DA 4BM7A 2HFEB 2P49B 5F7UA 2A6IA 4JRYE 1IMHC 1FL5A 1IAIL 2WWKO 4ETQA 2GW5A 4HUUB 4KVCH 3MLRL 4JHAL 3ROOB 1R3HA 2C1OA 3EO1A 3HE7B 2ORBL 3VFVB 4AQ1B 1KCSL 3F12A 4HWBL 5HI4D 4ZFFB 1WBZB 3QUXA 4MB5A 4LHUA 2BFVL 3SJVE 4OGAD 1NGWA 2V5SA 2VDNH 2HYMA 3IRZA 3V6OA 1AHWC 3MV7A 3LRSA 4PJ7A 1IGTA 2M26A 5HGAB 4E41E 1NUGA 4N90E 5HVHB 4PRDA 1B3JA 4PB9H 3MXWH 1I3GL 2UUDH 3CX5K 3S7GA 2WINB 5DGQA 4HIJA 3AVEA 1AGFA 3AREA 3VXPA 4GS7B 3QQ4B 3CFDB 4O2EA 2JTDA 4XNQA 1AO7E 3CFJB 4AH2B 1FNAA 5L7XL 3O6FB 1CFNA 3CU7A 4MAUH 3STBA 3A0OA 2JB5H 5KVEL 2BC4A 1DUYB 1HQ4B 4IOFC 3W0WA 5BMFH 2DQIL 1WVZA 3DMMB 2Q86A 2CXKA 2VLKD 2XFXB 4WWKD 4KJPC 1LDPL 3ARBB 4AEHL 1XR9A 4X6CA 2AV7A 3X3FH 4JQXA 3LD8C 1DBMH 5CD5D 2EXYD 4MJ4A 4CVXA 3BH8B 3MNZB 4Y1AD 4JPKL 4MNHA 4OB5L 2DLEA 2XZAL 4TQEH 5T5NF 5C0GA 5C3LD 4JPIB 1XF4B 3BKML 3ALXA 4PJAA 4UIKH 1YJDH 1YPZE 2A0LD 1Z9SA 4Y5YA 4PJIE 3Q6FB 4HKZA 1HYSC 4L5FL 4P49A 5F6HI 4R0LB 2HT4C 1KELL 5A16A 4YK4C 3GJFA 4PRID 5IF0B 3O0RL 1KEMH 3MLYH 4PLOB 2AK4E 4PJGA 3LKOA 1RURH 1XF3A 4JO2H 5BJTA 5FHBL 5F1NB 3VDAA 4LRNH 2X1WL 1CGVA 2HJLA 3JUYA 1MIEL 2X9XA 2YA0A 3S4SB 5T1MA 4WDIB 5IB5A 4BZ1L 3VFPB 4ZAKD 5ADPL 5GRUH 3TA3C 2XWJB 5GS0H 1IGCL 1MUJB 3RA7H 2ARJB 4JHBA 4ISVB 2MSPA 4MNQD 2C3WA 5IG7B 3ULSA 3TJEL 1N7MH 2GIYA 2V9RA 2XXCB 1Y6MR 4HUWB 4PY8I 3DURB 2APBA 4R96A 4WFHD 1OAZH 1ORSB 3KPRB 1QYGH 1IC4H 4H25A 3QUZC 4NO5A 1NEZB 4UB0H 1UYWH 3QFDA 5CMAB 5F3BB 4M7JL 3N9GL 2R29H 4LDOB 5EUKA 4OV6F 2EO1A 5T3XH 2IANB 4JDVA 2FWOB 2V2WB 2BSSA 25C8H 4YDVB 1MHEB 3KPTA 3D0VA 5FM5O 4YEEA 4LLDB 1RZIB 5FA3B 5INCA 1GPOL 1MHPL 4KHTL 1S7RA 1HI6B 1TPXB 3X11A 2DKUA 4OZIB 1U8MA 3FO0L 2BVPA 5ALCH 1NCBL 1MAKA 1RJYA 3KPSB 4F9LA 5C0CD 5L2KD 4LLMB 2DQFB 1G7MA 4MNGA 4ONHB 1MCJA 3V5DA 3BI9X 4X98A 3HLAB 4LVNB 4RGND 1UB6B 2IADB 2NQCA 4O58L 5AD0B 3OKMA 4JFXB 1KOAA 3OZ9L 4P4RB 3RTQC 4NYLA 5IFAH 2OYPA 5DSCA 2NY7H 4NNYB 3HZYB 3LSOA 4HWNA 1SVZA 1T1ZA 4YPGA 4OGZA 1ZTXL 2LV4A 4N8VA 5IQ7H 4NUJB 4PJFA 3HAEB 4LSUH 4P59L 1GGCH 3L6FB 1CICC 3IDYB 5IR1B 5D7IE 4W70A 4L3EB 3QUZD 3OKEB 3VFUB 3U4AA 1N59A 3EYFA 3QXAB 2NLJA 3CFCL 3B9KB 2CGRL 3QSKB 1UZ6E 3V52H 4F7CB 3W9DB 3RNQA 1EA9C 2DLIA 4K07A 3QA3B 2A9ML 4W6XB 5CEYB 1L9MA 1UENA 1IEBB 1B0WA 4MXWL 3WNPA 4G80B 3QFJE 1P7QB 3W81A 4KZEL 1IT9H 5H37G 2A2QT 5IEHB 5JA8B 3QQ3B 4KU1A 3Q5OA 3JV0A 3WSQL 4MJIE 1N2RA 4X4XA 5DJYA 5EU3B 1IQWH 4HXBL 5AZ2L 3TF7C 4HAGA 3D3VD 1R24A 1EVTC 1IM3A 3GFUA 4NPYB 1IAII 4YDIL 4MJ5A 4MCZB 1CICD 1I1RA 1DZBA 2E9IA 5ANME 4UT7H 1FO0B 4LCYB 4ONFH 2X9YA 4PRHB 1A7PL 3VG9B 3O4LB 3QNZB 4ACPA 1KUMA 2VLLB 1FPTH 2XNAA 3C09B 4PJ8C 5CKAA 1JZ5A 4LIQH 4P3DB 3BGFB 3QXDB 3KPPA 1YN6B 4HPYL 1DVFA 5BW7C 3EGSA 1MVFA 5H35A 3EOBB 2CLVB 1CFSB 4DJMA 1EBAA 1X44A 3MRCB 4I0PC 1ZKAA 4HIXL 3U4BL 1BQHB 3RWHA 1J8HA 5LBSL 5GGVH 4BFGA 3VFWA 5JW4Q 1KLGB 4CU7A 2DOCA 3RQ3A 5EBMA 4YXKL 4QRRB 4L8DB 1CR9L 4NC2B 1PX3A 1ZV5A 2FZ3B 3ARDB 3MLSH 1VA9A 1LK2A 2VZTA 3BP7A 3ZL4H 3JV6B 3NABH 1JUFA 3LCYA 3L1OH 5HVGB 3QIWC 3NAAH 4YHZL 1VACB 1YNLH 4GMSL 5DD3L 4Z7WE 2WP3T 2OP4H 4NZRL 1B0GB 4ZTPH 4FQIL 3QJHA 3N0PB 2V7NA 1CLOL 1QHPA 2HMIC 1Q9LB 2D31B 4NRZB 4H0GA 1FP5A 1OAYL 1KGCD 3D2UB 1D6VL 3REWB 3LQAH 3GI9H 5TF1L 3BT2H 3UJJL 2JJTA 5SWSE 5DUPH 5TFSL 4JRYD 3LKRB 4FQ2L 4HPOL 3IGAA 2OZ4L 4WO4B 1A5FH 3MCKA 4LPUA 5EO9B 4ZUUB 2HKFH 1C7TA 5AZEL 3GBML 2VYRE 5GS3A 1RZFH 3TJHD 3MRHA 3BPCA 1JGVL 3DXAB 3SJVD 4I0PD 3S35L 1QA9A 3TBYA 1KIPA 5FA4A 1RMFH 3FRPG 4XVTL 3X13A 2GSIA 1DN2A 4NQCB 1P9MA 3WKMH 3GMLB 2MMXA 4PV8A 2AQ3A 5D7LB 4PG2A 2BY2A 3OKLB 4RAHA 4E41D 2F74B 5KS9E 2WBJC 1UM6H 3LZFL 4JPVH 5C0AB 4JFOA 4KMQA 4M6OH 4PTUB 1A1OB 3FN9A 4FXGA 3O6KH 2PCPA 3QG7L 5C0NC 1GCFA 1BVKA 1QO3B 4JKPH 4X99A 2NY5L 3C5JB 5IMLB 1NAKH 1GHFL 2BOCB 4QYOB 1AO7D 2HKHH 2EEBA 1AGCB 3PIQB 5DT1H 1OD7A 5IB4A 4HDIA 2EIBA 3TN0A 2VXVH 3QT2A 5B21A 2AKRB 3E3QE 3MV11 1JF6A 4JB9H 4XWGH 3L5XL 1NCDL 2Z35B 1A6VH 5EBWA 5L8KB 2VLRB 4EQ3A 3K80A 4RIRB 3ZTJG 1RUML 1XGPA 2GY7B 3V4VH 2EE2A 2W0PA 4M93B 1K85A 4K3GA 5E2VL 1RIVH 4GBXA 3S3JA 3BN3B 1FVDA 1T1WA 3IF1A 4HQQL 4P23A 1EO7A 4PB0L 3VXMD 4FTVD 5D72H 3TBWA 1JWMA 1LO2H 3MUHL 3TWCH 2B39A 2QKIB 3LEXA 3TVMC 2ICWJ 3FTGB 4QRUA 1CU4L 4KKNA 4MZ2A 4QRQA 4U4BA 4ZQKA 1TMCB 1FNGB 3ZZ1A 1A7NH 4WNQB 2ZJSH 4H8WH 2G2RB 1M05A 3TV3L 4XP5H 1EGJL 4CW1B 1D9KB 4LPVA 3MGOA 3NIDE 1JK8A 2XWTA 4PP1C 43C9B 4ODVL 2ED9A 3DVFA 5EWIL 3LS4H 4C59B 1KFAL 4RFNB 5IHBA 3G5VB 4KK8C 1S9XA 3IDMB 1NC2B 3GNML 2AEWA 1EO8L 5DJ2A 1QVOA 2Y23A 4ZD3L 5IHUH 1P69B 1NFDB 3MV01 1FN4A 1YN7A 1YEDB 2D0HA 2QADC 3WUWB 3IKCA 3RHWF 3E0GA 5TDPA 4DUVA 4UAOC 2Z31B 5HYSG 4U1MB 4WHTB 4X9HA 3MR9B 4HLJA 3LN5A 2NY2C 4NBZB 3O11A 3C6SB 5F71A 4YQXL 1AGDA 1F90H 3GMNB 3WFCH 3RNKB 1BQSA 5ENWB 1DUZB 5HHNB 4JKKA 1HWHB 3C6LB 3Q2CA 4WUKH 2YMXH 5D7IF 1A3RH 5I30H 3MRJB 5HGGS 3FN0H 2EKSA 2VOTA 2AV1A 2PW1A 4N0UB 1R5VA 5D71L 1KEGH 2OTWA 4LKXA 5ICZA 4PJEF 1K4CB 4J6RL 4U1HB 1BD2B 2VZOA 2DQDH 3VFMA 3T2QA 4ZNEA 2E27L 3HUJE 4LRIC 2DRUA 4MWFB 4WCYL 4NKQB 3UYRH 2HJKB 2OM5A 1A7RL 4HFWA 3DV4B 1DLHB 3K4ZA 3VRIA 2Y36H 5T1LA 2EH8L 5I1CH 1RZJC 2AJUL 4EZMA 5SWZA 4DKEH 4RGMB 2X1QA 2GITB 1HHKA 1N0XL 2IJ0C 3QXUA 4JFFE 5D5ME 3LEYL 5DQJB 1MCWM 3T08A 2YUZA 3X14A 2Q6WB 5F7KC 5E4EC 4ZO9A 4BFIA 2EC9T 1DLFH 2WZPD 4RWHA 3VD5A 1ZE3C 2F15A 5HHOA 1AGEB 5FCUL 5FM5M 1PZ5B 1KNOB 1JWSB 4GAGH 3SGDI 1T1XA 5ESVA 3P73A 3RVTD 2YEZB 3VWJA 4OM0L 4D8PA 2BMKB 2QQLL 4FXKB 4V1DA 2LE9A 4YXHH 3OX8A 4HC1H 1N6UA 2EDLA 2EDQA 1XEDA 1MH5A 5I66A 4U6YA 3QDME 4KMLB 1P7KA 2OXGA 3ZKXC 4LVHB 2R0WH 3RWIB 1ZHKA 3VXRA 4DKDC 3AXLB 3MJ8A 1K8IB 1KBGH 5DLML 3FO9B 3QUKA 1TJHH 4F7PA 5F7FA 5L88H 3V79C 3QEQE 4L4VB 4NN5C 5CILH 4FA8A 2VXUL 4EN3D 1BJ1J 4GAJL 5EG6C 2HJFA 5JXAH 3K8MA 3UAJD 1YMHB 4NKDA 1EHLH 3PHOA 2BRRL 3IFNH 5DRWB 4PJDE 1DQQA 1GIGL 3C60D 4YO0A 5ACLA 3QDGE 1YEEH 1AJ7H 4X9FA 3HFML 4MJID 3RHWK 4UIMA 3T0XA 2F5BH 2P5WA 5DJ6A 5HPMB 5JW3L 3BP4B 3H42L 5D2LE 4NO0B 4HFUH 2F9BT 5E6IA 4Z0XA 4YNYB 1A14H 2UVEA 5IVXB 5FYKH 2DB8A 2LU7A 4HC1A 3U0PA 4YFEA 3ARGB 1IKFH 3WIIL 1UQSA 4F9PC 3DLQR 3CX2A 4Z7WF 2C4XA 1X5KA 4WI9A 4Z7UA 2VR4A 4KY1H 1FBIH 2NXZC 4BSWB 3MRNB 1UG9A 4HGWA 2NR6C 1NBZA 3FQXA 5SV4A 4EXPX 1ZWIA 5LKNA 2XPGB 2Q8AL 3ARSA 2FGWL 5HYJA 3QWRD 1N4XL 5MERA 3CVHH 1ZMYA 4GSDL 4Y5VA 3QYCA 2OJZL 4QTIH 4N5UA 1CGUA 3GSRA 1Y6NR 4FQXC 4MDJA 1CGWA 4Z7VB 3VJ6B 5FV1L 1N8ZA 1KN2H 4Y2DC 3Q6GL 2GAZB 1WFUA 3L7EB 6CGTA 5FDYA 2JIXA 1JZ8A 5DDHA 2JCCE 1IRAY 3ZE0E 5CZVH 3SHSA 3TBSB 5F1IB 2ZCLH 3GSNL 5KS9F 2AP2A 1TIUA 3FB5B 4KDVA 3FHQA 4AEEA 5IFHL 4S1SL 4DTGH 1L9NA 3TYFB 3O9WA 4TNVK 4NHCL 5DRZB 3U30B 3RX8A 1N3NB 2ATPB 5HHPB 5DJXA 1E28B 4LSVH 4HIIB 3E2HC 4MZ3A 2VLKB 2V2TA 5SWSD 4NWTH 4WWKB 1YA5A 5GGTH 3FQRB 3D39E 3CVHA 3DHMA 5EUOE 1LE9A 2WW8A 2UWEB 3UDWA 1MQKH 1NFIA 4QHNB 2YD7A 1QRNA 4DUWA 1NCWH 5J3HC 1YY8B 4HS8L 2HFTA 3VRLE 4MS8C 1PG7W 4EDXA 2B1HL 2RBLA 4NNPH 1FE8H 4LP4A 4LL9A 4EIZC 3FQUB 4P5MB 3UEZA 2H1PL 5J9PA 3TO4A 4WW2B 4KRPD 2F58L 4R7DB 1JMZA 3PWPE 2GJ6B 4PRIB 2BVQA 4JGUA 3IDXH 4FRWA 3VGFA 4XVJL 3PABB 1N5AA 2NY4D 1CDJA 1QLEL 3TNMA 1UWGH 4FQJH 1P6AB 3SDYL 1D5IH 1EJOH 1GGBL 2CKBH 2J5LB 3MGTB 2NXYC 1CK0H 2AAVA 3TEUA 1INEH 2P7TA 3QNYB 5GGTA 3NIDF 2DD8L 5DC0A 5I15H 4I18C 3WIFA 2FL5A 5GRVK 4ZAKB 4IRJC 1J7VR 4ODWB 4JY6B 1DEEB 1LO0L 4PJ9D 4PG9A 4MNQB 1FLRL 4PTTA 3CFIC 4R2GD 5IESH 1LK3L 5C0EA 2UZXB 3BUYB 4S10A 2FECL 1NDGB 3QB7C 3D25B 4U1LA 3SKOB 2XRAH 4N0CD 4RA3A 1C1EL 1U8PA 5E9DA 1RIUL 4X6EB 1Y0LA 1I7UA 5I1IH 2XZQH 1UB5A 4IMKA 4M1CC 4AG4L 3KHQA 4EOWL 4XRCA 1T4KB 3IDNB 1YECH 4LBEA 1LHZA 4FNLL 3G04B 2UZIH 1JNLH 4M7LT 5T1KD 2MKLC 4PBWD 5EOTB 5JHDD 1MREL 3BMWA 1A4KA 1H3PH 1Z2KA 3FB6B 1FYTB 1P5VA 2VSDA 3BP5B 1F11A 1Q38A 3ZMRA 1VFAB 3RDTA 1MY7A 4JR9H 2CKBA 3IFOB 2K7QA 3G5YB 4P5TC 4PBXA 1RZGB 4ZO6A 1SEQL 5L2KB 3R06B 4JFDE 3WNMA 2NXYD 3MA9L 5E00A 2C4FT 4G9FE 4RGNB 4OGXL 2I07A 3G9AB 1RSFA 2ZOKB 4NGHH 4DKFL 3KLHC 1RZ7L 1H3UA 3TCLA 1E27A 1Q9OB 3GMRA 4F15C 5HJ3A 5LGJA 3BKJL 4NQED 1UJ3A 1H8SA 1I8LA 3B8SA 3HNVH 5C0BE 5D5MF 4RGOL 4X6BB 4G8FB 5IK3A 5DMYA 5B38B 4NBXB 1JPTH 1B0RA 5H94B 2VRAA 1A1MB 1YUHA 5EN2B 4E9LA 1AQDA 2CMRH 4XPFH 4M7ZB 4F37F 1A47A 4N8PA 3CVIH 5JXEA 1T22B 2BVYA 1DL7L 4K3DH 4M1CD 4F58L 1MI5E 3AB0C 3LMJL 2EYSA 2B8OT 2QLVB 2UY7A 4U6HB 5IB3B 1QLRA 1CXLA 1XGUB 2XIDA 1FC2D 2BNRA 4UT9L 3MROB 2YBRA 4JG0H 3CCHB 3L9RA 4HH8A 5DJZB 4XH2A 3BZFB 1KB5L 3CJJA 4OT1L 1TNMA 3F7YA 4IIQA 3RWEA 3CFKB 2PO6D 3BXNA 1BEYH 3GMOB 3GMPA 4JFQA 4P5TD 4YX2L 1EERB 4G9DA 4ZXBC 2FIKB 4OM1L 3VXTA 2KQNA 4KJQC 3RZCC 4OIIL 4BH7A 1K2DB 4B0MM 5EU6E 3LHPH 1S9VB 3TLRA 2XWBB 2ICWI 1TVBA 3GM0A 4LFHG 4PJDF 3U9UA 4JFFD 3KLHD 2VAJA 5FB8B 1T03L 2FJFA 3DTXB 3GSQA 2AI0L 3LAFA 1FZKB 3MV8B 4HWEH 4JY4B 4HUUA 5ESQB 5C0IB 3ROOA 4MMXC 3HE7A 5DD5H 3WO3B 3O6LL 3VFVA 4HX1B 5FK9B 3RWFB 2DM3A 4GG8B 4ZFFA 3ALPA 1WBZA 3WXVL 3KJ6L 1CDUA 4UOJA 2YK1L 4JKLA 4X5XB 3QDMD 5HHMD 5GS1C 2I27N 2AEQH 4X7CC 3CZJA 3BPNB 5HDQL 3QR2A 3NTCL 4GKSB 1KPRB 2SEBB 2XA3A 3V7MA 1U8HB 5I19L 2R4RH 5K9QI 3I9GH 3F62A 1F3DJ 3UO1H 2HRLA 3GHEH 3VWKD 4QRTB 3D85D 5HGAA 3QEQD 5D7SH 3V6OE 3T0ED 4IM8A 2O26U 4I1NB 3FRUB 5CLWA 1RJCA 1T0MB 5FGBC 5FOBB 3MJ7B 2I24N 1CGSL 4NSKA 6FABL 3ARFB 3P11H 1Q1JL 5I1HL 1CFQB 1ADQH 3QQ4A 5GRXG 3CFDA 3H9YA 3CFJA 1AXIB 4AH2A 4BQBA 4OGYH 3QDGD 1KSRA 1FNHA 3O6FA 4MXVE 2HTLC 4JM2F 7CGTA 5IROC 4MAYC 2HLFD 1DUYA 1HQ4A 4POZC 2V17L 2JCCF 4NKOB 3ZE0F 3NACL 3DMMA 15C8L 3VGGA 3I3EA 4ZS7L 2XFXA 2V2XB 4TOYL 1QRKA 2FATH 3H7BB 4X8JB 3QISA 3H9SE 3ARBA 1DBKL 1DQML 1CE1L 2PETA 1GOHA 1E4JA 4JRYB 3BH8A 3MNZA 4UTAL 4X6DE 3QZWB 4GKNB 4KVNL 4G6KL 4JPIA 1XF4A 2VDOL 4XXDB 2OR7A 3THMH 1UGNA 2J8OA 3Q6FA 1CDIA 4WY7H 1UXWB 3OAZK 3SJVB 2JJUA 4YHML 4R0LA 1I8MB 5EUOF 3VGEA 4Q9BA 1KN4L 1ADQA 2NTSP 4PJAE 5IF0A 1OLZA 5D1XB 1GSMA 1ZA3B 1A7QH 1K8DB 4OD2B 4JM2D 2H2SD 4OI9A 5EOQH 4E41B 5F1NA 1LO3L 2O5YH 2R2CA 4ZNCD 4PS4H 3SDAB 3LH2H 4KK5C 4Q6IC 4QHMB 3S4SA 3CSYB 3PJSB 4WDIA 1E4XH 5CJBA 4K94L 1JFQH 1BF2A 2DN7A 4LOUC 4LCCB 3VFPA 1WAAE 1AO7B 2MPAL 5C6TH 3LIZL 2XWJA 4WEMB 1MUJA 3CXDL 1UH3A 2ARJA 2DM7A 4ISVA 3MOBH 1CFTB 3F58L 5IG7A 5DK2B 5D1ZC 5ALBL 1MCOH 4HUWA 3DURA 4XNUL 2GK0B 4RFOL 1ORSA 4GQ9L 4I0CC 3H3BC 3KPRA 5I75C 5F70A 1NEZA 4F57H 2FHCA 5CMAA 5F3BA 3E6HB 2BCKB 1FNSL 4JZJB 5DO2C 5M95B 2IANA 1A3LL 3OWEA 2FWOA 2V2WA 1H5BB 3QIUC 4IDJH 4YDVA 1I3RB 1MHEA 4LLDA 3K0WA 1RZIA 2DQTH 1X4XA 5FA3A 4S1RL 1GGYA 1YPZB 3OR6B 3SE8L 1HI6A 3SDDC 3MRLA 4OZIA 4PJIB 3FJTA 2ZUTA 5E6ZA 3EDDA 3ESVF 1AI1L 2PR4H 1MLBB 4WEBL 4ODHL 5GGQL 3KPSA 4LLMA 2DQFA 4XNYH 1FGNH 4ONHA 3DVNB 2AK4B 4J4PA 3HLAA 2CR6A 3WCYA 3EYOB 1UB6A 3TFKC 1JHKH 2IADA 1CZ8H 5AD0A 4JFXA 1NMCC 2R2HB 4NNYA 3HZYA 3OBAA 3T4YA 2FB4L 5FYJD 5MI0C 2VDQL 1SY6L 3HC3H 1KJ3H 3MXVH 4R97B 2QHRH 1V7NL 1LD9B 1A6ZB 1NL0L 3HAEA 4NUJA 4RZCB 3L6FA 4M62H 1AKJB 5IR1A 1OW0C 3EJYC 1A0QL 4L3EA 2VTFA 5MP6L 1TQBC 5DR5L 5DWUL 5HYQB 3OKEA 3VFUA 1C5DB 1FL3B 1J0YA 1FO0H 2WBWB 3ULVC 4Q7DA 1X5HA 3KXFE 3QXAA 3TO2B 1NMBH 3HNTL 5FFLA 3B9KA 3QWOB 4F7CA 4HCRL 5FUZH 5T3XE 3W9DA 3ULVF 3RIFF 3S5LG 2AGJL 1HZHH 4XP6L 3UYOD 3QA3A 4XHQA 5CEYA 1IEBA 5ERWB 3FT2B 4G80A 1P7QA 4GRLD 2QV2A 3JWDC 2JF1A 4Q0XH 1J11A 1NGPH 5IEHA 2QHLA 1VSCA 1YY9C 3PWVB 4K7PX 4FS0A 2IFFH 2JELH 3QQ3A 5A2KH 5B8CC 4Z77B 1T83C 5KVGH 5EU3A 1FG2B 2CUHA 1IAOB 5MENE 3DO7B 3B83A 4WTZG 3BGMB 4A6YH 4UTBL 4MD4B 1YEKH 4KRNA 4JFDD 4U2YA 1JCKA 4HK0B 4NPYA 1I7ZB 4JLRB 3S37H 4G9FD 3QO0B 1HNGA 4MCZA 1GOGA 3MV9E 3UC0H 3O6MH 4UI2A 3MUJA 1FO0A 4LCYA 5GSVB 5F96L 4R4ND 4PRHA 3ULUC 3O4LA 3QNZA 2VLLA 4M7KH 5DA0B 3BEWB 5C0BD 3D9AH 4NIKB 4P3DA 3TT1H 2X4PB 3QXDA 5D7IB 5I0DA 1YN6A 3MFFB 3W82A 1NBYB 3EOBA 2CLVA 1CFSA 3MRCA 1MI5D 3NCEB 3WS6C 2DF3A 3WS3A 4AK1A 1L7IL 1Q0YH 3ZHDA 1ZVSB 4GQPH 1BQHA 4HW6A 1V3MA 2EICA 1KLGA 3TCXA 4XP4H 3QI9A 4QRRA 4L8DA 3QUXC 5EBLB 5CGMA 1CCZA 4PREB 2FZ3A 3ARDA 4EN3B 4G7YH 1E4KA 35C8L 3JV6A 3SKJL 3QFJB 4HGKC 3BVNB 5LGKA 1FYHB 4I2XE 1VACA 3C60B 1B0GA 4AIXA 5EU6D 5HY9B 2IH1B 2DQHL 4PJ7F 2NX5E 3FMGH 1Q9LA 4MJIB 4NRZA 3AC0A 3MA7B 4U1NB 2FDBP 5JUEH 3OXRA 3D2UA 4NFCA 1X7QB 3AREC 1OAKH 2EC8A 1FAIL 3REWA 5JNYB 4UINH 5DC4B 4FP8H 1V3KA 3LKRA 4KXZH 2D03H 5CLTA 4PJBE 4WO4A 5ANMB 5EO9A 2F53E 4LIQE 3UTTD 1CXEA 4GMTH 1QQDB 1ZANH 1G6VK 1MHCB 3DXAA 3OJ2C 1QFWM 4AMKL 4G6AC 1OGAE 4TTDC 2O93L 4TSBH 4S0TD 4DGYL 2XTJE 4NQCA 3GMLA 3OF6A 3OKOB 4LQFL 2ICWB 5D7LA 4FABL 5FUOH 2NY6C 3OKLA 4LHUD 4Y16C 4X6DF 2F74A 4ONOA 5C0AA 3T8XB 5J13C 2PYEE 3HB3D 1A1OA 4NN7B 4ODUB 4PTUA 2HRPH 1WWBX 3NFSH 1I9JH 1QO3A 4Y5YC 2AJ3B 3C5JA 5IMLA 2DDQH 3JSSA 2BOCA 4QYOA 4PJAF 1AGCA 3PIQA 4GRWH 2PXYB 2AKRA 3PP3K 4F7EB 1D3CA 1K6QH 2VR9A 1JF5A 3DPBA 4Z7WB 2Z35A 2VDNL 3PHQB 4GO6B 2VLRA 3KPQA 1XIWB 1YC8A 4RIRA 1L7TH 4KKBC 3VFGL 4KMTL 3B8YA 3H9SD 1WAAF 2AJZB 3IETB 1E0OB 4G3YH 5SWSB 3GSNB 4G6AD 4TTDD 4PB9L 1FZJB 2QKIA 1F02I 3Q5TA 4DK3A 1I8IB 4PGZA 2RCSH 3FTGA 2BERA 2APVA 1FLTX 2ZOLB 4X4ME 1FNGA 3MLXH 2OR9L 4WNQA 3KPLB 5CSZB 3QWQB 4MAUL 3FB8B 3VXUB 2JB5L 3RVVD 3SOBH 3HRZB 2G2RA 4CW1A 3IKKA 5BMFL 4XPAL 1Z6JT 3NGBB 4I77H 1D9KA 3EO9H 1VEPA 4KRPB 5KS9B 4HUXB 43C9A 1CXKA 5I18H 2VLJE 3ARQA 1OARH 3UJTH 2FEEI 5CBEB 3BD4A 4GW1B 1SJVA 2FHBA 4NWUH 2QBWA 3IDMA 5JLZB 1NC2A 1WZ1H 1DBML 2NY4B 1MHHB 1G9MH 2NY0D 1UVQB 3JV4B 4F9LC 1NFDA 4TQEL 3WUWA 4NQSB 4M4RA 5FEBA 4UIKL 1YJDL 4U1MA 4WHTA 5GS0C 1G9EA 1ZHBB 3MR9A 2YUVA 3EFDH 4NJAL 5H2BB 1J0KA 3ET9F 3PGFH 4W6WB 3C6SA 3GMNA 5ENWA 1DUZA 4CDHA 5HHNA 5BO1L 4PJ9B 1KEML 1SJEB 3MLYL 4J3WA 1Z3GL 4CDGC 3C6LA 3PDOB 3MRJA 5INDB 1RURL 5FGRA 4LRNL 4N0UA 2AW2A 3ALWA 3KLSA 4KUZH 1BREA 1K4CA 3B5TA 3NA9H 3PP4L 4XMLH 2DTMH 4U1HA 1BD2A 1TLKA 2YPVH 1JGUL 1FH5H 4MWFA 4Y8DC 3QQ9C 2UUDK 3QPQD 2HJKA 3HAEG 1LMKA 5GRUL 1ES0B 1MJUH 3DV4A 5T1KB 1DLHA 2X4TB 5IQ9B 3RA7L 3MRRB 4BK4A 4LPWA 4Q9QH 4CVWA 2GITA 1N7ML 5TF0A 2EYRB 4QT5B 5EIQA 1J86A 5DQJA 5DUBB 1QYGL 1IC4L 2Q6WA 3NPZB 4UB0L 5T1DL 1UWXH 1UYWL 4XMKH 5FHAH 5D8JL 1G1CA 1KNOA 1PZ5A 2R29L 4PY7B 3RY4A 3ELAT 1JWSA 5T3XL 1J0JA 2YEZA 2BMKA 4FXKA 3WDJA 5HHOE 4NZTL 2CDFB 2VUOA 3H2WA 1UM4H 4WI5A 1RK0B 2W1NA 2FNBA 3I2CH 3KXFD 4YLQT 3RWIA 3AXLA 4LLAA 1K8IA 3FO9A 5EULV 5T3XD 5E2UH 3B5GA 5BXFB 3UJIL 4L4VA 1H3TA 4M3JA 1QD0A 3U83A 1KIQB 4XBGB 3S6CA 5KSBE 1YMHA 3N1FC 4HZAA 5HDOA 5DRWA 2NY7L 1ZGLB 1JZ2A 2DWDB 4NQXB 1AC6A 4GG6E 5IGXH 1XAUA 5IQ7L 2KBGA 2VMFA 3MLRH 3HUJB 4JHAH 4LSUL 1NGXB 1U8NB 2PO6B 2DIJA 4NFDA 3MZTA 5HPMA 3BP4A 4QTHB 2X7LB 5EU7E 5J0BA 3U0TB 2BFVH 4NO0A 2L7JA 2GK2A 5IBLD 4YNYA 5IVXA 3NOIA 1M71B 3I6GB 5D5MB 1KB5B 1S7TB 3ARGA 3MV9D 2E8YA 1I1CA 3MLUL 1TZHB 2ZKHH 4PGBB 4BSWA 4Q9CA 1QFHA 3MRNA 1WZKA 2FIRT 2F19L 4U3XA 1P4BH 1J8KA 2XPGA 1Z9OA 5I8CB 3V4PH 5F93C 2JJTC 1RUKH 4PJBF 1CLCA 4XP9L 5IMMB 3QDMB 3UYPA 2FLBT 3VJ6A 4Z7VA 3F6IA 5KVMC 1MCQA 5JIPA 1IQWL 4W81A 1L0XA 4JRXB 3IXTB 3STZB 1DVFD 2GAZA 5E8NB 4AIZB 2ZG3A 3L7EA 4EI5D 2DQIH 2RGSA 3D85B 3QEQB 4ZPTB 4NN6C 1KPUA 2KL6A 4HWBA 1GGUA 5F1IA 4K8RC 1P9MC 4OJFH 1W0WB 4FZEL 1MFNA 1ODAA 4PJDB 5D4QA 4G5ZL 4C55A 4ONFL 4PG2C 4XMPH 1X4YA 4U6XB 1FPTL 3FB5A 1F45A 4LIQL 4OB5H 1WZMA 2XZAH 3QDGB 4X83A 5TJWK 2EDXA 2CK0H 2DQEH 1MCIA 2VH5H 2WAHA 4WV1B 5IEKB 3TYFA 2NX5D 4IJ3C 4KJYB 4HKBB 1TTUA 1HINH 1F4YL 5DRZA 2APWA 1N3NA 2VZSA 2ATPA 5HHPA 1E28A 3KNBB 5DMJB 5D2LB 1U6AH 2C3GA 4HIIA 3J8F7 4HIHB 4WWKA 2APTA 1KELH 3FQRA 5JIKA 3TN0C 5GGVL 4YBLB 2F53D 3U1SH 4DEPC 2UWEA 3K3QA 1CQKA 4RFEB 2DQGL 5ADOH 5FHBH 4QHNA 5JW4N 1QFUH 1KCLA 1H0DB 1YY8A 1OGAD 3ZL4L 4DCQB 5JORB 3NABL 4G6FB 1MIEH 3L1OL 2XTJD 1LNUB 3ZDXE 3BN9C 3TPUB 3FQUA 43CAB 1RVFH 1YNLL 4P5MA 2J12B 2OP4L 4P23C 3G9VA 4WW2A 5ADPH 4PLJC 4R7DA 4RNRB 5F97E 4HUNB 3S36L 4PRIA 2GJ6A 2PYED 5EPMB 3MQIA 1JZ4A 4EDWH 2VXSL 5TE4L 2DWEB 4JM2B 1AQKH 3PABA 3LQAL 3GI9L 3HMXH 3BT2L 3HA0A 1X5JA 3HKFA 4OCYH 4TUOB 1JTPA 2JCCB 5I74C 5GRWA 1RZKH 3U7WH 3MGTA 3F6LA 2RB8A 4M7JH 3N9GH 2HKFL 3QNYA 4YBHA 1KCVH 5IM7B 3VH8B 4DVBB 4ZAKA 4A2MA 4KV5E 3B2VH 4BSJA 3LKPB 4NCC2 4ODWA 5IW6B 4JY6A 1DEEA 3WKML 1IGFL 4MNQA 1GPOH 4HBQA 1T1YB 3SDCD 5C07E 3BUYA 5IVZB 1NDGA 3D25A 3SKOA 4OLYH 1NCBH 1UM6L 4X6EA 2FSEB 2ENSA 3DO3A 1AR1D 3D39B 1WIOA 4XX1G 1F4WH 1P5UA 5EUOB 3BN9D 3O6KL 3ROLB 1T4KA 1A22B 1CD1B 5AG9A 4GBXD 1G6RL 4JKPL 3IDNA 3MJGX 4P23D 3OZ9H 1NAKL 3G04A 2VB5A 5DT1L 5EOTA 3N1QC 2AK1H 5GS2H 2VXVL 1ZTXH 3FB6A 4LPTA 1FYTA 3BP5A 2VIRB 4Z5RB 1VFAA 3U79A 4DN4H 2UYLB 4JB9L 3IFOA 4XHJC 2C26A 1A6VL 3G5YA 1A7OL 4H8WC 1RZGA 5L2KA 2VLJD 3R06A 4LKCB 1OM3H 4QHKI 3PWPB 1M6OB 4F33B 4LMQE 3V4VL 4KTDH 3D69B 1RIVL 5DVKA 3CFCH 3RKDC 4CVUA 3D1MC 2ZOKA 3FO2B 2CH8A 2GJJA 4LPYA 2VQTA 1Q9OA 3IYLW 2EXWD 4H88L 4YFLF 3LQZB 4X6BA 4G8FA 1JZ3A 1J87A 5B38A 5H94A 2CO7B 4QRSB 4KZEH 1A1MA 5EN2A 3RUGE 5IMKB 2HA1A 1A7NL 4J8RB 1VKXB 2ZJSL 1T22A 2IPTH 3HN3A 2CIKB 2X1OA 2DM2A 2E3VA 4Y19E 4Z76B 3WL9B 4U6HA 5IB3A 2NCMA 4XP5L 1XGUA 2Y4SA 1UA6H 4DZBA 4JCMA 3VWJC 4HXBH 3MROA 3WO4C 1QBAA 3DHJA 5F8RC 3CCHA 5DJZA 3BZFA 4OIAA 4YDIH 4KZDL 1UKSA 4HWZA 3CFKA 4GRLB 1HXYB 4LPXA 3BZEB 3GMOA 1YEJH 3L3JB 5IHUL 4U49A 3K2MC 2FIKA 5D7JD 5IFJB 3BH9B 4OTXL 3DVGB 3KLAB 1K2DA 1S9VA 2VDPH 2XWBA 1SHMA 5KSBF 3QNXB 3T65B 2ZSWB 3SGDH 5GGVY 4HPYH 1FVCB 1OHQA 1F90L 4UQ2B 3BQUD 5FB8A 1OPGH 3NN8B 3DTXA 1T6WA 5T1LD 1VGKB 4GG6F 3BZ4B 4JFDB 2R9HC 1FZKA 3MV8A 2W92A 4WUKL 2YMXL 4LDEB 4JY4A 1VERA 4G9FB 5ESQA 3FN0L 3U4BH 5C0IA 5E03A 2BY3A 1KEGL 3IFLL 4HX1A 5FK9A 4YXKH 5HHOD 3RWFA 4DQOH 4GG8A 1EXUB 3DI3B 4ENEC 3VGBA 5E6IC 2DQDL 5C0BB 2GUOB 4X5XA 4GKOA 2W0LA 1GZPB 1MEXH 4GKSA 1KPRA 2SEBA 2BK8A 4JZOB 4V1DD 1U8HA 4YHZH 4LF3B 2Y36L 4GMSH 2Z92B 5I1CL 4QRTA 5E2TH 1MI5B 4FQIH 4KGJA 3L3KB 1CLOH 2E9BA 2OL3H 5K33A 2X6MA 2VZVA 4P9ML 3FRUA 5ACMA 1T0MA 5FOBA 2G9HB 3MJ7A 1DLFL 3ARFA 3C87A 1CFQA 1FFNB 4Y5VC 5TF1H 5EB9A 1G9NC 3HNSH 4IHOB 4GAGL 1PD6A 4ODSH 2OZ4H 5MHSE 5DFWH 4YXHL 4NKOA 5K9OB 1JGVH 5EU6B 3ZSTA 2AEPH 1XFPA 2V2XA 1CQYA 4ZMAT 2DL9A 1I4FB 4XVTH 5EFIB 1U3JA 4OF3A 3H7BA 4X8JA 1U0QA 1TJHL 5L88L 5E99H 1BOGB 5CILL 4JRYA 1WLHA 2YKLH 3QHFH 2I9TB 1X5YA 4MSWB 3WNNA 1C5BH 5BQ7B 3QZWA 3O9WC 3QQNA 5JXAL 3DETC 1EHLL 4PLKD 4XXDA 4RA0C 1DBAL 3BIAX 1WISA 2NY5H 3L5JA 1JGLH 1UXWA 4KDWA 3SJVA 4XNMB 4BK5A 2R4SL 1YEEL 1I8MA 3VGAB 2YXFA 1AJ7L 1PKQE 1BHGA 5D1XA 1ZA3A 1K8DA 3UDWC 4OD2A 2HWZL 1W2KT 4YHPB 1NCDH 4HFUL 2OZ4A 4E41A 4PJXE 4JO3H 1RD6A 3KWWA 4RRPA 5F88B 2H32H 3HI6L 3SDAA 4QHMA 3CH1B 3CSYA 4LVEA 4OLUL 3PJSA 5E2VH 3W11C 2JIXD 4KY1L 4LCCA 3ECBB 3TO4C 1RJLB 4PB0H 1KLFA 1AO7A 3INUH 3W5MA 4OZFB 3LDBC 1PEWA 4M5YH 1GAFH 3ARZA 3VMNA 5HGDB 1CFTA 5DK2A 5LWYH 2GK0A 4QTIL 1TDQA 4U7SA 2EDJA 3WDHA 3EJZC 1PJ9A 2NY3C 3E6HA 1KN2L 1RUPH 2GT9B 1EHXA 2BCKA 3H9SB 2V5TA 3L95B 2OI9C 1J9CT 1QLFB 3TV3H 5KOVC 1EGJH 4JZJA 4UNTA 4GXVH 1H5BA 3UPRB 1JIBA 2EIEA 4F3FB 3QDJE 1JRHH 4ODVH 1I3RA 4X6DB 1KFAH 4YC2B 3NZHH 3OKKB 3OR6A 1YPZA 3RI5F 4ALAL 4X5WB 1QSFE 3O81A 4PJIA 1FSKC 4N8CH 4MNHB 1NANH 3UPAA 1MLBA 5E0QA 3E1F1 1J18A 3G6JE 4IMKC 2ZNXA 4NDMB 4PJAB 1KENH 3DVNA 4MVBC 3BRDA 2AK4A 2X4QB 2WM0A 4LSVL 4OZIE 4LK4A 3EYOA 4HKZB 2DI7A 2KPNA 5T5NG 1FRGL 3BKYL 4NWTL 2CK2A 1X9QA 1DQTA 3JZ7A 2R2HA 5I1AB 4N5EC 4YH6A 4OLEA 1NBQA 2JJWA 4QXGL 1WF5A 1FAKT 1MQKL 4RZCA 1LD9A 1A6ZA 3RDTC 1AKJA 2G5BB 3WFDH 1VEOA 1NCWL 5D71H 2NY0B 4H1LH 3K4AA 3PV6B 4UV4H 5HYQA 1EGJA 4NNPL 4UQ3B 1XCQB 1C5DA 1FL3A 8FABB 4HH9B 3WXWH 4JO4L 4H26B 5C07D 5D70L 2ED8A 1F2XK 1A7RH 3QWOA 1N6QL 3OAYK 4RSVA 2C9AA 4FG6C 1YQVL 4U1SB 1UJ3C 1I8LC 4AZ8A 3IDXL 2LTQB 3DIFB 3RUGF 3LEYH 5ERWA 3FT2A 1KTRL 2QR0B 1MFDL 3FN3A 1UWGL 5JXEC 2CKBL 1OAQL 5FCUH 4L8CB 2A6DA 4TSCH 4ODXB 3PWVA 1I1AD 1VENA 4Z77A 5I15L 2GI7A 4WRLA 1FG2A 2QQLH 1IAOA 1P1ZB 3CK0H 3DO7A 4XNZB 3BGMA 4O51B 1EHAA 2DYPD 4JJ5B 4MD4A 3OJVC 4HK0A 3GBNL 5F7DB 2IPKB 2NPLX 1S7RB 4I13B 1I7ZA 4H1LA 4JLRA 1U2CA 1U8QB 3QO0A 4IIQC 4KI5C 4L9LB 4P46B 3HG1E 2XRAL 4QXTB 5GSVA 2CDGB 2GTWB 4MJ6B 1OWWA 1IZJA 5I1IL 2GY5A 2VXUH 2VQ1A 3BEWA 4GAJH 3P4NB 4G6JH 2NW3B 1YECL 2X4PA 4JVPA 4AEIH 1QPPA 1RQ5A 2YPKB 5D7IA 3RGVD 1JNLL 4GLRI 3MFFA 3RI5K 3WV0A 1NBYA 3S88L 1IE5A 1GIGH 1H3PL 3BESR 4Y19D 2GTZB 3KXFB 1KXQE 2JE8A 2WMPA 1DR9A 4JR9L 1ZVSA 3SCMD 3HE7C 4XAWL 5HI5C 3H42H 5JXED 2PF6A 5EBLA 2Y07L 4EN3A 4JGJA 3UPCA 1I7TB 1KTDB 4ONGL 3MACL 1EJ6A 3QFJA 3WIIH 3BVNA 4PIRF 2Q76B 1SBBA 4KK6C 1ZHLB 3HNVL 5HVHC 3C60A 2NY1C 5HY9A 5FO7B 3RP1A 2IH1A 1IJ9A 4ODTL 3GK8H 1JPTL 3MBED 4YE4H 4MJIA 1FG9C 5MENB 2FGWH 3MA7A 4HZLB 4U1NA 1BAFH 1X7QA 2CMRL 2GJZB 2YC1B 4GSDH 5JNYA 4G8GE 2OJZH 4NHUA 2EDTA 3V0VB 3HC4L 1P84J 3O6FC 5KZCD 1ED3B 3MV9B 2A6KB 3RY5A 1FQ9C 2B0SH 1A02N 1BGXH 3JUZA 5DK0B 4JM4L 1WZLA 1QQDA 4CMMA 3DMMC 1MHCA 2D7NA 1WSST 2X4RB 3B9DA 5MEPB 1X6LA 3GGWB 1WV7T 1BEYL 1U92B 3OKOA 1N0LA 3QWRA 4Y4KB 2ICWA 2FCBA 2FX8L 2AABH 4XPHL 3LHPL 4YWGL 1QFWH 1AP2B 5KW9L 3T8XA 1CE6A 4ODUA 1B4RA 4NHCH 3VW3L 5J6GB 4EI5B 2AJ3A 3W39B 4HWEL 5KVFH 1Y18B 4R0LC 5JA9A 2GKIA 5DD5L 2PXYA 3ZKND 4F7EA 4I2XB 4JFEE 5DZLA 4ZTOL 1HHHB 5BS0E 4CGTA 4Z7WA 3ZDZF 3BP7B 3PHQA 4FFZL 1XIWA 2YXMA 2NX5B 4HJJL 4B5EA 3PGCB 2R4RL 4LP5A 3UO1L 2AJZA 2BVOB 2R2BB 3IETA 1KACB 2H1PH 1NFKA 3DMMD 1JZ7A 4UILL 5SWSA 1WT5A 2VLRE 1ZT7A 3GSNA 3RWGB 4WTWA 4NM8L 4PJBB 1FZJA 5GQBA 4RRPG 3ARBD 1BFTA 1I8IA 1P2CB 1GOFA 2F53B 4OCLC 4Q97A 4XVJH 3KYKL 1C12B 3FCTB 2ZOLA 4M03A 3SDYH 1OGAB 4FFVD 3KPLA 5CSZA 1RJZB 5DFVC 2XTJB 3FB8A 3VXUA 3WLBB 3HRZA 5SWQB 1J5OH 3R1GH 4MA7H 2VDMH 4C56E 1JYVA 1INQB 4HUXA 4M6NH 1Q9WB 2FATL 1EH9A 5DFTA 1KCUH 4O9HL 5CBEA 2PYEB 4IRSD 4J3TA 1LK3H 5L6YH 4GW1A 1TPXC 4JHWH 5JLZA 4LASH 4GRWE 1MHHA 1UH2A 3G6JF 4EKXA 1RIUH 1DE4B 2C3VB 1UVQA 3JV4A 3JWDL 5JZ7C 4AG4H 3RIAK 2JKXA 4NQSA 1RULH 4OZIF 4EOWH 2PCPB 1T7WA 3O2DH 4J4PC 4KHXH 3THML 4XPBH 1UEMA 4LVNC 4GAYB 1SEBB 2P8MB 5EZJB 1ZHBA 3QIBD 4FNLH 3UXFA 5H2BA 2ADGB 1NFDE 3V8CA 1NCCH 3M45A 4PJ9A 1SJEA 3EOYG 4YHKH 3PDOA 3SDCB 1FNLA 5FF6B 5INDA 2DL2A 4LMQI 2OK0L 5JO5B 2V9QA 3KPRD 4DK6A 3ILQD 1MVUB 2OQJB 1SEQH 3QDJD 3ARVA 4PS4L 3NIGE 2GCYB 1D7FA 3JWOC 4KK9C 3PWLB 2EIZB 5FUCC 3RVUD 3T3PF 4GBXB 3JVGA 1NPUA 1GRWA 12E8H 1QSFD 4BH8B 1GH7A 4DKFH 1TITA 1ES0A 3BIBX 2W9EH 5T1KA 1PBYA 5C6TL 2R1XB 2X4TA 5IQ9A 1OWRM 3EO0B 3MRRA 3MOBL 4AL8L 5GZNC 5KSAA 1BWWA 3OGCB 1MCKA 3UP1A 2EYRA 4QT5A 1ZLVH 4PRPE 4ZOBA 5DUBA 1CFVL 4XVUD 4L4TE 2VLJB 1PVHA 1JPSH 1G6RB 4JY5H 2R0LL 1DL7H 5JZ7D 1MRFH 3VXOB 3LMJH 4YHIB 4JANB 4PY7A 3WFZA 1H8OA 1Q72H 4NZDA 2ZUSA 3LPWA 4UT9H 4X7FC 3IAPA 4IDJL 2HT3D 4UMGA 1PG7H 1KB5H 2CDFA 1MCLA 2DQTL 4YHLL 1RK0A 3FOMB 2Q3AA 3IJSB 4L4JA 1F42A 1YNTB 4WEUD 2WWMD 3DX8B 4OM1H 4HIEB 5AEAA 4MQSB 1MWAL 4XNYL 3VG9C 1FGNL 3QUMH 3ZKMC 5BXFA 4U1IB 5IJKA 3BGFC 1QEWB 1X5LA 3B9KD 1KIQA 4XBGA 1CZ8L 4WGVB 4X9GA 3G6AB 1R3KB 1T03H 1K3ZA 1ZGLA 3SBWA 2VXQH 4LSTH 5JW5B 3MRDB 2DWDA 4NQXA 2MQ0A 1KJ3L 3MXVL 2QHRL 3HUJA 1UCTA 2VITB 1NGXA 4M62L 1H9VA 4TULL 1U8NA 3MRIB 2PO6A 1VHPA 3O6LH 4BQ9A 4L9DA 5IHLB 1S5IL 4QTHA 3CSGA 3H6JA 2X7LA 4LLUB 5D7JB 3H0TA 3WXVH 3KJ6H 1FGVL 4M02A 3U0TA 3VFMB 2YK1H 2DI8A 4ZO8A 3ARDC 1E4KC 3EHBC 1B4JH 1M71A 3I6GA 4NJ9H 5D5MA 4ZSOE 1KB5A 1S7TA 5I19H 3HG1D 3BQUB 4K7PL 2X1XR 4XCEB 5FUZL 1P84K 1QFOA 1TZHA 4U1GB 1HZHL 4PGBA 2OLDA 4UNUA 2BXZA 3TH4T 2XZCL 1BLNB 3KJ4B 3MBXL 1K9TA 5HI3D 3B43A 3D48R 3IJHB 4N68A 3P4LA 6FABH 5I8CA 5LGHH 4S1QL 2IFFL 2JELL 5IMMA 3QDMA 5KVGL 4BA8A 1SVCP 4DOHE 4WO4C 4JRXA 3IXTA 3STZA 5E8NA 2ZPKL 5GJSL 4A6YL 4AIZA 3U36B 1EFXD 3RVXC 1NBVL 1YEKL 1DCLA 3D85A 5L9DL 3QEQA 15C8H 4ZPTA 4ZS7H 4TOYH 3S37L 2WK2A 1T04B 3UC0L 5HHVH 1W0WA 5KSBB 1GJIA 2HTKD 1DBKH 1DQMH 1CE1H 4PJDA 2WQRA 3QI9D 5E5RB 2NZ9C 4M7KL 4U6XA 1K4DB 4UTAH 3D9AL 4GG6B 1G84A 3QDGA 3EHBD 1Z0NA 3TT1L 4PJCE 2XZZA 1R3LB 5IEKA 4WV1A 4G6KH 5DK3A 4O4YL 4KJYA 5HHQB 4HKBA 3UTPE 2JB6B 3B3IB 3KNBA 3DRTB 5D2LA 2ZUQB 4U31A 4HIHA 3FT3B 4JJHA 4W4OA 2NNAB 1TFHA 4XP4L 2BVEA 4K23L 3IDIB 4RFEA 1MSPA 2QSQA 1LO3H 3C2AH 3EOAB 1MQ8A 1H0DA 4G7YL 5AYUH 4AEFA 1MCPH 4DCQA 5JORA 1T89A 3WDIA 3EOTH 4K2UH 2E5EA 1LNUA 3MREB 4M93C 4U0RB 3LB6C 3TPUA 43CAA 2YRPA 4K94H 2N1KA 1ZLSH 2BHZA 3IAGC 4RNRA 1ZWIB 3FMGL 4LCUB 4NQCD 3TZVC 3AUVA 5K9QG 4D2NA 1O5DT 3F58H 4MXQC 3OMZA 4U6TA 1P6FA 2DWEA 3P4MB 2YN3A 3ARYA 4XXCC 4FP8L 4TUOA 2JCCA 2D03L 2GJ6E 3P0YL 3EZJB 3OKDB 4WI3A 2EZ0D 1A3LH 2JIXB 4GMTL 5IM7A 1S7SB 1ZANL 3VH8A 2G75B 4DVBA 4UBDC 2K1MA 4OFDA 4OLXL 2QQNH 3LKPA 4TSBL 5IW6A 2VR5A 3BP6B 1MPAL 4RFNC 4GRWF 5D6DA 3QXVA 3SE8H 1MLCB 1T1YA 1G7PB 5F7MC 5FUOL 5ESAB 5IVZA 1CLYL 2EYTB 1MRCL 4WEBH 2VLRD 2FSEA 3ZHLA 4ORGA 2DLTA 4HUKB 2R69H 4X7TB 1FL6B 3D39A 5EUOA 3NFSL 3ROLA 1I9JL 5CINH 1CD1A 2Z31C 3GSWB 1LP9E 1BZQK 2D4DA 5DXWA 1NFDF 3B9AA 5HDBE 3B2UD 4CJ1A 1BIIB 1UC6A 1MNUH 3P9LB 1S9WB 3DGGB 1U8LB 2HFFB 1B90A 5B39B 3QBTB 1SY6H 3T0DA 3C6LC 4MXQD 4ZUVB 2VIRA 4O2FB 1NL0H 4Z5RA 1EIBA 2UYLA 3NPSB 1WUNT 5DR5H 3S8WA 1HH9B 4K7PY 4C56D 1RFDL 1L7TL 5BRZE 1GC1H 3PWJB 4LKCA 3PWPA 4YPJA 1M6OA 4F33A 5B4MD 3D69A 4MB4A 1IC7L 4Y7MA 1UH4A 1D9KD 3QEGL 3FO2A 4HCRH 4XGZB 5CEZH 3BWUC 4KTEH 1BZ7B 5C2BL 4HK3J 1NC4D 3LQZA 4RGMC 4XZUB 2RCSL 3VGDA 4TVSa 2CO6B 4QRSA 2A74B 5IMKA 4NQVB 3VG0H 1VKXA 1FFOB 1ACYL 2ICES 4PBVC 2CIKA 3WL9A 4OCRH 5IIEB 5C07B 4I77L 2W0FB 1HHJB 1QNZH 2ZCKH 3EO9L 4NZJA 2V7HB 1CD8A 1SY6A 1BMGA 5I18L 1OARL 3CH8A 3FONB 2IQ9H 3C6LD 4M1GL 4NWUL 1IGMH 4LVHC 4KKLC 1IGJB 4Y2OA 3ISWA 3MC0A 1HXYA 5TGBB 1G9ML 3BZEA 5L0QB 5CJOH 2J2ZA 2YWYA 3L3JA 5F96H 1Y0LB 3G5XB 5IFJA 3BH9A 3KLAA 2R2EB 4QOKE 1I1AB 2L7UA 5IB1B 4HCRA 3QNXA 3T65A 2ZSWA 3VFRB 4RQQB 1AIFB 4G8IB 4PRPD 3NIFE 3E8UH 3PGFL 1FVCA 4UQ2A 2DYPB 3O3UN 3NN8A 4L4TD 1VGKA 4L1DA 3BZ4A 4JFDA 4C4KT 1WK0A 1HK6A 4HJ0D 2FYYB 3KYMB 3SGKA 5ISZE 2OS7A 4M6MH 1L7IH 2HT2C 4G9FA 5H8DA 2UY6A 2W07A 5EOCH 1S7QB 3NA9L 1EXUA 3KS0J 2DTML 4LCWE 5KTEL 5C0BA 2GUOA 1FDLH 1X5XA 2BSTB 4P48A 1I9IH 1T6VN 2D7QA 4P2CG 1GZPA 3G08B 4NOFA 3RBGA 3ARGC 4JZOA 3RGVB 3CD4A 4NFBA 4LF3A 3RUGB 1MJUL 4S1DC 5IVXF 3X3GH 2Z92A 2P43B 1MI5A 2VWEE 1OSZB 4Y19B 5BV7L 3L3KA 2DQHH 2X42A 3FQTB 3SCMB 3T0BA 3T2OA 2G9HA 5HI4C 1FFNA 4UT6H 4U6VL 3CLFH 2Z8RA 4OGAC 4QWWD 4IHOA 4CN4A 5ECJE 1QKZH 3UTZB 1TVHB 3LS5L 4LSQH 5I73B 2M8XA 4ODBD 2EEDA 2IBZY 3ZE1E 5K9OA 4FZ8L 4Z7VF 1UM4L 3DROB 5ILTL 2CRIA 1B88A 4AMKH 5GPRA 4RMTA 5EU6A 3RPKA 4XT1C 4L29B 3I2CL 5D2NE 4DGYH 1I4FA 3MBEB 5EFIA 4TVPH 2IG2H 4OZFH 4OLVH 4LQFH 1YNKH 2F54E 4Z8FL 1BOGA 3AFLA 1LO5B 3A6BH 2IC2A 2KZWA 2X70B 4MSWA 5D96B 1KXVC 4XC3H 5DD0H 5BQ7A 4KQ3L 4KUCF 3MJ6A 4YHYB 4L8SB 3U30C 2FJFB 3OJMB 2APFA 1CTNA 1CGTA 3VFTB 4MB3A 1F5WA 1BBJB 3P4OB 2EDRA 4XNMA 4UDUB 5IGXL 4WWKC 5E2WH 1HILB 4AM0B 1JMXA 1TTGA 4N9OB 1JHTB 5I17B 4XCCH 5CGYD 4LEXH 4LLYB 4P0DA 4LGRB 1QP1A 2J6EL 5CD5C 1BFVL 2EXYC 4NKIH 4YHPA 1WQVT 4KXZI 5F88A 2A6JB 2UWEF 4N0FB 3VFGH 4KMTH 3CH1A 5KSUB 1ZOXA 3CDYA 2A0LC 4B7LA 5D1QB 1N26A 3EYSL 2ZKHL 3ECBA 4OLWL 1RJLA 3MZGB 4I3SL 4NO2B 2EDDA 4OZFA 1UWXK 1U3ZA 2Q20A 1VFBB 1P4BL 1REIA 3PNWB 5D1ZB 4EBQL 5HGDA 4NSKB 4WW2F 4KUCD 3V4PL 1WJ3A 1A6UH 1PQZB 1RUKL 4XCNB 2OR9H 4WHDA 5FOJA 5GZOD 2J5LC 3DVIA 1RU9H 2GT9A 1A3QA 4P3CH 4YGAB 2QSVA 3H9SA 3L95A 5JR1H 1QLFA 4UOW1 4XPAH 1IAMA 1U3YA 3UPRA 4ZAKC 4F3FA 3O4OB 5LCVH 1I1YB 4X6DA 4OJFL 1S9YB 3SQOH 3GKZA 3OKKA 3RVUC 4LSSL 1QSVA 3OL2A 2AS5M 3BZDA 3MLVH 1JGDB 2J88H 4X5WA 4UNVA 4XMPL 3EDFA 3BKCH 3GHBL 2W38A 2YPLE 3OB8A 2VH5L 2CK0L 2DQEL 4GUPB 4LSPH 1PKQB 1LP9F 4NDMA 1HINL 5HDBF 2X4QA 3FT4B 1U6AL 3CDCA 4NJAH 3LQMA 4PJXB 2ZUUA 4M5ZL 3GSVB 5I1AA 5CCKH 4Z18A 3C8HA 5BO1H 1CN4A 2GJ6D 5E8DH 4IRSB 4LCIL 4X4YB 3RL1B 1Z3GH 3U1SL 1HWGB 3GSUB 2ILLA 5F89B 1B6DA 2G5BA 4CADB 5ADOL 1QFUL 2X4SA 2X4NB 1WAAA 5C6WH 3BAEH 3PV6A 2YN5A 1HIMH 4UQ3A 3PP4H 3RJDA 1XCQA 3I75B 8FABA 1RVFL 4HH9A 4OZHE 1YC7A 1JGUH 5C0RH 1LE5B 4RGNC 4H26A 3QIBB 5JIHA 1DSFL 5FO9B 1BX2A 4NCC1 2VXTL 3ZLQC 4LFHD 4U1SA 3ZYOA 1PEZA 3DIFA 4MA3B 5E2JA 4JCLA 4KAQL 5GJTL 1AQKL 3RPIB 2BVTA 3HMXL 3LV3B 3UZQA 3LPFA 2QR0A 4OCYL 3EDKA 5T1DH 3QDJB 5CJXA 1QSEE 4M7ZC 1RZKL 3U7WL 4L8CA 4P4KD 4E5XB 5D8JH 4ODXA 4D9LH 1QTYT 3AAZB 3K81A 2D7OA 3NBNA 1X5ZA 1KJ2B 1KCVL 1QSFB 2IPUK 2M2DA 3F8UB 4MD0B 4Q58C 3S3PA 1P1ZA 3B2VL 5J11B 4O51A 3BGAA 1BM3H 5LG1A 4YR6B 4JJ5A 4NZTH 3G6JB 5BRZD 1T7VA 1EEZB 4I3GA 5F7DA 2IPKA 4LSRL 1FYTD 3MRLB 1U8QA 5JW4R 2HLAB 4L9LA 4P46A 2ITDB 4OLYL 4QXTA 1TCRB 2CDGA 2GTWA 4MJ6A 4M9PA 4OSUL 3UJIH 1WCQA 2OMBA 1F4WL 3VD3A 5C8JA 3MNWB 4FMKA 3NIFF 1G7LB 3P4NA 3MNVA 2NW3A 3UBXG 4JAMB 3S35X 2YPKA 5CIPB 3DARA 2MHAB 4WHYH 4YFDB 2PYFB 1U8KB 4LARH 5F3HB 3T4YB 2E9JA 3AM8A 2AK1L 4EUPG 4H0IA 3B9EA 1KJVB 1U93B 4HAFA 1NGQL 2GTZA 3KXFA 4DN4L 1T2QH 5GRYA 3WHE1 5EU4B 2KH2B 1PZUB 2F8VA 4MQXC 1OM3L 3EDEA 2WIIB 4U1JB 4KTDL 4DFHA 4QY8B 3UTQA 1I7TA 3BPNC 1KTDA 5GS2D 3WFEL 4F8QA 3MLUH 2Q76A 1Z0MA 3T2PA 1ZHLA 3V2AR 4QOKD 1FIGL 1CF8L 4Y4HD 5FO7A 3PL6D 3AY4A 2F19H 3U7AA 1F6AB 4BQ8A 1MWAB 2JJSA 3H9HB 2NZIA 3GM8A 5MENA 4HZLA 4D94A 3ARFC 1TXKA 2GJZA 2YC1A 2IPTL 5T5FH 4XP9H 3V0VA 1CGXA 1UA6L 4MD5B 5CUSL 1ED3A 3HG1B 3MV9A 4PR5B 5CJ5A 3ZE1F 2A6KA 3C5ZD 4TUKH 5DK0A 3VXQB 3GMQB 1R6VA 3MV8D 1T3FA 2KKQA 4MYWB 2D0FA 4GW4B 1WTLA 3RL2B 3P9WB 2X4RA 4FOMA 5MEPA 4GJTB 3GGWA 4FZEH 3IB4A 3Q5YA 1KG0B 4ZUWB 1U92A 1YEJL 2FJGB 4G5ZH 2Z8SA 4Y4KA 3BDBA 2PTTB 4MQXD 4Y16B 2VDPL 1AP2A 2DM4A 4BYHA 2YA2A 4PJ5E 2XI9A 1F4YH 4PFEA 1OPGL 1EFXB 5J6GA 4EI5A 4X0KB 3DRQB 2MWCA 4Y5XB 3LOWA 3TJHC 2WWKT 1X3DA 3W39A 3WS3B 3QHZL 1Y18A 1ZXQA 3HPJB 3O41B 1UJTA 1OT1A 5F7EH 3NMEA 4DKAA 2B4CL 2JLLA 5D1XC 3ARPA 1NH6A 4I2XA 3TP4A 3QI9B 3ARFD 2RFXB 4DQOL 3QJFB 1HHHA 2DQGH 4MDIB 4Y4FD 3HPLB 4S0SD 4A6YB 4YBQD 3RY6A