3ZLAA

Crystal structure of the nucleocapsid protein from bunyamwera virus bound to rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
234
structure length
229
Chain Sequence
GSMIELEFHDVATFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKTSLAKRSEWEVTLNLGGWKITVYNTNFPGNRNNPVPDDGLTLHRLSGFLARYLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEVQSALTVVSSLGWKKTNVSAAARDFLAKFGIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleocapsid Protein Structures from Orthobunyaviruses Reveal Insight Into Ribonucleoprotein Architecture and RNA Polymerization.
pubmed doi rcsb
source organism Bunyamwera virus
molecule tags Viral protein/rna
molecule keywords NUCLEOPROTEIN
total genus 69
structure length 229
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00952 Bunya_nucleocap Bunyavirus nucleocapsid (N) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.142.20 Mainly Alpha Up-down Bundle Poly(ADP-ribose) Polymerase; domain 1 Poly(ADP-ribose) Polymerase; domain 1 3zlaA01
3.90.25.50 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase; domain 1 3zlaA02
3ZL9A 4J1GA 4J1JA 4IDUB 4IJSA 4IDUA 4JNGA 3ZLAA 4BHHB 4BGPA 4IDXA
chains in the Genus database with same CATH superfamily
2ZCVA 4GV7A 1SB9A 1FXSA 1GS0A 1EK6A 1KVSA 2EXXA 1Z73A 5GY7A 1I3NA 2PAWA 1E7RA 4BHHB 3SC6A 3SLGA 1K6JA 1OC2A 4IDUA 4ZZZA 1RPNA 2PZJA 3GN7A 3PVZA 4JNGA 1VL0A 1A9YA 1E6UA 4IDXA 4EJ0A 4OPXC 4WPGA 4WOKA 2VRBA 1UDBA 2X6TA 1NAIA 5IN4A 2P5YA 1KC1A 4XHUA 4ZRMA 2QYSA 1KC3A 4L7LA 1N2SA 1UDCA 3L3LA 1LRKA 5A00A 4G5HA 3RUAA 1QYDA 2UV8A 1GY8A 4ZZXA 5U9CA 1I3MA 1K6IA 2VUUA 3W1VA 3L3MA 1HZJA 4L7UA 4IDUB 2GN4A 2QX7A 1Z7BA 1Z45A 1KVQA 4B8ZA 3GJWA 2C5EA 1UK1A 1U9JA 2UDPA 3I6IA 2GASA 1WOKA 3RU7A 3ZLAA 4GV2A 3I52A 1LRLA 1DB3A 3PAXA 2CNBA 1I3KA 2GNAA 1QRRA 3KO8A 1QYCA 1KERA 2R2GA 4L6ZA 4HHYA 4L7RA 4GV0A 2HUNA 2VUTA 3VPSA 2R6JA 1BWSA 4GLLA 3AW9A 4ZRNA 2Q1SA 3KJDA 1KEWA 1R66A 1K6XA 4L6SA 1TI7A 1I2CA 2GGSA 1GFSA 4LW8A 1KEPA 3DXFA 3FHBA 4L70A 1UK0A 3ZL9A 4J1GA 2C5AA 2Z1MA 4IJSA 3ICPA 3SXPA 4UNDA 2X86A 2C54A 1I3LA 1KVUA 3RUFA 4BKPA 4RV6A 1BXKA 2VRCD 4OQBC 4OQAC 5IN5A 3E48A 2JL1A 3C4HA 3RUHA 4ID9A 4B8WA 3VVCA 1T2AA 1N7GA 3C49A 1KVRA 1UDAA 3ENKA 1BSVA 3I6QA 2C20A 4E5YA 4L7NA 4HHZA 3C1OA 2GN9A 2B69A 1EFYA 2Q1UA 3EHEA 1KEUA 2GN6A 2VUSA 1XGKA 2Q1TA 1XELA 4BL5A 2QW8A 1A9ZA 4PJVA 4PAXA 1WVGA 4J1JA 2WM3A 1G1AA 4R5WA 1E7QA 2P5UA 4TVJA 4DQYC 3RU9A 4PJTA 1SB8A 3RUDA 3CE0A 1I2BA 1RKXA 3RUEA 2WMDA 1KETA 1N7HA 1R6DA 2RD6A 1KBZA 1PAXA 4L7OA 1Z75A 2ZCUA 3LU1A 2BLLA 3RUCA 1KVTA 2PK3A 2QZZA 2PAXA 1NAHA 4R6EA 4L7PA 4LISA 2VRCA 1EK5A 1A26A 1EQ2A 1Z74A 4IDGA 2C59A 4ZZYA 3E5MA 4GV4A 2GN8A 1E7SA 4UXBA 2Z95A 3C3XA 3I5MA 2HRZA 2RCWA 4TWRA 3KCZA 1LRJA 4BGPA 1I24A
chains in the Genus database with same CATH topology
3W1VA 3ZL9A 4J1GA 4IDUB 4IJSA 2GN4A 4BHHB 4IDUA 4BGPA 4ID9A 3PVZA 4JNGA 3ZLAA 4IDXA 3VVCA 2GNAA 2GN9A 4IDGA 2GN6A 2GN8A 4G5HA 2UV8A 4J1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL9 A;  4J1G A;  4J1J A;  4IDU B;  4IJS A;  4IDU A;  4JNG A;  3ZLA A;  4BHH B;  4BGP A;  4IDX A; 
#chains in the Genus database with same CATH topology
 2ZCV A;  4GV7 A;  1SB9 A;  1FXS A;  1GS0 A;  1EK6 A;  1KVS A;  2EXX A;  1Z73 A;  5GY7 A;  1I3N A;  2PAW A;  1E7R A;  4BHH B;  3SC6 A;  3SLG A;  1K6J A;  1OC2 A;  4IDU A;  4ZZZ A;  1RPN A;  2PZJ A;  3GN7 A;  3PVZ A;  4JNG A;  1VL0 A;  1A9Y A;  1E6U A;  4IDX A;  4EJ0 A;  4OPX C;  4WPG A;  4WOK A;  2VRB A;  1UDB A;  2X6T A;  1NAI A;  5IN4 A;  2P5Y A;  1KC1 A;  4XHU A;  4ZRM A;  2QYS A;  1KC3 A;  4L7L A;  1N2S A;  1UDC A;  3L3L A;  1LRK A;  5A00 A;  4G5H A;  3RUA A;  1QYD A;  2UV8 A;  1GY8 A;  4ZZX A;  5U9C A;  1I3M A;  1K6I A;  2VUU A;  3W1V A;  3L3M A;  1HZJ A;  4L7U A;  4IDU B;  2GN4 A;  2QX7 A;  1Z7B A;  1Z45 A;  1KVQ A;  4B8Z A;  3GJW A;  2C5E A;  1UK1 A;  1U9J A;  2UDP A;  3I6I A;  2GAS A;  1WOK A;  3RU7 A;  3ZLA A;  4GV2 A;  3I52 A;  1LRL A;  1DB3 A;  3PAX A;  2CNB A;  1I3K A;  2GNA A;  1QRR A;  3KO8 A;  1QYC A;  1KER A;  2R2G A;  4L6Z A;  4HHY A;  4L7R A;  4GV0 A;  2HUN A;  2VUT A;  3VPS A;  2R6J A;  1BWS A;  4GLL A;  3AW9 A;  4ZRN A;  2Q1S A;  3KJD A;  1KEW A;  1R66 A;  1K6X A;  4L6S A;  1TI7 A;  1I2C A;  2GGS A;  1GFS A;  4LW8 A;  1KEP A;  3DXF A;  3FHB A;  4L70 A;  1UK0 A;  3ZL9 A;  4J1G A;  2C5A A;  2Z1M A;  4IJS A;  3ICP A;  3SXP A;  4UND A;  2X86 A;  2C54 A;  1I3L A;  1KVU A;  3RUF A;  4BKP A;  4RV6 A;  1BXK A;  2VRC D;  4OQB C;  4OQA C;  5IN5 A;  3E48 A;  2JL1 A;  3C4H A;  3RUH A;  4ID9 A;  4B8W A;  3VVC A;  1T2A A;  1N7G A;  3C49 A;  1KVR A;  1UDA A;  3ENK A;  1BSV A;  3I6Q A;  2C20 A;  4E5Y A;  4L7N A;  4HHZ A;  3C1O A;  2GN9 A;  2B69 A;  1EFY A;  2Q1U A;  3EHE A;  1KEU A;  2GN6 A;  2VUS A;  1XGK A;  2Q1T A;  1XEL A;  4BL5 A;  2QW8 A;  1A9Z A;  4PJV A;  4PAX A;  1WVG A;  4J1J A;  2WM3 A;  1G1A A;  4R5W A;  1E7Q A;  2P5U A;  4TVJ A;  4DQY C;  3RU9 A;  4PJT A;  1SB8 A;  3RUD A;  3CE0 A;  1I2B A;  1RKX A;  3RUE A;  2WMD A;  1KET A;  1N7H A;  1R6D A;  2RD6 A;  1KBZ A;  1PAX A;  4L7O A;  1Z75 A;  2ZCU A;  3LU1 A;  2BLL A;  3RUC A;  1KVT A;  2PK3 A;  2QZZ A;  2PAX A;  1NAH A;  4R6E A;  4L7P A;  4LIS A;  2VRC A;  1EK5 A;  1A26 A;  1EQ2 A;  1Z74 A;  4IDG A;  2C59 A;  4ZZY A;  3E5M A;  4GV4 A;  2GN8 A;  1E7S A;  4UXB A;  2Z95 A;  3C3X A;  3I5M A;  2HRZ A;  2RCW A;  4TWR A;  3KCZ A;  1LRJ A;  4BGP A;  1I24 A; 
#chains in the Genus database with same CATH homology
 3W1V A;  3ZL9 A;  4J1G A;  4IDU B;  4IJS A;  2GN4 A;  4BHH B;  4IDU A;  4BGP A;  4ID9 A;  3PVZ A;  4JNG A;  3ZLA A;  4IDX A;  3VVC A;  2GNA A;  2GN9 A;  4IDG A;  2GN6 A;  2GN8 A;  4G5H A;  2UV8 A;  4J1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...