3ZLEA

Crystal structure of toxoplasma gondii sporozoite ama1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
382
structure length
382
Chain Sequence
GQNPWATTTAFADFMKRFNIPQVHGSGIFVDLGRDTEGYREVGGKCPVFGKAIQMHQPAEYSNNFLDDAPTSNDASKKPLPGGFNNPQVYTSGQKFSPIDDSLLQERLGTAGPKTAIGRCALYAYSTIAVNPSTNYTSTYKYPFVYDAVSRKCYVLSVSAQLLKGEKYCSVNGTPSGLTWACFEPVKEKSSARALVYGSAFVAEGNPDAWQSACPNDAVKDALFGKWEDGQCVPFDTKTSVQSDQATNKEECWKRVFANPLVASDAPTTYPEAAQKNWNDFWPVHEQSSPKSGGFGANWANFYLEKESGETICAIFDQVPDCFAPITGAVAYTALGSSTEVNLPQCDSASFIPIEGPCNNCVQVVTECVGNQFDQTSKACCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1
publication title Toxoplasma Gondii Sporozoites Invade Host Cells Using Two Novel Paralogs of Ron2 and Ama1
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 98
structure length 382
sequence length 382
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3zleA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3zleA01
1NK1A 5CT3A 4Z09A 3HMTA 1BHTA 4Z0EA 2J8JA 5CS3A 4R19A 4UAOA 1GMNA 3HMSA 4Z0DA 4APMA 4APLA 4R1AA 2LL3A 3HN4A 3ZWZA 2LL4M 2YIPA 2Y8RA 2HGFA 3SRIA 3SP8A 3ZLDA 2J8LA 2QJ2A 5CSQA 5CT2A 2Q8BA 5CS5A 1GMOA 2Z8WA 2X2ZA 2Z8VA 2F83A 3HMRA 4Z0FA 1Z40A 4A5TS 1I8NA 5CS9A 5EODA 1HKYA 1YXEA 5CS1A 4UV6A 2YILA 5EOKA 5I25A 1W8KA 5CT1A 2Y8SA 2K13X 4YIZA 4R1BA 5CP9A 2QJ4A 3ZLEA 4IUAA 2YIOA 1GP9A 3MKPA 5COEA 1W81A 3SRJA 4DURA 2Y8TA 4R1CA 2Q8AA
chains in the Genus database with same CATH superfamily
3ZD1A 2EHFA 4JHSA 3GXEA 5CT3A 3MQLA 5CS3A 4PZ5A 3FGRA 4R19A 1GKNA 1C1ZA 1VVCA 1H03P 4APMA 1SS2A 1VVDA 3ZD2A 5HYUB 2CG7A 4MSLA 3ZWZA 3OXUD 1OJWA 1GPZA 1RLHA 2ZYCA 3R62A 2HGFA 2I2LA 3SRIA 1OK3A 2XWJI 3M7PA 2J8LA 5HZPB 5CT2A 3K3TA 3O8EB 2Z8VA 3EJHA 1Z40A 4A5TS 3NJAA 2RKYA 2ERJA 2LOJA 1HCCA 4YIZA 1TPNA 5CP9A 3ZLEA 4DURA 1HKYA 1QUBA 1NWVA 4YIVA 1HFIA 2O39C 5DN5A 1ELVA 2YBYA 2UWNA 5FO8C 2KL5A 1U5MA 1HFHA 1MD8A 4UAOA 1OK2A 4YNXA 2BZMA 3SW0X 2EC3A 4LOSA 1Z92B 4AYEA 2G7IA 2LL3A 4BWCA 1PPQA 4DJZA 1LY2A 2LL4M 3VWOA 4LOTA 4A5WB 1SRZA 3RJ3D 3ZLDA 4ONTD 4MUCA 5CSQA 3GOVA 1FBRA 2KMSA 1E8BA 2F83A 3HMRA 4KKDA 2MCYA 5CS9A 2XRDA 3FGTA 5CS1A 5HYPA 3T5OA 5EOKA 4AYIA 2QJ4A 4IUAA 3MKPA 4PO7A 3F6KA 1W81A 4K12A 2QY0A 2IZ3A 1NK1A 2XWBF 3HMTA 1BHTA 4Z0EA 3KXVA 5DN4A 2RL0A 1ZJKA 3KZJA 3HMSA 1Q3XA 4Z0DA 1TPGA 3OP8A 4APLA 2RKZA 3HN4A 2RLQA 2YIPA 2JGXA 3CALA 4AYDA 1H2PP 2W80A 1OJVA 1H2QP 4FXGG 2Z8WA 2X2ZA 2V8EA 1TPMA 2CG6A 2JGWA 2MCZA 3L89M 1YXEA 2YILA 2WIIC 3IX0A 1W8KA 1OK9A 2Y8SA 2YRAA 5CT1A 3WSXA 4R1BA 3SRJA 1UOTP 2YIOA 1MD7A 3TVJA 5JPMG 2XRBA 2Y8TA 3ERBA 4R1CA 2Q8AA 1E5GA 3ZRZA 4Z0FA 2A55A 2JRAA 3INBC 4Z09A 1GHQB 1OJYA 3CI0J 4IGDA 3IU3I 2J8JA 1G4FA 1GMNA 1QGBA 2KRIA 4R1AA 1CKLA 4AYMA 1O9AA 2Y8RA 3SP8A 2RLPA 2B5ID 2QJ2A 2CKUA 1OK1A 2IZ4A 5CS5A 4J38B 3OEDC 2Q8BA 2XQWC 1QO6A 1GMOA 4N7EA 4F4OC 5I0QB 1I8NA 3WSYA 5EODA 1H04P 4C16A 4ZH1D 4UV6A 5I25A 1E88A 4B2RA 1GKGA 5HYTB 2K13X 4CSYA 3NFPI 4WJG2 1G4GA 1GP9A 5COEA 4B2SA 2W81A
chains in the Genus database with same CATH topology
5CT3A 5CS3A 3FGRA 4R19A 4APMA 3ZWZA 4MSLA 2HGFA 3SRIA 2I2LA 2J8LA 5CT2A 2Z8VA 1Z40A 4A5TS 3NJAA 4YIZA 5CP9A 3ZLEA 4DURA 1HKYA 4YIVA 2KL5A 4UAOA 2LL3A 4BWCA 2LL4M 3ZLDA 5CSQA 2F83A 3HMRA 5CS9A 3FGTA 5CS1A 5EOKA 2QJ4A 4IUAA 3MKPA 1W81A 4PO7A 3F6KA 1NK1A 3HMTA 1BHTA 4Z0EA 3HMSA 4Z0DA 4APLA 3HN4A 2YIPA 2Z8WA 2X2ZA 1YXEA 2YILA 1W8KA 5CT1A 2Y8SA 3WSXA 4R1BA 3SRJA 2YIOA 4Z0FA 2Y8TA 4R1CA 2Q8AA 4Z09A 2J8JA 1GMNA 4R1AA 2Y8RA 3SP8A 2QJ2A 2Q8BA 5CS5A 1GMOA 4N7EA 1I8NA 3WSYA 5EODA 4UV6A 5I25A 2K13X 1GP9A 5COEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK1 A;  5CT3 A;  4Z09 A;  3HMT A;  1BHT A;  4Z0E A;  2J8J A;  5CS3 A;  4R19 A;  4UAO A;  1GMN A;  3HMS A;  4Z0D A;  4APM A;  4APL A;  4R1A A;  2LL3 A;  3HN4 A;  3ZWZ A;  2LL4 M;  2YIP A;  2Y8R A;  2HGF A;  3SRI A;  3SP8 A;  3ZLD A;  2J8L A;  2QJ2 A;  5CSQ A;  5CT2 A;  2Q8B A;  5CS5 A;  1GMO A;  2Z8W A;  2X2Z A;  2Z8V A;  2F83 A;  3HMR A;  4Z0F A;  1Z40 A;  4A5T S;  1I8N A;  5CS9 A;  5EOD A;  1HKY A;  1YXE A;  5CS1 A;  4UV6 A;  2YIL A;  5EOK A;  5I25 A;  1W8K A;  5CT1 A;  2Y8S A;  2K13 X;  4YIZ A;  4R1B A;  5CP9 A;  2QJ4 A;  3ZLE A;  4IUA A;  2YIO A;  1GP9 A;  3MKP A;  5COE A;  1W81 A;  3SRJ A;  4DUR A;  2Y8T A;  4R1C A;  2Q8A A; 
#chains in the Genus database with same CATH topology
 3ZD1 A;  2EHF A;  4JHS A;  3GXE A;  5CT3 A;  3MQL A;  5CS3 A;  4PZ5 A;  3FGR A;  4R19 A;  1GKN A;  1C1Z A;  1VVC A;  1H03 P;  4APM A;  1SS2 A;  1VVD A;  3ZD2 A;  5HYU B;  2CG7 A;  4MSL A;  3ZWZ A;  3OXU D;  1OJW A;  1GPZ A;  1RLH A;  2ZYC A;  3R62 A;  2HGF A;  2I2L A;  3SRI A;  1OK3 A;  2XWJ I;  3M7P A;  2J8L A;  5HZP B;  5CT2 A;  3K3T A;  3O8E B;  2Z8V A;  3EJH A;  1Z40 A;  4A5T S;  3NJA A;  2RKY A;  2ERJ A;  2LOJ A;  1HCC A;  4YIZ A;  1TPN A;  5CP9 A;  3ZLE A;  4DUR A;  1HKY A;  1QUB A;  1NWV A;  4YIV A;  1HFI A;  2O39 C;  5DN5 A;  1ELV A;  2YBY A;  2UWN A;  5FO8 C;  2KL5 A;  1U5M A;  1HFH A;  1MD8 A;  4UAO A;  1OK2 A;  4YNX A;  2BZM A;  3SW0 X;  2EC3 A;  4LOS A;  1Z92 B;  4AYE A;  2G7I A;  2LL3 A;  4BWC A;  1PPQ A;  4DJZ A;  1LY2 A;  2LL4 M;  3VWO A;  4LOT A;  4A5W B;  1SRZ A;  3RJ3 D;  3ZLD A;  4ONT D;  4MUC A;  5CSQ A;  3GOV A;  1FBR A;  2KMS A;  1E8B A;  2F83 A;  3HMR A;  4KKD A;  2MCY A;  5CS9 A;  2XRD A;  3FGT A;  5CS1 A;  5HYP A;  3T5O A;  5EOK A;  4AYI A;  2QJ4 A;  4IUA A;  3MKP A;  4PO7 A;  3F6K A;  1W81 A;  4K12 A;  2QY0 A;  2IZ3 A;  1NK1 A;  2XWB F;  3HMT A;  1BHT A;  4Z0E A;  3KXV A;  5DN4 A;  2RL0 A;  1ZJK A;  3KZJ A;  3HMS A;  1Q3X A;  4Z0D A;  1TPG A;  3OP8 A;  4APL A;  2RKZ A;  3HN4 A;  2RLQ A;  2YIP A;  2JGX A;  3CAL A;  4AYD A;  1H2P P;  2W80 A;  1OJV A;  1H2Q P;  4FXG G;  2Z8W A;  2X2Z A;  2V8E A;  1TPM A;  2CG6 A;  2JGW A;  2MCZ A;  3L89 M;  1YXE A;  2YIL A;  2WII C;  3IX0 A;  1W8K A;  1OK9 A;  2Y8S A;  2YRA A;  5CT1 A;  3WSX A;  4R1B A;  3SRJ A;  1UOT P;  2YIO A;  1MD7 A;  3TVJ A;  5JPM G;  2XRB A;  2Y8T A;  3ERB A;  4R1C A;  2Q8A A;  1E5G A;  3ZRZ A;  4Z0F A;  2A55 A;  2JRA A;  3INB C;  4Z09 A;  1GHQ B;  1OJY A;  3CI0 J;  4IGD A;  3IU3 I;  2J8J A;  1G4F A;  1GMN A;  1QGB A;  2KRI A;  4R1A A;  1CKL A;  4AYM A;  1O9A A;  2Y8R A;  3SP8 A;  2RLP A;  2B5I D;  2QJ2 A;  2CKU A;  1OK1 A;  2IZ4 A;  5CS5 A;  4J38 B;  3OED C;  2Q8B A;  2XQW C;  1QO6 A;  1GMO A;  4N7E A;  4F4O C;  5I0Q B;  1I8N A;  3WSY A;  5EOD A;  1H04 P;  4C16 A;  4ZH1 D;  4UV6 A;  5I25 A;  1E88 A;  4B2R A;  1GKG A;  5HYT B;  2K13 X;  4CSY A;  3NFP I;  4WJG 2;  1G4G A;  1GP9 A;  5COE A;  4B2S A;  2W81 A; 
#chains in the Genus database with same CATH homology
 5CT3 A;  5CS3 A;  3FGR A;  4R19 A;  4APM A;  3ZWZ A;  4MSL A;  2HGF A;  3SRI A;  2I2L A;  2J8L A;  5CT2 A;  2Z8V A;  1Z40 A;  4A5T S;  3NJA A;  4YIZ A;  5CP9 A;  3ZLE A;  4DUR A;  1HKY A;  4YIV A;  2KL5 A;  4UAO A;  2LL3 A;  4BWC A;  2LL4 M;  3ZLD A;  5CSQ A;  2F83 A;  3HMR A;  5CS9 A;  3FGT A;  5CS1 A;  5EOK A;  2QJ4 A;  4IUA A;  3MKP A;  1W81 A;  4PO7 A;  3F6K A;  1NK1 A;  3HMT A;  1BHT A;  4Z0E A;  3HMS A;  4Z0D A;  4APL A;  3HN4 A;  2YIP A;  2Z8W A;  2X2Z A;  1YXE A;  2YIL A;  1W8K A;  5CT1 A;  2Y8S A;  3WSX A;  4R1B A;  3SRJ A;  2YIO A;  4Z0F A;  2Y8T A;  4R1C A;  2Q8A A;  4Z09 A;  2J8J A;  1GMN A;  4R1A A;  2Y8R A;  3SP8 A;  2QJ2 A;  2Q8B A;  5CS5 A;  1GMO A;  4N7E A;  1I8N A;  3WSY A;  5EOD A;  4UV6 A;  5I25 A;  2K13 X;  1GP9 A;  5COE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...