3ZLLA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
302
structure length
297
Chain Sequence
HHHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
total genus 96
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3zllA00
1FRWA 1VGUA 2XMHA 1XHBA 4MNDA 4Y9XA 1FO9A 5C4CA 2QGIA 5CQLX 3F1YA 5C36A 4EEMA 4M28A 4Y6NA 1NF5B 1I52A 4KXOA 5CMFX 5CMJA 2OI5A 2RJ5A 1JV1A 4Y62A 3F1CA 2VSHA 4L41C 1S4PA 2PGYA 1H4CA 1EYRA 5IDTA 4IRPA 2BO7A 2GGQA 4AYJA 3NGWA 1W57A 1VICA 2Y4LA 1WT0A 3ZGGA 3O3PA 1VH1A 2RJ4A 2CU2A 2X60A 4KNXA 2O1HA 2YESA 3V8ZA 1MP4A 2WVMA 4DDZA 4BQHA 4CJBA 4M2AA 3I0LA 4XWIA 1H7HA 4FRMA 1H5SD 3OH0A 4B4BA 4LW6A 1G23A 2V0KA 2X5SA 4NAIA 4K6RA 1IINA 2AH9A 4EE5A 4FROA 3QVBA 2WGZA 3OH1A 4FRBA 4D11A 2FFVA 3SXBA 2O1GA 5C4BA 5FV9A 5FTVA 1ZJ3A 5C38A 1NKHB 4LW3A 1O7OA 1NHEB 4GBPA 1JYLA 1PZYB 2E8BA 2FYBA 3OH3A 2XWNA 3SX7A 5C48A 1LZ0A 4FRHA 3FWWA 2FYDB 3R2WA 3V91A 1H5SA 3T7MA 3USRA 5C3AA 4AYLA 2VS5A 2AESA 3SXDA 4D11C 2AECA 1H5RA 4B4MA 4ZDQA 2RJ9A 5EIYA 3PKPA 3K8DA 4MYBA 4UEGA 2AM4A 5EJ1A 4EVWA 1K4VA 1MC3A 3D8VA 5CMHA 1G0RA 5C1LA 4KQLA 4Y64A 1FXOA 1MP3A 3V0PA 3D5NA 1VGZA 2Y4JA 4JD0A 2JCOA 2FYCB 1FZWA 2VS3A 2YQCA 1G1LA 1H7EA 5IFYA 5AJNA 1OMZA 1O23B 3V0LA 3ZF8A 2OI6A 2VXMA 4AC3A 2RJ1A 4P02A 3SXEA 1ZJPA 1YROB 4CVHA 3DK5A 3Q4SA 4KC4A 4B3UA 1YP4A 1LL3A 3I0IX 1WSZA 2JCKA 2NXVA 3RSBA 1WVCA 1GQ9A 2WEEA 1ZI1A 2JCJA 1VZXA 1INJA 1VH3A 1HJLA 5I1FA 3V0OA 2UX8A 4HO4A 1LL2A 4EEGA 1NWGB 2RITA 2D7IA 4G3QA 2W0WA 2D7RA 2YQHA 2RIXA 2AE7A 2BO4A 2A8WA 5FUHA 1E5KA 4JISA 4BMAA 1GA8A 4B42A 2ICYA 3CKJA 1R82A 4NALA 3RMVA 2YC5A 5CQMX 1XZ6A 5CQNX 1VZUA 2V0IA 4KPZA 5C4EA 1VGWA 3SX8A 5FU0A 4HCQA 1FO8A 1H5SB 4KC2A 3USQA 3POLA 1JVDA 4FRQA 4EE4A 3I0EA 1H5RB 3I0FA 4Y6UA 1GQCA 1GX4A 1H7QA 4HO6A 3FOQA 5BXCA 2Y4KA 3DJ4A 1S4NA 5JQQA 1R7TA 1FG5N 2FYAA 1TW5A 5C1HA 4HG6A 4HO3A 2RIYA 4FRPA 1GX0A 2I5KA 1JV3A 1O7QA 1JYKA 4IRQA 1VPAA 1ZCYA 4ASJA 1OMXA 5DDTA 1HM9A 3SXAA 4ECMA 1MP5A 2QH5A 2FY7A 2PX7A 3IOIA 4R7PA 3V0QA 3I0HA 3IOHA 2BO8A 1G97A 2YQSA 3CKNA 2Z86A 3CU0A 4Y7GA 3V0NA 5C8RA 1H7LA 3Q7UA 5FTSA 3T7OA 1WT3A 2I5EA 4B5BA 2RJ8A 4Y63A 1R7YA 4HO9A 1R7XA 2RJ0A 3I0JA 4HO5A 3TQDA 5J49A 5FYEA 4HOCA 2YCMA 4M4KA 3V0MA 1LZJA 2P6WA 1GWWA 2Y4MA 2X5ZA 1R7VA 1Z90A 1LL0A 2VS4A 3HL3A 3R3IA 1FXJA 2W0VA 3OC9A 3CKOA 1G3LA 4HO0A 3EE5A 4D0TA 1G8OA 1QGSA 4Y7UA 5L6SA 3JUJA 2VD4A 5C1GA 3RMWA 1JVGA 4ASYA 3KIAA 3CKVA 2BO6A 3OAMA 4FQWA 3SX3A 4KNRA 5C49A 2RIZA 4EE3A 1ZDFA 1H5TA 3SXCA 1R7UA 1G95A 2GGOA 1YP3A 5HS2A 5L6VA 4EEAA 4D48A 1ZCTA 1SS9A 1S4OA 3E25A 1H3MA 1TW1A 3TZTA 4E1KA 2QKXA 2X65A 2A8UA 4NANA 3D98A 1YP2A 4Y7VA 1LVWA 2V0HA 1NMMB 1V84A 2ZU8A 2OEGA 1LZIA 4FRAA 4YS8A 1ZI5A 2V0JA 3T7NA 2APCA 1ZI3A 3Q80A 2AM5A 1WT2A 2YC3A 3U2TA 1H7TA 1ZJ1A 2VFZA 2XWMA 4FREA 2E3DA 1LZ7A 1VZTA 4B4GA 3OGZA 3BRKX 3I0DA 3U2UA 5C47A 3U2WA 3OH4A 1FR9A 1G93A 1ZJOA 3K8EA 5C3DA 1HM0A 4FCEA 3E26A 4B2WA 5C4DA 3V90A 1VGTA 3ZLKA 1OQMB 2AM3A 3SPTA 1ZHJA 2Y7AA 5DDVA 1QG8A 5C4FA 2AGDA 3ZLLA 2RJ7A 1FOAA 2V0LA 1V83A 1W77A 1ZCUA 1QGQA 5CQPA 3I0CA 3OH2A 5AJOA 1ZJ2A 5C3BA 2ZU9A 1H4DA 4P00A 2RJ6A 2WVKA 4KPXA 4KT7A 4D0ZA 3ZGFA 4Y7FA 3SXGA 2P72A 1GWVA 1TZFA 1IIMA 1V82A 4CJ8A 1FGGA 4KRVA 4J18A 4G3PA 1H4EA 4FRLA 3PKQA 3DUVA 5EJZA 2O1FA 1HV9A 2I7BA 1HJJA 3IOJA 4DE7A 3BCVA 1FR8A 2XMEA 3U2VA 3N9WA 1H7FA 4DECA 4HO2A 5CQOA 2OI7A 2VXLA 1HM8A 1ZJ0A 1H5TB 3I0KA 1FGXA 1PZTA 3GUEA 1EZIA 1R80A 3OKRA 2XWLA 5IDSA 4C2SA 1W55A 4KC1A 2WVLA 4ARWA 3SX5A 4B2XA 1R81A 2Y6PA 4CJCA 4FCUA 3JUKA 2PA4A 4M2BA 5CMIA 3PNNA 1ON6A 1WT1A 2WE9A 1QWJA 1ZDGA 1KWSA 3JTJA 4G87A 1H5SC 4G3SA 3I0GA 2VSIA 1ON8A 4HO8A 4FRDA 2WAWA 1NQIB 3U2XA 3V8YA 1INIA 3CGXA 4Y7TA 1VM8A 1O0RA 2P73A 4EEOA 1ZCVA 2DPWA 2Z87A 2MZBA 3U0YA 4AAWA 3LW6A 5FU8A 3ST8A 1ZIZA 3U0XA 3CKQA 2D0JA 2PGVA 2Q4JA 5CMGX 5AJPA 1H7GA 2ICXA 2FFUA 1FWYA 2ZU7A 4NAKA 1G9RA 2YQJA 1ZI4A 2JCLA 1G2VA 1TVYA 2OEFA
chains in the Genus database with same CATH superfamily
1FRWA 1VGUA 2XMHA 1XHBA 4MNDA 4Y9XA 1FO9A 5C4CA 2QGIA 5CQLX 3F1YA 5C36A 4EEMA 4M28A 4Y6NA 1NF5B 1I52A 4KXOA 5CMFX 5CMJA 2OI5A 2RJ5A 1JV1A 4Y62A 2C0NA 3F1CA 2VSHA 4L41C 1S4PA 2PGYA 1H4CA 1EYRA 5IDTA 4IRPA 2BO7A 2GGQA 4AYJA 3NGWA 1W57A 1VICA 2Y4LA 1WT0A 3ZGGA 3O3PA 1VH1A 2RJ4A 2CU2A 2X60A 4KNXA 2O1HA 2YESA 3V8ZA 1MP4A 2WVMA 4DDZA 4BQHA 4CJBA 4M2AA 3I0LA 4XWIA 1H7HA 4FRMA 1H5SD 3OH0A 4B4BA 4LW6A 1G23A 2V0KA 2X5SA 4NAIA 4K6RA 1IINA 2AH9A 4EE5A 4FROA 3QVBA 2WGZA 3OH1A 4FRBA 4D11A 2FFVA 3SXBA 2O1GA 5C4BA 5FV9A 5FTVA 1ZJ3A 5C38A 1NKHB 4LW3A 1O7OA 1NHEB 4GBPA 1JYLA 1PZYB 2E8BA 2FYBA 3OH3A 2XWNA 3SX7A 5C48A 1LZ0A 4FRHA 3FWWA 2FYDB 3R2WA 3V91A 1H5SA 3T7MA 3USRA 5C3AA 4AYLA 2VS5A 2AESA 3SXDA 4D11C 2AECA 1H5RA 4B4MA 4ZDQA 2RJ9A 5EIYA 3PKPA 3K8DA 4MYBA 4UEGA 2AM4A 5EJ1A 4EVWA 1K4VA 1MC3A 3D8VA 5CMHA 1G0RA 5C1LA 4KQLA 4Y64A 1FXOA 1MP3A 3V0PA 3D5NA 1VGZA 2Y4JA 4JD0A 2JCOA 2FYCB 4O6MA 1FZWA 2VS3A 2YQCA 1G1LA 1H7EA 5IFYA 5AJNA 1OMZA 1O23B 3V0LA 3ZF8A 2OI6A 2VXMA 4AC3A 2RJ1A 4P02A 3SXEA 1ZJPA 1YROB 4CVHA 3DK5A 3Q4SA 4KC4A 4B3UA 1YP4A 1LL3A 3I0IX 1WSZA 2JCKA 2NXVA 3RSBA 1WVCA 1GQ9A 2WEEA 1ZI1A 2JCJA 1VZXA 1INJA 1VH3A 1HJLA 5I1FA 3V0OA 2UX8A 4HO4A 1LL2A 4EEGA 1NWGB 2RITA 2D7IA 4G3QA 2W0WA 2D7RA 2YQHA 2RIXA 2AE7A 2BO4A 2A8WA 5FUHA 1E5KA 4JISA 4BMAA 1GA8A 4B42A 2ICYA 3CKJA 1R82A 4NALA 3RMVA 2YC5A 5CQMX 1XZ6A 5CQNX 1VZUA 2V0IA 4KPZA 5C4EA 1VGWA 3SX8A 5FU0A 4HCQA 1FO8A 1H5SB 2VK9A 4KC2A 3USQA 3POLA 1JVDA 4FRQA 4EE4A 3I0EA 1H5RB 3I0FA 4Y6UA 1GQCA 1GX4A 1H7QA 4HO6A 3FOQA 5BXCA 2Y4KA 1S4NA 3DJ4A 5JQQA 1R7TA 1FG5N 2FYAA 1TW5A 5C1HA 4HG6A 4HO3A 2RIYA 4FRPA 1GX0A 2I5KA 1JV3A 1O7QA 1JYKA 4IRQA 1VPAA 1ZCYA 4ASJA 1OMXA 5DDTA 1HM9A 3SXAA 4ECMA 1MP5A 2QH5A 2FY7A 2PX7A 3IOIA 4R7PA 4Q7CA 3V0QA 3I0HA 3IOHA 2BO8A 1G97A 2YQSA 3CKNA 2Z86A 3CU0A 4Y7GA 3V0NA 5C8RA 5D91A 1H7LA 3Q7UA 5FTSA 3T7OA 1WT3A 2I5EA 4B5BA 2RJ8A 4Y63A 1R7YA 4HO9A 1R7XA 2RJ0A 3I0JA 4HO5A 3TQDA 5J49A 5FYEA 4HOCA 2YCMA 4M4KA 3V0MA 1LZJA 2P6WA 1GWWA 2Y4MA 2X5ZA 1R7VA 4FIXA 1Z90A 1LL0A 2VS4A 3HL3A 3R3IA 1FXJA 2W0VA 3OC9A 3CKOA 1G3LA 4HO0A 3EE5A 2J0AA 1G8OA 1QGSA 4D0TA 4Y7UA 5L6SA 3JUJA 2VD4A 5C1GA 3RMWA 1JVGA 4ASYA 3KIAA 3CKVA 2BO6A 3OAMA 4FQWA 3SX3A 4KNRA 5C49A 2RIZA 4EE3A 1ZDFA 1H5TA 3SXCA 1R7UA 1G95A 2GGOA 1YP3A 5HS2A 5L6VA 4EEAA 4D48A 1ZCTA 1SS9A 1S4OA 3E25A 1H3MA 1TW1A 3TZTA 4E1KA 2QKXA 2X65A 2A8UA 4O6NA 4NANA 3D98A 4MIXA 1YP2A 4Y7VA 1LVWA 2V0HA 1NMMB 1V84A 2ZU8A 2OEGA 1LZIA 4FRAA 4YS8A 1ZI5A 2V0JA 3T7NA 2APCA 1ZI3A 3Q80A 2AM5A 1WT2A 2YC3A 3U2TA 1H7TA 1ZJ1A 2VFZA 2XWMA 4FREA 2E3DA 1LZ7A 1VZTA 4B4GA 3OGZA 3BRKX 3I0DA 3U2UA 5C47A 3U2WA 3OH4A 1FR9A 1G93A 1ZJOA 3K8EA 5C3DA 1HM0A 4FCEA 4FIYA 3E26A 4B2WA 5D92A 5C4DA 3V90A 1VGTA 3ZLKA 1OQMB 2AM3A 3SPTA 1ZHJA 2Y7AA 5DDVA 1QG8A 5C4FA 2AGDA 3ZLLA 2RJ7A 1FOAA 2V0LA 1V83A 1W77A 1ZCUA 1QGQA 5CQPA 3I0CA 3OH2A 5AJOA 1ZJ2A 5C3BA 2ZU9A 1H4DA 4P00A 2RJ6A 2WVKA 4KPXA 4KT7A 4D0ZA 3ZGFA 4Y7FA 3SXGA 2P72A 1GWVA 1TZFA 1IIMA 1V82A 4CJ8A 1FGGA 4KRVA 4J18A 4G3PA 1H4EA 4FRLA 3PKQA 3DUVA 5EJZA 2O1FA 1HV9A 2I7BA 1HJJA 3IOJA 4DE7A 3BCVA 1FR8A 2XMEA 3U2VA 3N9WA 1H7FA 4DECA 4HO2A 5CQOA 2OI7A 2VXLA 1HM8A 1ZJ0A 1H5TB 3I0KA 1FGXA 1PZTA 3GUEA 1EZIA 1R80A 3OKRA 2XWLA 5IDSA 4C2SA 1W55A 4KC1A 2WVLA 4ARWA 3SX5A 4B2XA 1R81A 2Y6PA 4CJCA 4FCUA 3JUKA 2PA4A 4M2BA 5CMIA 3PNNA 1ON6A 1WT1A 2WE9A 1QWJA 1ZDGA 1KWSA 3JTJA 4G87A 1H5SC 4G3SA 3I0GA 2VSIA 1ON8A 4HO8A 4FRDA 2J0BA 1NQIB 2WAWA 3U2XA 3V8YA 1INIA 3CGXA 4Y7TA 1VM8A 1O0RA 2P73A 4EEOA 1ZCVA 2DPWA 2Z87A 2MZBA 3U0YA 4AAWA 3LW6A 5FU8A 3ST8A 1ZIZA 3U0XA 3CKQA 2D0JA 2PGVA 2Q4JA 5CMGX 5AJPA 1H7GA 2ICXA 2FFUA 1FWYA 2ZU7A 4NAKA 1G9RA 2YQJA 1ZI4A 2JCLA 1G2VA 1TVYA 2OEFA
chains in the Genus database with same CATH topology
1FRWA 1VGUA 2XMHA 1XHBA 4MNDA 4Y9XA 1FO9A 5C4CA 2QGIA 5CQLX 3F1YA 5C36A 4EEMA 4M28A 4Y6NA 1NF5B 1I52A 4KXOA 5CMFX 5CMJA 2OI5A 2RJ5A 1JV1A 4Y62A 2C0NA 3F1CA 2VSHA 4L41C 1S4PA 2PGYA 1H4CA 1EYRA 5IDTA 4IRPA 2BO7A 2GGQA 4AYJA 3NGWA 1W57A 1VICA 2Y4LA 1WT0A 3ZGGA 3O3PA 1VH1A 2RJ4A 2CU2A 2X60A 4KNXA 2O1HA 2YESA 3V8ZA 1MP4A 2WVMA 4DDZA 4BQHA 4CJBA 4M2AA 3I0LA 4XWIA 1H7HA 4FRMA 1H5SD 3OH0A 4B4BA 4LW6A 1G23A 2V0KA 2X5SA 4NAIA 4K6RA 1IINA 2AH9A 4EE5A 4FROA 3QVBA 2WGZA 3OH1A 4FRBA 4D11A 2FFVA 3SXBA 2O1GA 5C4BA 5FV9A 5FTVA 1ZJ3A 5C38A 1NKHB 4LW3A 1O7OA 1NHEB 4GBPA 1JYLA 1PZYB 2E8BA 2FYBA 3OH3A 2XWNA 3SX7A 5C48A 1LZ0A 4FRHA 3FWWA 2FYDB 3R2WA 3V91A 1H5SA 3T7MA 3USRA 5C3AA 4AYLA 2VS5A 2AESA 3SXDA 4D11C 2AECA 1H5RA 4B4MA 4ZDQA 2RJ9A 5EIYA 3PKPA 3K8DA 4MYBA 4UEGA 2AM4A 5EJ1A 4EVWA 1K4VA 1MC3A 3D8VA 5CMHA 1G0RA 5C1LA 4KQLA 4Y64A 1FXOA 1MP3A 3V0PA 3D5NA 1VGZA 2Y4JA 4JD0A 2JCOA 2FYCB 4O6MA 1FZWA 2VS3A 2YQCA 1G1LA 1H7EA 5IFYA 5AJNA 1OMZA 1O23B 3V0LA 3ZF8A 2OI6A 2VXMA 4AC3A 2RJ1A 4P02A 3SXEA 1ZJPA 1YROB 4CVHA 3DK5A 3Q4SA 4KC4A 4B3UA 1YP4A 1LL3A 3I0IX 1WSZA 2JCKA 2NXVA 3RSBA 1WVCA 1GQ9A 2WEEA 1ZI1A 2JCJA 1VZXA 1INJA 1VH3A 1HJLA 5I1FA 3V0OA 2UX8A 4HO4A 1LL2A 4EEGA 1NWGB 2RITA 2D7IA 4G3QA 2W0WA 2D7RA 2YQHA 2RIXA 2AE7A 2BO4A 2A8WA 5FUHA 1E5KA 4JISA 4BMAA 1GA8A 4B42A 2ICYA 3CKJA 1R82A 4NALA 3RMVA 2YC5A 5CQMX 1XZ6A 5CQNX 1VZUA 2V0IA 4KPZA 5C4EA 1VGWA 3SX8A 5FU0A 4HCQA 1FO8A 1H5SB 2VK9A 4KC2A 3USQA 3POLA 1JVDA 4FRQA 4EE4A 3I0EA 1H5RB 3I0FA 4Y6UA 1GQCA 1GX4A 1H7QA 4HO6A 3FOQA 5BXCA 2Y4KA 1S4NA 3DJ4A 5JQQA 1R7TA 1FG5N 2FYAA 1TW5A 5C1HA 4HG6A 4HO3A 2RIYA 4FRPA 1GX0A 2I5KA 1JV3A 1O7QA 1JYKA 4IRQA 1VPAA 1ZCYA 4ASJA 1OMXA 5DDTA 1HM9A 3SXAA 4ECMA 1MP5A 2QH5A 2FY7A 2PX7A 3IOIA 4R7PA 4Q7CA 3V0QA 3I0HA 3IOHA 2BO8A 1G97A 2YQSA 3CKNA 2Z86A 3CU0A 4Y7GA 3V0NA 5C8RA 5D91A 1H7LA 3Q7UA 5FTSA 3T7OA 1WT3A 2I5EA 4B5BA 2RJ8A 4Y63A 1R7YA 4HO9A 1R7XA 2RJ0A 3I0JA 4HO5A 3TQDA 5J49A 5FYEA 4HOCA 2YCMA 4M4KA 3V0MA 1LZJA 2P6WA 1GWWA 2Y4MA 2X5ZA 1R7VA 4FIXA 1Z90A 1LL0A 2VS4A 3HL3A 3R3IA 1FXJA 2W0VA 3OC9A 3CKOA 1G3LA 4HO0A 3EE5A 2J0AA 1G8OA 1QGSA 4D0TA 4Y7UA 5L6SA 3JUJA 2VD4A 5C1GA 3RMWA 1JVGA 4ASYA 3KIAA 3CKVA 2BO6A 3OAMA 4FQWA 3SX3A 4KNRA 5C49A 2RIZA 4EE3A 1ZDFA 1H5TA 3SXCA 1R7UA 1G95A 2GGOA 1YP3A 5HS2A 5L6VA 4EEAA 4D48A 1ZCTA 1SS9A 1S4OA 3E25A 1H3MA 1TW1A 3TZTA 4E1KA 2QKXA 2X65A 2A8UA 4O6NA 4NANA 3D98A 4MIXA 1YP2A 4Y7VA 1LVWA 2V0HA 1NMMB 1V84A 2ZU8A 2OEGA 1LZIA 4FRAA 4YS8A 1ZI5A 2V0JA 3T7NA 2APCA 1ZI3A 3Q80A 2AM5A 1WT2A 2YC3A 3U2TA 1H7TA 1ZJ1A 2VFZA 2XWMA 4FREA 2E3DA 1LZ7A 1VZTA 4B4GA 3OGZA 3BRKX 3I0DA 3U2UA 5C47A 3U2WA 3OH4A 1FR9A 1G93A 1ZJOA 3K8EA 5C3DA 1HM0A 4FCEA 4FIYA 3E26A 4B2WA 5D92A 5C4DA 3V90A 1VGTA 3ZLKA 1OQMB 2AM3A 3SPTA 1ZHJA 2Y7AA 5DDVA 1QG8A 5C4FA 2AGDA 3ZLLA 2RJ7A 1FOAA 2V0LA 1V83A 1W77A 1ZCUA 1QGQA 5CQPA 3I0CA 3OH2A 5AJOA 1ZJ2A 5C3BA 2ZU9A 1H4DA 4P00A 2RJ6A 2WVKA 4KPXA 4KT7A 4D0ZA 3ZGFA 4Y7FA 3SXGA 2P72A 1GWVA 1TZFA 1IIMA 1V82A 4CJ8A 1FGGA 4KRVA 4J18A 4G3PA 1H4EA 4FRLA 3PKQA 3DUVA 5EJZA 2O1FA 1HV9A 2I7BA 1HJJA 3IOJA 4DE7A 3BCVA 1FR8A 2XMEA 3U2VA 3N9WA 1H7FA 4DECA 4HO2A 5CQOA 2OI7A 2VXLA 1HM8A 1ZJ0A 1H5TB 3I0KA 1FGXA 1PZTA 3GUEA 1EZIA 1R80A 3OKRA 2XWLA 5IDSA 4C2SA 1W55A 4KC1A 2WVLA 4ARWA 3SX5A 4B2XA 1R81A 2Y6PA 4CJCA 4FCUA 3JUKA 2PA4A 4M2BA 5CMIA 3PNNA 1ON6A 1WT1A 2WE9A 1QWJA 1ZDGA 1KWSA 3JTJA 4G87A 1H5SC 4G3SA 3I0GA 2VSIA 1ON8A 4HO8A 4FRDA 2J0BA 1NQIB 2WAWA 3U2XA 3V8YA 1INIA 3CGXA 4Y7TA 1VM8A 1O0RA 2P73A 4EEOA 1ZCVA 2DPWA 2Z87A 2MZBA 3U0YA 4AAWA 3LW6A 5FU8A 3ST8A 1ZIZA 3U0XA 3CKQA 2D0JA 2PGVA 2Q4JA 5CMGX 5AJPA 1H7GA 2ICXA 2FFUA 1FWYA 2ZU7A 4NAKA 1G9RA 2YQJA 1ZI4A 2JCLA 1G2VA 1TVYA 2OEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRW A;  1VGU A;  2XMH A;  1XHB A;  4MND A;  4Y9X A;  1FO9 A;  5C4C A;  2QGI A;  5CQL X;  3F1Y A;  5C36 A;  4EEM A;  4M28 A;  4Y6N A;  1NF5 B;  1I52 A;  4KXO A;  5CMF X;  5CMJ A;  2OI5 A;  2RJ5 A;  1JV1 A;  4Y62 A;  3F1C A;  2VSH A;  4L41 C;  1S4P A;  2PGY A;  1H4C A;  1EYR A;  5IDT A;  4IRP A;  2BO7 A;  2GGQ A;  4AYJ A;  3NGW A;  1W57 A;  1VIC A;  2Y4L A;  1WT0 A;  3ZGG A;  3O3P A;  1VH1 A;  2RJ4 A;  2CU2 A;  2X60 A;  4KNX A;  2O1H A;  2YES A;  3V8Z A;  1MP4 A;  2WVM A;  4DDZ A;  4BQH A;  4CJB A;  4M2A A;  3I0L A;  4XWI A;  1H7H A;  4FRM A;  1H5S D;  3OH0 A;  4B4B A;  4LW6 A;  1G23 A;  2V0K A;  2X5S A;  4NAI A;  4K6R A;  1IIN A;  2AH9 A;  4EE5 A;  4FRO A;  3QVB A;  2WGZ A;  3OH1 A;  4FRB A;  4D11 A;  2FFV A;  3SXB A;  2O1G A;  5C4B A;  5FV9 A;  5FTV A;  1ZJ3 A;  5C38 A;  1NKH B;  4LW3 A;  1O7O A;  1NHE B;  4GBP A;  1JYL A;  1PZY B;  2E8B A;  2FYB A;  3OH3 A;  2XWN A;  3SX7 A;  5C48 A;  1LZ0 A;  4FRH A;  3FWW A;  2FYD B;  3R2W A;  3V91 A;  1H5S A;  3T7M A;  3USR A;  5C3A A;  4AYL A;  2VS5 A;  2AES A;  3SXD A;  4D11 C;  2AEC A;  1H5R A;  4B4M A;  4ZDQ A;  2RJ9 A;  5EIY A;  3PKP A;  3K8D A;  4MYB A;  4UEG A;  2AM4 A;  5EJ1 A;  4EVW A;  1K4V A;  1MC3 A;  3D8V A;  5CMH A;  1G0R A;  5C1L A;  4KQL A;  4Y64 A;  1FXO A;  1MP3 A;  3V0P A;  3D5N A;  1VGZ A;  2Y4J A;  4JD0 A;  2JCO A;  2FYC B;  1FZW A;  2VS3 A;  2YQC A;  1G1L A;  1H7E A;  5IFY A;  5AJN A;  1OMZ A;  1O23 B;  3V0L A;  3ZF8 A;  2OI6 A;  2VXM A;  4AC3 A;  2RJ1 A;  4P02 A;  3SXE A;  1ZJP A;  1YRO B;  4CVH A;  3DK5 A;  3Q4S A;  4KC4 A;  4B3U A;  1YP4 A;  1LL3 A;  3I0I X;  1WSZ A;  2JCK A;  2NXV A;  3RSB A;  1WVC A;  1GQ9 A;  2WEE A;  1ZI1 A;  2JCJ A;  1VZX A;  1INJ A;  1VH3 A;  1HJL A;  5I1F A;  3V0O A;  2UX8 A;  4HO4 A;  1LL2 A;  4EEG A;  1NWG B;  2RIT A;  2D7I A;  4G3Q A;  2W0W A;  2D7R A;  2YQH A;  2RIX A;  2AE7 A;  2BO4 A;  2A8W A;  5FUH A;  1E5K A;  4JIS A;  4BMA A;  1GA8 A;  4B42 A;  2ICY A;  3CKJ A;  1R82 A;  4NAL A;  3RMV A;  2YC5 A;  5CQM X;  1XZ6 A;  5CQN X;  1VZU A;  2V0I A;  4KPZ A;  5C4E A;  1VGW A;  3SX8 A;  5FU0 A;  4HCQ A;  1FO8 A;  1H5S B;  4KC2 A;  3USQ A;  3POL A;  1JVD A;  4FRQ A;  4EE4 A;  3I0E A;  1H5R B;  3I0F A;  4Y6U A;  1GQC A;  1GX4 A;  1H7Q A;  4HO6 A;  3FOQ A;  5BXC A;  2Y4K A;  3DJ4 A;  1S4N A;  5JQQ A;  1R7T A;  1FG5 N;  2FYA A;  1TW5 A;  5C1H A;  4HG6 A;  4HO3 A;  2RIY A;  4FRP A;  1GX0 A;  2I5K A;  1JV3 A;  1O7Q A;  1JYK A;  4IRQ A;  1VPA A;  1ZCY A;  4ASJ A;  1OMX A;  5DDT A;  1HM9 A;  3SXA A;  4ECM A;  1MP5 A;  2QH5 A;  2FY7 A;  2PX7 A;  3IOI A;  4R7P A;  3V0Q A;  3I0H A;  3IOH A;  2BO8 A;  1G97 A;  2YQS A;  3CKN A;  2Z86 A;  3CU0 A;  4Y7G A;  3V0N A;  5C8R A;  1H7L A;  3Q7U A;  5FTS A;  3T7O A;  1WT3 A;  2I5E A;  4B5B A;  2RJ8 A;  4Y63 A;  1R7Y A;  4HO9 A;  1R7X A;  2RJ0 A;  3I0J A;  4HO5 A;  3TQD A;  5J49 A;  5FYE A;  4HOC A;  2YCM A;  4M4K A;  3V0M A;  1LZJ A;  2P6W A;  1GWW A;  2Y4M A;  2X5Z A;  1R7V A;  1Z90 A;  1LL0 A;  2VS4 A;  3HL3 A;  3R3I A;  1FXJ A;  2W0V A;  3OC9 A;  3CKO A;  1G3L A;  4HO0 A;  3EE5 A;  4D0T A;  1G8O A;  1QGS A;  4Y7U A;  5L6S A;  3JUJ A;  2VD4 A;  5C1G A;  3RMW A;  1JVG A;  4ASY A;  3KIA A;  3CKV A;  2BO6 A;  3OAM A;  4FQW A;  3SX3 A;  4KNR A;  5C49 A;  2RIZ A;  4EE3 A;  1ZDF A;  1H5T A;  3SXC A;  1R7U A;  1G95 A;  2GGO A;  1YP3 A;  5HS2 A;  5L6V A;  4EEA A;  4D48 A;  1ZCT A;  1SS9 A;  1S4O A;  3E25 A;  1H3M A;  1TW1 A;  3TZT A;  4E1K A;  2QKX A;  2X65 A;  2A8U A;  4NAN A;  3D98 A;  1YP2 A;  4Y7V A;  1LVW A;  2V0H A;  1NMM B;  1V84 A;  2ZU8 A;  2OEG A;  1LZI A;  4FRA A;  4YS8 A;  1ZI5 A;  2V0J A;  3T7N A;  2APC A;  1ZI3 A;  3Q80 A;  2AM5 A;  1WT2 A;  2YC3 A;  3U2T A;  1H7T A;  1ZJ1 A;  2VFZ A;  2XWM A;  4FRE A;  2E3D A;  1LZ7 A;  1VZT A;  4B4G A;  3OGZ A;  3BRK X;  3I0D A;  3U2U A;  5C47 A;  3U2W A;  3OH4 A;  1FR9 A;  1G93 A;  1ZJO A;  3K8E A;  5C3D A;  1HM0 A;  4FCE A;  3E26 A;  4B2W A;  5C4D A;  3V90 A;  1VGT A;  3ZLK A;  1OQM B;  2AM3 A;  3SPT A;  1ZHJ A;  2Y7A A;  5DDV A;  1QG8 A;  5C4F A;  2AGD A;  3ZLL A;  2RJ7 A;  1FOA A;  2V0L A;  1V83 A;  1W77 A;  1ZCU A;  1QGQ A;  5CQP A;  3I0C A;  3OH2 A;  5AJO A;  1ZJ2 A;  5C3B A;  2ZU9 A;  1H4D A;  4P00 A;  2RJ6 A;  2WVK A;  4KPX A;  4KT7 A;  4D0Z A;  3ZGF A;  4Y7F A;  3SXG A;  2P72 A;  1GWV A;  1TZF A;  1IIM A;  1V82 A;  4CJ8 A;  1FGG A;  4KRV A;  4J18 A;  4G3P A;  1H4E A;  4FRL A;  3PKQ A;  3DUV A;  5EJZ A;  2O1F A;  1HV9 A;  2I7B A;  1HJJ A;  3IOJ A;  4DE7 A;  3BCV A;  1FR8 A;  2XME A;  3U2V A;  3N9W A;  1H7F A;  4DEC A;  4HO2 A;  5CQO A;  2OI7 A;  2VXL A;  1HM8 A;  1ZJ0 A;  1H5T B;  3I0K A;  1FGX A;  1PZT A;  3GUE A;  1EZI A;  1R80 A;  3OKR A;  2XWL A;  5IDS A;  4C2S A;  1W55 A;  4KC1 A;  2WVL A;  4ARW A;  3SX5 A;  4B2X A;  1R81 A;  2Y6P A;  4CJC A;  4FCU A;  3JUK A;  2PA4 A;  4M2B A;  5CMI A;  3PNN A;  1ON6 A;  1WT1 A;  2WE9 A;  1QWJ A;  1ZDG A;  1KWS A;  3JTJ A;  4G87 A;  1H5S C;  4G3S A;  3I0G A;  2VSI A;  1ON8 A;  4HO8 A;  4FRD A;  2WAW A;  1NQI B;  3U2X A;  3V8Y A;  1INI A;  3CGX A;  4Y7T A;  1VM8 A;  1O0R A;  2P73 A;  4EEO A;  1ZCV A;  2DPW A;  2Z87 A;  2MZB A;  3U0Y A;  4AAW A;  3LW6 A;  5FU8 A;  3ST8 A;  1ZIZ A;  3U0X A;  3CKQ A;  2D0J A;  2PGV A;  2Q4J A;  5CMG X;  5AJP A;  1H7G A;  2ICX A;  2FFU A;  1FWY A;  2ZU7 A;  4NAK A;  1G9R A;  2YQJ A;  1ZI4 A;  2JCL A;  1G2V A;  1TVY A;  2OEF A; 
#chains in the Genus database with same CATH topology
 1FRW A;  1VGU A;  2XMH A;  1XHB A;  4MND A;  4Y9X A;  1FO9 A;  5C4C A;  2QGI A;  5CQL X;  3F1Y A;  5C36 A;  4EEM A;  4M28 A;  4Y6N A;  1NF5 B;  1I52 A;  4KXO A;  5CMF X;  5CMJ A;  2OI5 A;  2RJ5 A;  1JV1 A;  4Y62 A;  2C0N A;  3F1C A;  2VSH A;  4L41 C;  1S4P A;  2PGY A;  1H4C A;  1EYR A;  5IDT A;  4IRP A;  2BO7 A;  2GGQ A;  4AYJ A;  3NGW A;  1W57 A;  1VIC A;  2Y4L A;  1WT0 A;  3ZGG A;  3O3P A;  1VH1 A;  2RJ4 A;  2CU2 A;  2X60 A;  4KNX A;  2O1H A;  2YES A;  3V8Z A;  1MP4 A;  2WVM A;  4DDZ A;  4BQH A;  4CJB A;  4M2A A;  3I0L A;  4XWI A;  1H7H A;  4FRM A;  1H5S D;  3OH0 A;  4B4B A;  4LW6 A;  1G23 A;  2V0K A;  2X5S A;  4NAI A;  4K6R A;  1IIN A;  2AH9 A;  4EE5 A;  4FRO A;  3QVB A;  2WGZ A;  3OH1 A;  4FRB A;  4D11 A;  2FFV A;  3SXB A;  2O1G A;  5C4B A;  5FV9 A;  5FTV A;  1ZJ3 A;  5C38 A;  1NKH B;  4LW3 A;  1O7O A;  1NHE B;  4GBP A;  1JYL A;  1PZY B;  2E8B A;  2FYB A;  3OH3 A;  2XWN A;  3SX7 A;  5C48 A;  1LZ0 A;  4FRH A;  3FWW A;  2FYD B;  3R2W A;  3V91 A;  1H5S A;  3T7M A;  3USR A;  5C3A A;  4AYL A;  2VS5 A;  2AES A;  3SXD A;  4D11 C;  2AEC A;  1H5R A;  4B4M A;  4ZDQ A;  2RJ9 A;  5EIY A;  3PKP A;  3K8D A;  4MYB A;  4UEG A;  2AM4 A;  5EJ1 A;  4EVW A;  1K4V A;  1MC3 A;  3D8V A;  5CMH A;  1G0R A;  5C1L A;  4KQL A;  4Y64 A;  1FXO A;  1MP3 A;  3V0P A;  3D5N A;  1VGZ A;  2Y4J A;  4JD0 A;  2JCO A;  2FYC B;  4O6M A;  1FZW A;  2VS3 A;  2YQC A;  1G1L A;  1H7E A;  5IFY A;  5AJN A;  1OMZ A;  1O23 B;  3V0L A;  3ZF8 A;  2OI6 A;  2VXM A;  4AC3 A;  2RJ1 A;  4P02 A;  3SXE A;  1ZJP A;  1YRO B;  4CVH A;  3DK5 A;  3Q4S A;  4KC4 A;  4B3U A;  1YP4 A;  1LL3 A;  3I0I X;  1WSZ A;  2JCK A;  2NXV A;  3RSB A;  1WVC A;  1GQ9 A;  2WEE A;  1ZI1 A;  2JCJ A;  1VZX A;  1INJ A;  1VH3 A;  1HJL A;  5I1F A;  3V0O A;  2UX8 A;  4HO4 A;  1LL2 A;  4EEG A;  1NWG B;  2RIT A;  2D7I A;  4G3Q A;  2W0W A;  2D7R A;  2YQH A;  2RIX A;  2AE7 A;  2BO4 A;  2A8W A;  5FUH A;  1E5K A;  4JIS A;  4BMA A;  1GA8 A;  4B42 A;  2ICY A;  3CKJ A;  1R82 A;  4NAL A;  3RMV A;  2YC5 A;  5CQM X;  1XZ6 A;  5CQN X;  1VZU A;  2V0I A;  4KPZ A;  5C4E A;  1VGW A;  3SX8 A;  5FU0 A;  4HCQ A;  1FO8 A;  1H5S B;  2VK9 A;  4KC2 A;  3USQ A;  3POL A;  1JVD A;  4FRQ A;  4EE4 A;  3I0E A;  1H5R B;  3I0F A;  4Y6U A;  1GQC A;  1GX4 A;  1H7Q A;  4HO6 A;  3FOQ A;  5BXC A;  2Y4K A;  1S4N A;  3DJ4 A;  5JQQ A;  1R7T A;  1FG5 N;  2FYA A;  1TW5 A;  5C1H A;  4HG6 A;  4HO3 A;  2RIY A;  4FRP A;  1GX0 A;  2I5K A;  1JV3 A;  1O7Q A;  1JYK A;  4IRQ A;  1VPA A;  1ZCY A;  4ASJ A;  1OMX A;  5DDT A;  1HM9 A;  3SXA A;  4ECM A;  1MP5 A;  2QH5 A;  2FY7 A;  2PX7 A;  3IOI A;  4R7P A;  4Q7C A;  3V0Q A;  3I0H A;  3IOH A;  2BO8 A;  1G97 A;  2YQS A;  3CKN A;  2Z86 A;  3CU0 A;  4Y7G A;  3V0N A;  5C8R A;  5D91 A;  1H7L A;  3Q7U A;  5FTS A;  3T7O A;  1WT3 A;  2I5E A;  4B5B A;  2RJ8 A;  4Y63 A;  1R7Y A;  4HO9 A;  1R7X A;  2RJ0 A;  3I0J A;  4HO5 A;  3TQD A;  5J49 A;  5FYE A;  4HOC A;  2YCM A;  4M4K A;  3V0M A;  1LZJ A;  2P6W A;  1GWW A;  2Y4M A;  2X5Z A;  1R7V A;  4FIX A;  1Z90 A;  1LL0 A;  2VS4 A;  3HL3 A;  3R3I A;  1FXJ A;  2W0V A;  3OC9 A;  3CKO A;  1G3L A;  4HO0 A;  3EE5 A;  2J0A A;  1G8O A;  1QGS A;  4D0T A;  4Y7U A;  5L6S A;  3JUJ A;  2VD4 A;  5C1G A;  3RMW A;  1JVG A;  4ASY A;  3KIA A;  3CKV A;  2BO6 A;  3OAM A;  4FQW A;  3SX3 A;  4KNR A;  5C49 A;  2RIZ A;  4EE3 A;  1ZDF A;  1H5T A;  3SXC A;  1R7U A;  1G95 A;  2GGO A;  1YP3 A;  5HS2 A;  5L6V A;  4EEA A;  4D48 A;  1ZCT A;  1SS9 A;  1S4O A;  3E25 A;  1H3M A;  1TW1 A;  3TZT A;  4E1K A;  2QKX A;  2X65 A;  2A8U A;  4O6N A;  4NAN A;  3D98 A;  4MIX A;  1YP2 A;  4Y7V A;  1LVW A;  2V0H A;  1NMM B;  1V84 A;  2ZU8 A;  2OEG A;  1LZI A;  4FRA A;  4YS8 A;  1ZI5 A;  2V0J A;  3T7N A;  2APC A;  1ZI3 A;  3Q80 A;  2AM5 A;  1WT2 A;  2YC3 A;  3U2T A;  1H7T A;  1ZJ1 A;  2VFZ A;  2XWM A;  4FRE A;  2E3D A;  1LZ7 A;  1VZT A;  4B4G A;  3OGZ A;  3BRK X;  3I0D A;  3U2U A;  5C47 A;  3U2W A;  3OH4 A;  1FR9 A;  1G93 A;  1ZJO A;  3K8E A;  5C3D A;  1HM0 A;  4FCE A;  4FIY A;  3E26 A;  4B2W A;  5D92 A;  5C4D A;  3V90 A;  1VGT A;  3ZLK A;  1OQM B;  2AM3 A;  3SPT A;  1ZHJ A;  2Y7A A;  5DDV A;  1QG8 A;  5C4F A;  2AGD A;  3ZLL A;  2RJ7 A;  1FOA A;  2V0L A;  1V83 A;  1W77 A;  1ZCU A;  1QGQ A;  5CQP A;  3I0C A;  3OH2 A;  5AJO A;  1ZJ2 A;  5C3B A;  2ZU9 A;  1H4D A;  4P00 A;  2RJ6 A;  2WVK A;  4KPX A;  4KT7 A;  4D0Z A;  3ZGF A;  4Y7F A;  3SXG A;  2P72 A;  1GWV A;  1TZF A;  1IIM A;  1V82 A;  4CJ8 A;  1FGG A;  4KRV A;  4J18 A;  4G3P A;  1H4E A;  4FRL A;  3PKQ A;  3DUV A;  5EJZ A;  2O1F A;  1HV9 A;  2I7B A;  1HJJ A;  3IOJ A;  4DE7 A;  3BCV A;  1FR8 A;  2XME A;  3U2V A;  3N9W A;  1H7F A;  4DEC A;  4HO2 A;  5CQO A;  2OI7 A;  2VXL A;  1HM8 A;  1ZJ0 A;  1H5T B;  3I0K A;  1FGX A;  1PZT A;  3GUE A;  1EZI A;  1R80 A;  3OKR A;  2XWL A;  5IDS A;  4C2S A;  1W55 A;  4KC1 A;  2WVL A;  4ARW A;  3SX5 A;  4B2X A;  1R81 A;  2Y6P A;  4CJC A;  4FCU A;  3JUK A;  2PA4 A;  4M2B A;  5CMI A;  3PNN A;  1ON6 A;  1WT1 A;  2WE9 A;  1QWJ A;  1ZDG A;  1KWS A;  3JTJ A;  4G87 A;  1H5S C;  4G3S A;  3I0G A;  2VSI A;  1ON8 A;  4HO8 A;  4FRD A;  2J0B A;  1NQI B;  2WAW A;  3U2X A;  3V8Y A;  1INI A;  3CGX A;  4Y7T A;  1VM8 A;  1O0R A;  2P73 A;  4EEO A;  1ZCV A;  2DPW A;  2Z87 A;  2MZB A;  3U0Y A;  4AAW A;  3LW6 A;  5FU8 A;  3ST8 A;  1ZIZ A;  3U0X A;  3CKQ A;  2D0J A;  2PGV A;  2Q4J A;  5CMG X;  5AJP A;  1H7G A;  2ICX A;  2FFU A;  1FWY A;  2ZU7 A;  4NAK A;  1G9R A;  2YQJ A;  1ZI4 A;  2JCL A;  1G2V A;  1TVY A;  2OEF A; 
#chains in the Genus database with same CATH homology
 1FRW A;  1VGU A;  2XMH A;  1XHB A;  4MND A;  4Y9X A;  1FO9 A;  5C4C A;  2QGI A;  5CQL X;  3F1Y A;  5C36 A;  4EEM A;  4M28 A;  4Y6N A;  1NF5 B;  1I52 A;  4KXO A;  5CMF X;  5CMJ A;  2OI5 A;  2RJ5 A;  1JV1 A;  4Y62 A;  2C0N A;  3F1C A;  2VSH A;  4L41 C;  1S4P A;  2PGY A;  1H4C A;  1EYR A;  5IDT A;  4IRP A;  2BO7 A;  2GGQ A;  4AYJ A;  3NGW A;  1W57 A;  1VIC A;  2Y4L A;  1WT0 A;  3ZGG A;  3O3P A;  1VH1 A;  2RJ4 A;  2CU2 A;  2X60 A;  4KNX A;  2O1H A;  2YES A;  3V8Z A;  1MP4 A;  2WVM A;  4DDZ A;  4BQH A;  4CJB A;  4M2A A;  3I0L A;  4XWI A;  1H7H A;  4FRM A;  1H5S D;  3OH0 A;  4B4B A;  4LW6 A;  1G23 A;  2V0K A;  2X5S A;  4NAI A;  4K6R A;  1IIN A;  2AH9 A;  4EE5 A;  4FRO A;  3QVB A;  2WGZ A;  3OH1 A;  4FRB A;  4D11 A;  2FFV A;  3SXB A;  2O1G A;  5C4B A;  5FV9 A;  5FTV A;  1ZJ3 A;  5C38 A;  1NKH B;  4LW3 A;  1O7O A;  1NHE B;  4GBP A;  1JYL A;  1PZY B;  2E8B A;  2FYB A;  3OH3 A;  2XWN A;  3SX7 A;  5C48 A;  1LZ0 A;  4FRH A;  3FWW A;  2FYD B;  3R2W A;  3V91 A;  1H5S A;  3T7M A;  3USR A;  5C3A A;  4AYL A;  2VS5 A;  2AES A;  3SXD A;  4D11 C;  2AEC A;  1H5R A;  4B4M A;  4ZDQ A;  2RJ9 A;  5EIY A;  3PKP A;  3K8D A;  4MYB A;  4UEG A;  2AM4 A;  5EJ1 A;  4EVW A;  1K4V A;  1MC3 A;  3D8V A;  5CMH A;  1G0R A;  5C1L A;  4KQL A;  4Y64 A;  1FXO A;  1MP3 A;  3V0P A;  3D5N A;  1VGZ A;  2Y4J A;  4JD0 A;  2JCO A;  2FYC B;  4O6M A;  1FZW A;  2VS3 A;  2YQC A;  1G1L A;  1H7E A;  5IFY A;  5AJN A;  1OMZ A;  1O23 B;  3V0L A;  3ZF8 A;  2OI6 A;  2VXM A;  4AC3 A;  2RJ1 A;  4P02 A;  3SXE A;  1ZJP A;  1YRO B;  4CVH A;  3DK5 A;  3Q4S A;  4KC4 A;  4B3U A;  1YP4 A;  1LL3 A;  3I0I X;  1WSZ A;  2JCK A;  2NXV A;  3RSB A;  1WVC A;  1GQ9 A;  2WEE A;  1ZI1 A;  2JCJ A;  1VZX A;  1INJ A;  1VH3 A;  1HJL A;  5I1F A;  3V0O A;  2UX8 A;  4HO4 A;  1LL2 A;  4EEG A;  1NWG B;  2RIT A;  2D7I A;  4G3Q A;  2W0W A;  2D7R A;  2YQH A;  2RIX A;  2AE7 A;  2BO4 A;  2A8W A;  5FUH A;  1E5K A;  4JIS A;  4BMA A;  1GA8 A;  4B42 A;  2ICY A;  3CKJ A;  1R82 A;  4NAL A;  3RMV A;  2YC5 A;  5CQM X;  1XZ6 A;  5CQN X;  1VZU A;  2V0I A;  4KPZ A;  5C4E A;  1VGW A;  3SX8 A;  5FU0 A;  4HCQ A;  1FO8 A;  1H5S B;  2VK9 A;  4KC2 A;  3USQ A;  3POL A;  1JVD A;  4FRQ A;  4EE4 A;  3I0E A;  1H5R B;  3I0F A;  4Y6U A;  1GQC A;  1GX4 A;  1H7Q A;  4HO6 A;  3FOQ A;  5BXC A;  2Y4K A;  1S4N A;  3DJ4 A;  5JQQ A;  1R7T A;  1FG5 N;  2FYA A;  1TW5 A;  5C1H A;  4HG6 A;  4HO3 A;  2RIY A;  4FRP A;  1GX0 A;  2I5K A;  1JV3 A;  1O7Q A;  1JYK A;  4IRQ A;  1VPA A;  1ZCY A;  4ASJ A;  1OMX A;  5DDT A;  1HM9 A;  3SXA A;  4ECM A;  1MP5 A;  2QH5 A;  2FY7 A;  2PX7 A;  3IOI A;  4R7P A;  4Q7C A;  3V0Q A;  3I0H A;  3IOH A;  2BO8 A;  1G97 A;  2YQS A;  3CKN A;  2Z86 A;  3CU0 A;  4Y7G A;  3V0N A;  5C8R A;  5D91 A;  1H7L A;  3Q7U A;  5FTS A;  3T7O A;  1WT3 A;  2I5E A;  4B5B A;  2RJ8 A;  4Y63 A;  1R7Y A;  4HO9 A;  1R7X A;  2RJ0 A;  3I0J A;  4HO5 A;  3TQD A;  5J49 A;  5FYE A;  4HOC A;  2YCM A;  4M4K A;  3V0M A;  1LZJ A;  2P6W A;  1GWW A;  2Y4M A;  2X5Z A;  1R7V A;  4FIX A;  1Z90 A;  1LL0 A;  2VS4 A;  3HL3 A;  3R3I A;  1FXJ A;  2W0V A;  3OC9 A;  3CKO A;  1G3L A;  4HO0 A;  3EE5 A;  2J0A A;  1G8O A;  1QGS A;  4D0T A;  4Y7U A;  5L6S A;  3JUJ A;  2VD4 A;  5C1G A;  3RMW A;  1JVG A;  4ASY A;  3KIA A;  3CKV A;  2BO6 A;  3OAM A;  4FQW A;  3SX3 A;  4KNR A;  5C49 A;  2RIZ A;  4EE3 A;  1ZDF A;  1H5T A;  3SXC A;  1R7U A;  1G95 A;  2GGO A;  1YP3 A;  5HS2 A;  5L6V A;  4EEA A;  4D48 A;  1ZCT A;  1SS9 A;  1S4O A;  3E25 A;  1H3M A;  1TW1 A;  3TZT A;  4E1K A;  2QKX A;  2X65 A;  2A8U A;  4O6N A;  4NAN A;  3D98 A;  4MIX A;  1YP2 A;  4Y7V A;  1LVW A;  2V0H A;  1NMM B;  1V84 A;  2ZU8 A;  2OEG A;  1LZI A;  4FRA A;  4YS8 A;  1ZI5 A;  2V0J A;  3T7N A;  2APC A;  1ZI3 A;  3Q80 A;  2AM5 A;  1WT2 A;  2YC3 A;  3U2T A;  1H7T A;  1ZJ1 A;  2VFZ A;  2XWM A;  4FRE A;  2E3D A;  1LZ7 A;  1VZT A;  4B4G A;  3OGZ A;  3BRK X;  3I0D A;  3U2U A;  5C47 A;  3U2W A;  3OH4 A;  1FR9 A;  1G93 A;  1ZJO A;  3K8E A;  5C3D A;  1HM0 A;  4FCE A;  4FIY A;  3E26 A;  4B2W A;  5D92 A;  5C4D A;  3V90 A;  1VGT A;  3ZLK A;  1OQM B;  2AM3 A;  3SPT A;  1ZHJ A;  2Y7A A;  5DDV A;  1QG8 A;  5C4F A;  2AGD A;  3ZLL A;  2RJ7 A;  1FOA A;  2V0L A;  1V83 A;  1W77 A;  1ZCU A;  1QGQ A;  5CQP A;  3I0C A;  3OH2 A;  5AJO A;  1ZJ2 A;  5C3B A;  2ZU9 A;  1H4D A;  4P00 A;  2RJ6 A;  2WVK A;  4KPX A;  4KT7 A;  4D0Z A;  3ZGF A;  4Y7F A;  3SXG A;  2P72 A;  1GWV A;  1TZF A;  1IIM A;  1V82 A;  4CJ8 A;  1FGG A;  4KRV A;  4J18 A;  4G3P A;  1H4E A;  4FRL A;  3PKQ A;  3DUV A;  5EJZ A;  2O1F A;  1HV9 A;  2I7B A;  1HJJ A;  3IOJ A;  4DE7 A;  3BCV A;  1FR8 A;  2XME A;  3U2V A;  3N9W A;  1H7F A;  4DEC A;  4HO2 A;  5CQO A;  2OI7 A;  2VXL A;  1HM8 A;  1ZJ0 A;  1H5T B;  3I0K A;  1FGX A;  1PZT A;  3GUE A;  1EZI A;  1R80 A;  3OKR A;  2XWL A;  5IDS A;  4C2S A;  1W55 A;  4KC1 A;  2WVL A;  4ARW A;  3SX5 A;  4B2X A;  1R81 A;  2Y6P A;  4CJC A;  4FCU A;  3JUK A;  2PA4 A;  4M2B A;  5CMI A;  3PNN A;  1ON6 A;  1WT1 A;  2WE9 A;  1QWJ A;  1ZDG A;  1KWS A;  3JTJ A;  4G87 A;  1H5S C;  4G3S A;  3I0G A;  2VSI A;  1ON8 A;  4HO8 A;  4FRD A;  2J0B A;  1NQI B;  2WAW A;  3U2X A;  3V8Y A;  1INI A;  3CGX A;  4Y7T A;  1VM8 A;  1O0R A;  2P73 A;  4EEO A;  1ZCV A;  2DPW A;  2Z87 A;  2MZB A;  3U0Y A;  4AAW A;  3LW6 A;  5FU8 A;  3ST8 A;  1ZIZ A;  3U0X A;  3CKQ A;  2D0J A;  2PGV A;  2Q4J A;  5CMG X;  5AJP A;  1H7G A;  2ICX A;  2FFU A;  1FWY A;  2ZU7 A;  4NAK A;  1G9R A;  2YQJ A;  1ZI4 A;  2JCL A;  1G2V A;  1TVY A;  2OEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...