3ZMEA

Structure of the p53 core domain mutant y220c bound to the small molecule phikan7242
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecule induced reactivation of mutant p53 in cancer cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Cellular tumor antigen p53
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmeA00
4IBYA 3QYMA 3ZMEA 3WTUA 2GEQA 1HJBC 3TS8A 4GUQA 4HJEA 3WTTA 5AOMA 3WU1A 2J1WA 4AGOA 2H1LM 2AC0A 3Q01A 3WTYA 5AOIA 3WTWA 5G4OA 4XR8C 3EXJA 4IBUA 1TSRA 5ECGA 1HJCA 2VUKA 2FEJA 4IBQA 2WGXA 5AB9A 2YBGA 1E50A 3WTVA 4QO1B 1LJMA 4MZRA 3IGLA 2X0WA 2XWCA 4IBTA 3IGKA 2OCJA 2J1ZA 1IO4C 4A63A 2XWRA 4AGNA 4LO9A 3D08A 4MZIA 3US0A 4AGQA 3D0AA 1EAOA 2BIMA 3D06A 5G4NA 3Q05A 2BINA 1YCSA 2J20A 2ATAA 1T4WA 2IOIA 1CMOA 5BUAA 3WTXA 3QYNA 2BIOA 4IJTA 4IBSA 4KVPA 2RMNA 3VD2A 3KZ8A 4G83A 5LAPA 1UOLA 2X0UA 3US1A 4L18A 2J21A 2PCXA 3EXLA 1HU8A 4AGLA 4IBZA 3D05A 3VD1A 4AGPA 2IOMA 2J1XA 5ABAA 2J1YA 3Q06A 2IOOA 2X0VA 3VD0A 2BIQA 2MEJB 1H9DA 5A7BA 2J6WA 3KMDA 4GUOA 4AGMA 2ADYA 4L0YA 2P52A 4LOFA 5AOLA 5KBDA 2AHIA 1KZYA 2BIPA 1EAQA 4LOEA 5AOKA 3D09A 3WTSA 5G4MA 5AOJA 1EANA 4IBVA 5LGYA 1TUPA 4G82A 1CO1A 4L0ZA 1GZHA 1GZHC 4IBWA 3D07A
chains in the Genus database with same CATH superfamily
3GQFA 4ZAKA 5AVRB 3FF8A 4XMPH 1DUYB 2IGFH 3GBNH 3UTPE 4BEIA 2VR6A 2ZSWA 4FLQA 3ZMRA 4DEPB 4KDVA 4PJ6A 1JPSH 1IAIH 3MODL 1U92A 5F9WB 3ATAA 1T83C 3F5WA 3BKYH 3MRNA 4KZEH 4YLBA 3SN6N 5LGHH 1CGVA 2EDJA 3D2UD 3VXQA 4OI8A 3HG1B 1NGQH 4NQXB 4RBPK 1HN1A 3C5SB 5IMOA 5DC2A 2FT8A 4G9FD 3FO0H 5D1ZA 4QR7A 1R3LA 3FU5A 2ZXAA 2VLKE 4QD2E 3X12A 5KYUB 2D7PA 4FLSA 4JDTL 4MMYA 2ZXBA 4RMVA 5SWSD 4HOXA 4ONOA 5D71H 3X13B 4O2EB 4HIPA 5DJ6B 1GOFA 2ENPA 4N2LA 2HRPH 5HHPA 5F6HI 4AW7A 4CSSA 3CCHA 4L3EB 2HWZH 2Z8SA 2R0WL 3R06A 4KQ3L 2EILB 5AL0A 5IBTL 3PXJA 5IB4A 1YEGH 1OV8A 5G55A 4CMMA 1JSYA 5FW8A 5TTRA 1OCCB 2CLZA 4U3HA 3WNKA 2PO6B 1FLTX 4FQPA 1HWHB 4PWKA 2Y22A 1FWXA 4PRAA 1L7IH 2HRPL 3IDYC 1WUNT 1L4IA 5CJOH 1PKQB 5DUML 1NWOA 4O02L 5IGXH 3D25A 5FCUL 1RK1A 5C0JB 4PCTA 2BCMA 3V55A 2OL3A 2OMWB 3W1ZA 1ZV5A 2DQGL 1CGTA 1K3ZA 1H0DB 1T6BX 4QRSA 4EQ2A 3QIUA 4PGDA 4PJ8D 1IC1A 1KG0A 2PPDA 5GJSL 3SGJA 1J1XH 4JCLA 3LD8B 3STZA 4AW4A 3FT9A 1JPFA 1HL9A 2YPLA 4HIJA 1NANI 1KDIA 4KAQL 4WWNA 4ZDHA 2BP0B 2WBXA 3RVUD 5IJVB 1QEWB 1FNGA 3DOHA 1MCFA 4NT6A 3RP1A 3O4LB 4JFPA 4U31A 4N2CA 3MLXL 2V9RA 2AABL 4K3DH 5I8OH 5C0EA 2NNXA 4NHCL 1HZHL 5BVPH 3S8GB 1L9RA 4LCVA 1MZYA 4U1LA 1INDL 3RIFF 1FFTB 3T0EB 4OLVL 3EZJB 4L0YA 1DQDL 4UB0L 4Y9EA 3TV8A 3EJRA 1TLKA 3FB8A 1C5CL 3QP3A 3SKJL 2L3BA 3ZT5A 3UTSE 2EUWA 4PMFA 4TTDC 5SWZA 3F6LA 2B14A 4JZNB 4UZUA 2X2YA 3EYFA 4WV1C 1XGRA 3LH9A 2FJSA 2YR3A 2IAAC 2OJ1A 3LKPB 4X8XA 4J4PC 2H9GA 4XOEA 3SGDH 1AIZA 5I1JH 1CURA 1I3RA 1F02I 5DFAA 1KEMH 4R4FH 1I82A 3I2CL 3NH7L 1FCGA 4KO7A 3QUMB 3SKOA 4HKZA 3VJ6B 5D7JB 3WSQH 3BWAA 2DMBA 1TCRB 5IVZB 5F96H 3SDXA 3QUHA 3X1BA 3QUZB 3NVQA 4O02B 4DP2X 3O3BA 1PY9A 4OD3H 2RR3A 5C6TL 1Z1WA 4FKKA 3K6OA 2Y36H 3Q2LA 5LBSH 4BZ2A 2EKSA 5DRZB 1SF3A 3AY4C 4KY1L 1XB6A 1A66A 1H9VA 4KK8C 1BG9A 3ZSTA 4E41D 3SZ6A 2ZCHL 5ERWA 1H15A 4JFFB 1N8ZB 1LP9A 1PZ3A 2AANA 4V33A 4XP5L 4KK6D 5KVEE 2DKSA 4MAYC 4BFRA 1A3RL 1KBGH 5ILTL 1E5AA 1RERA 1NKOA 3IDUA 3N2JA 4FQQB 4BQ9A 3DJ9A 3US0A 2XXMB 3ZGHA 2DN7A 3P0VL 2PYEB 5AVWB 2ED7A 2VLRE 4C4KO 2CALA 4XPFH 1XBDA 5C0BB 2BS8A 2FO4B 4I18B 3WKMH 4ESKA 1K6QL 4BCYA 4EAEA 1UURA 2CKBB 4MJID 3TWCH 1LDPH 4DO5A 3FQTB 3V4PL 1YC8A 1T5WB 1MJ7H 2OLDA 4EI5B 5I18L 4FI6A 4WEMB 1DN2A 1A3LH 3DUSA 1YEEH 3NAAL 3VQLA 2X4NB 3TEUA 3RTQC 2VQ1B 5DTFB 3IF1B 5EEXA 1O0VA 4ODUB 1ZIAA 2IBBA 4TUKL 4FA7B 2O6PA 1XSIA 3QIWB 2IQAB 4LIQH 3U9WA 4P2QD 4IOFD 4U3XA 2PN5A 2WWKO 1RP9A 3FSOA 2VGLM 3B56A 4XC1H 1S2EA 2KZWA 3ULVC 3NJFA 4ZUSA 2C3HA 5AWNL 5F7BA 1IEAA 4OM0H 4WFEE 1UD6A 2YRBA 3X12B 3IMVA 1FQ9C 2K1MA 4D3CL 5I8CB 3ZYIA 2MQ3A 5C0CB 3ZDZB 2FGWH 3NCJL 4OD2A 5BRZE 4NQTA 1NMAL 2EDXA 2QLYA 3PREA 4JMNA 2WO2B 2WOYA 1ID5I 4QOKD 4AEHH 1FVCB 5K59E 2QTVA 3C9NB 3GEWB 2HX8A 5TQ2H 3OQ3B 3I75B 5DXWA 4RAUA 4APQD 3BLKA 3E6HB 2EE9A 4L1SA 3LEVL 3J27A 5B22A 1CFMA 4CW1A 5K39A 3U7WL 3PQYD 5L8KB 1ADQA 5BV7C 1JWSB 1GOHA 3RE0A 1VFBB 1I1RA 2RJMA 4GLRH 5CMAA 1CBVH 2NUTB 3SDYL 2X1WL 5MEOA 2R7EA 4NO0B 3SPGA 1A9VA 4W81A 5TE4L 1HDMB 1GCFA 5E2VL 4QRRA 1NCAL 3IB4A 5IBLD 1T1YB 4X8JA 2D03H 3C5XA 3UMTA 3DXAD 5K9QI 1P5VA 3EFOA 3FTXA 1I8MA 3OKMA 1A7NL 1ET8A 2WNGA 2D7NA 1FGVL 3PGCB 1PFOA 2CBTA 4MMZC 3LIZA 4YN3A 4B5EA 2V37A 3JV6A 5J56B 4NT6B 4AYSA 3EBHA 2R29H 2V6HA 3ZTJG 1LDSA 4BFEA 1SOQA 3A6BL 3IGLA 2YXWA 4PFEA 2YGVA 4OLZH 1CLCA 4KI1A 5GGRB 5TE7H 3DO4A 3EBGA 1J9SA 4PREB 1ZPLA 2WUBL 1TZ8A 3FZUC 3II1A 3N40P 2RQEA 3QEQE 1P7HL 3S3SA 2EUXA 3VI4B 1H8NA 1Z0MA 2XDHA 3I6SA 3HC0A 3LNIA 1QMUA 4QGYA 2W9DH 1KTCA 4RGMC 1NH6A 1G7IB 3ARTA 3F8UB 5EU4B 1IVLA 2YN3A 1R1CA 4JPIA 4I1PA 4X6CF 1FCCA 3SSGA 3VXMB 5I1IH 5DD5H 4WHYH 3LXUX 2JMRA 4JX0A 4Q2ZB 4PV8B 4HFUL 4I0CC 4OW6A 5AAWC 3FO2A 3WIHL 5FC9A 3MRIA 2B1AH 1QPPA 4OKVB 3W5NA 3A22A 3C60A 4K15A 1Y07A 3P2BA 4MWFB 2UZXA 3UMNA 4OF6A 5F3HA 5J13C 4I5BA 2Q3ZA 1UA3A 4PJ5D 4ENED 4PIBA 4QNPF 1HCFX 1KGCE 3VXSA 4NUMA 4YDJB 1YY8A 4ZYKB 1FAIL 3S5ZA 1TQCB 4HUUB 1AGCA 3KNBB 5IJKC 3APMA 3K3QA 4GAAA 3T1FB 1R0AH 2OJEB 3IDJA 1XCQA 4P5RA 1UACH 2APFA 3JWDL 3U0TA 3GXTA 3QQXA 2R1XB 3KVQA 4HZLB 5LBGA 4GW4A 4LRIC 5ADPH 5LQBH 4LKXB 1LD9A 3FKUS 5FKAA 5DSCB 5CP7B 1CDGA 3FB6B 5DWUL 5G2NA 3NJKA 2OTWB 1YC7A 3TEXA 4MX7A 3OKYA 3M45A 1P9MC 4EF3A 4OIIH 2E7MA 2VDNB 5T3XL 2HSIA 2FWOB 4M8RA 5DD6A 3P9LB 4CAGA 3GK8H 4MDJA 2B1HH 2QSCL 1QTYT 5L2KE 2HFEB 2X4TB 3VFOA 1NIBA 4NRYA 1IGFH 2JK5B 3FH5A 1JK9B 1QRKA 2YD7A 4OY9A 5ISZA 2GFBB 1N70A 3L16A 2MOGA 2CNZA 5CEYB 2F0CA 1ZT7B 3EGXB 2HFGH 1E50A 1KJ2A 1FGVH 2ZOKB 1LJMA 1FFOA 4XXDA 4MMZB 2K70A 1WC7A 2WTPA 1Y6NR 2R29L 5FO9B 1HQ4B 3HB3D 3NIDE 1A2YA 4H1LG 3SPVA 2CGYA 3QEUB 4E9LA 1KPVB 4B7IA 3L3DB 5JHLH 1XZ0A 2AMUA 2K45A 2WKOF 3OMAB 3T1WA 4FHBD 3DHMA 1MCQA 4HMDA 3KPTA 4N85A 2OMXB 3H1ZA 5GHWL 1QHQA 4U3CA 2HVKB 2C8NA 3NQKA 4HKJB 3SE4C 3QFJB 5LN4A 2YMOA 3EJUA 1SJHB 4XPHH 2YMXH 5F0MB 3IWVA 2YD3A 5TFSL 1R3HB 3UGXA 5BZWA 3BYTA 2WKOA 1R3JB 1LWRA 1QQDA 2FJGB 3K5SA 4CBPA 1LL1A 3BAWA 4NAMA 1L7TH 1V3KA 1B4JH 5GGTA 1J7VR 2NMSA 4IRZH 3GGWA 1FNGB 5ICXB 4N0CD 1BLNA 4G7RB 1UD8A 3KLAB 3RZWA 1E8YA 2YA2A 1WBZB 3TLRA 5HP5A 3HPJA 3LVEA 3SYAA 4XVOA 2MKWA 3GDBA 4NQVB 4AL8L 3VXPB 4DVRL 2V4LA 5KS9B 4JK0D 3I6KB 1KGJA 3V6OC 4XCYB 4S1RH 3V9CA 2OQJA 5F7FA 2VLRD 3QG7H 3RFZA 5E4OA 5JNYA 3F7LA 2ZKWA 1JI1A 1DBMH 1JN6A 1U2YA 1H9DA 3QXDB 2Z4TA 2QPDB 2VLLB 4AQZA 3BVWA 2GI0A 1ESOA 3ARPA 3LKNB 1OGAE 1PS3A 2BS71 4G5ZH 5CBAB 3CFTA 5IQ9B 4OV5A 4F9LA 4EIGB 2W0PA 5F9OH 3WDHA 1KUMA 1JPEA 5HDRA 1ZDSA 2ADFL 3RL1A 3LQZB 5F7HA 3VRIA 4JHUA 4R7LA 5EC2A 1C5DB 3BIKA 4FQ1L 4N8CH 5EU6A 2KH2B 2FEDC 4PJ9B 2Z7YA 4MJIA 4ZW8A 3SKMA 4OCRH 1S7SB 4WVRA 4PJXF 3IJYB 1ZT1B 1NC4D 4DKTA 5L2KB 3ELQA 2K6WA 5CLZA 5AOMA 4CJ0A 1QBBA 2DQEL 5DJAA 5IW6A 1PY0A 2FSEA 4JFEE 1JXFA 4BD4A 3ALPA 3AM8A 4M00A 3SDCD 2BP8B 1CGSL 3P11H 5F0JB 4PRPE 4ZOCA 1IUZA 3BD4A 4P5TA 2JWYA 3PNWB 4FEMA 5TH2A 5JIIA 1T0MA 2Q3XA 1UH4A 4K71B 5DZJA 4Z1PA 1NUDA 2IMMA 3L5IA 2XWCA 2EDHA 5DJ0A 4XPAL 2YQGA 4K7PH 3QJRB 3EYOA 3WXVL 2DQTH 1IO4C 4LHUG 5EWIH 3EYSH 4RNRB 2X10A 5TDPA 2O5YL 3RDTC 3PWNB 1N12A 4N2DA 3UG4A 2ITCB 4KPHL 3MAWA 2XWJA 3EDFA 1WGOA 3V0IA 2Y6SD 2VSDA 3O3EB 3ARRA 2PCPB 2VERA 5E0QA 4NIKB 2VABB 1UM6L 1PKQE 2LU4A 3QPQC 2DWDB 2VAAB 4PJAE 2VXQA 3S35H 4DUVA 4HIXH 5FECB 4S0TD 2IAMB 1XCTB 4KROD 1CCZA 4PBXA 4PRIA 2A1WH 1J0YA 1RUKL 1FO0L 3APNA 3JWNG 2WVVA 1NDMA 3ABGA 4D9QE 5AUMA 1B4TA 3HE7B 1O7DE 4B7LA 43CAB 1QYGL 1FJ1A 2JJVA 3MRLB 1DLFL 2XKNA 2BDNL 1N8OE 5LAXA 3N41F 3H42L 4MNGA 1JD7A 5EU7E 4S1QL 4PJHF 1BX2B 3FYIB 2ZKYA 1FRGH 2K0RA 5I15H 4NQXA 4O2CB 3NPSB 2FK9A 1UH2A 3B9VA 3AAZB 3ELAT 5TQ2L 2ADYA 1TKWA 5FWQA 3PP3H 2WN3A 5AOLA 4DAGL 5L0QB 2DM2A 2NYYC 4RFEB 2OMYA 5E1IA 2BW4A 3A6CH 3EBAA 5IKCA 3MC0A 3HS0C 2D7TH 4YBLB 2QADC 1I9RH 1XZWA 5EN2B 4NKDB 1BBJB 4AIOA 4YHKL 1DQML 3NIFF 2C7UB 1MELA 3O3DB 1K5NA 4NRZB 1BECA 1NCDH 4OIBA 5DUJA 4XVSL 3PQYA 5E8OB 1KBKA 3H3PH 3NFSH 3CQFA 1JZDC 2PO6C 4N6QA 2H6UA 3VYPA 3GI8H 2DQUL 3WU1A 2H41A 1AACA 4MA7L 1PIGA 2NZ9D 5DRXA 2ZP0T 5ITBH 4L05A 5JYLA 3E6FA 2E27L 1Q0XH 2WCPA 2XXFA 3CFNA 2L4OA 4R7NA 1NCDL 4IRSA 1UASA 4PH8A 1GC1H 5LWYL 3IAPA 3OJDA 3VW3H 4PREA 2YLKA 1BQLL 4JFFE 4JY4A 4RAVB 4Y88A 4F2EA 2F5AH 2IPTL 2WGXA 1GPOL 3NG5A 1U8QB 4PJCB 2E0PA 3BWZA 3SDDA 4NKIL 2BFVH 1MW2A 3QG6A 5ITFB 3T0XA 2H45A 3U83A 2G3XA 5LNGA 1A14L 2FATL 4GBXA 1HT6A 3V4PA 4BFJA 3RU8L 2NYZA 5F89A 3WJJA 4XO4A 3K4ZA 5B7EA 4UT9L 2KDGA 4M4RB 1RUPL 2VN6A 2ATPA 3GHPA 3TGXA 3CLEL 3KDMB 1WF5A 2P8PB 2QT6A 1IGIL 3K0YA 2GI7A 3IU4H 4OCRL 4G8FB 1ITBB 3GRWH 4KMTH 3CXFA 4ODVL 5F9WC 4Z76A 3IDIB 3GMNA 1I3UA 2EEDA 3IE4A 1JGVH 1AP2B 1RJLB 3VB9A 3GEFA 3NN8B 1IBYA 4QXGH 2OYKA 3ORJA 4I85A 3STLB 3QHFH 1EK3A 1S7RB 4RDQG 1WIPA 1TTGA 1E4WH 4K5PA 3TYGH 2AV1A 2TRYA 3QXAA 4DNLA 1BF2A 3Q3GB 1ZS8A 3VVVA 4XPFL 1R5VA 1PPIA 4R5XA 3I2CH 3NH7H 1HI6A 2APVA 4UM8A 2IC2A 4BGLA 3NP4A 5CSGA 2AJSL 3FRPB 4ZK8A 4IGBD 2W07B 4AQAB 1HU8A 4Y5VC 4D9LL 4PJ5A 4DWHA 3S7GA 3KLDA 2GJJA 4LFHG 2C1OA 3MMEB 4R0LC 3QRFM 4WO4D 3P4LA 4PV1C 4LRIA 5MI0C 3FT2A 1U6AH 4PJXB 4HCGA 1OCWH 1IKFH 3B3BA 1BD2E 4MFHA 1ES0B 1K72A 1RQ5A 5HI4C 4YSRA 1VCAA 1JP5A 3HKFA 1F4WL 1WG3A 3PDOA 4O51A 3RFRA 3QZNA 1AQDB 4PW9A 2DBLH 3E2HB 5F3BA 2FWOA 3N44F 3RVVD 1OL0A 3IKKA 3D09A 5JYMA 1BEYL 4MSWB 4NI3A 2WXMA 4G7YH 3PP4H 1YNKH 4MQXC 1HKLH 1MCWW 2CJUH 2EEXA 2UWEA 5D1XE 4N5UA 4ACPA 5IJDC 3WTUA 5EEUA 2DV6A 3K8LA 3VFRA 2N1TE 2PXYA 3HHRB 4M5ZL 1KOAA 4I0KA 2VXVH 3U30B 5DCCA 1CQYA 2ZUQB 3JBG7 1QASA 5B4MD 3EJYC 5KSBE 3UJJL 1BFVH 4PJBA 4ZSOE 4EMZA 1UXWA 4JHBA 3FFOA 4YHOH 5EMYA 1UJ3B 3RUGF 4WUUD 3CXDL 2CK0L 2XXGA 3P9MA 1IC7H 4GRWF 4S1QH 1M7DA 3IJEA 1GCYA 2FX7L 3X11A 2X6MA 5DFVD 4GKZB 3QDME 3Q8EA 1J86A 4JANA 4JLRB 4L0PB 4ORGB 1J10A 1JPSL 2A99A 3MODH 2P5EB 1UWXH 2VLRA 5HYJD 5GS2D 3N06B 4QO1B 5EOCJ 1INQB 3SCMB 2E4TA 2E7DA 5DR5L 5JIQA 2VB5A 1CLOH 4J5VA 4O2CA 1N9PA 4B9FA 4TSAL 1MW0A 4OGXL 4NUJB 1A14H 2FATH 4U1KB 4M6MH 3IYLW 1LMIA 1MEXH 2CCLA 3FYEB 4WFFD 1NMAH 1U21A 1FO0H 1DUYA 3DKHA 5E99L 5ESQB 4FMFA 3TBYA 4A7TA 2O5XH 4DJMA 1I1YA 2KLRA 2IF7A 3HNTL 3OKDA 4GFTB 1ETZA 1HTYA 4WK2B 3WL9B 2YN5A 3FPXA 3D69A 1S9XB 3FOMB 4KRPC 3KWWB 2H2SD 2NSXA 3QAZB 4KO5A 3GRGA 3ARXA 1X5HA 1HH9B 2MPAH 4X9HA 1FO0A 4B5ZA 5ENWA 1QSFD 1RI8A 1G84A 3V52H 4FN0A 1Y0LB 4QRPB 4ELKA 1HOCB 1YJDL 4IM8A 4RIRA 2G75B 4L18A 3K46A 4DESA 3K2UH 1UVQB 2DW5A 3LIZH 1YMHB 5EEZA 3W39A 2AEIT 4R4ND 4FQCH 1B0RB 4AGLA 4LCCB 3ECWA 2HCZX 5L7XH 3UTQB 3VD1A 2NDGA 2Z8WC 1BFOA 3BUTA 4J3OH 1H5BA 4W9JC 4Q4EA 3GSRB 1E5UI 1BVLB 5AVYB 1Q94B 4B9GA 2K8MA 3NA9L 4Z18A 1KXTB 3CQPA 4JB9H 3AXLA 2HFFA 4LLWA 32C2B 1FF5A 2GBUA 1CYGA 4HJIA 1KB5A 3OMZA 3DA0A 4W9LC 3DURB 3E1F1 3OHXA 2VUYA 2AAVA 4CKQA 5D96C 3UABA 1MWAB 1KCLA 2JCCE 1EAQA 5HHOD 4XVJL 4H20H 5D2LA 4DT2A 3WAKA 4Q0XL 1F86A 4H4NA 2WLIB 5GRVK 1CTNA 1VEMA 1A7OL 2IADB 4U1HA 3T8XB 2XZCL 2A6IB 1SF5A 3TV3H 1EEZA 1A64A 5FYLE 5D7EA 3WG7B 4HKXB 4FQJL 3VFMA 3VTTA 2FLBT 3BXNA 4LASH 1CL7L 1JDCA 3VGGA 1DE4A 1EJ6A 4F57L 2QPUA 4JPWL 4N9OB 4L8SA 4G9FE 2O61A 3IJSA 4MXQD 3GIVB 3AZUA 4NKMB 3O8XD 4XMKH 2P5EE 3EHBD 4IMLB 3TBWA 3GSUB 1BMGA 2PP9A 2AJZA 3MRCB 2XUWA 5D70L 1UTDA 4NN5C 4N6RA 3VAEA 3LKSB 5I23A 2IBGA 1JV2A 1VACA 2CBOA 2FO8A 4HS3A 3MBEB 4U0RC 1JTOA 4LARL 1A8ZA 1NCBL 2V3FA 3HS8A 4K9JA 4LIQE 4G6AC 4OVVA 4UZGA 1I4FB 5AW6B 5EZOL 2VITA 3QHFL 5I18H 4HHGA 3GBEA 4B9JA 2PP8A 3QZPA 5AAWA 1E4XH 5M95B 3DSFH 3CDZA 1NAML 3AACA 4OCWL 5GS1C 1PZUB 1CYXA 1DJHA 4HEMA 4JNXA 1HKLL 2CJUL 3COOA 3PV6B 1G7PB 4G1EA 4OZIB 5EF3A 2EO1A 3FAXA 4GO6B 3BWAB 3DXAE 2Q87A 1TTFA 5D8JH 4BKTC 4DSYA 4GMSL 3H0TA 3GMOB 5JDSA 4N86A 4YLQT 3CMGA 2C9XA 4J3XA 3WGVB 4G59C 2E6PA 2NR6C 1X9UA 3LYRA 4EUPB 4H8WH 2FBRA 3US1A 1JTTA 1J8KA 3E1ZA 3BDXA 3P1VA 3QI9A 3AAZA 1AQKH 2XICA 1IM3B 2NZIA 2DPKA 5CFAA 4NQCD 1K4DB 4KNSA 1HWGB 4R9HA 4H5SA 4Y16B 3HZMA 1BZOA 1EJFA 2N7BA 4P23B 3UC0H 2J73A 4JANB 1NEZB 2JK5A 2IOOA 4S10A 5JA9A 1OAKH 5I74C 4ZNEE 2XOTA 3BPCA 2C34A 4X8GA 3EH5B 2VWEC 1RZGB 4LMQE 4F7MB 3BGAA 4XBPB 3V0HA 1ZT7A 3EGXA 3GM8A 3IETA 5BRZD 3TASA 3FCTB 5DJ8A 1F1AA 1KTLB 1JIBA 4XCEA 4PD4J 2CLRA 5DMJB 1YY9C 4QYOB 1NUGA 2ITFA 1YEDB 1NMCC 4RA3A 5GHWH 1MCLA 2NW2A 3O11A 1WT5A 1OALA 1WBXB 1RZJL 2EYSA 5IP4A 1WZMA 2DYRB 3FTGB 4GW5A 3MKGA 4YHZL 1RIVH 2V9UA 1T5WA 2ALWA 4N2KA 4BFIA 3QI9C 4J1UA 3FTVA 3CFBA 3WUWB 4KRNA 1K85A 1IQDB 4NCC1 1S7XA 4AKOA 3SDDB 2YKLH 1CFBA 2E9IA 1LEGB 2NQ3A 3V9EA 4QRPA 4XP4L 4FFZL 6FABL 3ARFC 1LVEA 3BVXA 1DLHA 4Z0BL 4OI7A 1HEHC 1T7ZA 2CM5A 1MH5B 2FT6A 2F54E 3NGBB 2ZF9A 3AB0C 4WGVB 3PJNA 4KY1H 1A5FL 1DJSA 5I1AA 3LKRB 5LXGL 2C1PB 5E6ZA 3N42F 1HWWA 4QTIH 2FT7A 4BJLA 3VXNA 3W37A 1V3LA 3D4ZA 1JVKA 3HZVA 4Q8BA 4DW2L 4ZNEA 4WZ9A 5FLUA 4Q0XH 5IESL 3C9NA 4Z0XA 3QUKB 3WIHH 3EDJA 1PD1A 4I18C 3WFEL 1XWVA 2EC8A 1YPZA 4NPYB 1SRDA 2ODIA 1S3KH 3ARDD 3MV8A 1BDYA 1R24B 5GGSB 4LSSH 3TYGL 3QARA 5MERA 4QEGA 4XMWA 5CEZL 2HMID 1YEIL 3UJTL 1FPTL 3DROB 1MEXL 4JFYA 3U2SA 3PWPD 2H0JA 3WIHA 3TNNB 5HYJE 1IGCH 3WKPA 5E2UH 1INDH 4EDWL 3SKMB 5DYFA 2X40A 4OLYH 4UB0H 4S1SL 1WS8A 3J07A 2H32A 4Z7WE 4GQQA 3Q7JA 3T3MB 5GXBB 1RJZA 1LMKA 4XVTL 2FHBA 4W6WB 5IVXB 2IOMA 4EZMA 2QVKA 2X12A 1UXSA 1VLXA 1OF2A 1VENA 1AXTH 3SBQA 1ED3A 1NFIB 4YSTA 3WO4B 4EDWH 1TENA 3FUMA 5M7QA 2X38A 3ATEA 3V4LA 2JCCF 3ILPA 4M93B 4OQ1A 1YNTF 3AM8C 3FB5A 4NJ9H 1A9BA 4A7VA 2NX5E 5JQ6L 2ZWKA 3EOTL 4QRQA 1XEUA 5AOKA 2GAZA 4MMXA 2ADGA 4G7YL 1V05A 1VJSA 2F53E 4MJIE 1U58A 4MJ2A 4PD4K 4W70A 3RAJH 1DBBH 4OZIA 3V0VB 4Y19B 3L95A 2A83A 4PRDA 3ZMEA 5JXEC 1BVOA 3K2IA 3G6JE 1XB3A 4YDKH 4DTGL 4R7VA 2PTTB 1D9KC 3CC1A 5KJRH 4FHJA 4LDEB 1NCUA 2F53D 2I24N 3TBCA 5TF1H 1NL0L 2Y7QA 4NM4L 1GKOA 2OMTB 4UMSA 5KYXB 1ZA3A 2E46A 2PKDA 4WKXA 4NFCA 1OE3A 4YDVA 1LWHA 3JTTA 4LCCC 4LGRB 3RWGB 2VDOH 2EYRB 1XH3A 2XN0A 3N1FC 1LWJA 2NNFA 5BUPA 1K4DA 4YL4A 2EDLA 3WY4A 3QK0A 3GMPA 3FRPG 1WSST 3EG9B 3I6LE 4YSPA 4Z8FL 4MZRA 1ECYA 5C3IA 3D30A 4P3CH 4P2QA 2NY5C 4ERSH 4QOKE 5C7ZA 1F45A 3KLSA 2JKIS 1I9EA 2BRRH 2JV6A 4JFEB 4WRLA 1B4JL 1MCKA 5DLLA 3VDAA 3QFJD 2QDWA 2VDRH 1AE6H 2NY6C 2OL3H 4WUUB 1AQHA 5C08D 4YAQA 3EGSB 4GXFA 2XV0A 2ZE0A 4P4KB 1VFUA 1RHFA 4QYOA 1IEBB 2OYPA 3GSQB 2K78A 1LK2A 4HAGA 4MD5A 2DWSA 1S4IA 3BO8B 1GA2A 3GBDA 1A4JB 3P02A 2HFEA 2QR0B 5BV7B 4K8RC 4UQDA 2P24B 4X99A 2P7TB 5C08E 4HV8B 4PIRF 5GGTL 2Q7NA 1WAAA 3ETTA 1T4KA 1ZA6A 4LCCA 4PJBF 3MJ7B 2BP0A 5D1QA 5GS3A 3UTQA 2W65A 2BZCA 2PWEA 3OKEA 2OCFD 4I9WE 4O02H 3LMJH 4WI5A 5E9AA 4QAMB 4WUKH 2I9TA 3Q9QA 4ILDA 3NMEA 1CE6A 1M7IB 2Q6WB 3S8FB 2YSSA 1FBIL 4OZGB 1QW8A 2WXOA 4FQLH 4PS4H 4E9VA 2XWTA 5KANI 1MIEL 4MA8H 5ESVA 3VNYA 4H8UA 5BNXD 3G5WA 1ODUA 4R7NB 3H3KA 4KJQD 4LDOB 5K93A 3DMMB 4OBRA 3OB0H 1AGFA 3SKUD 4WFGE 5FHBL 1JFQL 5IQNA 1KELH 3B2VH 1E30A 1O6SA 4RQQB 4XAWL 4NSKA 2C9RA 2A9CA 2FJGA 3NJGA 2VZ1A 5FW7A 2VQUA 4BK5A 3A4FA 2YBRB 4KO6A 8CGTA 3FU9A 4V1DD 4HPYL 2VDOB 2AQQA 4KNTA 4M6OH 1NDGB 3SHSA 1CGSH 4HKZB 2VR4A 4BZ2H 2OK0L 1FZKB 3D9AL 2A9BA 4FL4B 1D5MA 2EDRA 2UWEF 1X5XA 4IK7A 3RX5A 3FUIA 3MXWH 1KEGL 4FOMA 5D7LB 4YZFE 3ZW3A 5DQJA 3X11B 1LP9F 2CHXA 4U7MA 3SE9L 1WS7A 3T3PF 2P26A 4PG2A 1ZV2A 4M7ZB 1B0IA 3IPBA 5G4OA 3TJEL 1VFOA 4ELMA 5EPMB 4K7PX 4LHQB 4JFXB 3VW3L 2YD6A 1HIMH 2D0FA 3AMKA 3ZIYA 5JO5A 3RY6A 3F7YB 4U3SB 4RMRA 3ULUF 3QDMB 4RGOH 1YEJH 1UB6B 4MZ2A 4NQCA 4R96B 3H9YA 3ISRA 2VTFA 2BCKB 3DOSA 3MNDA 1NBYA 3MRDB 1RJZB 5DFTA 4DN3H 2UUDK 1XGPB 2KL6A 2NCEA 2OQJB 4TRPL 2PCPA 3ETSA 3S34L 1UT9A 1HL5A 5AD0B 1OPOA 1EO8H 3H85A 3CFCH 2Z35A 4BUHA 1FDLL 3QYCA 3D0VB 1F3DH 5F9JB 1IC4L 1M57B 2C9UA 2RAMA 4WF7A 1PX3A 1FG9C 1O6VA 2CHZA 3NZHL 2FJUB 1HNGA 2VMDA 4KUCF 2GAZB 4JVWA 4MMXB 5JXAH 3GUFA 1GOGA 1YMMB 4N25A 1HQRA 4MDIB 4CGUB 1QSEA 1CDJA 4MD4B 4OGYL 3WFBL 4ELKB 4HLEA 4LLUA 4X5LA 1TLMA 3M6DA 2UX7A 3RY5A 3QDGA 4ODWA 4PJCF 5J6HA 3L8QA 4I89A 4L37B 5FYJE 1T1WB 2DQJH 1FRGL 4ZUSB 2EH7H 3QDHA 2UY6B 3D33A 1HNYA 5EA0H 2DYSB 5CILH 4NO3A 2ED6A 1IT9H 4LSQL 5K1VA 5T1KB 3H56A 2N01B 5GQBA 4MJJA 3ULSB 4Z8FH 3U4EB 3S3PA 3I3EA 4PYHA 1S7UB 5D2NA 2WYTA 2A6KB 1OAYL 5DJ8B 1T0MB 3PV7A 1IEAB 1OIOA 5I75B 4JQVA 3IBOA 1F3JA 2HLFD 3EYQD 4ZUWA 2WTRB 3HC4L 3U9PL 1OTTC 3V52L 5DT1H 4OT1L 5TDNB 4YEEA 2NQDA 1F0LA 3MLTA 2LOEA 5EA0L 4GRLA 4PTTA 3FRUB 5K33A 2F19H 4N8VA 3LIZL 4ORGA 3UC2A 1W0WB 2UY7B 3MXVL 1Z32X 5E6RB 2BDNH 3HG1E 4BFIB 1BEYH 1U95B 4ZAKB 1FNLA 4GIPD 3X14A 5J6SA 2EH8L 3FQNA 3MV9D 3CFQA 2H0EA 1WTLA 3HFFA 3GB7A 1Z9PA 2B16A 3GBNL 1SHXA 4KTDL 3T0EE 1BMWA 4X8CA 5T3ZL 3GSQA 2QVIA 1NCHA 4IBYA 4OAWB 2IBZX 3HBQA 1KCVL 3T6QC 1S7TA 3GJEA 1KPUA 3MV01 1FL3B 4FLHA 1JL8A 2DEYX 2EZ0D 2X4OA 2V7NB 3FQ4A 5KG9B 2V0AA 1KNOA 3O2VH 4NHUB 3UTTE 4Z7UE 1D5RA 1Y6MR 3AT0A 1L6PA 1I1AA 1UKTA 5DQ9B 2X4PB 3KPNB 1KLGA 2VR9A 4L4TE 3DV6A 3PGFL 5F7AA 2L7QA 4DKFH 1DL7L 1FN4A 3HN8A 5FF6B 4EUPG 1QPXA 3M88A 5ENWB 5GSVA 3I50H 1A7NH 2APSA 2QQQA 4QTIL 3QS3A 1ZJBA 4BCXA 5D1XB 5DS1A 1MFUA 1GW6A 2GY5A 3BCFA 3LH8A 1CXEA 3LRKA 1OP3K 2X28A 4FADA 4ZZFA 2VM3A 1PG7L 2CMRL 4OZFG 4N2EA 4XNYH 4ZOBA 4UT9A 1HE8A 1A47A 3QORD 4ZTOH 5T1LA 1EZVX 1R6VA 3CNKA 3GM0A 5TE6L 1KGIA 3ZDYE 4Z7VA 1QFUH 5CKAA 1SYSA 1V3MA 4GRWB 4YDLC 3LHAA 3ZO0A 3VI4A 5DZVA 4B6ZA 3QEQD 1NSNH 1V7NL 4LAQH 3QHTC 2XFGB 3P9WB 1U93B 2YXFA 1MNUH 1TQWA 2C7UA 3WAJA 3TCLB 1K2DB 3G6AB 2J56A 3VSTA 4GMTL 3DETC 2V2WA 4PTUB 4N5ED 2WMPA 1DTUA 4JL2A 2DQHL 4OCYH 1FL6B 5EHFA 1QEWA 5CR8A 4W68A 4UAOC 2B5IB 4MWFA 1KELL 3ARQA 4TUJA 1SEQH 1IC0A 4ODHH 1UWFA 2QKIA 1ZEAH 4YHYC 4I1NB 1MFBH 1Z5LB 4BA0A 4JVPA 3BP4A 1FYTA 2GJZB 4GAGH 1EO8L 1XSOA 3OJDB 5KVDH 2HT4C 3O45B 3ARDB 5KVFH 3SYQA 2Z0BA 2HVJA 3QJFB 1P4BL 3SDCA 4WGWB 2UWEB 3G08B 3QUGA 4P2OB 2A6JA 4TKWA 3K91A 5J1SC 2HYMA 4WEEA 3VWJB 3PWPA 5IROA 2ENQA 4FNTA 1E0OB 1OT4A 4S2SB 5AVQB 2XPGA 3I3BA 1BQHG 2R2HA 3DECA 3BQUC 5JHDA 4Q74A 3BZEB 4WWKC 3AUWB 4JDZA 3PYCA 3A6CL 2WHVA 1N6UA 3C12A 5G4MA 3S2CA 1MJ8H 3NTCL 5D7KD 3SPHA 4MB5A 1KLUB 5E5UB 1QSEB 2JJWA 3IRZA 2ZG1A 3KYAA 4U1GC 1H3WM 5EBMA 3AQXA 3NFNA 5FS5A 5CLWA 5GGVH 3TYFA 3EFFB 5BRQA 2VO5A 4M62L 4RFOH 3ZDXE 3AQYA 4XMKL 1H15B 4PY7A 5DRNA 1MHPL 2PYEE 2DBJA 5DF0A 5F1NB 5JHLA 4JG5A 5IEKB 5K9OA 3TA3C 2Q5BA 3KVDD 3S96B 2DIAA 3HHSA 3Q8FA 4YOKA 3OZ9H 4BFKA 1RZQA 3ECVA 1E5BA 2NQCA 3AJ7A 5JXAL 2AXGA 1YYLH 2AK4B 2GEEA 4N1EA 1GPOH 5LNDA 3IEAA 3LX9A 4L4JA 2Z34A 1FYTE 2X88A 3I6GB 1AD0B 1HH9A 4GIOA 3TEWA 2EDDA 5CHNB 1GSKA 2VDLB 4I9XA 3NCCB 5ID1A 1UM5H 2EACA 2Y07H 4A55A 2R69L 4OCMC 5CINL 3U7YL 3RJOA 3VSUA 4L3EE 5MERB 4EN3D 5A2KH 5EO0A 3ESUF 5CZXD 3D3VB 4PWIA 3JV4B 2XU9A 1MHEA 3X14B 3FB7A 1N0LA 1IZKA 4MXWL 3ARWA 4KK8D 3TESA 3NFPB 1AR1D 2QELA 3F2LA 4XNZC 1XAUA 3NJMA 4PJ8B 5E03A 4DPBX 2A7BA 3TN0B 1G9NL 3MKKA 4WI8A 1DQLH 4FCAA 2XG4A 4NO2B 3O4LD 3AG1B 3HR5B 4WJKB 1A6TB 5F70A 4AQOA 1JHKL 4JKLA 3RUGE 2HUEA 1JN6B 4K5LA 1XB8A 1JFHA 1H19A 3QA3B 4Y4FA 4YNYA 4YHIB 4E41E 1XD1A 3RPIA 2JQAA 2ADIB 2BSSA 1C7TA 2R59A 4JG1L 4FABL 3RFZB 5AZ2H 4I77H 3EJCA 3U0WL 4G7VH 4HFUH 2AXWA 1RZ8A 4JFDE 5I6KA 2CU9A 2F15A 4FYQA 5AVTB 4I8DA 1CTMA 4GS7B 4I2XE 3WV0A 5IJCC 5I1AB 1XF2A 1KZYA 5C09D 3BXNB 2HA1A 4NJAH 1DSYA 4MCNA 4YBLC 3TBYB 1KT2A 1TO5A 5DMYA 1SMAA 4NO0A 4QLWA 5BOPA 3HI6H 1OGTA 4Y1TA 1MNNA 1V3JA 3LSOA 1A9EA 3N1PC 1BQRA 1MQKH 1QLFA 1K3IA 1MLBA 2IIJA 3QCUH 4U2YA 3RRQA 4KJPC 1A1OA 3PAVA 2NY1B 5HD8D 1PD6A 3DJRA 5LKNA 4QWWC 2BNUB 5I75C 2DM7A 5B1JC 1OCRB 4JDVA 1OAQL 2WD0A 4YK4C 3VXRD 5JMRA 3E9UA 1E9PA 2XHNA 4ZUTA 3L9YA 2HFFB 2J5LB 2KS0A 2V17H 4PB0H 4QXUH 2QKIB 2LFGA 2GSIA 4UCFA 3GYRA 2ZZUT 1FYTB 4LPYA 5L4JA 1DUZB 2JF1A 2XTJB 3ZDYF 4TL4A 2CO7B 3GS0A 4W4NA 5EU7C 4GRMA 4IKNA 3DGGA 1UZ8B 1J9TA 4MQ7B 3ULUL 5JDSB 1CIUA 4MDIA 5I9QC 3FSVA 1J48A 1G5AA 1B2YA 1S9KC 5CKGA 4NZRL 3ZE2B 4P57A 1YEEL 2WWOA 1RXLA 2XWJB 2WWMD 4XX1G 3RKDD 1KJ2L 3QI9B 4YGAB 1FUNA 3UJIL 3GMLB 3H9HB 3ZTDC 3LPPA 3JTSA 5CU5A 3V0GA 5IZ7A 3RDTA 2V7HA 1TITA 3VH8B 4ACTA 2DDQL 5FDWB 5I28A 1A1MB 5JHLL 1NIDA 1OAJA 2J2ZA 3A47A 3EFDH 1UM6H 1WIUA 1ND0A 2ICES 3JWOH 3T65A 1IGML 4AYEC 4BK8A 2XVKA 1N0XL 4IMKC 1HINL 3X3GL 2AK4D 2NLJA 3C2SA 3IMSA 3GHEH 3HG5A 5LVEA 2H26B 3QVAA 1O6SB 2QKSA 1I4FA 1HS6A 2WLLA 3P77A 1OTUC 4JFFD 4RQQA 5DJ2A 3FFCD 3AUVA 5FA4A 4RISL 4R0LB 3V6OE 5FK9B 3NSDA 3VSQA 2B1OA 1P53A 2BERA 3MBEA 4Z3TA 4FKEA 2WZAA 1BBJA 1TNMA 3QDGD 4HD9A 4Q58C 4WDIA 3US9A 1OW0C 2QL1A 5BRZB 2GBVA 3BPOB 4ZMVA 2GUYA 5HXMA 4FCHA 4POZC 3AREA 4Z7NF 3MSPA 3MRQB 4RFEA 2AJUL 1GMEA 1C1EH 3ESMA 5ID1B 5DWUH 2HX7A 2Y25A 5J9PB 3SOBL 3ASWA 1T2QL 4J8QA 4PJDE 5DQJB 3BSZH 3WTSA 1BQKA 5DGQA 4ENEC 2WM0A 1NGQL 2HKAA 4DCQB 1W0VB 2H3NB 2V9QA 3MV9A 3CZUB 3N5AA 2OSWA 1AC6A 1CFSA 2A6DB 5ALBL 3FB7B 3MJ6A 4DK5A 1OP5H 1PLBA 4EI5D 2E6QA 3QYMA 4JZNA 3NABL 2XFXB 1NGZB 2FJFB 4KKQA 3N3EA 3WTTA 2AJUH 1BOGB 4JQIH 4R97C 5C0NC 4GJTB 4ZW6A 4MS8C 3X1GA 4ZBJA 2BVYA 4K5OA 4JG0L 1QUNB 5KSAC 2GVYA 3CC5B 2FH8A 1OAQH 5ISZE 4N90E 4M6NL 1CZ8L 3OKEB 2NY0B 4JGJA 3UCRA 2EINB 2AV7A 4P46D 1D5XA 2NY5L 2A74C 3HRZB 4LU5L 3WFEH 3L3HA 5C9JA 4RVBA 1FBIH 1Q9LB 1IC5L 2OXGA 3H6AA 1ZGLA 3V7AE 3BD5A 4GG6A 2F5BH 2Q6WA 4JO3L 4KZ0A 5AAPA 2H6OA 4V2CB 5EUKA 4XP9L 4TNEA 3EADA 2WOBA 4L3EA 3UO8B 4ANXA 6PCYA 4UQEA 5I2IA 5BQDA 2MPVA 5GRYA 5KS9E 1W8OA 2VZUA 4NEHB 5J11B 3VXMD 1IIKA 2X42A 2H32B 5MEQB 2PO6A 3HMWL 4L1DA 1AP2A 3OAYH 3PHOA 4GMTH 2N4IA 1CIDA 3O11B 4MB1A 3BI9X 4B0MB 5DHEA 3ROLB 3RQ3A 1L9QA 4U1NA 4KTEL 3KYKH 4AK1A 4NHCH 2M8XA 2BY3A 4MA3A 1Q0YL 1SFHA 4LEXH 1OSEA 3O6FC 1UACL 1J1PL 1PZCA 1SBSH 2BHFA 2DIEA 3H9SA 4FG6C 2D7MA 2B77A 2K3HA 3DV4A 3GZOA 1CN4A 2BFVL 5TDOA 1F1DA 1OWWA 3IF1A 3OGCA 3RHWK 3UADA 4F8QA 1J8RA 1NC2B 4KI5F 3D52A 1I7UA 1AGDA 5I30H 2X41A 1ZVSA 2DLIA 1PG7W 2K8QA 1A6PA 1YEKL 3KWUA 3KPLB 1ZDQA 2EIBA 4WWKA 4ZS7L 3HMXA 3MROB 4D0DB 2E74C 3D7PA 3FULA 4PRHE 4QHKI 2VQ1A 5DTFA 4CVXA 1MHHB 4OCLC 4DTGH 3UEQA 4AUYA 1C7SA 3IDNA 4KX9A 4P07A 5EU3B 2Y24A 5F7EH 25C8L 4EN3A 3SJVD 2OSLB 1ONQB 3HE6B 4K8RL 4UV7H 4LSUH 5AOJA 5I0XA 4I88A 3QAZC 1WT5C 4N3UA 4QHNB 5K69A 3NZHH 2BRQA 1ZS2A 3B37A 3O9WD 3T4YB 3I75A 1ZE3H 2CD0A 4ZMQA 2E7LC 1BIHA 3ET9F 2D9CA 2BY0A 2VDML 3LH2H 1CXFA 2PXYB 1I3GL 3QW9A 1FN4B 1R5WB 2QPEB 2V8MA 2PABA 5GSVB 4YO0A 3UAJA 2AC0A 1JWSA 3RIFK 2D3JA 3CZLA 4OJCA 3T6WA 4D9LH 2MHAA 4JY5H 4WWPA 4HSAC 4L4TB 1YYML 4FDWA 3ZN6A 3G5XA 2OA9A 5I1HH 1ASPA 1KCRL 1KIQB 3TH2T 3FCSB 4DN3L 4D7PA 4YAQB 4EI0A 1IM9A 2OZ4L 3FONA 4PJHE 3S34H 2NCMA 4GRWH 5AENA 5KAQF 2A74B 3N1GC 4TLKA 3GSXB 1F42A 1ZXKA 4XPAH 4K71C 2E3VA 4NB7A 1X9QA 3LRGA 2W1NA 2J88L 4UOW0 5D7LE 1CT8A 1JGEB 1XGYL 1MJUL 5EIQA 3C5ZA 5IW3A 1ULVA 3ESOA 4JM4H 1JJUA 5I0ZA 5C08B 3OAWA 5F3FA 5F7DA 1BCIA 4LHUD 2O6DA 4KKCD 1YCSA 3JTBA 1CXHA 3U30C 2I9TB 4WFED 1JGLH 3MRRB 4JN1H 4F7EA 3UTOA 2IPUK 2Z6FA 4PTTB 1FL6A 1CBVL 2X4UB 3RWHB 5KYXA 2I85A 3SY0A 1RK0A 4EZKA 1HYSC 3C8KA 3ZRCC 4KZEL 4LQFH 4MRCA 5CGTA 4OBSA 3CUPA 3OL2A 5C0ND 5FYLD 4N26A 1S78D 2ADIA 2BSSB 4HGMA 3BW9A 3NDYE 2VR8A 3F04A 1N4XH 2FSDA 5F2FA 3BPOC 3AB0B 4AJWA 4YBQD 2F8VA 4E9SA 3QISA 4ICXA 4LLWB 4JRFA 3RLSA 1OCZB 4PLKC 5A1AA 4BZYA 2BVQB 2J4WL 2VC2L 1CYWA 1YMME 4XPTL 4I4WA 3OHXB 1DQVA 3OLGA 1U8MB 5T3XD 1JZ4A 2AV7B 4HG4K 3Q5TA 1MI5B 5DK0B 4GUCA 1JPGB 1NFDF 4Z77B 1YRKA 4J3VA 3PFUA 1AQ8A 3DPDA 2G0KA 2WIMA 4HGWB 4AENA 1W6LA 4CW1B 4LDLB 4NNXB 3Q8AA 2YEVB 5JQIB 2N59A 3EO0B 5L4MA 5KVEH 2HZHA 2DQEH 1W0YT 2BIPA 5FM4A 2FGZA 2ZUSA 4XH2B 4PVNA 4E9XA 4YL9A 4E42A 3U48A 3UROR 2Z31D 3NRPA 3KH4A 4ONFH 3DTUB 5SWQA 3QQ9C 4HUXA 3L3IB 4EVNA 3F7RA 4KQ4L 4FMKA 1QFHA 2WXIA 3VXRE 1ZT4B 5FKAB 2ZCLH 1AKJD 5CJBA 1J1PH 5D55A 1GJIA 1AJ7H 1I3RB 2VM9A 5DJDB 1JE6A 3FQXA 3CSPA 4PJBE 2J1WA 1N6QH 4BFBD 1GZPA 5B38G 5HHPB 5DJZB 3W9DA 1CJYA 2Q8BL 4YDLB 4OM1L 4HCRL 2GCYA 4FYRA 4ALAC 2AK4A 3QDJB 5I9QB 1KIPB 4Y16C 4HIEA 4KZDL 2AEPH 1HJCA 1X6NA 3DV4B 3HLAA 3INOA 1DSFH 1P7KA 5TDOB 3S97C 2CKBL 4KXZI 4QXUL 1FZOA 3MLYL 4AITA 1RUQH 3T4AB 5DS8B 3BCDA 3VTMA 5E5LA 1AGDB 1THAA 1XH2A 4ODSL 4TMPA 1MCSA 2DL2A 4ZO8A 4WO4B 4FFYA 3CDFA 4N2GA 1NIAA 2VLKD 5ECJE 2M1KA 1FZJA 4KXCA 4F24A 1JNLH 1UOKA 4R3SA 2EIKB 3FJTA 2OULB 2GBAA 3D12B 5HGDA 4HXAH 4NO3B 4B9ZA 3OXSA 5B3NA 4E9YA 1WFTA 1RK7A 4LCIH 2VDQH 5H37A 1E6JL 5HJGA 4P5KB 5I1JL 3D2UA 2X3BA 1SLWA 1O7DC 2CHNA 3FPYA 1DVUA 4K7PL 5DUPH 3IPEA 5CN1A 2OSXA 1QRNB 4GSXA 5KVMC 3GTTA 5I0WA 3M17B 5C70A 1FVDA 3B83A 3TVMA 3OHMB 4JFHD 2WZPA 3PJSA 1X9RA 3QUML 1JV5B 3T1FA 5IG7B 5EDXA 1U3ZA 2J6EH 2OMXA 2L7UA 4M03A 2CHWA 3S36H 4HF5H 5CD5D 3KCPB 3DI2B 3O2DH 5IROC 2QFPA 1JDAA 4HFWB 4L8DB 3UBXI 4AUJA 5LQBL 4LCYA 4RCAA 5BW7C 2DKMA 5E1GA 3SKNA 4HUWB 4JUSA 3UPAA 5EBGA 3WD5L 4NFBA 1FZMA 5HVGB 4XN7A 4M7JH 3IDJB 4X5RA 3MUUA 5K1NA 4P5MB 1J8HD 4OAWA 5I6XB 3QQNA 3BPCB 3U25A 2XZAH 1I8IB 1PAZA 5IW1A 1TCRA 5IVZA 2WN2A 5AALA 5HYIA 4L3ED 1NGZA 2FJFA 3WS6A 1UD4A 1BG1A 1J8HE 4X6EA 5EU5B 3IJEB 1ASOA 2AERT 5DEGB 3UTTB 1BZQK 3VYOA 5JIHA 5DK2B 4TS6A 1NLBH 3KBFA 2WXLA 2VDOL 1ILSA 3CBKB 1DCLA 4XHJD 3GXDA 2ZSVB 4PJBB 3JUZA 5E8PA 2JXMB 3MOAL 3G6JF 3OKOA 3ZTEA 4GW5B 3MTXA 2YA1A 2PPFA 4N0CC 2ZUTA 4F7CA 1BLIA 2VLLA 5D1QC 2FIRT 3MTRA 4K7PY 4PJ9A 3X13A 4AGOA 4ZZKA 4V11A 5D2NB 3N1MC 3TC9A 2X9XA 3WFZA 5TD4A 2BS9A 1S5IL 1NKGA 5T1LB 4OFYA 3MRMB 3TPUB 4X98A 4N2OA 5DQDH 1NCAH 1WDAA 4GAFB 5BO1H 1CXLA 2VJ0A 2UYLA 2Z9TA 5A6MA 5HYSA 5E8EA 3QXVA 5CEYA 3U1QA 3SGKA 1HESA 3SQBA 4KITB 2VLMD 4FI8A 4JFQB 4K3HA 3B7UX 4K3DL 5I73B 1TETL 4AYFB 5MEPA 4XMVA 5B4MC 3KPOA 4M6OL 4WU7A 5IF0B 1A1MA 2AW2A 2IDQA 2KI6A 3GGWB 3QIBC 2HG5B 4NIYE 3QXTA 2JVUA 4Y5YC 4WW1A 4Y1AA 4DP4X 4FQIL 2WXQA 1R3HA 5EUOA 4UDUA 3SJVA 4NQVA 2HPTA 4B9CA 3PUCA 1CICC 3NJNA 4CDHA 2EVHA 4IIQC 5FWRA 4ZUUB 3TT1H 4XXWC 3ZHDA 2ZXGA 1FNEB 2LAAA 1X4XA 3OGCB 3QRGH 3VGDA 1DN0B 3G08A 4P2OA 4ZTEA 3T2NH 4K9EL 4YHLH 1FG2A 1KJMB 2BWQA 3UYOD 3GSNA 4ZMWA 1MQKL 3EOBB 2WNXA 1BF8A 3R4RA 4G5ZL 5CEXA 4XWGH 2I9LB 4HOMA 2UXGA 1EA9C 3KWVA 3R7RA 3MFFA 1EHKB 1Z9MA 3MROA 1YPZE 2DEXX 4PJIB 5D6CA 3C8HA 4N2BA 4FP8L 4TRPH 5F9OL 3A6BH 4MCMA 4DF9A 1E4KC 5KSAB 1UJ3C 2BNUA 4UOZA 3AT8A 4U1HB 3TJHD 2DQHH 2DWTA 2FQEA 1DQQB 3G9VA 3MRKA 5JOPE 5F1IA 5CJQL 5FM5O 2J43A 1BX2A 2LLNA 2CR3A 4OF3A 4OJFH 4K3EH 3ZKMD 3FH7A 5HY9A 5CZRA 1FC1A 1FJ1B 1BSIA 1RUMH 3C8DA 4JR9H 4PJGE 1ZLSL 5BQ7A 3L1OL 3DGDA 3OAYK 3PWLB 2BVEA 2OR8A 1HH6A 3RJQB 4IKKA 4KOBA 3VFMB 1KYDA 5F0LB 1JGUH 1ZA3B 3HNSL 4GP5B 3DIFB 4ZRGA 4A1RA 5I6LA 2I69A 3W9EA 5CJQH 4LSTH 3ZQWA 1BA9A 2G9HB 4JFDB 1YEWA 2PTTA 2ICEB 4Y5YB 2PYFA 4YFDB 3VFVA 3B9AA 3EOYG 4K3EL 2DQCH 2H4EA 3MV7A 5KBLA 2GJZA 2DH2A 5DLMH 2ZOWA 4I9WD 4WI0A 4P23C 4XR8C 2G4GA 5DHXB 5DJ0B 2ZF8A 4WNSA 3CDZB 4H25B 2DEWX 1T0PB 1YEFH 1XMWA 2WB7A 4L8DA 4WY7L 1D7DA 1ORQA 2IV8A 1MWAH 4CGTA 1C5BL 1FFRA 4N87A 3SKNB 2GSGA 3I9GL 2AJSH 5K9QG 2O30A 3O45A 2ZYHA 4J8RB 2XG5B 5FHAH 5C0CD 1IBBA 4Q2ZA 1JDDA 4G43B 4KGJA 5JQ6H 2X4UA 4CJ1A 15C8H 4PU2A 4YPGA 2W8CA 5FYJL 4MMYB 3PU7A 3SBWA 1SY6A 4H13C 5FYKE 4KTDH 3BMWA 3F58H 2JI2A 2PPAA 4F91B 3L2LA 3Q43A 3LY6A 1KY6A 3AGVA 2X1PA 3C6LA 5EFIB 5AUMB 3ZE1B 4E2OA 4OLUH 1J1OL 4GG6F 4P23A 4NNPH 4L9LB 1LO4L 2LU3A 2X3AA 5LBVA 4HC1A 3MJGX 4C47A 2AABH 3B3IA 3CFMA 2F54A 4ZOEA 2J5WA 1BZ8A 2ATPB 2IANE 2P5WA 1NGPL 3LJ3A 3VGFA 5KTEH 1EXUB 4HIHA 2L0DA 2X44D 5HJBA 4OZGA 2HJFB 1IGTA 3S35L 3S96A 3BAEH 2O26U 4YK4B 3HHSB 3QIWD 1L0PA 4AJ0A 4TULH 4X7EC 4A39A 5EBLB 2CR0A 4NP9A 1P69B 2AXGB 3JXAA 1YJDH 3QXDA 3WY3A 5CILL 5FA3B 2NUTA 1I1CA 2YUZA 3SE8L 4RH4A 5HHNA 5MEOB 1D5XB 4PG2C 1U3JA 2XLLA 1J8HA 1JPFB 3HBZA 5IKCB 2VLJB 2IDFA 3DX9B 3IPFA 1OAXH 4Q7DA 1YAIA 3PDDA 3MQIA 2CPCA 1I3VA 1ZLDA 2C4FU 5KYWA 4DW2H 5HGAB 3NZ8A 2FQDA 5E8NA 1AQMA 1AQDA 5HYFA 1T3FB 4YMPA 1DVSA 1GRWA 4AE0A 2F08A 2X5PA 2WXPA 4GS7C 4XXDB 1IBZA 1XGRB 4CC0A 3ZHFA 3BH9A 4K55A 1OD7A 3PWJB 3ZE1F 1XZ0B 2WCGA 4GEJA 2YA0A 3FB8B 4H20L 2CDEB 4XVJH 2WNKA 1WPCA 3FCBA 3V0DA 3NA4A 5BUGA 3L2NA 5I0VA 2ZOLB 4OM1H 4POYA 1FP5A 3QDMA 3UOAB 1XGQB 1CFTB 5D6CB 1GYAA 2XACC 4ABVA 3UERA 3CG8A 3HKZA 3ME0B 3QORB 5KSAA 1WV7T 3NIGF 4ZMOA 5GPRA 4AQ1A 3O6FB 2BX5A 5AD0A 3DXAA 5D7SH 1CGXA 1GW0A 1KENH 1WZKA 1TFPA 4JPVL 4Z76B 2WAHA 3TN0C 4LCWA 3OSVA 7FABL 2FBJH 3NA9H 4PB0L 4WWOA 3RNKB 3GTNA 4WFHD 5FO7A 1BBDH 2HTKC 3MUGB 1XF2B 1E6JH 1GY2A 2ZWYA 1MIMH 4L37A 3SDXF 3U2IA 4A2MA 4OZHF 3UP1A 2YOAA 4PJFE 2RCSL 2DWEB 4HOWA 4XPBH 1DBJL 2P1YA 5ISZD 3DO7A 3PXHA 2V5SA 5IWLA 4F8PA 1L9NA 3LB6D 1UM4L 3ULSA 2G5UA 5C6PB 3ETBF 4HUNB 4Y19D 2ATKA 2FCBA 4XN4A 3TVMD 1MDAA 4I48B 5IB2B 1R9FA 5D5MA 1G9NC 1SFDA 1QI3A 3ESVF 1FNFA 2JIXB 4IRJA 1Y1DA 3PHQA 1NAKL 3WN5B 1QWUA 1G7LA 3TA3B 1WZ1L 1KJVB 2BP5M 4ZX4A 3PY9A 4NNXA 4YSOA 4DP8X 3V9FA 4CC4A 2XC8A 3RTLA 3PAUA 4M1CD 3RWEA 4DN4L 3FOMA 2BWDA 3T2PA 4EZLA 4OCYL 4XRCB 3K7UA 2VZOA 4D9RE 3G6JB 1MREL 1W8EA 2A9DA 3IDXL 4Y2OA 5FX3A 1BP3B 4WUKL 1CGYA 1G94A 3ZT6A 1UKQA 4TUKH 1E42A 5ADPL 4NWUH 1QBLL 1MHCB 1KB3A 4OUOA 1OQOA 3VRJB 4AV4A 2V7HB 4UOQA 4FFWC 3UYRH 4GKNB 4M9PA 3ZZLA 5ACLA 5JQHC 3VXSE 1X7SA 3MRBB 5DJDA 5EN2A 1DJXA 5E8DL 5C9KA 3GB7B 4KX7A 4X4YA 5F6IB 3WNNA 5E4IA 4X6BB 1LQSR 3MLUH 3MV9E 1ZV9A 1AXSB 3ARYA 3L4VA 4FXKA 1S7TB 3GLAA 3LS4H 4TOYH 1S9VB 1AO7E 3RY4A 1ETB1 1XGTA 3UYRL 3BUIA 3MGOA 1QYGH 5MI0B 5GGUA 4YFLI 2VKWA 3UPCA 5HPMA 1FV1B 2ESVE 2R4RH 4HHWA 5HYSG 1EMTH 2L7EA 3K1DA 1H6TA 4GBXC 2BHUA 2QVFB 2VJXA 5IESH 2AGJL 1RHHB 2FHFA 1A6WL 3CX5K 3ERXA 3MNZB 1JYWA 5FKPB 1CDUA 2R56H 2VABA 2EDTA 1KTBA 1IAIM 4IOSA 1M05A 4YGVB 5ITFA 1QNIA 1FAKT 4PJEA 3ZPDA 1JZ3A 5JPNB 5FECA 5CXPA 4PI0A 2RB8A 2Y7OA 4Z7QF 3VUAA 1N10A 3GLDA 4AGNA 5J6GB 3CLFL 4X8JB 5C0FB 7PAZA 1EMTL 1SGKA 3AVEA 3HPJB 1N67A 3OG6B 5HDBE 5I5RA 1KC5H 1F6LL 1C08B 2BVPA 3OKMB 4Z95L 1A4KB 2DQDH 1ZWIA 2BC4B 3BZ4B 2VNCA 4M48H 1D9KB 4HGWA 2QQLL 2D3LA 5C97A 1I1YB 3A3YB 3WL9A 3PJSB 5JHAA 1AZVA 1KMGA 3CPLB 3OX8B 1BYPA 3MV7E 2Y5TB 3L3GB 4MBOA 3VFGL 1NPJA 5KYYA 1B6UA 4Q4IA 4FFYH 4X9GA 3LKOB 1DVFD 3ZHNA 3ALWA 4HS6B 2EXYC 2VE6A 3BDYH 2WQRA 1DCEA 4AYID 2IPUG 1XSJA 2ZWZA 2O6EA 2XIDA 3A67H 2R2EB 3SDCB 5K9JL 5AW4B 2H3XC 5J1AA 3IDNB 5FOJA 2NY6D 4LCWD 3BRFA 3L5XL 1G7MA 1N3NB 4ZMAT 1TVHB 3CC5A 1IX2A 1M6UA 3GSVB 2Y2YA 3QE5A 4FP8H 3TTSA 1F6AA 2CBQA 4KTEH 1U2CA 3ULUH 4TYUA 2NY1C 2A0LC 3NJIA 1I7TA 3ATBA 4WTXA 1PYWA 1Q9OA 2W0LA 4DN4H 4PV8A 4XAWH 3NESA 2R2BB 5E23A 5L88H 4Y2NA 3LN9A 1GYCA 2DRUA 1ERNA 1UC6A 4HA1A 4HUUA 4JN2A 5J57B 1P7KB 1UJTA 2FSEB 1KGWA 1TDQA 3PHOB 1F1GA 1EFXD 1KB9J 1KN2L 2D31B 2FBOJ 2NT0A 3GK8L 2H1PL 5I8EB 2VO8A 4DQOL 1USQA 1RZGA 1XQ4A 3P4MB 1SXCA 1TZOA 3S36X 4HS8H 4K3JH 2N7AA 4MA3B 3HI1B 5J1TC 1M2VA 1U8QA 1K8DB 4MLIA 5BJTA 2JKJA 3CK0H 2Z3FA 4KXAA 4DVBA 4XMTA 4I0PC 1GYVA 3L6FB 1GGTA 2XN9B 2XX1A 3FB6A 2F19L 2HRLA 1YMMD 4TSBH 4TNVF 4JFHE 2H1LM 1L0XA 4KUZL 1YECH 5C8JB 5JZ7D 2EDKA 3JYBA 2GY7B 5BRPA 3WNIA 5HYEA 4ADJA 5LG1A 3O4OC 2VRAA 4I48A 2P5WD 4BE6A 5IB2A 5EIIB 3B8YA 1JCKA 2JFCA 3HZYA 4DK3A 1KZQA 5HI5C 4LLQB 4Y4HA 3PHQB 4DERA 3DIVA 3OR7B 4FEIA 3FQRB 3KPOB 3MRGA 5FYJD 3LKSA 5T1KD 1T80A 3VGAB 4TNWF 1A7QL 4ZXBC 3U4KA 2Z91A 1BOYA 4XVUD 1YN6B 2YPKB 4X80H 2VQ4A 2LVEA 4NQDD 4DFIA 4GQRA 4XBGB 4JFFA 4DKFL 2G3MA 4WEBH 5SWSB 2HKFH 1FSKB 4UM8B 1OVZA 2DLEA 5EB9A 2XWDA 5EZJA 5KYNA 4N0YL 3NBNA 2IGFL 4OFPA 5AVVB 1CMOA 5CCGE 3FL7A 1EHAA 2N3JA 4APQA 2W9LA 3MRPA 4NUPA 1OP4A 2PNDA 2QFRA 2VL4A 4ZAKD 2PF6A 1JXGA 2KZKA 1RIUL 3RPKA 4IBSA 2GK0B 4PJ5E 3WIAA 3BRDA 4KY2A 5DEGA 4ODTH 1CVSC 2AXHA 3A0OA 3ZTCC 2IMNA 3FRUA 5FYKH 2XY1A 5EOQL 2WLZA 3M1CA 3FQTA 3OQRA 4L4VE 3GSXA 1E4JA 2ZJSH 1TTRA 2NY2D 4EOWL 4GBXD 2ORBL 1HAWA 3Q6GL 1F3JB 5A40E 4GG8A 5D1ZD 2G4EA 1KIQA 2QQKH 5AOZA 3D05A 5D71L 4L8CB 3WNPA 2OL3B 5BS0B 4TNWK 1PZ5A 1BFOB 4ODUA 3WHXB 4OT1H 1NCNA 4Z3FA 1F4AA 1QRNE 3IS1X 3VD0A 2OTUA 1FFPA 2HKHH 2Q76B 5EEYA 4OCSL 3S37H 4AGMA 2WVUA 5LCVL 1HH6B 4NFDA 2LLLA 3B5TA 3JVFC 1GHFH 1EUUA 2F54D 4A7SA 1V27A 3H8NA 3VX0A 4YXLL 4Q9QH 4UBDC 3MLWL 4PJ9C 3RU8H 5LGHL 2Y69B 2R4RL 2GT9A 2PYFB 3VFVB 2AQ1A 3BUYB 1EAPB 4FFZH 6FABH 4EO5A 3VTAA 2XSKA 2EO7A 4XWOC 3NACH 4QRQB 2ISDA 3VFUB 3SCMA 5LCVH 4TNFA 3B9KB 3D0LB 4MA1C 3MLWH 3ZKNC 1J1XL 1C1EL 2B59B 4P3WA 4WO4A 4R26H 3U6RB 4QJ4B 3QAQA 3ZRSA 2NR6A 3RIAF 3KXFD 4NQSA 5BVJA 3H9ZA 1SPDA 5HGDB 3OC8A 3K5RA 3EYVA 2DLHA 4X6FA 2QSTA 1JPTL 5CSZA 4JVUA 1ZT1A 2DD8L 1VGEH 3L2MA 1CWVA 3DMMD 4HALA 2G60L 4NPYA 4K23L 2J5LC 3ZYZA 1HHJB 2XETA 1NC4A 5SWSE 3VO0A 1T1XA 3JVGA 3T6XA 5HJ3B 4PYGA 4C57C 1EBPA 3BD3A 2G9KA 1SUJA 2VW4A 3CVHB 1ZT4A 3D06A 2VQTA 4JM4L 4L9LA 5MENA 3DSNA 3MVSA 4JHAH 1RJCA 2B2XL 1KBBA 5C0RL 5T33H 3B4NA 3VG0L 4OIIL 4OLZL 3MV8B 4KRPD 3W57A 3OAUH 1EH9A 4IQHA 2MJWA 1RZFH 3ECBB 5IB5B 3TWCL 5JA8B 4XO5A 4HYTB 5AZEH 1CF1A 2AAAA 3BPLB 1XIWD 2FWLB 3MO1A 3O4LE 3O3UN 3PL6A 4TVUA 5C0BA 1AXTL 5D8JL 5BOZG 2CM6A 2F8IA 3QJUB 1PZ2A 1RZKH 4H8HA 4M4PA 2OXHB 1VKXA 5HYJA 4S2SA 2NLJB 3TONA 3QORC 5GRZA 2FECL 4WTWA 1R3IL 5HHXH 1MWAA 7CGTA 3V79C 3TO4D 4H0LC 1DQTA 2K4WA 3ATDA 2FX8H 2OFQA 1DHKA 2I5YH 2GYSA 3UZVA 3SO3C 4K73A 2B9BA 3FFDB 3VD4A 2FZ3B 1JZ2A 4D8PB 1CLZH 4JZOB 1QSZA 4KI5E 4NQEE 1WZ1H 2Z65C 2ZKXA 2CIKB 3PIQB 5DJ6A 5E8PB 3FTUA 1MFCL 1GZQA 3K6DA 4FYTA 1HEZB 4WI6A 2W65B 3LEXA 2OI9B 1YUKB 3NFSL 3TZVD 1MCDA 3T2LA 3KYOA 4LP5A 4RZKA 1DE4B 1L9TA 3FCTA 3G3LA 2DQUH 1KLUA 1SOSA 2ICWJ 4F15C 3TBTA 5SWSA 4IRJD 4X0KB 5IBUB 3U82B 3OXSB 2IFGA 4TULL 4ZAKC 1ZTXH 5LGYA 3EFDL 3ZHKA 4KDTC 5IHWA 1TT6A 2C5DC 2K9FB 2Z7WA 1DDTA 3KJ4B 5DT1L 1QABA 3D3VD 3DIDA 3BP7B 4JO1L 2ZYRA 4LVOB 2CXKA 1XHHA 4NJ9L 4HXBL 1MVUA 3I6GA 2O93L 2GK0A 4UZSA 1ZXQA 4XTRD 4HK3N 5DYOA 4ZD3H 5JPMC 4HUWA 5F7EL 4QPEA 1EZVY 4CC1A 3LZPA 4A37A 3WENA 3AW5A 2AXFB 4UQIM 4PG9A 2EH8H 1TZGL 4UTBA 2FH6A 4YDVB 2CWRA 3ASNB 3EHBC 4H8VA 5GRWA 4UMGA 4YIQA 1DZ0A 2CGRH 3FN9A 3MRHA 5I76A 4X7SH 1X5JA 4HP5A 3OLEA 4IBQA 3GKWH 3ARGC 2GHWB 5CO1A 4MKTA 3OR6A 1GY1A 4A2DA 1JK9A 3FBKA 3EO9H 3KWWA 3LRHA 4JY5L 5AB0A 4RRPM 1TVBB 2PPCA 4HDIA 3ZL2A 2FHCA 5DRXB 3CPLA 3UZEC 1OZTG 4N0FA 4DZBA 5JLZB 1I8UA 3DYOA 1H8SA 5DHDA 3SCMD 2ZX8A 3ULVF 1Y0LA 3MYJA 1EPFA 5C0AB 2MQ0A 2ZUQC 4XN5A 4AZUA 2B4CH 4HLJA 4RMTA 5F89B 4PJFB 2PWDA 4L3AA 1NCWH 4QY8A 4BWWA 1IFRA 4HZ1A 4FG0A 1EVUA 1FE8H 2DI7A 3SD5A 1X5FA 1WZLA 4RDBA 1WFJA 3TPKA 1LO4H 4NKOA 2CSPA 1FVEA 5C86A 4XPTH 2HLEB 3CH8A 1A65A 5ADOL 5GS2H 1T4KB 1ZA6B 1SEBB 1G6VK 4GI9A 4F7CB 3DVIA 1U8LA 4AUUA 2OBGA 4GXVH 1JG9A 1YNLL 4TQEH 5BZWB 3KPSB 4MAUL 3LNFA 3NCJH 4O02A 4RGOL 1XF3B 5C0CE 3ZDZE 1PYWB 1IKFL 1TSHA 2VXTL 4F5CE 1XT5A 3E8UH 3FMGL 3CN3A 1A5FH 3FUEA 1OQXA 3GUTA 3NGBC 1W72L 4P5TC 5DHMC 5FGCE 4F7KA 1RFDL 3PGDA 1W9XA 2FX8L 3JT2A 5E8EB 3N50A 4Z7WB 5DA0B 5ALCL 5T1KA 1ORSB 2WLIA 2OW7A 3L1OH 5LDSA 1MRDH 5GSRA 3U4EA 3D9AH 1IZJA 2KZBA 1ZSDB 2ENSA 5EC1A 4HKXA 5CM1A 3ZGIA 1A1OB 2OW6A 1DQIA 4KHXH 4UAOB 2BZ7A 3FN0L 4MNGE 1QVOA 4G72B 2NXYD 3BKYL 1OGTB 4J3SA 3HG4A 4G8IA 4MJHA 2O61B 4PAZA 3Q44A 4F8LA 5TE6H 1AKPA 4F7PB 5CBAA 5GS0C 5J12B 4JJOA 5J3HD 2Y7NA 1QLRA 2YARA 2P5PA 7PCYA 3FAWA 4CN4A 4JO2L 4OFKA 5AEAA 4PJXA 2GSGB 4Y2LA 3QI9D 2YGOA 3F83A 4FKHA 4J3OD 4LCUA 4YSCA 2N1KA 3KGRA 5FXCH 4I87A 3P0YH 4Y19E 5EO1B 2HN7B 1J5CA 3WLWD 5I74B 5CLTA 1J0IA 1RUML 3CN2A 1ZLSH 5F3BB 1N5AA 2OTWA 1IAMA 1M05B 4YGVA 4OZ4A 2WLJA 1OZUA 2F1AA 1JNLL 5ECGA 5BCAA 4NQCB 1HHGA 1SEQL 2ATKB 1MCWM 3CDGA 1T5XB 4X4ME 3WI9A 3RA7H 3KH3A 4PRNA 3LV3B 4CSPA 3ARBA 3O8XB 4TNVK 4P2AA 2XN9D 4X5WA 1ZJAA 1OSYA 3AROA 1QAWA 2AEPL 3DX6B 3V95A 1DEEB 4O9HL 4TN9A 2B9AA 4QDGA 1F11A 1EGJH 1G7HA 2YJLA 3QDGB 4C56A 3KPNA 4QWWD 3B2MA 1DBBL 3CGTA 4G7SB 2XKUA 3C5SA 1XD0A 2C4XA 5CD3B 2YD4A 1DBJH 4OF7A 1GJUA 2FB4H 5GGRY 1AD9B 4Y9GA 4ATTA 1QI5A 4DP1X 4JN1L 4N68A 4QO1A 2GJPA 1T2QH 1NQBA 3QQ3A 3MRIB 1NGXA 1G9MH 3L3JA 5E0FA 1QACA 1M71B 5JW5A 1ZOXA 3AWEA 2YD5A 1G7QB 3D39E 1MJ8L 3QJSB 4A6YA 5C1MB 5KAQG 3GC3A 1D5BB 3LEYH 1TQBC 4NUJA 2HFTA 4YXHH 2E47A 3GJFB 4DGWC 5I8KL 3ARZA 5C0RH 4ZQKB 4NN5B 5FGCB 5KJ7E 5EZIL 2FB4L 1FLRH 2OSYA 1SDDB 2P45B 4R0LA 3L3OB 3RUGB 2WMPB 3A5VA 3WFHA 5KSUB 1N19A 3JV6B 4JRYB 2YSSB 1XTLA 2AMGA 4NZFA 4EIBA 4PP2B 5FIEA 3L1GA 1M53A 3EKCA 4U6XA 3DGCR 2ZX7A 5EV7A 1LE5B 5JPMB 1SYVA 3R1GL 3DMMA 5ALCH 1KTRL 4YJZL 5KS9A 1A7OH 2BSDA 4X4MA 3IDGA 1P1ZA 3CMOL 1W80A 4HU8A 2P52A 2F1EA 1QPKA 4DFHA 3L5JA 3O2VL 2B0SH 4FQHA 4X7FC 5KS9F 4KH2A 1QBAA 5D2LE 1YQ2A 2V7NA 2X4OB 1TTAA 1EANA 4LPTA 1N64H 3OF6A 3WDIA 3L3IA 5FGRA 2BM3A 4EKXA 2R2HB 3R1GH 5JHDB 1SUHA 2Y5EA 1DANU 3NACL 2X2UA 4YDIH 5EBWA 3UL4A 3PWPB 2ADJB 3WO4C 5DD0H 5F88A 2HJFA 3SBPA 4IJ3C 2GITB 4CMHB 4A6YL 1E28B 3QPXH 2A9MH 4POZD 1UCBH 4ZTOL 2ZOKA 3KJ6H 1XR9A 2X3CA 2IWEA 4HMCA 1YDPA 3BX7C 5ES4B 3FSAA 1BBDL 4DP6X 2VC2B 1R3KA 4MTMA 3MJ9L 4GQ9L 1DSWA 3VD3A 1JBJA 4P48A 5DD0L 1XL6A 3O0RL 1JGDB 1EUTA 1A6AB 3AT9A 3B2PA 3TBWB 3KPMB 2QQNH 5DMGC 4F3FA 2XYCA 2IFFL 1YYMH 3L81A 1WA1X 3G5YA 3PGFH 1RL1A 3QR1A 4LAJH 1RZPA 5D7JA 4L8SB 3FUJA 5MEQA 1HZHH 1KLFA 2CGRL 3VMPA 1AO7D 2B2XH 2HT2D 1CLVA 1H3UA 1H3PL 2UX6A 2W9DL 3PABA 3L54A 2YD0A 2AJXL 4ETYA 3BH9B 2Y6TE 1HXKA 5J11C 3FMGH 1RPUA 2HLAB 3S8WA 3U4AA 4K8RD 1JCVA 1HHHB 2ZX5A 3UJTH 1WD9A 5GZOA 4D0BA 1QWHA 5F8RC 3KDMA 3AU0A 1CK0L 1JYXA 2OYMA 4FF9A 4Z3GA 1J12A 2CUHA 4TLTA 3CE1A 3GS4A 1XGQA 2VITB 3ARSA 1SQ2N 4HW6A 2DJUA 2R9HC 4LMQI 4LVHB 1C16B 2CCWA 4IOIA 1H3PH 3FSWA 4NRYB 2VOTA 3WGUB 2ZX6A 3T71A 1GZQB 1XH1A 3LQAH 3TA3D 3F85A 4XI5C 4BSWB 4XPBL 1OLLA 2FL5B 2FO4A 4Y9CA 2W0FB 3OXRB 1U8HA 1BJ8A 5B21A 2ESVA 2HP4A 3SB3A 4DGVH 4AKQA 1OAUH 2VL5B 3LKNA 4LPCA 4ODSH 4YSQA 1MFVA 2DJSA 4NC2B 1G1CA 3EJPA 4FAAB 1QR1A 3SYPA 4YC2B 4QRAA 2W95A 3ZRFC 3ILQD 2GTZB 2IH3A 1AY1H 1L0YA 3M86A 4LBAA 1O9ZA 1ZIBA 3WIIH 1OB0A 4YO0B 2UZXB 2Q3AA 5K59F 2AK1L 3ESPA 3HR5A 5KJ4A 4QHNA 3VACA 2YAQA 1GKEA 4RMSA 4WTZG 5CSBA 2DS4A 1UD2A 2CBPA 1L0QA 2FAUA 2IG2L 4N4YB 5DVOA 5JHDE 3TO4A 3L4TA 5DK2A 1ZAGA 4TSCH 1AR1C 4ZMPA 2AP2A 4QUOA 2E4FA 1GGIH 3CU7A 4TSBL 1B2WH 2YMXL 5GGSY 4NERA 5FKPA 5CEZD 4XNDA 2OMYB 1Q38A 1G7JB 5F7UA 1AVAA 4Q9RH 1G7QA 4A6YB 1TJHH 5F9JA 2K4AA 3O3AB 4ODXA 3Q8CA 1U36A 5IEKA 2GSMB 4ADIA 2NOYA 4R83A 1AD0A 4ZW5A 4XNQB 1UG9A 5F7NC 2HFGL 3LDBB 1WUZA 1JNHB 5A16A 2JE8A 3CVHH 3V10A 1Z3GL 1KN4L 4PI2A 4QOKB 4XC1L 1JZ7A 5DK3A 3OX8A 3GSOB 3P9MB 5IQMA 1RY7B 4Q56A 5DMIH 3HG1A 1N5YL 5T5NF 1JRHL 4EQ3A 4HVBA 4JG0H 4WFHE 1MCPL 4JQXA 3BAIA 2QV2A 3SE4A 3BWUF 3H2WA 4FNSA 2QMJA 2VLME 2YQ2A 4N20A 1J05A 5F1OB 4ZX5A 3N0AA 4QRRB 3RL1B 3ZE0F 2B4CL 4LLDA 4F20A 4NAJA 5DD3L 4RSYA 2GFBA 5D7JC 3RWCA 1E9PB 1HZKA 5TK4A 5AKTA 1UEYA 3RWFA 1P5VB 2YAFA 3MCKA 3CLEH 3MJ8A 3A67L 5E08H 3TCTA 4JFZH 5A3IC 3BFWA 3CHPA 4JCMA 1CU4L 3L1FA 1G87A 2F61A 1JUFA 3CAFA 3KLHD 4LVNB 3AS2A 5ESQA 4M7KH 4X6CE 3TOPA 3FUKA 3X1FA 4PVMA 3SIKA 2Z93B 1B9KA 3LXAA 4ZXBB 2C26A 1IV8A 2J6EA 2CLZB 1QNZH 2MKLC 3ETBJ 3FHAA 3I9IA 4BYHA 3NSJA 3MNVB 3OPZL 3ARGB 3VG0H 4DOHB 4OLUL 4AYGA 5LHDA 5EC1B 2WXRA 1NMBH 1S7RA 2FJHB 4BK5C 1HOCA 1YEIH 3F3HA 2NNRA 1FH2A 1TOXA 2X0VA 4AEHL 3LZRA 3HAEG 4MHHI 1TZIB 1HI6B 4F5CA 1EAJA 2EXWD 4XVSH 4J4PD 1K8IA 3L3OC 3T0VA 2DD8H 4GOSA 5J13B 5D4JA 2WLMA 4Y5XA 1I8KB 1KEML 3QRBA 4M1DL 1RUAL 1KLFB 4R4FL 5KJRL 3BFQG 3BKCH 3OZLA 3QDJA 3RVUC 5EPMA 2BLFA 4JPWH 1J87A 1MVUB 4Q9CA 3CX2A 1L5GA 1ZMYA 1RIHL 3QWRD 3STBA 4WQOA 3QULA 4FJYA 4PLKD 4JHZA 4HSQA 5SWZD 4K9EH 3MRGB 4N1HB 4YHLL 4V1DB 5GISH 2GKIA 5DMKB 2R23B 4NZJA 1V8HA 2ESVD 4WDIB 3SKJH 4X9YA 5IQ9A 1KACB 4OV5B 1CFSB 3AFLA 4JGNA 1JHLL 1ZTMA 3QIBA 4MAYD 1WO2A 5K9KA 4Z7VB 1QFWI 4HISA 4X6CA 3MFGB 3KYKL 3O3BB 3BN9C 3KL3A 4PJCA 3CSYA 2EH7L 2K7PA 4N0UE 2A9AA 4HDIB 4GP8B 2F8XC 4LLYB 2BNQE 3OZKA 3OXRA 4P57B 4ONGL 3HNVL 2ZP9A 4LSVH 2GPZA 3QQ9D 3VMNA 2FEDD 1UXWB 2R39A 2ENJA 4J8RA 2BSCA 4IBTA 1I1FA 3W11D 3GMLA 1K9TA 3H9HA 5K1JA 3ARBD 3TU6A 3CBJB 1U8NB 4UTBH 1AMYA 3FO9A 3KJ6L 3IWUA 2QGBA 4ZSOB 5FDWA 4AGQA 1GGYA 3HUJE 1X5MA 1BQ5A 1HXMB 4JHAL 5ERWB 1NOAA 3DOIA 1RJLA 2WBWB 3L6FA 3QHZL 4PEEA 5DJCB 1PDKA 3ZKSD 1A6VH 5DUPL 3F84A 2OMUB 3FTSA 2O4EA 3RX9A 4DKEL 1FNAA 4G7QB 1JZGA 3VFWB 2P47B 1KJ2B 1OO2A 25C8H 3QH3A 3DETD 3DX1A 3P54A 2J2ZB 4UQBA 3ZK0A 2PXYD 1NMCB 2JB5L 2IVFC 4JRYA 4NPJA 3QEUA 4J3OF 2A6JB 4OJAA 2X70B 3B7YA 2Q76A 1UYWH 1SXBA 3VXTB 5EF0A 5B1KA 1JRHI 3MLTB 1ICTA 2FX7H 2NY2B 4FGMA 4R90L 2C1OB 3MMEA 1SYVB 4GRLC 5FUOH 4AK2A 4L29B 2GJ6A 3OPZH 5EU5A 5IB3A 4LQFL 5LXGH 2OZNA 3HBGA 3HI5L 1UWEL 4NN7B 4E9RA 4Y4HB 2F5BL 3IK2A 1ADQH 1PQZB 4PG9B 1JNNL 3HFML 1DFXA 5IQOA 1UWYA 3UXFA 1MY5A 4GH7B 4UNIA 3MLPA 3RTQD 3PP4L 2JI1A 1Z9SB 4MA1B 1ZLUH 3W39B 3HAEB 4BDVA 4C59B 5GRUL 2ZCLL 3QFDA 3MUY1 3P30H 3LN5A 5E08L 4PSPA 4YQXL 1Y7VA 1BD2D 2UZPA 4RGNC 2D9QB 4UTAH 4IOSD 3SDDD 1MLCB 4BZ1A 1PZDA 5A3ID 1ACCA 1VEPA 3DV6B 1OM9A 3AXLB 2VDPB 4TTGA 3BQUB 5E9DE 1E28A 1LK3H 1NIFA 1TJMA 1DBKH 3NDZE 4OCSH 1W72B 3OF6D 3MPCA 1G6RH 1OHQA 3WMPA 3PUUA 3ZOAA 3S5LB 3CFDB 1KIUB 3UACA 3LSOB 5AAMC 2LFEA 3CZKA 5HHOB 3QC6X 5KVEL 4JFQA 2CRIA 2F1BA 4RAUB 3JSSA 1WFIA 4G2AA 2Z92A 4JQIA 4UTAA 5GS1B 3L3KB 1O5PA 3T4YA 4PY8I 1N5YH 2OMVA 2HX9A 3EUUA 5DEFA 4HQQL 4HPOH 3WIFA 5IJKA