3ZMEA

Structure of the p53 core domain mutant y220c bound to the small molecule phikan7242
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Small molecule induced reactivation of mutant p53 in cancer cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmeA00
1E50A 1TUPA 4QO1B 3TS8A 2X0UA 2IOIA 3EXJA 3IGLA 5ECGA 3WTTA 3US1A 5AOIA 2BIPA 4IBSA 4L18A 1EAOA 2BIQA 1YCSA 2XWCA 4AGLA 2ATAA 4AGQA 2AHIA 3WTSA 4IBQA 2P52A 3KMDA 1KZYA 3D07A 3QYNA 1EAQA 3WTWA 3D06A 5AB9A 4G83A 2J1XA 4G82A 1H9DA 4AGOA 2AC0A 3VD0A 2BIOA 1EANA 4LO9A 1HJCA 2ADYA 1GZHC 4AGMA 4KVPA 3VD2A 1IO4C 5G4NA 5ABAA 4L0YA 4MZRA 3WTXA 2J1WA 2BIMA 4IBWA 4HJEA 2FEJA 1T4WA 1GZHA 3Q06A 1CO1A 4GUQA 4GUOA 2GEQA 1LJMA 2OCJA 5LGYA 4AGNA 2J1YA 2H1LM 2X0VA 4A63A 2VUKA 2IOMA 1CMOA 2WGXA 5G4OA 4AGPA 2BINA 4L0ZA 3WU1A 2J21A 3Q05A 3EXLA 3VD1A 5AOKA 1TSRA 3D08A 2RMNA 4IBZA 3IGKA 2X0WA 3US0A 4IBYA 4LOEA 4LOFA 4IBVA 2J20A 4IBTA 2J6WA 3Q01A 2XWRA 3WTUA 1HJBC 3QYMA 3WTVA 5A7BA 3D0AA 5BUAA 3KZ8A 4MZIA 2MEJB 1HU8A 2IOOA 3D09A 1UOLA 3ZMEA 5AOJA 5KBDA 2PCXA 3D05A 4IJTA 2J1ZA 3WTYA 5AOMA 2YBGA 5G4MA 5AOLA 4IBUA 5LAPA 4XR8C
chains in the Genus database with same CATH superfamily
3ABZA 2VM9A 2OMWA 4PJBF 1M53A 1G7IA 1IC4L 4R26L 4U1SA 4XCNA 3S35L 3K74B 4LEEA 4GYBA 4I4WB 2DQDH 1KLGA 5A2JH 1INEL 4GW1B 3BN9C 4U4BA 4QKTA 2JLLA 5DUJA 3V4VA 1JPFB 3WY1A 1MFEL 1KF9B 4OB5H 4YXHL 4RIRB 4GQ9L 1OP4A 4KDTA 3CHXA 1KIRB 1QBAA 3T3MF 3DBXB 1GC1L 3B3IB 4X5XA 4LNRB 5C07A 4CVXA 2D3NA 5FO8A 1T0OA 4WDIB 2VR3A 4EZJA 1FYTA 1FZJA 3BO8A 4ZPTA 2FWSA 1J1XH 3CSPA 4IRZL 2YA0A 4NERA 3SPIA 3MNWB 2VO8A 4WI4A 3U7YL 4G83A 4H25B 5GRVL 2DYPD 1PZSA 2H0EA 5DR5L 4L4TE 3CK0L 1GS8A 3KXFE 1FNLA 3MRBB 1IU1A 3GB7B 5C09A 3MLSH 3BZFA 4MS6A 5MEOB 3NZ8B 3HCVA 2D4DA 4L1DA 5HGBA 3ZDZF 2X6BA 2JCCE 3W11C 3CHSA 2LLNA 4M5SA 3U7WL 1CFVH 1VFBA 4Z8FH 4AMKL 5KS9F 2F8VA 1U95B 2EUVA 5DD0H 5KJ4A 3UTSA 2ROYA 5ESAB 1YPZA 3QUXC 4CL7A 5HHPA 3KLAA 4RMVA 3JWDH 1GZHA 3WIIL 1CFQB 4K23L 1ZSDB 5E94A 5F3HA 5IEKB 4TSBL 1UB5A 1EEZB 3PXHA 3JYBA 2FR4B 1ZA6A 4JN2B 4L1TA 4YVUA 2XRAH 1RZFH 1Q9KA 3BWAA 5HHOA 3QHZL 2MQGA 4UUJA 3DSFL 4NO2B 2D7MA 4LVEA 2DQGH 5J5EA 3K80A 4YDLB 5CILL 1A9VA 1WC7B 2ZKMX 5B1BB 1MWAH 2AJVL 2OMVA 3IAQA 2MCMA 4A68A 3OAZK 2XN9A 4NN6C 3Q6FA 1AFVH 4IBYA 4EUPA 3TASA 4DN3L 4ZW3A 35C8H 4E2OA 5H2BA 3RIKA 5I5JA 5A2LH 5DC0A 3DSNB 3GMRA 4ELDA 3LS5H 2C1OB 3ROLB 3QI9D 5MENA 3EFOB 1JNHA 4U1KA 3EDDA 3NDYE 3NP3A 4JFPA 5J12B 5SWQB 3ULVE 3J07A 4NNXA 1ORSB 2CGYA 5AWNL 1HILB 4LU5H 4G1MA 1I8AA 5KG9A 4V1DE 1BP3B 2OSXA 5DD1L 4KOBA 3WLBB 43CAB 4LRIC 5KYYB 1GJWA 3TZVD 4X83A 1NC2D 5EV7A 4FQ2L 4D8PB 2VZOA 4JHUA 1ZY9A 4M6ML 3SKOB 5GGVY 2ZWZA 4BSWA 1HTYA 2FEDC 4Z7OE 2DWXA 4PJ8D 5EUOE 3GUTA 2C7UB 4O4YL 2ICEC 3DJSA 3CUPA 4M3JA 5E7FA 5E6YA 1JK8A 4XN4A 5AQ0A 2YPLA 1CDHA 3ZR5A 2EXWD 5CD5C 1PX4A 2VLLB 4V33A 2B1AL 4F15B 1JGIA 1XGQA 3U30C 3A6BL 2F18A 3MRJB 4MJ5B 1A3QA 3JWOH 3GSVB 3B4NA 2Q7NA 3INUH 2R0ZH 4N9OB 4XNMB 1ZT1B 2ZUYA 3UERA 4PSPA 4KKBC 3TO4B 1CUOA 2AJSL 1A7RH 3BFQG 3CFBA 4PPTA 4ZO7A 2UWEA 1FORH 2Z92B 1CBJA 3NESA 3QARA 5JMOC 3WFDL 4LSRH 2DL9A 5LAXB 1I8UA 4GRLD 2F8OA 3KH3A 4PJCB 3BD3A 3HBZA 3H9SA 3MJ8B 5EOQL 1O5PA 5J13B 4YDJA 3QUXA 4JDVA 1T2JA 4WWOA 1BVLA 1BD2D 2E47A 3AS1A 3JWNC 1BX2B 4N3TA 3I6GB 1LILA 5MP6L 5E5UB 4ZS7H 3MV7A 2FYYB 5DC2A 5C08E 1S9WB 4MBOA 2YPVL 1TZIA 1VACA 3D52A 3N0AA 3NIFB 3VWKD 5I18L 5L7XH 3B9KA 3OXSB 1NL0L 4X5LA 4XPHH 3SODB 3PL6B 1JJUA 3Q7JA 4N8UA 4QXTA 1YMMB 1HZHL 1OXYA 3LCYA 4J3OD 2Z3FA 2Z64C 3CZFB 4MVBD 4PJ5B 2I27N 3QJHA 2P5WA 3KGUA 2HMID 4YPGB 1N8OE 2XYBA 4XCCH 3W0WD 3EO9L 2ZYIA 2CGZA 4RRPA 5CD3B 5ETUB 1FZKA 3UZVB 4ZFOL 4FN0A 1MHHB 1TCRA 3ZKMC 2EDWA 1OSPL 2BZCA 4Y4HC 1TKWB 1EJOL 1OTSD 4XC3L 4HKXB 1WFNA 3UJTH 1XGTB 5HGHA 4YDLC 2PWEA 1IIIA 1MAMH 2CA3A 5I28A 3H6JA 1T0NB 3IS1X 3V0VA 1H3VA 1MCKA 1XCWA 4NI3A 2XG5B 3W5MA 5AAMA 4PB9L 1PCSA 2D3LA 4LOVA 3QYMA 4HK0B 4LRIA 2EE3A 3RPBA 4HK3J 5D7SH 1G6VK 1JWUA 2RCSL 2KHAA 4NWTH 1U8HB 4LPYA 4NS0A 4OZGA 4M7KL 2FD6L 1AXSB 5J12C 3PV7A 1F41A 1HL5A 1SF5A 4O02H 3S2AA 2YQ3A 3GXUB 4EN2A 5C71A 5I16B 1XBRA 1ZLVK 2Z6FA 4YHZL 5BJTB 1ZS8B 2ZICA 4JZJC 3CBJB 2Y7NA 3RHWK 2X89A 4HIIB 3UCQA 5T5FL 4GW1A 3IDJB 1RUKL 2A0LC 5DMIL 1CIUA 1ZV2A 5DMKB 1JPFA 5DUPH 1EAPB 3QDHA 4DZBB 4RIRA 2EINB 1X5GA 1AI1H 1KIRA 2CGRH 2VDPL 3ZKSD 3DBXA 3B3IA 3S37H 4LNRA 5DS8A 1HNGA 4UTBH 4KZ0A 2WKLA 4F15C 1TZHB 1EERB 2X3AA 5K1JA 3R7QA 4O9HH 4HKZA 2YC1B 5DEGB 2IDSA 3LQAC 3FTZA 3MNWA 3NJIA 3OL2A 1IGIL 3JQOB 2HN7B 1FQ9C 5GZOA 2GTQA 3MRBA 2GBUA 3DWTA 1LO5B 3LMJL 4N2LA 5T1LD 1HKLL 2X4RB 3IWUA 3NZ8A 5JXEC 1KACB 5MEOA 3MNDA 2A6KB 2K70A 1WH0A 4M5ZH 5E6IC 3KGSA 2VSKB 4OF5A 1PNDA 3ZN6A 4DPBX 3NOIA 1U95A 5DMYA 2WBJB 5G4NA 5D1ZB 4IU3B 5ESAA 1NWOA 5JPNB 3E8UH 3H55A 3VI3E 1OAKL 2D03H 3KPSD 1CFQA 1ZSDA 1UD3A 5IEKA 4GEJA 3TFKC 2BP3A 1EIBA 1UWXK 4TQ8A 5HHMB 3RU8L 1EEZA 2FR4A 2G3MA 4JN2A 2R83A 2XZAH 2EXYD 2XLLA 4XP1L 1KXQA 5LNEA 3PL6C 4LGSB 4AVHA 1D5RA 4Y4HA 3E9UA 4KK8C 5DZJA 4NO2A 2IAAC 2WVVB 2H1LM 4KRPB 2PYFB 4FFWC 1WC7A 4E9RA 4RSYA 2MWCA 4Y4FC 3ZDXB 1CFNA 1GGCL 3FT3A 3VDAA 4WWNA 4L9LB 3CU7A 2X9XA 1QFUH 3DSNA 1KB5L 2C1OA 4XVTL 4LESA 5DQDL 1Z5HA 3C60D 3ROLA 4DP8X 2WQXA 3EFOA 1TEFA 5DYOB 4PR5B 3VM7A 1MCDA 5SWQA 1MW3A 1ORSA 4RGNE 3H7BB 1AHMA 5FYJD 1HILA 2Z4QB 1DSFH 1SXNA 43CAA 1I7RB 3WLBA 3S3DB 2MJWA 1KIPB 3WNJA 2NRDA 3EJJX 3UYRH 5B3JF 1NGPH 5E4EB 5GGVH 1QG3A 1E4JA 1E9OB 4R7XA 4AEHH 4D8PA 1VAHA 3SKOA 4A2FA 3WFZA 1DYZA 3F58L 1JGUL 1ND0B 3FQ2A 5CP3A 1ZCRA 3W5NA 1GKEA 1I31A 2C7UA 3QFJB 1E4WL 2LAGB 3C6EA 5E56A 3UO1H 4TM9A 1MN4A 4PIBA 5E2VL 1Z5LB 2VLLA 2OZ4H 3LHPH 1KC5H 3UJIL 1IJNA 3MDJA 3MRJA 4MJ5A 2ZX9A 4M1DL 4PRHE 2Q10A 3GSVA 1NPNA 4XNMA 1ZT1A 4JPWL 3WKYA 2IG2L 3HZMB 4P0DA 4TUJB 2OS7A 2BS71 4KOCA 3TO4A 1OF0A 1RIVH 1ICTA 1SEQH 3ALPA 3VQLA 4AEIH 2Z92A 1RURH 3EYVB 5JXEA 1EAJA 1BJ8A 1TMCB 4HFUL 5E6IA 5LAXA 4DK5A 2OW7A 2Y6TE 4PJCA 1F5WA 3BRGC 5C0NC 3MJ8A 3S8GB 3VSQA 1A6ZB 3DOSB 3D4CA 1UENA 4AZ8B 1Y6MR 1QPXA 3MKGA 3OPUA 4IGBC 5I8KH 4MXQD 1BX2A 3I6GA 2EIBA 2IPKB 3PAZA 1KJ3H 2DD8L 1OWRM 3TNMB 2FYYA 1TJGL 2ZWYA 3ZTJG 4KKQA 1K3IA 1S46A 3OXSA 1R5IB 2VLJE 2WBJC 2F68X 3PL6A 5D1ZC 5I71B 1BSIA 1YMMA 5JPNC 1ETZB 3OD3A 4GLRI 4XN2A 1Z2KA 4UBDC 2P43B 1OK0A 3CZFA 1VHPA 4H88L 4YPGA 4F58L 3BAXA 5KSBE 3V7MA 2HTLD 3ZHFA 1EO8L 2H3KA 5HGDB 5CD3A 2I60L 3QHFH 3FUDA 2P48B 1YY8B 5ETUA 3UZVA 1YQ2A 1MHHA 4PB0L 1N6QL 3GJFH 3FZUD 3LZFL 4HKXA 3NJKA 3PJNA 3AJ7A 1XGTA 2Y23A 3BZ4B 4JANB 4KRPC 4L1HA 5CU9A 1NIBA 5F7LB 4W9FC 5E4AA 1M9SA 1T0NA 3ZXAC 1JYWA 4TQEL 1AE6H 1KBWA 1TENA 2XG5A 1YYLH 4K71B 4AM0B 4E9WA 4HK0A 4FEMA 4OF0A 3QPXL 2DI9A 3KM1A 4Y19E 3T0AA 3LHAA 1U8HA 4XNUH 9PCYA 5CJOH 1AXSA 2GY5A 5A7BA 3KZ8A 4ORZC 5I16A 2EEAA 2C8NA 3Q2WA 5BJTA 2F5AL 1ZS8A 2CKBH 5DK3A 3D8MA 3A3YB 4JG1H 2YBRB 3L4YA 4HIIA 4A2GA 1TT6A 3WTYA 5E4EC 5DMKA 5AOMA 4KHXH 5FYLD 5E24E 4X98B 1EAPA 4DZBA 1V5JA 2VGLM 4PHZA 4F8PA 1QSFD 5BVPL 4PY8I 5H37H 3IDNB 3UBXA 3VTTA 4FTDA 1VGKB 1WP6A 1TZHA 5DD3L 4OVVA 4X50A 4N0FB 2GTWB 2YC1A 5DEGA 2OYPA 1NBYB 2X88A 3TA3C 1VPOL 4JFHD 4QXGH 2HN7A 3BESR 3N1MC 2ADFL 4XMKH 3DX2A 4IGBA 3R7RA 4HLZH 1LO5A 4ESKA 4JB9L 5FK9A 2MKLC 2A6KA 3ULVH 4FABL 4YIQB 5GS3A 1XXFC 1X6LA 3BHBB 2A3TA 3GMQB 1I7TB 2HAZA 2WBJA 3KH4A 5D1ZA 4IU3A 1GC1C 1UASA 2NW2B 1H9DA 3OKKB 4JFFD 3EBGA 4RISL 3N2JA 3MV8B 5JPNA 1BF8A 4NPJA 2VZTA 4K9JA 4GSUA 7PAZA 2Y3AA 1CDBA 1IC5L 1F6LL 2DLIA 1C7SA 3ZHKA 2DB8A 1QABA 1OQOA 4XCEB 4HUXB 5IW6B 2Y3NA 2DTMH 1W0VB 3QO0B 1U36A 2MRYA 3CXHJ 5AFAA 3ZTNL 1O9VA 3RKDC 4FA6A 4PGBB 3JUZA 1C8QA 1GGBH 2PYFA 4IOSA 5FWRA 5BOZG 1ML0A 4HPHA 1X5KA 1DJGA 4L9LA 2WMPA 4G72B 4X0NA 3A67H 4OTXL 5H8DA 2DQTH 2CCVA 4FOMA 3RGVB 4B27A 3ARXA 3I6KB 4OIIH 4YSRA 5E5RB 1OGAD 4JFOB 3GBEA 3GIZH 5LBSL 3RWDB 3LNHA 3OPZH 3DNKA 3Q05A 5DYOA 1SDDB 3R4RA 1IGFH 1WPCA 4PR5A 2BSEA 4Z1PA 4EDXB 2HP4A 4ZFOB 3H7BA 3P9WB 4KNQA 1J8SA 4K71C 2Z4QA 5ESQB 1RMFL 3OTTA 1I7RA 4HD5A 4LOEA 3WO3B 1KIPA 4KUZH 3MGAA 4X9FA 2CR6A 3K2KA 4LDLB 4GO9A 1A25A 4Q56A 1E9OA 4YEFA 4QHKJ 1HIMH 3CZNA 1ND0A 3I6LD 1AZRA 5D7EA 2W5PA 4LCIL 4XX5A 3ZMEA 3QFJA 4R5VA 1LWJA 3LIZH 3KPNB 1A1NB 1LHZA 2P80D 3IBOA 4FCAA 4Z0BL 1Z5LA 1N68A 4FJYA 3US1A 5I1IH 1FFRA 3CN4A 4PJIE 4I0CC 2FJHB 1R3KB 1BZEA 2ITDB 2WWNA 4UINH 5F3FA 1E2WA 1F3DH 1HHIB 2EIMB 4RMBA 3HZMA 4J28A 4TUJA 1PBYA 2DLGA 4B5EA 4O2CB 2AK1H 4C56E 4S1DC 3KJ6L 3L3DB 1RIHL 2TRYA 4XAWL 4JKNA 2F54B 2DH3A 2O5YL 1GTNA 4QYAA 5TDNB 4AV0A 3CDFA 4AVIA 3JVGA 1OCCB 1PZ2A 1X7TA 1A6ZA 32C2B 2V2XB 5LKNA 2VDPB 3DOSA 4KVNH 1FCGA 4AZ8A 5BQDA 1ZANH 2DQIL 4TRPL 4LP8A 1OCWH 4N90E 3MOBH 5LB1A 1TXKA 1A65A 3H2QA 4MJ6B 4DGWC 2CO6B 3FFCB 4EQ3A 6PCYA 2IANB 2Y36L 3QYNA 2IPKA 4MB4A 4IRZA 3FUMA 3TNMA 3NVQA 1UM5L 1HAUA 2UVFA 5KBNC 1RV6X 1U3ZA 5TF0A 3PDDA 1RZJH 4ZYKB 3C9NB 5DFVD 2X2HA 1R5IA 2APBA 2YS4A 3DO3A 3FN0H 2BWIA 4JPVH 1ETZA 4ETQB 4Z7WB 4URKA 1YEEH 3PNRB 2XG4B 5F7DB 2R1XB 4WNSA 2D2CC 3OKNB 3IRCA 4GAJL 1UUSA 4YXKL 4NUJB 4QRPE 2WXLA 1KTJA 2LVCA 1YY8A 1QTYT 3KPRD 3RVVD 1O75A 1J1OL 1HYRC 2J6EH 4Z0XB 2ODIA 1P5UB 5T3ZH 5JHDE 2CPUA 1QZNA 2I07B 4L8DB 1AXTL 2X6UA 1EHAA 2ZNWA 3V6OE 4JANA 3BZ4A 5L2JB 4I9WD 1K2DB 4HWBH 4BM7A 2NY3D 4J4PC 3FHAA 3WIFB 1AHKA 2AEOA 1N12A 3T0XA 4RFOH 1X9QA 5HYJE 4AM0A 2GTZB 2DDQH 4YHMH 1FGVH 1DQMH 1DCEA 4PRIB 4DH2A 4ZQTA 1HWGB 2I69A 2WWKT 5EEUA 1WA1X 3IDIB 3D08A 4BE5A 2W0LA 3G5YB 1C7TA 4Q52A 2PTTB 3IMSA 3P1VA 1SVZA 4Y16D 1BVOA 5EWIL 4DKFH 1KB5B 1A9BB 2R0LH 3ZW3A 1C9SA 1TR7A 3THML 2ORBL 3FUFA 2YBRA 2VXVL 4HOZA 4KZCA 4L1LA 4HSAC 3UROR 1V8HA 4X98A 4PWIA 4FXKB 3MCG1 1X4ZA 1VERA 3MCKB 1KFAL 1QSEE 1WGOA 3GKWL 1F02I 4Z3JA 4FTVB 1JSYA 4XNYH 2NXZD 4IOFC 4JFUA 3IDNA 1E5AA 5DHVB 3PJSA 2UZYB 5E0QA 2YJLA 3UOAB 4HXAH 3BYYA 4JY5L 4ERSL 4POYA 1VGKA 4L3FA 3KCWA 1GHFH 1IQDB 1USZA 2GTWA 4G5ZH 1NBYA 3GF8A 1U91B 2EJ1A 1MJUL 4N0RA 5AENA 1AY1H 4X99B 3D0LB 2NQDA 3VGAB 3KYKL 4NQUA 4JHZA 4Y2DB 4WKZB 5FYJL 1HINL 3T2OA 1MFDL 2EDXA 4YGAB 4XVJH 2P28B 4YIQA 1NANH 3EF7A 4Y2NA 3ZQ9A 3BHBA 3GMQA 3NSFA 1I7TA 3QXDB 4NCDA 2NW2A 2X1PA 2GI0A 3OKKA 2JQAA 2J8UB 1A8JH 3WMSA 3ZHNA 2UY6B 4P3WA 5HJ3B 2CHDA 1UTDA 3JWNG 4PRDB 1SZNA 3S37X 4DO5A 2XZQL 4M5TA 5CO1A 2IWGA 4QD2E 1AKPA 3PGCB 1SQMA 4XCEA 2VXSL 4HUXA 4ZW8A 5IW6A 3LXBA 4WV1B 1W0VA 3QO0A 5ES4B 1EFXB 5B1JC 3GXTA 3SDXB 2DKSA 4QF1B 3BE1H 4PGBA 1QHOA 2AABL 2AQ2A 3B3BA 4IS6B 3EFDH 1DHKA 2YPVA 3CSTA 1QBBA 1HHJB 4FNQA 4MHHI 4J4PA 3RI5F 4OI8A 3I3BA 3QEQE 3G5ZB 5KYNA 2MPVA 5BQ7B 2YXVA 3KDPB 3RGVA 3I6KA 4AQEB 1P5UC 1U3NA 4JFOA 2ISDA 1QWHA 3RWDA 5E08L 5SWZD 2Z34A 3B83A 4TNVK 3MGOB 1SDDA 1NFKA 5BUGA 3QDGD 3PAVA 4TSCH 2F53E 5C0CE 4EDXA 2A83B 3Q8AA 2MSPA 4ZFOA 4N2DA 1R4XA 4GBXD 3QR1A 3EHBD 5ESQA 4I3RH 4PI0A 4EBQL 1A9EA 5CM1A 5GZNA 1ZLWH 2XPZA 4OM1H 4NP4L 2LU5A 1P5VB 2DYPB 3D51A 3BKCH 1F4WL 3N3EA 1AD9B 1NEPA 4FHKA 5D1QE 5K1NA 1MHCB 4IBTA 2K9UA 3QIWD 4U6HB 3MLRH 5JR1L 1Q4NX 2C3WA 1QA9B 5BCAA 3QCVL 2WQUA 3MBXL 4KQ3L 2C9VA 3G6DL 3KPNA 5D70L 4CMHB 1A1NA 4D8OA 4L9DA 4FI7A 1F4XH 4KTEL 4LHUD 3ZL4L 3UEZA 5E5LA 3CXDH 3R1GH 2P44B 4CN4A 4FXKC 2FJHA 1HCVA 1R3KA 4N0UB 2ITDA 5T33L 2NTSP 2PR4H 4PVLA 2PXYD 1HHIA 4MD0B 2X28A 2Z4TA 5T5FA 4O2CA 2WWKO 1D7DA 1TVDA 3D12B 3L3DA 1SN5A 1XSIA 2ZPKL 2F54A 3MBWB 3WE1A 1N6UA 2VQUA 5TDNA 3D9AH 3SO5A 1XTMA 3R0MA 32C2A 4WHCA 3FMGH 1AJ7H 3G5WA 2V2XA 4GUCA 4R8WH 1LXMA 4FQJL 1A7NL 1HQ4B 3QZOA 3VGAC 4HW6A 4Y2DC 4K4KA 2FZ3B 4MBRA 4MJ6A 5LNGA 3FFCA 2IANA 1EJ6A 4LSDA 3VGDA 3L08A 3CN2A 3EOAB 3QI9B 4F92B 4FAAB 1PG7X 3HR5B 3SCMB 4ZYKA 3C9NA 3HFML 5FDYA 5FYLL 3LEYH 5B1JA 4Z7WA 4ETQA 1BZQK 4Y9FA 5DT1L 2XG4A 2Y9RT 5F7DA 4P5TD 3TZVB 5EEWA 4CDGC 1NC2B 4EOWL 3G9VA 3B7UX 4N20A 4NUJA 2XQYA 4JO8A 1O5DT 2AJXH 4N28A 4Z0XA 5IB4B 3HI5H 1P5UA 1G4RA 4PJ8B 2I07A 3QNZB 4L8DA 1RZ8B 4N8VB 5EZOH 4K7FB 3T8MA 4XOBA 4NQEE 4HCIA 2HT3D 4Y2LA 3EFFB 1K2DA 1NAMH 3NTCL 2MNJB 2GC7C 3RBSA 3WIFA 3HC2A 2D7NA 1A0QH 1LJMA 2H1XA 3SD5A 3ULVC 1L7TH 2GTZA 2TSAA 2QGCA 3IM1A 2NNCA 1ZHBB 2RD0A 2ZOUA 5HHVH 4PRIA 1MREH 5TE6H 2VZ1A 2ZCZA 1Z9SB 5CNHA 1UXMA 1OTTC 5DD5L 3IDIA 1XGRA 1I3RB 3G5YA 1D6VL 3O4LD 2PTTA 4JFQB 3SDDD 3WKQA 1CXFA 2WJ7A 3V0EA 4GRLB 3H8NA 5C7XL 1KB5A 1A9BA 1WZKA 3IPBA 3ZE2F 3BVVA 1C12B 5MI0B 1XGZA 1SM3H 1FFOA 4EXKA 2GAZB 3W39B 5I75B 1BD2B 3BVWA 2EIDA 4FXKA 1JGVH 3MCKA 3TA4D 1MFMA 2GJPA 4HJ0D 1LVEA 4LCWD 4NAMA 4FTVA 4MMYB 1XGPB 3VWKB 5DI8B 5LGHL 5DHVA 4CMHC 4NPYB 4ZAKC 4UM9D 2UZYA 2NY2B 4GW4B 4GI9A 2VUYA 1UM6H 3QVAA 3UDWC 3O2WH 3SYOA 1EHNA 3CVCA 1IQDA 4UF7C 4YHLH 3RILA 3RWCB 5I8OL 3EJYD 4YEEA 1U91A 5F97E 3W0WB 4OFYA 4FI6A 1XD0A 1IVLA 4G59C 4X99A 1CF8H 5CS7A 4Y2DA 3HN3A 4JGUA 3HC0A 4WKZA 2CDGB 5GJTL 4AIZB 3UBXG 1LMIA 4KBPA 4N4YB 3UTOA 2IWKA 3K3QA 3SPVB 2XX1A 3VFMB 3LNGA 2IV9A 5EORH 5DLLA 1SJMA 3MODH 3QG7H 3QXDA 5E23A 2DWSA 1IT9H 1QLRB 2J8UA 4HUWB 2UY6A 4GMTH 2JWYA 2ZX8A 5HJ3A 4PRDA 1SUHA 3K4ZA 2DEWX 3QI9C 4AG4H 3PGCA 3SCMC 3GHBL 4GP5B 2QJDA 5AB9A 4WV1A 1C5BL 4L29B 5JO5B 5AD0B 1EFXA 2R23B 3NDZE 3G6AB 2GVYA 5I0WA 1YUHB 4IS6A 5E4IA 4A2MA 1H8NA 1HHJA 1QX1A 2LQRA 4Q6IC 5GRVK 4CU6A 4LLAA 3S4SG 5I19L 4KMLB 1JCVA 3G5ZA 5BO0D 4G8AC 5BQ7A 2R4SH 1J18A 1IBHA 1SLXA 2BZDA 3LN5B 4JW3A 1R46A 4AQEA 4QAMB 1S5IL 2MOGA 2C1PB 5FCUL 2H0JA 4PRNB 3MGOA 4H1LB 3D69A 1J0YA 1NMCB 4OCWH 3ORJA 3RAJH 4FQIH 4P48A 1QBLH 1Y1DA 1S7UB 3ML9A 4OZIF 2WGXA 4N25A 3QP3A 1PLCA 1A8ZA 4HZAA 1P5VA 1OB1A 1U42A 1D7BA 2DYPA 1IFHL 4DCQB 2I9TB 1GIGH 5CCGE 1MHCA 5EB9A 5T1LB 4U6HA 1GYUA 2JE8A 3NP4A 2PTUA 4RX4D 1E0OB 4GRLC 4NO5B 5D55A 3TEYA 4S0HA 3QJOA 5M95B 4AZUA 3Q8CA 3RWIB 3PHQB 1REIA 5MI0C 3VW3L 4KK9D 5CN2A 1U2CA 3GRGA 1HE7A 4JX0A 2EE9A 3UDWA 2VXQH 1J11A 1XBDA 5TE7H 1UYWH 2NNXA 5I75C 4MA3B 4EI5D 3KPSB 5KVEE 1MPAL 3Q2LA 1NEZG 2FK9A 4BFOA 4QEGA 4NQVB 4MD0A 1E5ZA 2XKUA 1ZXKA 3VWKC 1NGQH 4XC1H 4FKHA 5JIDA 2NY2C 2VR4A 3MBWA 1U6AL 4PJXF 2OP4L 5IHUH 4J3OC 1E8ZA 2VL4A 4MVBC 1CGVA 2HMIC 1IKFH 2WXMA 1T21B 1Y6NR 1HQ4A 4P2RE 4WI0B 5D2LB 5IB3B 1UA6H 3MROB 3PG2A 3EDEA 4XNDA 1CLYL 2FZ3A 3MC0A 4FFTA 3T3ME 5EBLB 3S5ZA 4AQ8C 1OTSC 3EOAA 1PVHA 1NGWB 3C60B 3QI9A 1L3WA 2KERA 3HR5A 3SCMA 4N2CA 1G7JB 1WFMA 2YZ8A 5CJXC 1N5AB 1NDGB 2AKRB 3WNPA 4OI7A 3P0YH 1OE3A 2H47C 2DMGA 4NOBA 4AGLA 2NSMA 4M8VA 4U6VH 4Y1SA 3VQMA 5A2CA 3OJDB 5C0AD 3TZVA 1NC2A 3PP4L 3IMBA 5F6HI 4L0PB 2KLTA 2ZCKL 5IEHB 4BFIB 4YNYB 5IVXE 4HEMA 5ITBH 1LP9A 5D7LD 4F37F 3MCLH 5IB4A 1FA4A 5KS9E 1U93B 7FABL 3KHQA 2K6YA 3QNZA 4PJ8A 1RZ8A 3MACH 4K7FA 2DWTA 2L7UA 3S3BB 2W0FB 4F8LA 5ITFB 3GSXB 3EFFA 3C08H 3DHJA 2VLMD 2Z0BA 2FQGA 5B3SB 2WVUA 3VXME 3VCLB 1ZHBA 4TLSA 3ZE0F 4KFMA 1C1EL 4NENB 3LNEA 2YFNA 2FBOJ 5ICYB 1Z9SA 2X41A 5L4MA 1IE4A 1T2XA 5EA0L 1I3RA 1E90A 2A4ZA 3B34A 3MLYH 3WOVA 4JFQA 4AKQA 1NMCC 1UZ8A 4JO1H 5INCB 1G94A 4GRLA 4I13B 4S11A 5LBSA 4ZG1A 5FGRA 3SIKA 3PNWB 3QULB 2R0WL 1OSZB 4G9FE 4N0CD 3QYCA 2KL6A 3W39A 3L5XL 4WI9A 4LKXB 2WTOA 1BD2A 1HN1A 1XHHA 4EVNA 1E6JL 1RU9L 2OMTB 3QDMD 4BD4A 4EF3A 1TZGH 3QWQB 2Y22A 3B1TA 4NT6B 2FT6A 4MMYA 1XGPA 1CXIA 1Z3GH 3U6XS 4TUKH 5DI8A 3VWKA 2KT6A 2CCLA 1RSFA 4WHYG 4XPTL 5DMJB 4MA1B 4PWGA 2R56H 4GW4A 1EDYA 3RA7L 3CG8A 2XACC 4C4KT 5J4MA 3RWCA 1WCBB 3EZ8A 2R69L 3W0WA 4CADB 1KENL 2KDGA 3FDWA 3U2SB 2XNAB 4K3DL 1TEYA 1J87A 2P5ED 2CDGA 3U83A 3HG1D 1TUPA 4AIZA 5IGXL 2O26U 1DP0A 2EYTB 3BIKB 3SPVA 3MI6A 1MI5B 2WLKA 3VFMA 5CJXA 1CGYA 2DF3A 2XFGB 4HG4K 1E42A 2VM4A 3RFRA 4GW5B 1QLRA 4GLRH 4HUWA 3QA3B 3FH8A 3ZZLA 4N2GA 5L0QB 3B9DA 1EGJH 4PWHA 3WHXB 1YN7B 3LVEA 2DLEA 5HHNB 1E4HA 3IXTB 2UXVA 5DURB 5BS0D 5E9NA 2JI3A 2ARJQ 2ATAA 5AD0A 4WI2A 4KNTA 4L29A 3PGFL 5JO5A 4JL2A 2R23A 1KN2L 2BNUB 3VFWB 5CSBA 3G6AA 1QWNA 4EDWH 4QTIL 3K8LA 4WFED 1YUHA 1NGZB 5C70A 5EU7C 4OLVL 3EO1B 3GBNL 2CHWA 2AC0A 4MRCA 1UVQB 1UZ6E 4UQ3B 4J8RB 3EYSL 1TJHL 4JHVA 2EDEA 3LN5A 3NFNB 3FYEB 4GI6A 5DFAA 4J39A 1EHLL 4JFSA 3ZJAA 4UQIM 1AANA 2C1PA 5ICXB 4MXWL 2WUBH 4PRNA 3RPIB 2CRYA 4YS4A 4H1LA 3KAAA 2XQYK 5JUEH 4OGXL 2WKOA 2AEPH 2CWRA 1OAYL 4JNXA 2R2EB 2VMJA 1S7UA 3LRSB 1FLRL 3F3HA 4MJ4A 5F0LB 4QY8A 4ZMTA 15C8L 3W1ZA 4DCQA 2I9TA 1MZYA 2VUKA 4K0OA 3L1OH 3QQ9D 3QJFB 4NO5A 1SBSH 1QFWH 4KQ4L 2P42B 1B4RA 1NCJA 4LB8A 3PWPE 4N2AA 3RWIA 5L2KE 3PHQA 1DFXA 4K5OA 3HZKB 4X6CE 4JFFB 1NCIA 3STZB 4MA3A 3VRLE 3KPSA 4MXQC 5T1MB 1GZPB 4DAGL 1NCCH 2QVKA 3Q01A 4G6KH 3TV3H 3S8FB 4NQVA 2BFGA 1BV8A 3OGCB 5FXCH 43C9A 4QIRA 5K9JL 2BNRB 2G5RA 4MA1C 4ZNEE 5F96H 3ARBC 1EMTL 3ABKB 2OJEB 1T2QH 2OMBA 3MLVH 5GRUH 4J6IA 4HGWB 1D5BB 5C6TH 3WXVL 1P0SE 4ZZFA 1T21A 4KKAC 4C54A 4NZJA 1UJ3C 5IB3A 4WI0A 4D9RE 2VN7A 3K4AA 3MROA 4MCMA 2VRKA 3FHEA 3H56A 3MA7B 5D7JC 3QEGL 5DVOA 3GNMH 3LX9A 3LB6D 4FFYA 2SODB 1AGBB 2FBRA 2DQMA 1OGAB 5EBLA 3FCSB 2X09A 1NCAH 5DWUH 3FZUC 2XA8L 3C60A 4KJYB 3CBRA 1W8OA 3FUKA 2AP2A 1NCDH 4UQBA 4O58H 1G7JA 3MLXL 2FX9H 1N5AA 1NDGA 2AKRA 3HNTL 4UYPA 5D7KE 5GS2H 5SV4A 1G4MA 3CGTA 2YGNA 3HPLB 4C4KO 3OJDA 5L0QC 2BRQA 2FLMA 1CXLA 2Y06H 2G2NA 2DOCA 2O6CA 2Y1VA 5IEHA 5D71L 4QJ4B 2EH7H 4YNYA 4R90H 1OQXA 2YOCA 3FU7B 2G5UA 1U93A 2B1HL 2QV2A 3EZJB 3Q5YA 4XX1G 2BOCB 3FT0A 3CC5B 4GG6E 2DQDL 2W0FA 5HYIA 1GMEA 5ITFA 3GSXA 2DLHA 4KKNA 2CKNA 5KJRH 1OANA 3DTUB 4A37A 3TBWA 5K5YA 4FADA 3VCLA 2XQYG 5GGUB 4H0GA 2KI6A 1WDAA 4NENA 5ICYA 1OKEA 2K7PA 4X6EB 5IFHH 3C5JB 2X7LB 2ZOTA 2JB5L 3IGAB 5BRZE 4MMXB 1G9MH 3AC0A 3U1SL 1J1XL 2A4CA 3EIFA 5INCA 5IVNA 2GEQA 1M7IB 2J88L 2ZP8A 2RB8A 4KKLD 4XVUD 1AGDB 3PNWA 3QULA 1OSZA 1CICC 1XH3B 5I8CB 4JE0A 1PSKH 2HA1A 4LKXA 2OMTA 1JP5A 1UFUA 4U1NB 5ALBH 1SEBB 4HJTA 1CFVL 4NT6A 1IAKA 1WA2X 3ROOB 1ZGLB 2HUHA 1ET8A 2FWOB 3KL3A 2DYSB 4CN1A 4DUXA 1T20B 3WNMA 1N3NB 3T04D 4HK3N 4FYTA 2IGFL 4BWWA 3N43B 1WCBA 1OHZA 3BAYA 5F1SA 2CNZA 5F72S 5C92A 5KYXA 1EHXA 4CADA 5KANI 4OLYL 1RZFL 4MQ7B 3D39D 2QQLL 1G1OA 4LL9A 3U2SA 4H8WC 2XNAA 4X0KB 1BM7A 4Q6KA 3VDBA 3QCTH 1U8NB 2PCXA 3LRHA 4ZFGH 2DQGL 3VFVB 4RWYH 3T8VA 3A4EA 1MWAL 2EYTA 4IDLA 3BIKA 1MI5A 1AFVL 3R4DA 1VGEH 2NY3B 4W68A 3O9WD 2EIKB 1RLBA 2CK2A 4GW5A 3OGOE 5MHSE 1MCPL 3QA3A 5JOFB 4Y1TA 3LXCA 3WHXA 1YN7A 4GKNB 5HJDA 3ZYIA 1IBGH 3DBSA 5HHNA 4YBLC 3Q48A 3V0DA 3HBPA 2LVEA 3IXTA 3HS9A 3RFZB 3ZE1F 4MNQD 4UOJA 4Y16B 3ISRA 3KYAA 2BNUA 3B7RL 3VFWA 2QQNL 4B53A 1GR7A 2DIJA 1NGZA 1WEJL 3V6OC 3EO1A 3KMDA 3O6FD 3EH5B 1UVQA 1A22B 1NTDA 4UQ3A 3KPOB 3AZUA 1MJ8H 4EZLA 2QLVB 1N7ML 3ILEA 3SD2A 2AQSA 1ROCA 3UBGA 1U0QA 4F2FA 4ZTPH 1T03L 4DGIH 5F44A 5ICXA 3RUGB 3RPIA 1EXUB 1NBQA 2F7IA 1LO2H 2NXZB 3ETBF 3L48A 4JPQA 3DOHA 2OTWB 3VD2A 3RYMA 3TVMD 2ATPB 1NKGA 3JWOL 1WZ1H 4QNPE 4NQDE 4OCRL 3UX9B 2R2EA 3BEVB 1M56B 3LRSA 3CFMA 4FZEH 4NQCD 2NUTB 2X12A 4PRPD 5IMLB 1FORL 4PJAB 2XT1B 3C12A 4LSRL 4JPKH 2R29H 4MMXC 4DKEH 2B14A 1HI6B 5E51A 2A9AA 4U3CA 1WUNT 2VR8A 3QJFA 3U82B 4OCSH 4CGUB 2WAQA 5FKPB 3HZKA 3BJ91 2AXWA 2DQUH 4JFFA 5DVMA 3BT2H 3STZA 3O6LH 5HVHB 5T1MA 1GZPA 5L7XL 2P47B 5AOKA 1F90H 2Q3XA 2ZXQA 3OGCA 1RZQA 3TF4A 1Q38A 5GXBB 4XPHL 3P30L 2QSQA 3N91A 4LSTH 5HDBF 2BNRA 4DKAA 4OU3A 5DFVC 4PGEB 1W6LA 4OD3H 5FGSA 3CU1A 4H0IA 3VH8B 4QWWC 4BFFA 4XCCL 3DX9B 4HGWA 4ANWA 3WHE1 2WNWA 4FP8H 3CCHA 3D09A 3FSOA 4F27A 1L9TA 4K3EH 4PJ7B 1U8QB 3MA7A 4XB3A 5CIPH 4BWTA 1F3JB 1OAZL 1AGBA 3C5SB 5KOVC 3RVVC 1G5AA 1BFOB 2HX8A 1DQDL 1OGAA 3FCSA 1N67A 5SWZB 1MAML 4KJYA 2XZCH 2HSIA 1X5LA 3QDGB 5DUMH 4R84A 4WK2B 2XY2A 3FH7A 4WKXA 4MD4B 3FO2B 2H0FA 1IC7H 4GBXB 5I74B 3EHBB 3HPLA 2VDML 5D7SL 4PJFF 4WTZA 1I9EA 3CDCA 4YC2C 5DEFB 3D5OF 2F15A 3QISA 3P73B 4IBSA 5ALCL 5F0MB 1MCOH 2E9BA 4LFHD 1JPEA 4Y1AE 4O02L 1M7XA 3QIWB 3FU7A 2CLVB 2HFTA 3UCRA 4BUHA 3RFZC 4Y16C 3CX5J 2BOCA 3CC5A 3BCFA 1SVBA 4JO2L 4R83A 4G70B 1KG0B 2BM3A 3OZKA 1HSBB 5DUPL 1SXBA 5E6RB 4LHUB 4N2BA 5GS0H 2E74C 5D7IF 2UUDH 4KNUA 1KY7A 5GGUA 3D33A 1AI1L 2PXYB 3O3UN 2CGRL 4NJAH 3S37L 4X6EA 4WW2F 1JNJA 4XXCA 1CIDA 3C5JA 2X7LA 3IGAA 5DK2B 1KGXA 4MMXA 1QRNB 1IM9B 5T3ZD 3N44B 3A47A 3QR2A 3SKUD 1M7IA 2LT9A 3L45A 1CLOH 3AS0A 2EUWA 2N0KA 3MV9E 3ZQXA 1AGDA 1KCKA 1VF5C 2E9IA 4F7MA 4KTGA 5DF0A 1BAWA 5J3HD 1XH3A 2VLKD 5I8CA 4QTFA 4DEUA 4P2OB 3N41B 1XH0A 4GOSA 2IH9A 5BVJA 1P2CB 1F3DJ 4U1NA 1SEBA 1WAAE 1OLZA 3LJ3A 3ROOA 2HRPL 5F70A 1ZGLA 1R6VA 4YHYB 2WXNA 4BINA 2FDBP 12E8H 2FWOA 2HXAA 3ATBA 1IJ9A 3T0WA 4JQIH 5E1GA 5JW4R 1T20A 5CGMA 1N3NA 1AO7D 3NEXA 2D03L 3L4XA 2ICWJ 4HWNA 5LHDA 1ZLSH 5HVHC 2XIDA 2XPGB 1QR1A 4P5TB 4S1QH 2ZUUA 3EH3B 4HS6B 2XWXA 5CEZE 1KTDA 4MQ7A 3II1A 1MXDA 4JFDD 3GSUB 3ULAB 4X0KA 1COBA 4WO0A 3D0AA 3HMXA 1U8NA 1JF6A 3VFVA 1FO0H 1GGUA 1IE5A 3WSQH 1BOGB 4PWKA 4TUOB 5D5MA 3CVHH 2JJWA 3HPJB 4YDKH 4MX7B 5AOLA 2W60B 5JOFA 1I9IL 4M3HA 5BO1L 3RTQD 3U79A 1WTGT 4GKNA 4PJGE 1B4TA 5D1XE 1WLHA 3RFZA 3SDDB 1DSFL 2NOYA 4Y16A 3OR7B 2FX8L 3GINA 3KWVA 4GBXC 5I74C 3ZUNC 3EHBC 3UO8B 5H4ZA 4N2KA 5ABZA 2NY5H 3FFDB 3UYRL 3WKMH 1NGPL 1DJYA 3PQYD 3ZDYE 3F7QA 1UD5A 5CP7B 4AEHL 1KELH 1S9YA 2IQAB 3F84A 2E59A 3KPOA 4E9XA 4Z5RB 1FGNL 3X2QB 3UO1L 1O6VA 3FTSA 3QIWC 4Y9EA 2GSIB 4MB1A 2LU4A 2RTTA 3F64A 4TNWK 4LCWB 2KS0A 3RUGA 1EXUA 4H5SA 1PG7L 3LKOB 4UTCA 4UYQA 2OTWA 2G9KA 3NUKA 1KC5L 1MKFA 4UM9B 3T1WA 2ATPA 4I2XB 4HP5A 1BZ9B 4HOWA 4NUGH 5F7NC 3BPLB 3BEVA 2FGWL 1ET7A 1BFTA 2ILLA 2PXYC 2NUTA 2D3JA 5E2TH 4X9HA 5IMLA 4EN3C 1FFPB 2GB2A 4NXKA 4PJAA 1X9UA 1Z5YD 5EN2B 1HI6A 3CD4A 5FECB 5IBTH 1KDJA 3NZHH 1B2WL 1UH4A 1KGJA 2A6IB 3MUY1 5FKPA 4PJBB 5FUCC 2YXWA 5IQ7H 3HZ3A 4P2OC 1OARL 3NCXA 3DIDA 1HAWA 1FVCB 3WV0A 4G8EB 5AG8A 1VIWA 5J1SC 2KQNA 4ODTL 4YHYC 4DOHE 4KKZA 2B8OT 5AW4B 3RTLA 3CIQA 2VJXA 3B2UC 5HHQB 4PGEA 3FT4B 4LLDB 1MFCL 1MQ8A 4XCFL 2Q9OA 3VH8A 2GFBB 4HEPA 3HAEB 2DIAA 3DX9A 2A73B 4IRSD 2QZQA 4P5TC 2OLDA 2XWRA 3BDXA 2EDOA 3TP4A 5JA8B 1H8LA 3QHFL 5TFSH 3T3PE 1G84A 4PJ7A 1U8QA 3D0VB 1F3JA 4FG0A 1HOCB 1E5YA 5F71A 1BFOA 1WS8A 3ARQA 1D2PA 1FUNA 2DQEH 5SWZA 4XWGL 2Y07H 1W0WB 2R69A 2VXTL 4IJTA 2AXJA 1MRCH 1PQZB 3U7AA 2HT3C 3MU3A 3TTYA 4AQ1C 2X4PB 3ISWA 1YYLL 3ZDZB 4DP4X 1KGCD 4MD4A 3FO2A 4UILH 4GBXA 2YRBA 4EJ1C 2PP9A 2GQHA 5DEFA 3T71A 4P23D 1MWAB 4ZMAT 1QTSA 4F3FB 3P73A 4M6AA 5CJOL 4G7YH 2IO5A 3JUYA 4KY1L 3QIWA 5JNYB 2CLVA 2YGVA 2CKBL 3SDDC 3UXFA 1QZ1A 3AWFA 1LEGB 3KYNB 4K5PA 3WUWB 4L3AA 3HUJF 4QRFA 4D94A 2XV6B 4JG1L 4DHLA 1KG0A 5LDSA 1UURA 3RZCD 1OM9A 1HSBA 3P69A 3V2AR 4LHUA 3ARED 1NMAH 2Z31C 3OC8A 3L7EA 4GAAA 4EI5B 2IPUK 2AEWA 2LE9A 1JPGB 3QNFA 3V10A 3QQ3B 1VEOA 2D8KA 2PXYA 4Q9BA 2YQ2A 5CEXB 3OM3B 1FYHB 5DQ9B 3VI4F 5IQOA 5JW4Q 1JN6B 2XC8A 3LS4H 4LOUD 5DK2A 2YD9A 5AKTA 1QRNA 1IM9A 2OZNA 2VDNH 1YAZA 3VXRE 4A67A 2XWBB 4NKDB 3OKLB 2E27L 3GBDA 5HYJD 5ELIA 4OJDH 1OOAA 1L7IL 3CZKA 3I2CL 4P2OA 4IOIB 3TL5A 4KI5F 1DO5A 1IV8A 4HJEA 2EEBA 3VQ2C 2HLEB 1P2CA 4LQFL 1I7UB 3ARZA 3WJLC 3ZUCA 4QXUH 3L5JA 1VFUA 3NPSB 2VDOH 3QT2A 5CZXD 2CUMA 4XN9A 4WCYH 3FQWB 3RG1C 2VLRE 1CN4A 2XQBH 4IBLT 4XN7A 1Y7VA 5CEZH 4L4VE 1QSZA 4OLZL 3MOAL 4X9GA 1CGWA 2XPGA 4P5TA 3V0FA 4B0MM 4HS6A 1U8OB 1QSED 4AIOA 5JHBA 3W9DA 2H1PL 3EGXA 2VISB 3GSUA 5D7LB 2GUOB 4XE0A 1JF1B 1GGBL 5FIEA 5I82A 1IAOB 3PWUB 2YFOA 1BOGA 2UYLA 4XPAH 3ESNA 1F2XK 1BZ8A 2NCMA 3GPSA 1FAIL 3NA9H 4V2CB 4TUOA 3AU1B 2PPEA 4BQ8A 4ZMLA 2DQTL 3ARTA 1VJSA 1S7SB 3HPJA 4GQZA 4OIIL 4XOAA 5CKAA 4MX7A 2WIIB 2W60A 1BBJB 3OPZL 2NY0D 4URTB 4YBQC 1IGFL 1HESA 4TULH 5EZJA 1Z1WA 1RKRA 1DDTA 5ANME 1FJ1B 2IAMD 2XXGA 3MUGB 3BZDA 4Z77B 3OAWA 3SDDA 3D3VE 3OR7A 2VH5H 1JS4A 1JGLH 5F7FA 1P7BA 3QRBA 5KVGE 3FFDA 4QOKE 3BPOB 2ALWA 5CP7A 2HJKB 5E6UB 4ATWA 4P5SA 2VM3A 3BSHA 1HIML 2Z31A 2IQAA 4QLWA 5DEZA 5D2NB 5BV7H 1U8CA 5CEYB 4Q0XH 3ARFD 4QRSB 3DMMD 1P69B 3QDMB 2VDMB 4RAUB 4Y8AA 2GSIA 3L8QA 1P6AB 3LIZL 3ZKXB 4MNGB 4LCWA 3CX2A 4W9IC 4FXGB 4ZW7A 4ANVA 2IPUG 4WTXA 4P4KD 4UCFA 1FZOA 1E4KA 4UM9A 3FO9B 4O02B 4JY4A 4I2XA 3L4WA 1NA8A 4YDNA 1JYVA 1BZ9A 4HOXA 1M7DB 2OBGA 2YAMA 4QRUB 1W80A 3EAKA 4YN3A 4F80A 1NLDL 5DLML 1KCWA 1U8IB 1JIBA 4LLVB 1RK7A 3F8UB 1X5XA 5KZCD 3FUIA 3WDHA 3OMAB 1V7ML 3UYPB 1KY6A 4P2YA 5EN2A 3UACA 3FO0H 5L8JB 4JG0H 2P5EB 1RLWA 2IH3B 4GAGH 4JHAL 3HG1B 5CINH 2NSXA 5C8JB 3ALWA 3VA2C 5FECA 3CPUA 2IF7A 3MRNB 4KRLB 3N42F 2CIIB 4KVNL 3ULSB 2FBJH 2A6IA 1ZANL 4KHTH 3ULUE 4PJBA 1HE8A 4XMLH 1QFPA 3MOBL 4PGZA 4MRBA 3T0DA 5FLUA 4LEXH 4N6QA 3DGGA 2CLZA 4Z7UF 4LDCA 1FVCA 4NKMB 3PABB 3G6JE 1RZJL 2FJSA 3TCLB 2AEQL 1WWCA 3NPSC 1F6AB 3MLZH 4XP4H 3GQFA 2X0VA 5BS0B 1EDHA 1TETL 4JPVL 4HUNB 3IN2A 4BKLB 5A1AA 5HHQA 4K7PY 4LLDA 2GFBA 1BM3H 3HAEA 4X7SH 2A73A 2GC4C 4PW3A 4HS3B 3EXLA 4EMZA 1K3ZA 4CU7A 1VEMA 3TBBA 4YK4B 2YRPA 5IJDC 5T3ZL 1HOCA 3OC5A 3T9WA 3OKEB 1AGFB 1IAIL 3VU2A 1UM4H 1ESOA 1W0WA 1SMAA 1YEGL 3V9CA 1BMZA 4PGDB 2X4PA 1KCUL 4RFOL 4FCHA 1ZK5A 4ZMOA 3S5LB 4DFHA 4DZ8B 5TE4H 3RX7A 2DDQL 3SZKC 4YHML 4DPRA 3ILPB 5KBDA 4OCXH 2C9XA 5KS9A 3VM5A 3BSZL 1F6FB 4HIXH 4EIUA 5EZIL 1MWAA 5CR1A 3J2PA 2ODHA 2ZKHH 3B56A 2PKDA 2WVSA 1VKXB 5FFGA 4A38A 4QRRD 4GS7B 4DKFL 4RX4A 3KYNA 1LEGA 1BXUA 3WUWA 1K6QH 1WWBX 2FWLB 3DXAE 5I6OA 1T22B 4TNFA 4WTZG 1DN0B 5C7ZA 3IYLW 4R9HA 4YSEA 5D2NC 4EI5A 1JPGA 4ZFQA 3QQ3A 4NC2B 3ZKXC 5CEXA 2D9QB 1NM9A 2H9GB 5JHLH 1JN6A 4LSVL 1VFMA 3CFDA 4HXAL 1B0RB 4NQED 4ZXBC 1N0LB 2XI9A 5AW9B 4ANKA 2XWBA 4NKDA 3OKLA 5T1DH 4ZTOL 4EKJA 2B16A 1HT6A 1L0QA 3CVBA 1AY1L 4YZFF 2CSPA 4G6FD 4YZWA 5FV1L 1KTKE 1GS6X 1CD8A 2VJ0A 2WWOA 3LRGA 4OD1H 4IOIA 3HG5A 2BSCA 4PS4H 1BHGA 3AWGA 1I7UA 1J8HD 3CWGA 3UTPD 2VQ1B 3Q6GL 3S36H 1A7BA 4GXUN 2PABA 3PUCA 3DJ9A 1P7KB 2NR6C 2HT2C 3RIFK 3FQWA 1KCSH 4AOFA 4Z76B 3FTXA 1LMKA 1XQ4A 1CU4H 1QBMH 2NQCA 2D0FA 4X6FB 4M8RA 3V52L 3B37A 3M8OL 1U8OA 2Y4SA 1J05B 3MBEB 2VISA 1RJCA 1V55B 2A9ML 2X1OA 5ICUA 3LNIA 5D7LA 1L6XA 2GUOA 1PTZA 1JF1A 4LLQB 2P24B 2PWGA 5JA9A 3MA9H 3EFDL 5JIQA 1IAOA 4L8BB 3PWUA 1OD9A 4KO6A 4RSVA 1QACA 3AU1A 2YUZA 4KO7A 4W6WB 3VRIA 1BW8A 4NIYE 1S7SA 2X9YA 2R0KH 4YK4C 2WIIA 4X6DE 4XT1C 3PWJB 3HHSB 1JNLL 5E6SB 2EE2A 1A6WL 3JT2A 3VUAA 5EO1B 1HYSD 3AAZB 1FJ1A 1QMUA 3MUGA 3D4GA 4DTGL 2HRHA 3ZKND 4H40A 4I3RL 5E1IA 3GSNH 3V0IA 2BIMA 5ENWB 1DZBA 1H5BB 4PYHA 4B3EA 4EIBA 2VERN 3BKCL 3UG4A 1SOKA 2HJKA 5DRNB 5I15H 4LL4A 3WY4A 3ZPDA 1BEYH 3WBDA 4MJ2A 5D2NA 1G1YA 4QRTB 3NABH 4QRSA 3G04A 1OAXH 3OQRA 3QDMA 4RAUA 4GS7C 3V0WL 4MNGA 1JZ2A 3QQ9C 2HVKB 4FXGA 4BKSC 2FO8A 4G8GD 3SE6A 2WQWA 1TQCC 3T0EE 4GSDH 5E99H 3FO9A 1IFRA 4O02A 3CXDL 3R1GL 3T6WA 4XCYB 5LBGA 1A64A 2BIIA 2CKBB 2PR4L 4QRUA 2KZKA 5SX4I 1ZE3H 3HN8A 1NPJA 1U8IA 4OUUB 3HVNA 4GKLA 1KUMA 1SLVA 2ZCHH 5FM5M 4YSPA 3SE8H 4HWEH 3D39B 3UYPA 3IAGC 4RMQA 3SE9H 3BSGA 3ESPA 3GXIA 3KJ4C 4IMLB 4DN4H 4XAKE 2EILB 3FU3A 4OV5B 3ULUH 3E0GA 2P5EA 2IH3A 1NINA 3D9AL 3FBQA 3HG1A 3M86A 1W91A 2WXOA 3NIGB 4G42B 1UA3A 2ID5A 1BQLL 4OH2A 4OT1H 5C8JA 3MRNA 4R8WL 3ULSA 1ZVHA 2CIIA 1KWGA 2W9EH 4WSGA 4MJID 3O9WB 3LKRB 4MZRA 3KLLA 2VR5A 1G9NC 4BZ1H 4L3EE 3LB6C 3CZJA 4NKMA 1YUKB 3HMWL 3PABA 4BWUA 2P4AB 4IBWA 3TCLA 2VQ4A 3FCTB 4OKVB 4DW2H 3O2DH 1MY7A 1F6AA 1VRSA 3CAFA 4K7PH 3E38A 5DO2D 3VXOB 3PYCA 3LEYL 4ICWA 4BCXA 4UNVA 2EO1A 1P7QD 5BS0A 3NCMA 2YSSA 1MFVA 4HIEB 2GITB 4MNQB 4HGKC 1BG9A 1DE4B 3BGAA 3RB7A 2EVIA 5HHXH 3SDXF 1D7CA 4NQQA 4HS3A 4IYKA 2DV6A 1MFBL 3O6FB 2AJXL 4GT0A 3OAZH 3MBEC 4K2UL 3HI5L 1JWMB 3NK4A 5D1ZI 5EZOL 4I0PD 3OKEA 1AGFA 1FPTL 1IGMH 3ZOAA 1NAML 4F8OA 4PGDA 2GBAA 4RAHA 5I30H 2CHZA 3K71B 1WFJA 3ZTDC 1CDUA 3T4YB 4JO3H 3TVMB 3U6XA 3S5LA 1F4YH 4DZ8A 5JQ6L 3S88H 2ZOWA 3CXFA 3ILPA 2OSLB 1NIEA 1OT4A 4GKZB 4OSUH 1X5JA 3OF6D 4BUGA 3DPBB 1QPKA 5BZDA 2ZSWB 4NQCB 1UOVA 3IGFA 4PRPB 3WUZA 1E3XA 3X3GL 4EXPX 1VKXA 4C57C 4ABVA 4M61B 1DR9A 4X7DC 4YXLL 4FNRA 2OXHB 1ZHLB 4FULA 4U49A 1E8YA 2XHNA 4PCYA 3FSAA 1SM3L 2XETA 4KKLC 1E3FA 2ZXEB 3ET9F 1SY6H 1T22A 2BCMA 4G1EB 4OFVA 2CJUH 1LNUB 2Z91B 1DN0A 1RZIB 1AS7A 4DP9X 5GS2D 3LAFA 4E9VA 1F86A 2YWYA 5A2BA 1T5WB 3L4ZA 4KC3B 3IMUA 4RH4A 1Q72H 2H9GA 3EOBB 2CU9A 1RJLB 5ABDE 5GRJH 2DBJA 1MXGA 4HPYH 3LH8A 1B0RA 3JTBA 2HT4C 5HTSA 1N0LA 1UM6L 3L13A 3BC9A 5C0EB 1I9JH 1QUPA 2NTFB 5AVRB 3HRPA 2MTPA 4KUCD 1IARB 3VXMD 3IXAB 2J8OA 1CF8L 4HJIA 3DYMA 3HE6B 2FTAA 5K9KB 4MA8H 4H8QA 4IKLA 1HJCA 5GHWH 3M7OA 1M05B 1LO4H 2AGJH 5C07E 1SBBA 2VQ1A 1HX0A 2H45A 1M3JA 2G75B 4D7BA 3MODL 3QG7L 3DHPA 1P7KA 1IT9L 1FYTE 3SQRA 3M1OA 4GMTL 4EIZC 4Z76A 3O9WC 2ICWB 3IE9A 2P7TB 5KSAD 2NY7L 5EMYA 3SBPA 1I75A 4LLUB 2DMHA 2ZP9A 1J05A 3MBEA 5C09E 3WI9A 2A6DB 5DD6B 4N68A 2B4CC 4XXWC 2JK5B 1YEIH 1K8DB 4LLQA 2P24A 4KI1A 3U1PA 1MCRA 2W94A 4L8BA 3UTSE 1MCIA 4PG9B 4AITA 1YPZE 5TJWK 4K8RH 1PD1A 4Z95H 2H2PD 1KTBA 3QUML 2R4SL 1BREA 4R7DB 3FF8A 3V4UL 4QMEA 3V5DB 1U4FA 3QUZD 2A77H 3U9UB 4EI0A 3PWJA 4UANA 3HHSA 1MCLA 4HJ1A 1PG7W 1T66D 1KJ2L 1E9PA 2J5LB 2PTVA 5EO1A 3AAZA 5HHOE 3AQDA 3FU6A 4HMCA 2BVOB 3E3QC 3RAJL 4FQIL 3TVMC 4OQTH 4DK6A 4Q9RH 1QBLL 4PJEF 4UM8B 1DANT 2RQEA 1ZLVH 1YDPB 2IALB 4FHBD 1TTRA 5ENWA 1GPOH 2XN9E 3WN5C 2ZUVA 1H5BA 3MRPB 4ALAC 2AMGA 5DRNA 1ZTXE 2VLKB 1GIGL 2C9SA 4TNEA 3ZKQD 4AK1A 4DERA 2CBQA 3M88A 1A14L 4PJDF 2VSDA 5AL8A 3PV6B 4QRTA 1XT5A 3HRZC 4MAYD 3TJEH 3UC2A 5MENE 4F91B 2BVYA 3QJRB 3AQZA 1J5DA 2HVKA 2K6ZA 2FJUB 3IJ9A 4E9TA 5ADPL 2C34A 4JRFA 2VXUL 3UMNA 4AW4A 1YEKL 2XBDA 1DLFL 2VXQL 1JERA 3IGLA 4KY2A 3RWFB 1UYWL 1AO7B 1NCHA 4XCYA 3LPFA 5L6YH 3U0WH 1BFVH 3CN3A 4UT7L 3X17A 5I1JH 4H26B 1M3IA 4OUUA 3OX8B 1XD1A 4XC1L 4PRAB 3D39A 3BXNA 3UEQA 4IMLA 3U4BH 4JFDB 2O5ZH 4OV5A 1BPLB 5IHUL 3OQ3B 2KYIA 2VL5B 3GLDA 2VZVA 4G42A 5TQ2L 2YPLE 1IKFL 4G8FB 4RGMB 3ZT6A 4HT1L 2BHFA 3KG5A 1QRKA 4RCAA 1URLA 1ZWIA 4JS7A 4MZ3A 1EZSA 3O9WA 3LKRA 3PFUA 5DRZB 1SHSA 3HE6C 4L1BA 3BH4A 4W6YB 2FAUA 4KZDH 4HDIB 5I24A 5EC1A 4TNGA 3RTQB 3ZTJH 1BXVA 5KTEH 2WSDA 1P53A 1D9KD 1UWXH 2UWEE 3FCTA 4OKVA 2FJGB 3GRWH 5AVVB 3CSYB 2XIBA 1IKNC 4XXWA 3VXOA 2Y5QA 4FNTA 4N2OA 4HIEA 2GITA 4MNQA 4OFDA 4U6VL 1DE4A 2WLLB 1ZDSA 3H9SE 3QDJD 3Q0HA 3GHPA 4Z7QF 3HNVH 1RJZB 1EBPA 3PQYB 3O6FA 3GBML 4ODWB 5ITBL 1J5IA 5JIPA 2V33A 2QELA 3MCLL 4ZDHB 1X7QB 1JWMA 3T0BA 3SGKC 1N8ZA 2IOMA 3MV7E 3MACL 2NW3B 3F7KA 1JPTL 3F7VB 3L54A 4XO4A 5DS1A 3VXPA 2P8MB 3W3BA 3W81A 3TX4A 1JDDA 5LCVH 4YQXL 4P06A 3C08L 2V6HA 3I84A 4R4FL 5TGBB 3DVGB 4APXB 2EACA 1NICA 3K71A 3T4YA 3TVMA 4Y1AA 2IPTH 1DBML 3L9EA 4G7VL 2P5WE 1Q0YH 4OUOA 2OSLA 1QHQA 2N7AA 4GKZA 3HZVB 1NCOA 3DPBA 3ZDWA 2ZSWA 1N26A 4NQCA 4TVPH 3ZTEA 4PRPA 4BFBD 5DHEA 1MNUH 5DA0B 2OA9A 4JO1L 4M61A 1XH2A 4Q58C 5B7FA 3UBHA 4MXVE 1LL1A 1PZUB 2OXHA 3VVVA 1ZHLA 1YO4A 5FUOH 5IUSA 3K72B 2ZYHA 2VSMB 4G7SB 5C2BH 2I24N 5HI4D 2Z91A 1LNUA 4GIAA 1RZIA 2HFFA 5J3HC 1EV2E 2ROXA 3NQIA 5HYSG 4G6AD 4S1RL 1P1VA 1BCIA 4IIZA 3IDXH 4L8CB 1TZGL 1KFGA 3T6XA 4XPGH 1T5WA 4H20H 2PPAA 3LIUA 1HWWA 5FYKE 1Z3GL 4NZRH 4OZGE 4AQAB 2YAFA 5DJ2B 1P4BL 1RJLA 3D30A 2R56L 3LRMA 3ECBB 2ZAHA 3QRFM 5C0EA 1U8MB 2VW7A 1NH6A 4OZHF 1XF5B 3V4VH 2NTFA 3LIZA 2Z1KA 3H3PL 4YFEA 1CFSB 2WO2B 4IRSB 1CCZA 5FDWB 3IXAA 3RWJB 4A7SA 2E75C 1CK0H 4PP2B 4A6YL 4AYBA 4LSUH 2JCWA 3HE6A 4AV4A 5K9KA 5A7EA 2Y69B 5D2LF 3D07A 3TJHD 4Q9QH 3SDCD 1F13A 5JTWA 1HEHC 4WFGE 3AB0B 3VXSD 2BRRL 3FT1A 4D2NA 2G75A 2W07B 4G82A 1JWSB 2YHGA 4ZD3H 3HE7D 3N50A 3E8VA 2WYIA 1T80A 3SDAC 2ICWA 2VO5A 4BKTC 4KJWD 3H4FA 4GXVL 2P7TA 1MRFL 2JJTC 3HNSH 2R1WB 1NLBH 3WTXA 4LLUA 2Q3ZA 4P23B 3RTQC 4R2GD 1KEMH 4U1IB 3GKZA 1G6RL 2A6DA 3SGKA 1LWHA 5DD6A 1DFBH 1LM8V 2JK5A 1K8DA 3WD5H 3T77B 4EDWL 4JFED 1PZAA 4PG9A 4F24A 2HX7A 2XV0A 3RZCB 1VZHA 1JHTB 2DMBA 2VTFA 1CDGA 3AREB 4R7DA 2DLFL 1MF2H 3MRCB 4KXAA 3H42H 3V5DA 3GK8H 3U9UA 1C08B 4PN6A 3S36X 3ABMB 1SFHA 1KXQE 1UT1A 4TF4A 1NIFA 2E46A 1F56A 3O2VH 2VABB 4JKPH 2C9RA 2BVOA 1DO6A 4FRWA 25C8H 1A6UH 4JM4L 3VFGL 3NSCA 2APXA 3EJZC 5E0FA 1V7NH 1W8EA 4UM8A 3H9ZA 4Q9CA 2NXYD 2IALA 4QTHB 1SXZA 5E2WH 5HYJB 5K93A 1L9RA 1NAMB 2GJ6D 3MRPA 2D0GA 2OJZH 2VLKA 3OR6B 4DWHA 5AB0A 4KTDH 5IT2H 2ESVD 5IOPB 1LD9B 3PV6A 2YA2A 1UOWA 2DJUA 3U4KA 1G7MB 1QFWL 3BSZA 2A9DA 2OCFD 4ELMB 3B2MA 3B1UA 2WCPA 1YNLH 4Q89A 4NAQA 3RWFA 1AZBA 3PWVB 4JRWA 1AO7A 2Y6SD 3FCBA 3FQNB 1INDL 3TV3L 1C5CH 1T5XB 4M43H 1PNCA 2HB0A 3SYPA 1E5CA 4H26A 2EVFA 2EVGA 1OO2A 3A5VA 2GABA 5IJVB 3OX8A 4BA8A 1A3RH 1H19A 3N1QC 4PRAA 1SYVB 3RWGA 5F96L 3O6KH 4FG4A 1S7QA 1BLNB 1NKRA 1VLXA 4JFDA 2F19H 3MLVL 5GRUL 2VL5A 1DL7L 1H0DB 2GY7B 5C6TL 2XA3A 4G8FA 3BPNC 1GSMA 4IRSC 3F00A 1T7YA 5DRZA 3GNML 4DGVH 3SDAA 2ZCLL 3P3SA 1TQTA 1O7VA 2QR0B 3ZE2B 1QNZH 4P59H 4HDIA 4HQQL 3F7YB 3ZIYA 2CBTA 4GKOA 3RTQA 3ARGD 3G9AB 3VX1A 2NY0B 3VRJB 1E40A 4O58L 3AB0C 4BELD 3ECQA 2FJGA 2FX9L 2BS8A 4UB0H 1KGIA 1TTCA 2HX9A 2IAMB 3CSYA 5TF1L 1IBDA 4UOQA 3TV8A 4J7RA 5ABAA 4PJCE 4YR6B 2WLLA 1BFSA 4JHBA 4R4ND 1RJZA 4H8PA 2Y06L 2QGDA 1CXHA 1INQB 4P23C 1Z7JA 3KVPA 3PQYA 5TPWH 4R90L 2G60H 4ZDHA 1X7QA 4JKWA 3ARFB 3TTSA 3D2TA 3DMMB 3F7VA 4WUUD 2NW3A 1EK3A 1A7OH 3NIFE 2J1YA 2P8MA 4X8CA 3POHA 5GSVB 4L5FE 2Y25A 1MQKH 4P4KB 4APXA 2YPKA 5TGBA 1M2OA 3DVGA 2JELH 5KJRL 1YMME 2FL5B 3S2CA 5I76B 1O9WA 3RZCC 5EU5B 4PJ5E 2VR9A 3QWRD 1O6TA 2EYSB 1L9OA 4MFHA 3HZVA 2WSPA 4PM1A 5IFHL 1S7WB 1SHWA 2QVMA 1ROWA 4HKBB 3OAUL 4K7PX 2CLRB 4AJ0A 5I1HH 3QUMB 4LOUC 1NSNL 3MRKB 1QTPA 1NQBA 1ITBB 4YSDA 1XR9B 4MS8C 3AU0A 1GOFA 1BMGA 2X3CA 3K72A 3U4EB 4MHHG 4WY7H 1KJ2B 4PW4A 1UOKA 1PU0A 5IROD 2HLAB 4JM0A 3P54A 3V4PL 1OT2A 2VZUA 1V3MA 2LFGA 3VFTB 5C0RH 4L8CA 4B97A 3K8KA 3CZLA 1IX2A 3QE5A 4PREB 3GXDA 4LIQE 4RBPK 4AEFA 2WLZA 4JCLA 4AQAA 5DJ2A 3F12B 5GPRA 5CUSH 5ESVB 5CZXC 1DVZA 3ECBA 1ID2A 2DQJL 4LGPB 4DP0X 1AMXA 1U8MA 1VA9A 1XF5A 5DCCA 2XJKA 1DDHB 5DVKA 4IEFB 1CFSA 4RDBA 4IRSA 5IIEB 1WJ3A 4H2AA 3RWJA 3SY6A 2QQKL 2IBGA 2V5MA 4W70A 2F74B 5SV3A 3PHOA 3QCTL 1PZBA 2WN2A 2E7BA 4OZIB 2AW2A 2EADA 3TH3T 1BOYA 1BG1A 4GRWF 4UNUA 2W07A 3BVDB 1JWSA 3NCWA 4L8SC 1UEYA 4PTUB 4UZUA 4WGVB 2V9RA 4KV5E 3JWNH 3DUSA 4OM0H 2X44D 4TTDD 3S3CB 4P2AA 2R1WA 1IBGL 2XBZA 1P84J 4MDJB 4P23A 2Z8VC 2NY0C 3PWNB 4XPBH 4YE0A 3H7LA 3SN6N 4S0SD 1WTLA 2BC4B 2UX7A 4U1IA 4JDZB 2QADD 4YJZL 1A3ZA 2FUQA 1OF2B 3NFSL 3KM2A 2ARJB 4GRWH 4QRRB 1Z32X 4UDTB 4XP6H 3SGEI 3T77A 5BOPA 4ZX4A 4JR9H 4W9HC 4M62H 4D3CH 2OJ1A 3MUUA 2O6EA 4YGVB 5AVYB 3P11H 3RZCA 1UA7A 2FSEB 1MJ8L 3AWEA 4PJXB 1JHTA 1YQVH 4AYID 2YRLA 4UZSA 3V6FB 3MRCA 2HYMA 4XHJD 5HHME 1C08A 5T1KB 4DGIL 1JVKA 2ZX6A 3ELAT 2A9NH 3IPEA 1OP3K 3ZO0A 1QKZL 1LO2L 1AP2A 4KI5D 3QWNA 3SBRA 5EOTB 5A16B 1JV5B 2O61B 4PCTA 2BFVH 5DZOA 3TWCH 1JHKH 1LYQA 4NGHL 3C8KB 3LKQB 4QTHA 4EO5A 1HZLA 3ZDXE 1LEKB 2BXYA 4PV9B 1NAMA 2QSCL 4G6FB 1PLGH 3TO2B 1CGXA 2EDKA 1MCWW 2X4QA 5A2KH 3OR6A 4JPKL 4DKEL 1KYFA 5D1XD 2XVKA 4BA0A 4TLKA 3BUQA 3UABA 5IOPA 1LD9A 2FLBT 4M6NH 3Q5TA 1GJIA 3NCEB 1G7MA 2YK1L 2P9RA 4MZIA 1ZLUK 1J8HB 1XMEB 5H35B 3VTAA 5JW4M 2LU7A 2ITFA 2HVJB 2EIZB 3K91A 4AIXA 4N9GB 2X6VA 3D85D 4E41D 3MLWH 3SYQA 3OB0K 4NDMB 1N19A 2K7QA 2HH0H 5AYUL 2V2TB 3BT2L 1FBIH 1FH2A 3D05A 3PWVA 2GYSA 2K0RA 3FQNA 4DFIA 2HUEA 1DCLA 1XF2B 3VD7A 1ZHNA 1T5XA 1F90L 4Q2ZB 3NSXA 1LGVA 5CP3H 3CPLB 1WF5A 3B2DC 5IJVA 2KZ1B 1SYVA 1WZAA 3T6ZA 1E28B 3IEAA 1BLNA 4KXBA 3QFJE 3ZE0B 2CO2A 1H0DA 1HL8A 1IBZA 4FP8L 3E7JA 4HV8B 4YWGH 5CCKH 4K3EL 1KEGL 4KROC 4JRYD 3B5TA 3I75B 5KVFL 1FFNB 2QR0A 2WXHA 1S7XB 1WWWX 2NY1D 2YR3A 1P9MC 2OL3H 3VRJA 3WELA 4U1LA 5DUML 4A6YB 3WEOA 4JRLA 2BY3A 4TNVF 4APQD 3DX8B 1IC7L 1TZ8A 4YR6A 2Q3AA 1OV8A 1J5OH 2EDHA 2QMJA 5F3BA 1HNFA 1BYOA 1INQA 1MCOL 4FJ6A 3U1QA 1OP5K 2I5YH 5FR3A 1RAMA 5F1IB 4RFNC 1E30A 5E8NB 4FNLH 5B4MC 2Z93B 3WNLA 1BGXL 2IQ9L 3ARFA 4LLYA 2ZXGA 2XJLA 5HD8C 3AACA 4F20A 4XO5A 1FNEB 1MJ7L 5GSVA 1JZ5A 1E7UA 4P4KA 3RLSA 4G8GB 2VJ8A 1MFAH 2FL5A 1MCSA 5I76A 2JJUA 2UZIH 1G6RB 5EU5A 1DQJB 1Q94B 3OMZA 3UG5A 2W65B 1KPUB 3HA0A 1CBVH 1XCXA 2EYSA 4CC0A 3P9MB 1AD0B 1L5GB 4BQ9A 1JZ3A 4NJAL 3IJHB 1ZOXA 5B38G 3NG5A 1S7WA 4JAMB 1WBZB 4HKBA 3ZIMA 4ADIA 1XAUA 2CLRA 3B8SA 5I1AB 3QUMA 5ADOH 3MRKA 4LARH 3AADB 5E8EB 5LUMA 1CLOL 4WUKL 3UTTD 1XR9A 3KYMB 3IRZA 4X4ZA 3Q13A 2Q0ZX 3W2DH 3U4EA 5L88H 1QVOB 1KJ2A 2P45B 5CJ8A 4MJIB 2HLAA 4LIQH 3V6BR 3VFTA 5SX4H 4I3GA 1U92B 2QSVA 4RMSA 4PREA 2WXQA 5TK2A 3W9EB 4J3SA 4Q14A 1WYJA 1X4XA 4JY6B 1EPFA 3U2JA 3F12A 2KDYA 4NQXB 3ARSA 5ESVA 4ODHH 1JPSH 3KD4A 3MRDB 1NMBH 1P7QB 3IJSB 3PREA 3QZNA 3GDBA 4AH2B 2B15A 4S1QL 4IEFA 2VR6A 4YHKL 5IIEA 3IFLH 3L3OB 3L3GB 1NCBH 2F74A 4KXZH 2UX6A 1L6PA 1JTTA 2VXQA 5J1TC 4O00A 4JHWH 3GFUA 4OZIA 1T7VA 5F9AC 1P9MA 1UKQA 4I0PB 1WS7A 1J9RA 4NJ9H 4PLKD 3T2NL 3WSQL 5TH2B 3FL7A 2KH2B 4JK0D 4EE2A 4PTUA 4YDKL 3GRBA 4JM2C 4MAUL 3UTQB 4OVUA 1XDTT 1TIUA 3GWJA 3QIBD 3IU3B 4H8UA 3CHOA 2EUXA 3LVTA 1KN4L 3BH8B 5CKGA 4MDJA 1O6SB 1HCYA 3MLUH 4WVRA 3ZU8A 2ZUXA 4LSPL 1AZZC 1JXKA 3TYFB 2BC4A 4JDZA 4F57H 4W9GC 3BKJH 3WEAA 1HYSC 4JQVC 3QXVA 1BBDH 1A6VH 1EANA 1OF2A 4UDTA 3UAJD 2ARJA 3ZKNC 4QRRA 4Z77A 2ADYA 3MXWH 2F8XC 2NY5L 3NJHA 5KBPA 3IJ7A 1CD9B 2Q86B 3VMOA 2AANA 4Z7NF 3MV8E 4YGVA 4ZUUB 1VCBC 2IADB 2NUPB 1GJUA 3DROB 4PJXA 4LVOB 5FW8A 1ACYH 4K5LA 3SOBH 5DUBB 5DJDB 3V6FA 4KZEH 5T1KA 1P4UA 1XF1A 1CO1A 4AL8L 1WBXA 1DBBH 3GS4A 2JB6B 2CE6A 5EOTA 4PTTB 5A16A 1JV5A 2O61A 4KRNA 3IE4A 5DZLA 3WXWH 3C8KA 5JPMB 3LKQA 1LEKA 5T8IA 2W1NA 4HXBH 4GO8A 1BQSA 4PV9A 4YPJA 1ZT7B 3D7PA 4ZT1A 3SO3B 3TO2A 2HWZH 2Y7QB 3U25A 3ABLB 2NCEA 3E6HB 3HS8A 1HSAB 1JFHA 5E7BA 4HLEA 4UTAL 1J8HA 4N6RB 1FN4B 4BZ2H 3D3VD 5H35A 2XTLA 3ZSSA 2HVJA 2EIZA 3DLQR 3ZMNA 4N9GA 1E65A 1BZ7B 2JV6A 4OV6F 1NFAA 4NDMA 5IQ7L 3FQRB 2V2TA 5DYFA 5C0FB 4YAQB 1AQKH 1TJXA 2YEVB 4U7MA 2COQA 3QJQB 1AACA 4W9EC 4Q2ZA 4LASH 2FECL 5FHBH 1ZMYA 2BK8A 1KIQB 3SE4C 5JW5B 1IL1B 1E28A 3C6LD 3KBFA 1QAWA 2XQ0A 3V4PB 3B2PA 1WT5C 3UJJH 2WB1A 3QUYB 3RI5K 3QC6X 4CN6A 4G5AA 1IC4H 1HDMB 2E7HA 4R26H 1YEWA 4RQQB 5T3XL 4HV8A 3STBA 4BFEA 3S35H 4I88A 1N0XH 1NIDA 1YN6B 1Z9LA 3I75A 4WJKB 3RRQA 2YXMA 2K9FB 1OAJA 3RQ3A 4HU8A 1EFQA 4NRXB 2DQEL 1S7XA 1DTUA 5AZ2L 1L4IA 4FNSA 4YXHH 3PXLA 3IETB 1MRCL 4GQ9H 4RFEB 4UV4L 2IFFH 4A6YA 1E4XL 3AT0A 4C47A 2F54E 4JQVA 1GC1H 3DX8A 1GZQB 3ULUD 3TGXA 1KB9J 2F7RA 2CUAA 4P9MH 1CLCA 4IRZH 4G7YL 4G11A 5F1IA 1NC4D 1F58L 3PPEA 4LO9A 1ILSA 3FFCE 5E8NA 2IANE 1JG9A 1UGNA 2Z93A 1GZHC 3IDGB 1UQSB 3NIDF 5GGSY 4MAYB 3E80A 1A21A 4M7LH 5D4HA 4MASA 3NMEA 1FNEA 2HRGA 1VCAA 3O81A 3SQOH 1NCNA 1UWGL 3QJXA 4G8GA 3U7WH 2JKJA 2N3JA 4Z7WE 4FMVA 3VB9A 1Y07A 1G6RA 4B41A 1DQJA 1A7QH 1Q94A 4LVOC 3TBSB 3X1FA 4ES8A 2W65A 1KPUA 2RACA 1Q9LB 3GO1H 3P9MA 1AD0A 1L5GA 3FRUB 3WIIH 3IJHA 4JAMA 2W0PA 1WBZA 2HVBA 4U6XB 2R2HB 4TSBH 5I1AA 2DJMA 2GBVA 3X1NA 3UBFA 5AVTB 4QJ5B 1OE2A 4WTWA 5E8EA 2HKHH 3TBTB 2XFXB 3QHZH 5JPMC 1R33A 1QVOA 5H4YA 1ILUA 1CB4A 5CILH 3ZE1B 3SO3C 4MCNA 2V17H 2AJVH 3O0LA 1KBVA 1FL6B 1F8TH 1U92A 1WIUA 4PRIE 4HAKA 4BHUA 4DETA 3W9EA 4QXUL 4DO4A 5F9DC 4I77H 3SE4A 4JY6A 2VDOL 4WHYH 3VXUB 1D9KB 3G5VB 3CHRA 3RX8A 4NKQB 1SRDA 3MRDA 1P7QA 3IJSA 1WT5A 1GY2A 2YAQA 3L17A 3QDJB 3PWLB 5BZXA 4AH2A 1BVNT 1PKQB 3BMVA 2J8HA 3L3OA 2Q2EB 2YBGA 3L3GA 5CZRA 3RB5A 1U30A 4AENB 1XIWD 4ONGH 5HBBA 4FQ2H 1A5FH 1DQLL 3LZNA 3LNDA 4FTVE 4M6MH 1QSVA 2DKMA 4I0PA 1CURA 2JLPA 1MUJB 4A55A 2APSA 5SWSD 3QUYC 5TH2A 5T5NG 3RX5A 1NBCA 5JORB 4HZ1A 3ESUF 4P99A 3LH9A 1NKOA 3MHZA 2ZWSA 2OK0H 4WFFE 2GPZA 2ZYRA 1ETJA 3UTQA 3CZSA 3A6BH 4X4YB 1GCFA 2FYVA 3H6AA 3IU3A 5EIIB 3OF6A 3BH8A 4TULL 1O6SA 3QDAA 1YYML 1LQSR 2JQZA 3T4AB 1T66C 2DWDB 3TYFA 3NFPB 1MCNA 3UMTA 5CIPB 3EBIA 2K3HA 2VW6A 2AJSH 4MCZB 2VH5L 1GH7A 4WI3A 4D9QD 3UAAA 1KCVH 4ZS6C 1PS3A 3WFEL 4GJTB 3WFDH 1Z6JT 3CSBA 4UMGA 3BYTA 5F1KC 5HDBB 1RHHB 1WBYB 2CIKB 2OMXB 1HCFX 3F6LA 5AUMB 2J8UE 1E27B 3B9KC 3IAPA 4ZUUA 4HJSA 1JGEB 2IADA 1EZLA 2NUPA 3DROA 3BAJA 5BV7L 5B1AB 5DUBA 5DJDA 3OKOB 5C6WH 3DHUA 4MAYC 5J6HB 1FE8L 1TFPA 3FN3A 3US9A 1WRFA 2JB6A 2NLJB 5DJ6B 3KBPA 2YPVH 3F04A 5GGTL 5I18H 5DHYB 4PTTA 4X42A 3ARUA 3P9LB 2Y7LA 3SDXE 4ZBJA 1A02N 4RGOL 2NY6D 3V7AG 5JPMA 3C2AH 3IDMB 3POCA 3PY9A 3LH2L 3O0RH 3DYPA 1JXGA 3SPJA 4NZTL 1ZT7A 2LAAA 4EEEA 2Y7QA 3EO9H 2XY1A 3QQNA 5DJYB 4PJFB 1Z9PA 1ZJBA 5AAMC 3E6HA 4JG0L 4GAGL 5CINL 1B0WA 1HSAA 2DN7A 3SDCB 3VG9B 4N6RA 2L7QA 1FN4A 2HKAA 1GXEA 1OSPH 1RUPL 4LKCA 3VXSB 4KHTL 1EJOH 5E95B 1BZ7A 4XC3H 3RDTD 2J1KA 2TRHA 4JCMA 3FQRA 1MAKA 2PYED 4L1SA 2X0WA 3D25B 3HE7B 4AM0Q 5C0FA 4YAQA 4LEXL 3QK0A 1J9CT 4XOCA 4IHBA 2FB4L 4FZ8H 2IWEA 1KGYE 1KIQA 2QPFA 4J5VA 4XP4L 3MLZL 4R2GB 3I6SA 4Z7VF 5SX5K 1D9KC 1WG3A 5JW5A 2RCSH 2HKFH 5D7IB 1JFQH 1IL1A 5F7UA 1SVCP 3V4PA 2FD6H 2FT8A 3A4AA 4WW2B 4JFEB 1WO2A 1A4BA 2O5NA 2QEJA 2WZAA 3QUYA 4ICXA 4FFVD 4X7SL 4YHZH 4RQQA 1HDMA 4LAQL 4F7EB 5BMFH 1RIUL 3BQUD 2YMXH 1ZSHA 1YN6A 1ZXQA 5T5FH 5EF2A 2WLNA 4N0UE 3P0VH 4NRXA 1CL7H 2BVPB 2IOIA 4KX7A 3LY6A 1UM4L 1CE6B 5ECGA 3F83A 3CMOH 4M03A 3P2TA 3IETA 4RFEA 3DETC 1I3VA 1JUFB 2DBLL 3L3JB 5GZOC 1KOAA 2F7QA 3Q44A 1CS6A 5TE4L 1GZQA 4UMSA 4W1TA 1RZ7L 3QPQD 2JVUA 5J7CC 4HIXL 2NXYB 5KAQF 2ZXDA 5D4QA 5LXGL 3PUUA 2K1MA 2GJ6B 5KANG 1NCUA 1U2HA 1IGIH 1OHQA 4YBHA 3LDBB 3T4AC 2NZIA 3CFCL 4TL5A 2ESVB 3IDGA 4XODA 1UHVA 4JO4L 1UQSA 3LMJH 5I6MA 4MAYA 2VDLH 1HKLH 1K6QL 1RUML 5DHDA 1GGTA 2LFEA 3EJUA 4AY0A 3VB8A 3RL1A 1E2ZA 2Z35B 4KRMB 2FH8A 4M56A 2VAJA 1DSYA 1NM4A 3JV0A 4YUEH 5HI4C 1IZJA 4DK3A 4Z3EA 2IGTA 4QUOA 1NIAA 2FCBA 4C4BA