3ZMLA

Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
218
structure length
218
Chain Sequence
LVLYTLHLSPPCRAVELTAKALGLELEQKNINLLAGDHLTPEFMKLNPQHTIPVLDDDGTIITESHAIMIYLVTKYGKDDTLYPKDPVQQARVNAALHFESGVLFARMRFIFERILFYGKSDIPEDRIEYVQKSYRLLEDTLKDDFVAGSKMTIADFSCISTISSIMGVVPLEQSEHPRIYEWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE E2
publication title A Single Mutation in the Gste2 Gene Allows Tracking of Metabolically-Based Insecticide Resistance in a Major Malaria Vector.
pubmed doi rcsb
source organism Anopheles funestus
molecule tags Transferase
total genus 86
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3zmlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zmlA01
2C8UA 1O6JA 1OE8A 5D93A 4EO3A 4K2DA 2PGTA 4V1Ag 5ECRB 2BMXA 4ZL7A 3KIJA 4WETA 4MPGA 2H1AA 1BJXA 3GIXA 1XWAA 5JWOB 3FZ5A 6GSSA 4MP4A 1UN2A 5EPFA 2IMDA 4NV2A 1S3AA 4ECIA 1AW9A 4P3YB 1TTZA 2H1BA 2PN8A 1K0NA 3D5JA 5ECNB 3UJ1A 1SL0B 4ECBA 4YQVA 4QL9A 1E2YA 2VCZA 1THXA 4JRRA 4HS1A 1I5GA 2J23A 4FH8A 2DC5A 3EYTA 1U87A 2MBTA 3NOFA 4L5LA 1WIKA 4TR1B 5DALB 12GSA 4MK3A 1TXXA 5HR3A 4IVFA 2DJJA 2AV4A 5ECMB 5ECLB 5CRGA 5HFGA 4BVYB 4QL7A 2E7PA 1K3LA 4K9ZA 2EIRA 2R5GA 1GSDA 1T8EB 4ZBAA 4HUAA 1T4ZA 2LJRA 2F51A 3KEBA 1B9YC 3IDVA 2E2MA 1V2AA 2CV4A 1A23A 3DVXA 2AAWA 2WZ9A 1VF2A 2N5BA 16GSA 1VF4A 2F3MA 2B1LA 5DCHA 2AYTA 1PX6A 1BQ7A 2WB9A 1S3DA 1TI3A 4YAVA 4OD7A 4NMUA 1NHOA 4TW5A 1VF3A 3BCIA 3EMPA 2B5EA 3MWHA 4HU7A 4TR1A 5DALA 1UC7A 2H75A 2V1MA 4GXZA 1Y25A 1KEBA 2PVQA 1Z9HA 3CSIA 3DWVA 4HEA2 4K7OA 3PPUA 4HJMA 4BVYA 1AXDA 5G1LA 3G9BA 3D0ZA 2FY6A 2DMMA 3UOMA 1SYXA 1VGLA 1Z7PA 1GSEA 3F4SA 1X9SB 4IQ1A 2VUPA 3F3QA 3GX8A 4ZL9A 4POKA 2AHEA 2L5LA 2YNXA 5JCGA 2ES7A 3DVWA 4EDYA 3UAPA 4JE1A 3IR4A 3GN3A 3AY8A 3ZTLA 5F06A 4IBPA 1WPIA 5B8BA 3LXTA 5ECOB 1TK8B 3APOA 4ECJA 2L57A 2KUCA 3KP8A 5HFIA 3IAM2 4WF4A 4PNGA 4JR4A 2DJ3A 3EINA 4PNFA 4OFMA 3I69A 4N11A 1B4PA 2K8SA 1NM3A 4V2NA 1M9AA 2FWGA 5E59A 1SK0A 3F8UA 2CA8A 3J7Yb 1N2AA 4K0NA 1GWCA 2YPMA 5J4UA 3G7JA 13GSA 4IKHA 2HQTA 3ISOA 1TRUA 1Z3EA 3ED3A 4NWYA 2XPDA 3VURA 2GS3A 3GKKA 1SK1A 4LL1B 2PBJA 3IC4A 4N0VA 5IMDA 2GZYA 4J57E 3CYNA 3KCMA 5ECKB 1YDKA 3CRTA 4KH7A 4NHWA 2QC7A 4EUYA 2RIIA 2YN1A 4GWRA 4HZ4A 3P2AA 2C3TA 1TOFA 5H5QA 2VCXA 1XVQA 2VLTA 3KXOA 5CAXA 3D4MA 3CXGA 4HZ2A 2R37A 3C73A 5DQYA 4CDOA 3HCZA 3O3TA 5B8AA 4YQUA 4TN8A 1GLQA 4WKWA 4BA7A 1T00A 1TP9A 1JLWA 1K0CA 3BBYA 2FLSA 1JZRA 4G0KA 1OC8A 3P8WA 1OKTA 1WP0A 2YP6A 2B6MA 1U88A 4D73B 2HI7A 3ZL5A 3KMOA 3F6DA 3D21A 4YQMA 5IMVA 3APSA 1PL2A 3ERFA 5KEJA 4RI7A 1CQGA 3HKRA 5D9WA 5E4WA 1SJZA 4GSNA 2LRTA 4BWQA 3FZAA 5ECHB 3A2XA 1AIUA 2H6YA 4E8HA 3RHBA 3Q19A 3GV1A 3O76A 1SKRB 1U3IA 2X99A 5IO2A 4MZCA 3ZLPA 5D9VA 4X43A 4EL1A 2FA8A 4IQAA 3TOTA 2HFDA 5D96A 3DKSA 1SD8A 4GTUA 3QAWA 2X8GA 3KM6A 1U6TA 2ZNMA 4BPYA 1X5DA 2J9HA 4ML1A 1LBKA 1SL2B 5AIVA 3D6IA 3TJGA 10GSA 2P5QA 3FRCA 2N5FA 2X8HA 3FZ4A 3EE2A 4I2TA 3D4TA 4ULXA 1TW9A 4PUAA 4MCUA 5FHIA 3EWLA 2G0FA 1YZXA 3KMNA 2Z9SA 2AJQB 1WJKA 4D73A 4K7NA 3TCOA 4Q5NA 4ZB6A 1Z6NA 1ZGNA 1DBYA 3WD6A 5ECQB 2H30A 3ZIVA 1GL8A 4GSSA 1WMJA 2HRKA 2C3QA 5G5FA 2VAFA 1H4OA 3GFKA 3CTFA 1EWXA 4IS0A 3TJKA 2KHPA 1Q4JA 1Z6MA 5B6MA 1QQ2A 5LNKe 1TKDB 1XWKA 2DJ2A 5GAPD 4PQIA 2X64A 1A2LA 3GH6A 1IYHA 3EURA 2H73A 3IXRA 3PGTA 4Q5RA 3IE3A 3G7IA 3VI5A 3QCPA 1N8JA 3HVVA 4RUVA 1MD3A 2H0GA 3IV4A 4LLRA 3QAVA 1M2BA 2GSTA 2O89A 2ZCTA 4IJ3A 5G31A 4TOPA 2PMTA 3ZFLA 4KA0A 4KF9A 4POLA 4IW9A 3IK7A 4PQ1A 3M8NA 3FW2A 2IL3A 3UIWA 1FAAA 1ZMAA 3U5RE 3FK8A 3OR5A 4XTSA 1E6BA 2OBKA 5D73A 5FT3A 4K8MA 5B7CA 4ILFA 2IMIA 3CRUA 3IA1A 1FB0A 2DJ0A 4IGJA 4EC0A 4V1Ap 2VCWA 5F07A 1OAZA 1GSUA 3CTGA 4IN0A 3CSHA 3H93A 1VF1A 3CMIA 4ACSA 1O73A 3L9VA 4WR5A 1NSWA 5CREA 3RDWA 1TK0B 1YY7A 1UA5A 3C1SA 2O7KA 2CVDA 3FR6A 3O6TA 5GSTA 2AB6A 3BCKA 1A0RP 3P90A 5CRDA 1X0RA 1R7HA 4XS1A 1AAZA 1AQVA 3RHCA 4MF7A 2VL2C 2HNLA 3FHKA 2R3XA 3DMLA 2H19A 1X9MB 4KX4A 3UMAA 1BG5A 3GA4A 3KTBA 4FYBA 1TU8A 3TRXA 4TR3A 1JHBA 5A4WA 3HA9A 5BMUA 4IJIA 1ZYQB 2GQKA 3DYRA 2C80A 4J2FA 2B1KA 3BD2A 5D9XA 1KTEA 2H76A 1PSQA 1TRVA 3C71A 2CAQA 4GF0A 2HSHA 3LQ7A 4OMVA 2TRXA 2MMZA 1F37A 1XOAA 1XXUA 3F3RA 1A8YA 5AIXA 1PRXA 1GULA 2PVOC 2AUVA 1PGTA 1SYRA 2CVBA 3ERGA 4NV5A 1YKAA 1XWBA 2HSYA 5JCUA 3WYWA 2C0FA 2A2SA 2H8LA 1FO5A 2V32A 2DBCA 3J7Yk 3IRAA 4XS4B 4EDZA 2YV9A 4LL4B 1X5CA 3IOSA 2LJKA 5ELAA 3ZZXA 1PA3A 2PPTA 2WFCA 5CO3A 4PURA 3QPMA 4AGSA 6GSTA 3HHVA 2M72A 2CZ3A 2PUKC 3C8EA 2RM6A 5ELGA 1O7UA 3GH9A 4IP1A 1Q98A 8GSSA 1GH2A 3F4TA 4ZBBA 1QMVA 3GL5A 2HXKA 2IMKA 2L6CA 2LQOA 4G0LA 3F4RA 2FHEA 3M1GA 2NPBA 3TRQA 1FG4A 3VPQA 3VWXA 1K3YA 1JLVA 2RUFA 1WOUA 1SKWB 4O32A 4FQUA 4G9HA 3QOUA 2LRNA 2LSTA 2I4AA 3LG6A 4ZB8A 1XW5A 3GX0A 2I3YA 1XWGA 3UBKA 2FA4A 2WS2A 7GSSA 1EP7A 2GSRA 5DJLA 1MDKA 4TXVA 5HR0A 4KGIA 1M99A 18GSA 3GYKA 3JCML 1TI1A 1SENA 2HZEB 2YWMA 2FUG2 3L4NA 4ZL8A 3ZYWA 2WDUA 3IPZA 4HI7A 2LKUA 3H1NA 4POBA 5IOWA 4MJCA 1A2MA 4TR0A 2LUSA 2GSSA 1F3BA 5G5EA 3IK9A 2HE3A 2NDOA 4MA9A 2ON5A 4ZB9A 2TRCP 2HRAA 3H79A 2LNSA 1WRYA 2GT5A 1A24A 3TB2A 2V6KA 4HJ2A 1ZOFA 2VOCA 2VD1A 3UVTA 1M2DA 5J9CA 3CBUA 5IQYA 2PWJA 1XBSA 2L4QA 4ECCA 4KSMA 3ZIJA 1C72A 3E3EA 3ZMLA 4GRFA 1Z5YE 1F2EA 2YV7A 3VWVA 4K6XA 3TDGA 2RLIA 4KAEA 3F9UA 5EY6A 1AQXA 4WF5A 3HZ4A 3DXBA 3GNJA 2HZEA 4MH3A 3K8NA 4PGTA 3HD5A 2IWTA 2LEGA 1EGRA 4F0BA 1BYEA 3M0FA 2GDRA 3ERWA 5KN0A 3S9FA 1AC1A 1AQWA 2DJ1A 4K7IA 3RPNA 5GZZB 3A2VA 1Z7RA 1FB6A 1V98A 5EVOA 3E9JB 4MF6A 3WT1A 3F63A 3M3MA 4F0CA 3HJPA 2O85A 2X8CA 3ZVJA 1T7PB 5KN2A 2V2GA 3QD9A 1USBA 3C1RA 1PX7A 3CSJA 5F05A 4AF2A 2JACA 6GSYA 4X1UA 3MDKA 2UZ8A 2E0QA 5INYA 1U3AA 1V9WA 4G10A 3W6GA 2YWOA 1I9DA 4MZWA 1G6WA 3FEUA 2GGTA 3FYGA 3LJRA 2VL2A 2LS5A 1XIYA 3NIVA 5B6NA 1M9BA 3IBHA 5ECPB 1GTBA 1GUKA 5GSSA 2NVLA 2C4JA 2WULA 2H1GA 2LV3A 3GTUB 2P31A 1PKWA 2H6XA 2OKAA 5GAND 3TUEA 3WT2A 1LJRA 4MJAA 4H86A 1PMTA 3TJBA 3LFLA 5LD0A 3VPTA 4I2UA 2KOKA 5A4VA 1RW1A 5HR2A 4XRAA 3KTLA 3UEMA 4RQRA 4EVMA 4N30A 2DLXA 4ZXGA 3HVSA 1K0OA 4MDCA 4KCEA 3GKXA 4JR6A 5CRHA 5IMAA 2EIOA 2I1UA 3QFBC 3I9V2 4PXOA 4BL7B 2F8FA 4OWYA 3N9JA 1FVKA 1M7TA 1ERVA 2YOIA 1SL1B 1HQOA 4DSQA 2OADA 3I6AA 1QXHA 5JWRB 1G7EA 4ZILA 2DIYA 1KNGA 2P0GA 1TK5B 1GSFA 1G7OA 1XCCA 4PQHA 4KDUA 2HYXA 3GTUA 6GSXA 1NHYA 1EEJA 5IMCA 2WGRA 3HYPA 3ZVJD 1ZYEA 1BX9A 4I6XA 1EV9A 1DE2A 5COHA 3QMXA 2LRCA 1TRSA 2H1DA 3A2WA 3TKSC 3HJMA 2GQMA 3GMFA 4JBBA 4GLTA 4YAPA 3KJYA 4MABA 2EIQA 2EC4A 2VL9A 3FZ9A 6GSUA 2OACA 4WR4A 2H74A 1UVZA 2OE3A 1GTAA 3IC8A 3MAKA 4POMA 2JADA 2HLSA 4EE0A 2PERA 3LSZA 3A5WA 1XW6A 3LYPA 4MH2A 3KD0A 3KP9A 1VRSD 4BL7A 5C00A 2V41A 4F03A 5G1KA 1PQNA 3LWAA 5J9BA 4PTSA 4HU9A 5ID2B 5J3RA 3A3TA 3Q18A 1B8XA 3GL3A 1EOHA 3Q6OA 4KW6A 1G0TA 5IPHA 1ZL9A 4AJ6A 3I43A 3QDNA 3BJ5A 3V1WA 2FD3A 5J5NA 1T1VA 5H5RA 3MNGA 1FHEA 3WGEA 2BTOT 1XW9A 2FGXA 1A8LA 1JZOA 1OE7A 2I81A 2R4VA 5IPGA 3UARA 3EVIA 2L59A 1LU4A 1SK2A 1HNBA 4L0WA 1GLPA 5D8IA 1GUMA 2VIMA 1GSYA 4I8BA 2XBIA 2TIRA 1XWCA 3TRPA 4F9ZA 3DGQA 4XS6A 1V58A 2O8VB 3RPPA 1AUCA 3HZ8A 5ID2A 4CW9A 4NXIA 4EF0A 1FOVA 2XPEA 1JZWA 2CX3A 2L5OA 1XZOA 3UVHA 2VLVA 3MSZA 3L78A 1PKZA 4ID0A 1HYUA 4OCFA 1TRWA 2GTUA 5JWQB 3LXZA 2MBSA 4TKYA 2H71A 1A2JA 3Q74A 2JZSA 3LEFA 1SJ6A 1J0FA 2HZFA 2M80A 3RAZA 1EZKA 2F8AA 2B7JA 2YWIA 1ILOA 4TXOB 4YH2A 2REMA 5CRWA 4WBJA 4QQ7A 2RM5A 2WJUA 1EP8A 2K6VA 1SJIA 4IHUA 2JZRA 3NZNA 1B9XC 4EKZA 3F6FA 2E2GA 4NAXA 5ENUA 1XPVA 4MMMA 4L8EA 1G6YA 3KGKA 5FWGA 4XIHA 11GSA 5IMZA 1B4QA 2GLRA 1W4VA 3GKMA 3N5OA 2YJHA 4FYCA 5H5SA 4RQXA 2FWFA 4L5OA 2YCDA 5KN1A 1R26A 3FR3A 3H4KA 3IHQA 5IO0A 4WBRD 4XCSA 5DVBA 4HDEA 3M9KA 1SKSB 3F0IA 2VCTA 3QR6A 2MMAA 2RUEA 1OC3A 2IN3A 1EGOA 1EOGA 3TKSE 2CQ9A 1OVNA 2C1YA 4I97A 2OE0A 2FNOA 1X5EA 3GHAA 1F9MA 1K0AA 3L9SA 3VWUA 1JZDA 4Q5FA 2YANA 1SU9A 3EU4A 4XHMA 1GP1A 1ZCPA 1ERTA 3G7YA 3TKPA 5L71A 4TXOA 4KUNA 2JSYA 1K0MA 4OO4A 2LJAA 4V2MA 3FR9A 2VM1A 5A4UA 2GZZA 2H6ZA 1JFUA 1M0UA 2L6DA 2XHFA 4WEYA 20GSA 2LTKA 1R5PA 3EC3A 4O92A 3LGCA 4G19A 1YEXA 2IFQB 5DDLA 4XS4A 3VFIA 5J41A 1MDJA 3QAGA 2IIYA 1WE0A 3ZREA 4KNDA 4X0XA 2HRFA 1K3OA 4HOJA 2H72A 2V6OA 4JZQA 3P7XA 2HRNA 1K0BA 2H0HA 5IIZA 3TKSA 5DJMA 2GVPA 1YJ6A 3WGXA 4F82A 1HNAA 5AN1A 4HQZA 1S3CA 1ABAA 1GNEA 2VLUA 1ON4A 3R2QA 1O85A 2JSZA 3LYKA 3HDCA 3DRNA 1TU7A 5D9TA 4TRXA 3UBLA 4AJ8A 3HY2A 2DIZA 1V40A 4BVXB 1ERWA 1GRXA 2C3NA 3WGDA 4I5QA 3ME7A 4JU5A 3E0UA 19GSA 5ECIB 1ML6A 3KZQA 3HJOA 4L0UA 1ACVA 4MZBA 4KE3A 2F9SA 4G0IA 2ZUPA 4KDYA 1R4WA 1FVJA 2IFQA 3VLNA 2M46A 6GSVA 3R3EA 4O7HA 1MEKA 3GUSA 2C0DA 4MF5A 3SBCA 4Q5QA 1SD9A 4USSA 2MMNA 3GSTA 1Y6EA 4LA1A 1RQMA 2CVKA 1DUGA 3VWWA 4HQSA 3EMXA 3DEXA 5G30A 1IYIA 1M2AA 2KP1A 1QGVA 3QFAC 1OYJA 3PINA 1URMA 2IPAA 3PR8A 1HNCA 4BVXA 4F2IA 1PD21 3VI7A 1T4YA 5DBQA 2YZUA 1O81A 4J56E 2H01A 4XRDA 2C0EA 3TKRA 4MJEA 2HSMB 4BWSA 4Z7XA 3IAS2 1XFLA 3GSSA 1QK8A 3VK9A 2H70A 2WCIA 3GKNA 2OE1A 1F3AA 2WRTA 2JL4A 2VO4A 5A5KA 2QGVA 4ZBDA 4OFTA 3SWLA 4G2EA 2N5AA 3BOAA 3FY7A 4GCIA 5HFKA 1F6MC 1FW1A 1GUHA 2MMOA 4N10A 1MTCA 2FWEA 1K0DA 1HD2A 5IMFA 1OC9B 4IELA 2CZ2A 4GSTA 2D2ZA 4DEJA 2OJLA 2FCHA 2A4VA 2DJKA 3TKQA 1J08A 4O5RA 4OO5A 1R5AA 5DCGA 2G2QA 4MJBA 5KN3A 5ABRA 1V57A 2H66A 1YEPA 4KSOA 2K8VA 2QKEA 3HVXA 1THOA 1MDIA 4LMVA 2LNTA 1DSBA 5DQSA 1BEDA 2GZPA 1GTUA 1B48A 1GSQA 1KBNA 4NPBA 1OKDA 2VM2A 2HRKB 4K0GA 2HSMA 1YF1A 2OBIA 4DSSB 4V2LA 1ZZYA 3U6VA 5ECSA 2ON7A 14GSA 9GSSA 4EXJA 1ST9A 2KLXA 1A0FA 2P5RA 2B5YA 3C7MA 5DAKB 3DD3A 4NHZA 4K1FA 4TR4A 4OCEA 2OA7A 3ZMKA 5IM9A 1YF0A 2LQQA 2GSQA 1ERUA 2BJXA 2DMLA 2IJYA 3PH9A 2C0GA 1PN9A 4E8EA 2ALBA 1BAYA 3ME8A 4GQFA 1OC9A 2VD0A 2B5XA 3H8QA 4N0ZA 1XOBA 3EU3A 2CX4A 2JZTA 1O8XA 1X9WB 3TJJA 2NBSA 3ZITA 5AISA 4IP6A 2K9FA 2DSAA 2PU9C 3US3A 1CQHA 2VL3A 1O8WA 3KH7A 5EL8A 1EV4A 2HT9A 6GSWA 3W8JA 2L4CA 4JEDA 1YQ1A 2K18A 2B7KA 1GNWA 1GTIA 3LORA 4DSSA 3HXSA 4KCAA 1TDIA 2XBQA 4FIWA 5F0GA 2B3SA 4FO5A 4PUFC 2YJ7A 5F8BA 3FKFA 1TJDA 3L0HA 3RBTA 5DAKA 1H75A 5G2ZA 4CHSA 4ML6A 2HSNB 4TVEA 2R2JA 2GT6A 2YWNA 4LMWA 4DSRA 2I9HA 2IMFA 5CYYA 1XVWA 3TGZA 2IMEA 3TJFA 3GURA 2H0IA 2GQLA 4OFNA 2O87A 5C04A 2CT6A 4AJ7A 1NW2A 4FYUA 1YKCA 3GRXA 3D22A 2XC2A 3KH9A 3W8SA 2VCVA 5LCZA 1RK4A 1QUWA 3TOUA 1DE1A 5HR1A 1MD4A 2MZCA 17GSA 2A2RA 3UL3A 1GSSA 4RI6A 4DVCA 4KDXA 4MPFA 2QSIA 1T3BA 2CAIA 2MYGA 1WWJA 4ZIJA 1J9BA 1W89A 22GSA 1EEMA 3DIEA 4ISDA 2NTOA 5CNWA 2R6KA 2JU5A 2VCQA 4KB3A 5CP1A 1QFNA 3APQA 2FWHA 3ZFBA 4WXTA 2KP2A 5AGYA 5HQPA 3M9JA 4PX1A 4GQCA 5IOXA 3L9UA 2YZHA 3ZRDA 1PL1A 5JCWA 4MLYA
chains in the Genus database with same CATH superfamily
2C8UA 1O6JA 1OE8A 5D93A 4EO3A 4K2DA 2PGTA 4V1Ag 5ECRB 2BMXA 4AKGA 4ZL7A 3KIJA 4WETA 4MPGA 2H1AA 1BJXA 3GIXA 1XWAA 5JWOB 3FZ5A 6GSSA 4MP4A 1UN2A 5EPFA 2IMDA 4NV2A 1S3AA 4ECIA 1AW9A 4P3YB 1TTZA 2H1BA 1PFOA 2PN8A 1K0NA 3D5JA 5ECNB 3UJ1A 2H1LA 1SL0B 4ECBA 4YQVA 4QL9A 1E2YA 2VCZA 1THXA 4JRRA 4HS1A 1I5GA 2J23A 4FH8A 2DC5A 3EYTA 1U87A 2MBTA 3NOFA 4L5LA 1WIKA 4TR1B 5DALB 12GSA 1M3JA 4MK3A 1TXXA 5HR3A 4IVFA 2DJJA 2AV4A 5ECMB 5ECLB 5CRGA 5HFGA 4BVYB 4QL7A 2E7PA 1K3LA 5A34A 4K9ZA 2EIRA 2R5GA 1GSDA 4ICYA 1T8EB 4ZBAA 3MYDA 4HUAA 1T4ZA 2LJRA 2F51A 3KEBA 1B9YC 3IDVA 2E2MA 1V2AA 2CV4A 1A23A 3DVXA 2AAWA 2WZ9A 1VF2A 2N5BA 16GSA 1VF4A 2WVZA 2F3MA 2B1LA 5DCHA 2AYTA 1PX6A 1BQ7A 4Z2TA 2WB9A 1S3DA 1TI3A 4YAVA 4OD7A 4NMUA 1NHOA 4TW5A 1VF3A 3BCIA 3EMPA 2B5EA 3MWHA 4HU7A 4TR1A 5DALA 1UC7A 2V1MA 2H75A 4GXZA 1Y25A 1KEBA 1XG8A 2PVQA 1Z9HA 2R0GA 3CSIA 3DWVA 2WW1A 4HEA2 4K7OA 3PPUA 4HJMA 4BVYA 1AXDA 5G1LA 3G9BA 3D0ZA 2FY6A 2DMMA 3UOMA 2O5VA 1SYXA 1VGLA 1Z7PA 1GSEA 3F4SA 1X9SB 4IQ1A 2VUPA 3F3QA 3GX8A 4ZL9A 4POKA 2AHEA 2L5LA 2YNXA 5JCGA 2ES7A 3DVWA 4EDYA 3UAPA 4JE1A 3IR4A 3GN3A 3AY8A 3ZTLA 5F06A 4IBPA 1WPIA 1ZYNA 5B8BA 3LXTA 5ECOB 1TK8B 3APOA 4ECJA 2L57A 2KUCA 3KP8A 5J40A 5HFIA 3IAM2 4WF4A 4PNGA 4JR4A 2DJ3A 3EINA 4PNFA 4OFMA 3I69A 4N11A 1B4PA 2K8SA 1NM3A 4V2NA 1M9AA 2FWGA 5E59A 1SK0A 3F8UA 2CA8A 3J7Yb 1N2AA 4K0NA 1GWCA 2YPMA 5J4UA 3G7JA 13GSA 2WW0A 4IKHA 4HSCX 2HQTA 3ISOA 1TRUA 1Z3EA 3ED3A 4NWYA 2XPDA 3VURA 2GS3A 3GKKA 1SK1A 4LL1B 2PBJA 3IC4A 4N0VA 5IMDA 2GZYA 4J57E 3CYNA 3KCMA 5ECKB 1YDKA 3CRTA 4KH7A 4NHWA 2QC7A 4EUYA 2RIIA 2YN1A 4GWRA 4HZ4A 3P2AA 2C3TA 1TOFA 5H5QA 2VCXA 1XVQA 2VLTA 3KXOA 5CAXA 3D4MA 3CXGA 4HZ2A 2R37A 3C73A 5DQYA 4CDOA 3HCZA 3O3TA 5B8AA 4YQUA 4TN8A 1GLQA 4WKWA 4BA7A 1T00A 1TP9A 1JLWA 1K0CA 3BBYA 2FLSA 1JZRA 3LW9A 4G0KA 1OC8A 3P8WA 1OKTA 1WP0A 2YP6A 2B6MA 1U88A 4D73B 2HI7A 3ZL5A 3KMOA 3F6DA 4PI2C 3D21A 4YQMA 4AKHA 5IMVA 3APSA 3MIXA 1PL2A 3ERFA 5KEJA 4RI7A 1CQGA 3HKRA 5D9WA 5E4WA 1SJZA 4GSNA 2LRTA 4BWQA 3FZAA 5ECHB 3A2XA 1AIUA 2H6YA 4E8HA 3RHBA 3Q19A 3GV1A 3O76A 1SKRB 4E68A 1U3IA 2X99A 5IO2A 4MZCA 3ZLPA 5D9VA 4X43A 4EL1A 2FA8A 4IQAA 3TOTA 2HFDA 5D96A 3DKSA 1SD8A 4GTUA 3QAWA 2X8GA 3KM6A 4O5QA 1U6TA 2ZNMA 1YEWC 4BPYA 1X5DA 2J9HA 4ML1A 1LBKA 1SL2B 5AIVA 3D6IA 3TJGA 10GSA 2P5QA 3FRCA 2N5FA 2X8HA 3FZ4A 3EE2A 4N3ZA 4I2TA 3D4TA 4ULXA 1TW9A 4PUAA 4MCUA 5FHIA 3EWLA 2G0FA 1YZXA 3KMNA 2Z9SA 2AJQB 1WJKA 4D73A 4K7NA 3TCOA 4Q5NA 4QMKA 2O36A 4ZB6A 1Z6NA 1ZGNA 1DBYA 3WD6A 5ECQB 2H30A 3ZIVA 1GL8A 4GSSA 1WMJA 2HRKA 2C3QA 5G5FA 2VAFA 1H4OA 3GFKA 3CTFA 1EWXA 4IS0A 3TJKA 2KHPA 1Q4JA 1Z6MA 5B6MA 1QQ2A 5LNKe 1TKDB 1XWKA 2DJ2A 5GAPD 2VKZG 4PQIA 2X64A 2WW2A 4AKIA 1A2LA 3GH6A 1IYHA 3EURA 2H73A 3IXRA 3PGTA 4Q5RA 3IE3A 3G7IA 3VI5A 3QCPA 1N8JA 3HVVA 4RUVA 1MD3A 2H0GA 3IV4A 4LLRA 3QAVA 1M2BA 2GSTA 2O89A 2ZCTA 4IJ3A 5G31A 4TOPA 2PMTA 3ZFLA 4KA0A 4KF9A 4POLA 4IW9A 3IK7A 4PQ1A 3M8NA 3FW2A 2IL3A 3UIWA 1FAAA 4O5UA 1ZMAA 3U5RE 3FK8A 4GDFA 3OR5A 4XTSA 1E6BA 2OBKA 5D73A 5FT3A 5BMUB 4K8MA 5B7CA 4ILFA 2IMIA 4CY8A 3FMWA 3CRUA 3IA1A 1FB0A 2DJ0A 4IGJA 4EC0A 4V1Ap 2VCWA 5F07A 1OAZA 1GSUA 3CTGA 4IN0A 3CSHA 3H93A 1VF1A 3CMIA 4ACSA 1O73A 3L9VA 4WR5A 1NSWA 5CREA 3RDWA 1TK0B 1YY7A 1UA5A 3C1SA 2O7KA 2CVDA 3FR6A 3O6TA 5GSTA 2AB6A 3BCKA 1A0RP 1YVLA 3P90A 5CRDA 1X0RA 1R7HA 4XS1A 1AAZA 1AQVA 3RHCA 4PI0C 4MF7A 2VL2C 2HNLA 3FHKA 2R3XA 3DMLA 2H19A 1X9MB 4KX4A 3UMAA 1BG5A 3GA4A 3KTBA 4FYBA 1TU8A 3TRXA 4TR3A 1JHBA 5A4WA 3HA9A 5BMUA 4IJIA 1ZYQB 2GQKA 3DYRA 2C80A 4J2FA 2B1KA 3BD2A 5D9XA 1KTEA 2H76A 1PSQA 1TRVA 3C71A 2CAQA 4GF0A 2HSHA 3LQ7A 4OMVA 2TRXA 2MMZA 1F37A 1XOAA 1XXUA 3F3RA 1A8YA 5AIXA 1PRXA 1GULA 2PVOC 2AUVA 1PGTA 1SYRA 2CVBA 3ERGA 4NV5A 1YKAA 1XWBA 2HSYA 5JCUA 3WYWA 2C0FA 2A2SA 2H8LA 1FO5A 2V32A 2DBCA 1I1IP 3J7Yk 3IRAA 4XS4B 4CY6A 4EDZA 2YV9A 4LL4B 1X5CA 3IOSA 2LJKA 5ELAA 3ZZXA 1PA3A 2PPTA 2WFCA 5CO3A 4PURA 3QPMA 4AGSA 6GSTA 3HHVA 2M72A 2CZ3A 2PUKC 3C8EA 2RM6A 5ELGA 1O7UA 3GH9A 4IP1A 1Q98A 8GSSA 1GH2A 3F4TA 4ZBBA 1BG1A 1QMVA 3GL5A 2HXKA 3CQFA 2IMKA 2L6CA 2LQOA 4G0LA 3F4RA 2FHEA 3M1GA 2NPBA 3TRQA 1FG4A 3RFRC 3VPQA 3VWXA 1K3YA 1JLVA 2RUFA 1WOUA 1SKWB 4O32A 2EFCA 4FQUA 4G9HA 3QOUA 2LRNA 2LSTA 2I4AA 3LG6A 4ZB8A 1XW5A 3GX0A 2I3YA 1XWGA 3UBKA 2FA4A 2WS2A 7GSSA 1EP7A 2GSRA 5DJLA 1MDKA 4TXVA 5HR0A 4KGIA 1M99A 18GSA 4MNNA 3GYKA 3JCML 1TI1A 1SENA 2HZEB 2YWMA 2FUG2 3L4NA 4ZL8A 3ZYWA 2WDUA 3IPZA 4HI7A 2LKUA 3H1NA 4POBA 5IOWA 4MJCA 1A2MA 4TR0A 2LUSA 3IHGA 2GSSA 1F3BA 5G5EA 3IK9A 2HE3A 2NDOA 4MA9A 2ON5A 4ZB9A 2TRCP 2HRAA 3H79A 2LNSA 1WRYA 2X49A 2GT5A 1A24A 3TB2A 2V6KA 5KOXA 4HJ2A 1ZOFA 2VOCA 2VD1A 3UVTA 1M2DA 5J9CA 3CBUA 5IQYA 2PWJA 1XBSA 2L4QA 4ECCA 4EIPA 4KSMA 3ZIJA 1C72A 3E3EA 3ZMLA 4GRFA 1Z5YE 1F2EA 2YV7A 3VWVA 4K6XA 3TDGA 2RLIA 4KAEA 3F9UA 5EY6A 1AQXA 4WF5A 3HZ4A 3DXBA 3GNJA 2HZEA 4MH3A 3K8NA 4PGTA 3HD5A 2IWTA 2LEGA 1EGRA 4F0BA 1BYEA 1TXUA 3M0FA 2GDRA 3ERWA 5KN0A 3S9FA 1AC1A 1AQWA 2DJ1A 4K7IA 3RPNA 5GZZB 3A2VA 1Z7RA 1FB6A 1V98A 5EVOA 3E9JB 4MF6A 3WT1A 3F63A 3M3MA 4F0CA 3HJPA 2O85A 2X8CA 2QA1A 3ZVJA 5KN2A 1T7PB 2V2GA 3QD9A 1USBA 3C1RA 1PX7A 2EFHA 3CSJA 5F05A 4AF2A 2JACA 6GSYA 4X1UA 3MDKA 2UZ8A 2E0QA 5INYA 1U3AA 1V9WA 4K5SA 4G10A 3W6GA 2YWOA 1I9DA 4MZWA 1ZYPA 1G6WA 3FEUA 2GGTA 3FYGA 3LJRA 4Z2RA 2VL2A 2LS5A 1XIYA 3NIVA 5B6NA 1M9BA 3IBHA 5ECPB 1GTBA 1GUKA 5GSSA 4G01A 2NVLA 2C4JA 2WULA 2H1GA 2LV3A 1SVMA 3GTUB 2P31A 1PKWA 2H6XA 2OKAA 5GAND 3TUEA 3WT2A 1LJRA 4MJAA 4H86A 1PMTA 3TJBA 3LFLA 5LD0A 3VPTA 1BF5A 4I2UA 2KOKA 5A4VA 1RW1A 5HR2A 4XRAA 3KTLA 3UEMA 1SVLA 4RQRA 4EVMA 5J4YA 4N30A 2QA2A 2DLXA 4ZXGA 3HVSA 1K0OA 4MDCA 4KCEA 2WVXB 3GKXA 4JR6A 5CRHA 5IMAA 2EIOA 2I1UA 3QFBC 3I9V2 4PXOA 4BL7B 2F8FA 4OWYA 3N9JA 1FVKA 1M7TA 1ERVA 2YOIA 1SL1B 1HQOA 4DSQA 2OADA 3I6AA 1QXHA 5JWRB 1G7EA 4ZILA 2DIYA 1KNGA 2P0GA 1TK5B 1GSFA 1G7OA 1XCCA 4PQHA 4KDUA 2HYXA 3GTUA 6GSXA 1NHYA 1EEJA 5IMCA 2WGRA 3HYPA 3ZVJD 1ZYEA 1BX9A 4I6XA 1EV9A 1DE2A 5COHA 3QMXA 2LRCA 1TRSA 2H1DA 3A2WA 3TKSC 3HJMA 2GQMA 3GMFA 4JBBA 4GLTA 4YAPA 3A5IA 3KJYA 4MABA 2EIQA 2EC4A 2VL9A 3FZ9A 6GSUA 2OACA 2R0CA 4WR4A 2H74A 1UVZA 2OE3A 1GTAA 3IC8A 3MAKA 2WVXA 4POMA 2JADA 2HLSA 4EE0A 2PERA 3LSZA 3A5WA 1XW6A 3LYPA 4MH2A 3KD0A 3KP9A 1VRSD 4BL7A 5C00A 4W66A 2V41A 4F03A 5G1KA 1PQNA 3LWAA 5J9BA 4PTSA 4PHZC 4HU9A 5ID2B 3A3TA 5J3RA 3Q18A 1B8XA 3GL3A 1EOHA 3Q6OA 4KW6A 1G0TA 5IPHA 1ZL9A 4AJ6A 3I43A 3QDNA 3BJ5A 3V1WA 1N25A 2FD3A 5J5NA 1T1VA 5H5RA 4BIKA 3MNGA 1FHEA 3WGEA 2BTOT 1XW9A 2OT3A 2FGXA 1A8LA 1JZOA 2O3EA 1OE7A 2I81A 2R4VA 5IPGA 3UARA 3EVIA 2L59A 1LU4A 1SK2A 1HNBA 1M3IA 4L0WA 1GLPA 5BRTA 5D8IA 1GUMA 2VIMA 1GSYA 4I8BA 2XBIA 2TIRA 1XWCA 3TRPA 4F9ZA 3DGQA 4XS6A 3CHXC 1V58A 2O8VB 3RPPA 3HMJG 1AUCA 3HZ8A 5ID2A 4CW9A 4NXIA 1SVOA 4EF0A 1FOVA 2XPEA 1JZWA 2CX3A 2L5OA 1XZOA 3UVHA 2VLVA 3MSZA 3L78A 1PKZA 4ID0A 1HYUA 4OCFA 1TRWA 2GTUA 5JWQB 3LXZA 2MBSA 4TKYA 2H71A 1A2JA 3Q74A 2JZSA 3LEFA 1SJ6A 1J0FA 2HZFA 2M80A 3RAZA 1EZKA 2F8AA 2B7JA 2YWIA 1ILOA 4TXOB 4YH2A 2REMA 5CRWA 4WBJA 4QQ7A 2RM5A 2WJUA 1EP8A 2K6VA 1SJIA 4IHUA 2JZRA 3NZNA 4Z2UA 1B9XC 4EKZA 3F6FA 2E2GA 4NAXA 5ENUA 1XPVA 4MMMA 4L8EA 1G6YA 3KGKA 5FWGA 4XIHA 11GSA 5IMZA 1B4QA 2GLRA 1W4VA 3GKMA 3N5OA 2YJHA 4FYCA 5H5SA 4RQXA 2FWFA 4L5OA 2YCDA 5KN1A 1R26A 3FR3A 3H4KA 3IHQA 5IO0A 4WBRD 4XCSA 5DVBA 4HDEA 4K2XA 3M9KA 1SKSB 3F0IA 2VCTA 3QR6A 2MMAA 2WZSA 2RUEA 1OC3A 2IN3A 1EGOA 4AKXB 1EOGA 3TKSE 2CQ9A 1OVNA 2C1YA 4I97A 2OE0A 2FNOA 1X5EA 3GHAA 1F9MA 1K0AA 3L9SA 3VWUA 1JZDA 4Q5FA 2YANA 1SU9A 3EU4A 4XHMA 1GP1A 1ZCPA 2UV8G 1ERTA 3G7YA 3TKPA 5L71A 4TXOA 4KUNA 2JSYA 1K0MA 4OO4A 2LJAA 4V2MA 1PN0A 3FR9A 2VM1A 5A4UA 2GZZA 2H6ZA 1JFUA 1M0UA 2L6DA 2XHFA 4WEYA 20GSA 2LTKA 1R5PA 3EC3A 4O92A 5J4VA 3LGCA 4G19A 1YEXA 2IFQB 5DDLA 4XS4A 3VFIA 5J41A 1MDJA 3QAGA 2IIYA 1WE0A 3ZREA 4KNDA 4X0XA 2HRFA 1K3OA 4HOJA 2H72A 2V6OA 4JZQA 3P7XA 2HRNA 1K0BA 2H0HA 5IIZA 3TKSA 5DJMA 2GVPA 1YJ6A 3WGXA 4F82A 1HNAA 5AN1A 4HQZA 1S3CA 1ABAA 1GNEA 1S3RA 1ON4A 3R2QA 2VLUA 1O85A 2JSZA 3LYKA 3HDCA 3DRNA 1TU7A 5D9TA 4TRXA 3UBLA 4AJ8A 4ZB7A 3HY2A 2DIZA 1V40A 4BVXB 4YKGA 1ERWA 1GRXA 2C3NA 3WGDA 4I5QA 3ME7A 4JU5A 3E0UA 19GSA 5ECIB 1ML6A 3KZQA 3HJOA 4L0UA 1ACVA 4MZBA 4KE3A 2F9SA 4G0IA 2ZUPA 4KDYA 1R4WA 1FVJA 2IFQA 4YKFA 3VLNA 2M46A 6GSVA 3R3EA 4O7HA 1MEKA 3GUSA 2C0DA 4MF5A 3SBCA 4Q5QA 1SD9A 4USSA 2MMNA 3GSTA 1Y6EA 4LA1A 1RQMA 2CVKA 3EPTA 1DUGA 3VWWA 4HQSA 3CWGA 3EMXA 3DEXA 5G30A 1Y1UA 1IYIA 1M2AA 2DKIA 2KP1A 1QGVA 3QFAC 1OYJA 3PINA 1URMA 2IPAA 3PR8A 1HNCA 3HVNA 4BVXA 4F2IA 1PD21 3VI7A 1T4YA 5DBQA 2YZUA 1O81A 4J56E 2H01A 2EFEA 4XRDA 2C0EA 3TKRA 5KOWA 4MJEA 2HSMB 4BWSA 2WW3A 4Z7XA 3IAS2 1XFLA 3GSSA 1QK8A 3VK9A 2H70A 2WCIA 3GKNA 2OE1A 1F3AA 2WRTA 2JL4A 2VO4A 5A5KA 2QGVA 4ZBDA 2DKHA 4OFTA 3SWLA 4FXYP 4G2EA 2N5AA 3BOAA 3FY7A 4GCIA 5HFKA 1F6MC 1FW1A 1GUHA 2MMOA 4N10A 1MTCA 2FWEA 1K0DA 1HD2A 5IMFA 1OC9B 4IELA 2CZ2A 4GSTA 3RGBC 2D2ZA 4DEJA 2OJLA 2FCHA 2A4VA 2DJKA 3TKQA 1J08A 4O5RA 4OO5A 1R5AA 5DCGA 2G2QA 4AI6A 4MJBA 5KN3A 5ABRA 1V57A 2H66A 1YEPA 4KSOA 2K8VA 3HVXA 2QKEA 1THOA 1MDIA 4LMVA 4A5PA 2LNTA 1DSBA 5DQSA 1BEDA 2GZPA 1GTUA 1B48A 1GSQA 1KBNA 4NPBA 1OKDA 2VM2A 2HRKB 4K0GA 2HSMA 1YF1A 2OBIA 4DSSB 4V2LA 1ZZYA 3U6VA 5ECSA 2ON7A 14GSA 9GSSA 4EXJA 1ST9A 2KLXA 1A0FA 2P5RA 2X4AA 2B5YA 3C7MA 5DAKB 3DD3A 4NHZA 4K1FA 5A1NB 4TR4A 4OCEA 2OA7A 3ZMKA 5IM9A 1YF0A 2LQQA 2GSQA 1ERUA 2BJXA 2DMLA 2IJYA 3PH9A 2C0GA 1PN9A 4E8EA 5A5HB 2ALBA 1BAYA 3ME8A 4GQFA 1OC9A 2VD0A 2B5XA 3H8QA 4N0ZA 1XOBA 3EU3A 2CX4A 2JZTA 1O8XA 1X9WB 3TJJA 2NBSA 3ZITA 5AISA 4IP6A 2K9FA 2DSAA 2PU9C 3US3A 1CQHA 2VL3A 1O8WA 3KH7A 5EL8A 1EV4A 2HT9A 6GSWA 3W8JA 2L4CA 4JEDA 1YQ1A 2K18A 2EFDA 2B7KA 1GNWA 2A4HA 4X4JA 1GTIA 3LORA 5J47A 4DSSA 3HXSA 4KCAA 1TDIA 2XBQA 4K5RA 4FIWA 5F0GA 2B3SA 4FO5A 4PUFC 2YJ7A 5F8BA 3FKFA 1TJDA 3L0HA 3RBTA 3TU3B 5DAKA 1H75A 5G2ZA 4CHSA 4ML6A 5A1NA 2HSNB 1FOHA 4TVEA 2R2JA 2GT6A 2YWNA 4LMWA 4DSRA 2I9HA 2IMFA 5CYYA 1XVWA 3TGZA 5A5HA 2IMEA 3TJFA 3GURA 2H0IA 2GQLA 4OFNA 2O87A 5C04A 2CT6A 4AJ7A 1NW2A 4FYUA 1YKCA 3GRXA 3D22A 2XC2A 3KH9A 3W8SA 2VCVA 5LCZA 1RK4A 1QUWA 3TOUA 1S4BP 1DE1A 5HR1A 1MD4A 2A2PA 2MZCA 17GSA 2A2RA 3UL3A 1GSSA 4RI6A 4DVCA 4KDXA 2HSNA 4MPFA 2QSIA 1T3BA 2CAIA 2MYGA 1WWJA 4ZIJA 1J9BA 1W89A 22GSA 1EEMA 3DIEA 4ISDA 2NTOA 5CNWA 2R6KA 2JU5A 2VCQA 4KB3A 5CP1A 1QFNA 3APQA 2FWHA 3ZFBA 4WXTA 2KP2A 5AGYA 5HQPA 3M9JA 4PX1A 2WVYA 4GQCA 5IOXA 3L9UA 2R0PA 2YZHA 5A34B 3ZRDA 1PL1A 5JCWA 4EIQA 4MLYA
chains in the Genus database with same CATH topology
2C8UA 1O6JA 1OE8A 5D93A 4EO3A 4K2DA 2PGTA 4V1Ag 5ECRB 2BMXA 4AKGA 4ZL7A 3KIJA 4WETA 4MPGA 2H1AA 1BJXA 3GIXA 1XWAA 5JWOB 3FZ5A 6GSSA 4MP4A 1UN2A 5EPFA 2IMDA 4NV2A 1S3AA 4ECIA 1AW9A 4P3YB 1TTZA 2H1BA 2PN8A 1K0NA 3D5JA 5ECNB 3UJ1A 2H1LA 1SL0B 4ECBA 4YQVA 4QL9A 1E2YA 2VCZA 1THXA 4JRRA 4HS1A 1I5GA 2J23A 4FH8A 2DC5A 3EYTA 1U87A 2MBTA 3NOFA 4L5LA 1WIKA 4TR1B 5DALB 12GSA 4MK3A 1TXXA 5HR3A 4IVFA 2DJJA 2AV4A 5ECMB 5ECLB 5CRGA 5HFGA 4BVYB 4QL7A 2E7PA 1K3LA 5A34A 4K9ZA 2EIRA 2R5GA 1GSDA 4ICYA 1T8EB 4ZBAA 3MYDA 4HUAA 1T4ZA 2LJRA 2F51A 3KEBA 1B9YC 3IDVA 2E2MA 1V2AA 2CV4A 1A23A 3DVXA 2AAWA 2WZ9A 1VF2A 2N5BA 16GSA 1VF4A 2F3MA 2B1LA 5DCHA 2AYTA 1PX6A 1BQ7A 4Z2TA 2WB9A 1S3DA 1TI3A 4YAVA 4OD7A 4NMUA 1NHOA 4TW5A 1VF3A 3BCIA 3EMPA 2B5EA 3MWHA 4HU7A 4TR1A 5DALA 1UC7A 2H75A 2V1MA 4GXZA 1Y25A 1KEBA 2PVQA 1Z9HA 2R0GA 3CSIA 3DWVA 4HEA2 4K7OA 3PPUA 4HJMA 4BVYA 1AXDA 5G1LA 3G9BA 3D0ZA 2FY6A 2DMMA 3UOMA 2O5VA 1SYXA 1VGLA 1Z7PA 1GSEA 3F4SA 1X9SB 4IQ1A 2VUPA 3F3QA 3GX8A 4ZL9A 4POKA 2AHEA 2L5LA 2YNXA 5JCGA 2ES7A 3DVWA 4EDYA 3UAPA 4JE1A 3IR4A 3GN3A 3AY8A 3ZTLA 5F06A 4IBPA 1WPIA 1ZYNA 5B8BA 3LXTA 5ECOB 1TK8B 3APOA 4ECJA 2L57A 2KUCA 3KP8A 5J40A 5HFIA 3IAM2 4WF4A 4PNGA 4JR4A 2DJ3A 3EINA 4PNFA 4OFMA 3I69A 4N11A 1B4PA 2K8SA 1NM3A 4V2NA 1M9AA 2FWGA 5E59A 1SK0A 3F8UA 2CA8A 3J7Yb 1N2AA 4K0NA 1GWCA 2YPMA 5J4UA 3G7JA 13GSA 4IKHA 2HQTA 3ISOA 1TRUA 1Z3EA 3ED3A 4NWYA 2XPDA 3VURA 2GS3A 3GKKA 1SK1A 4LL1B 2PBJA 3IC4A 4N0VA 5IMDA 2GZYA 4J57E 3CYNA 3KCMA 5ECKB 1YDKA 3CRTA 4KH7A 4NHWA 2QC7A 4EUYA 2RIIA 2YN1A 4GWRA 4HZ4A 3P2AA 2C3TA 1TOFA 5H5QA 2VCXA 1XVQA 2VLTA 3KXOA 5CAXA 3D4MA 3CXGA 4HZ2A 2R37A 3C73A 5DQYA 4CDOA 3HCZA 3O3TA 5B8AA 4YQUA 4TN8A 1GLQA 4WKWA 4BA7A 1T00A 1TP9A 1JLWA 1K0CA 3BBYA 2FLSA 1JZRA 3LW9A 4G0KA 1OC8A 3P8WA 1OKTA 1WP0A 2YP6A 2B6MA 1U88A 4D73B 2HI7A 3ZL5A 3KMOA 3F6DA 3D21A 4YQMA 4AKHA 5IMVA 3APSA 3MIXA 1PL2A 3ERFA 5KEJA 4RI7A 1CQGA 3HKRA 5D9WA 5E4WA 1SJZA 4GSNA 2LRTA 4BWQA 3FZAA 5ECHB 3A2XA 1AIUA 2H6YA 4E8HA 3RHBA 3Q19A 3GV1A 3O76A 1SKRB 4E68A 1U3IA 2X99A 5IO2A 4MZCA 3ZLPA 5D9VA 4X43A 4EL1A 2FA8A 4IQAA 3TOTA 2HFDA 5D96A 3DKSA 1SD8A 4GTUA 3QAWA 2X8GA 3KM6A 4O5QA 1U6TA 2ZNMA 4BPYA 1X5DA 2J9HA 4ML1A 1LBKA 1SL2B 5AIVA 3D6IA 3TJGA 10GSA 2P5QA 3FRCA 2N5FA 2X8HA 3FZ4A 3EE2A 4N3ZA 4I2TA 3D4TA 4ULXA 1TW9A 4PUAA 4MCUA 5FHIA 3EWLA 2G0FA 1YZXA 3KMNA 2Z9SA 2AJQB 1WJKA 4D73A 4K7NA 3TCOA 4Q5NA 4QMKA 4ZB6A 1Z6NA 1ZGNA 1DBYA 3WD6A 5ECQB 2H30A 3ZIVA 1GL8A 4GSSA 1WMJA 2HRKA 2C3QA 5G5FA 2VAFA 1H4OA 3GFKA 3CTFA 1EWXA 4IS0A 3TJKA 2KHPA 1Q4JA 1Z6MA 5B6MA 1QQ2A 5LNKe 1TKDB 1XWKA 2DJ2A 5GAPD 2VKZG 4PQIA 2X64A 4AKIA 1A2LA 3GH6A 1IYHA 3EURA 2H73A 3IXRA 3PGTA 4Q5RA 3IE3A 3G7IA 3VI5A 3QCPA 1N8JA 3HVVA 4RUVA 1MD3A 2H0GA 3IV4A 4LLRA 3QAVA 1M2BA 2GSTA 2O89A 2ZCTA 4IJ3A 5G31A 4TOPA 2PMTA 3ZFLA 4KA0A 4KF9A 4POLA 4IW9A 3IK7A 4PQ1A 3M8NA 3FW2A 2IL3A 3UIWA 1FAAA 4O5UA 1ZMAA 3U5RE 3FK8A 4GDFA 3OR5A 4XTSA 1E6BA 2OBKA 5D73A 5FT3A 5BMUB 4K8MA 5B7CA 4ILFA 2IMIA 4CY8A 3FMWA 3CRUA 3IA1A 1FB0A 2DJ0A 4IGJA 4EC0A 4V1Ap 2VCWA 5F07A 1OAZA 1GSUA 3CTGA 4IN0A 3CSHA 3H93A 1VF1A 3CMIA 4ACSA 1O73A 3L9VA 4WR5A 1NSWA 5CREA 3RDWA 1TK0B 1YY7A 1UA5A 3C1SA 2O7KA 2CVDA 3FR6A 3O6TA 5GSTA 2AB6A 3BCKA 1A0RP 1YVLA 3P90A 5CRDA 1X0RA 1R7HA 4XS1A 1AAZA 1AQVA 3RHCA 4MF7A 2VL2C 2HNLA 3FHKA 2R3XA 3DMLA 2H19A 1X9MB 4KX4A 3UMAA 1BG5A 3GA4A 3KTBA 4FYBA 1TU8A 3TRXA 4TR3A 1JHBA 5A4WA 3HA9A 5BMUA 4IJIA 1ZYQB 2GQKA 3DYRA 2C80A 4J2FA 2B1KA 3BD2A 5D9XA 1KTEA 2H76A 1PSQA 1TRVA 3C71A 2CAQA 4GF0A 2HSHA 3LQ7A 4OMVA 2TRXA 2MMZA 1F37A 1XOAA 1XXUA 3F3RA 1A8YA 5AIXA 1PRXA 1GULA 2PVOC 2AUVA 1PGTA 1SYRA 2CVBA 3ERGA 4NV5A 1YKAA 1XWBA 2HSYA 5JCUA 3WYWA 2C0FA 2A2SA 2H8LA 1FO5A 2V32A 2DBCA 3J7Yk 3IRAA 4XS4B 4CY6A 4EDZA 2YV9A 4LL4B 1X5CA 3IOSA 2LJKA 5ELAA 3ZZXA 1PA3A 2PPTA 2WFCA 5CO3A 4PURA 3QPMA 4AGSA 6GSTA 3HHVA 2M72A 2CZ3A 2PUKC 3C8EA 2RM6A 5ELGA 1O7UA 3GH9A 4IP1A 1Q98A 8GSSA 1GH2A 3F4TA 4ZBBA 1BG1A 1QMVA 3GL5A 2HXKA 2IMKA 2L6CA 2LQOA 4G0LA 3F4RA 2FHEA 3M1GA 2NPBA 3TRQA 1FG4A 3VPQA 3VWXA 1K3YA 1JLVA 2RUFA 1WOUA 1SKWB 4O32A 2EFCA 4FQUA 4G9HA 3QOUA 2LRNA 2LSTA 2I4AA 3LG6A 4ZB8A 1XW5A 3GX0A 2I3YA 1XWGA 3UBKA 2FA4A 2WS2A 7GSSA 1EP7A 2GSRA 5DJLA 1MDKA 4TXVA 5HR0A 4KGIA 1M99A 18GSA 4MNNA 3GYKA 3JCML 1TI1A 1SENA 2HZEB 2YWMA 2FUG2 3L4NA 4ZL8A 3ZYWA 2WDUA 3IPZA 4HI7A 2LKUA 3H1NA 4POBA 5IOWA 4MJCA 1A2MA 4TR0A 2LUSA 3IHGA 2GSSA 1F3BA 5G5EA 3IK9A 2HE3A 2NDOA 4MA9A 2ON5A 4ZB9A 2TRCP 2HRAA 3H79A 2LNSA 1WRYA 2X49A 2GT5A 1A24A 3TB2A 2V6KA 5KOXA 4HJ2A 1ZOFA 2VOCA 2VD1A 3UVTA 1M2DA 5J9CA 3CBUA 5IQYA 2PWJA 1XBSA 2L4QA 4ECCA 4EIPA 4KSMA 3ZIJA 1C72A 3E3EA 3ZMLA 4GRFA 1Z5YE 1F2EA 2YV7A 3VWVA 4K6XA 3TDGA 2RLIA 4KAEA 3F9UA 5EY6A 1AQXA 4WF5A 3HZ4A 3DXBA 3GNJA 2HZEA 4MH3A 3K8NA 4PGTA 3HD5A 2IWTA 2LEGA 1EGRA 4F0BA 1BYEA 1TXUA 3M0FA 2GDRA 3ERWA 5KN0A 3S9FA 1AC1A 1AQWA 2DJ1A 4K7IA 3RPNA 5GZZB 3A2VA 1Z7RA 1FB6A 1V98A 5EVOA 3E9JB 4MF6A 3WT1A 3F63A 3M3MA 4F0CA 3HJPA 2O85A 2X8CA 2QA1A 3ZVJA 5KN2A 1T7PB 2V2GA 3QD9A 1USBA 3C1RA 1PX7A 2EFHA 3CSJA 5F05A 4AF2A 2JACA 6GSYA 4X1UA 3MDKA 2UZ8A 2E0QA 5INYA 1U3AA 1V9WA 4K5SA 4G10A 3W6GA 2YWOA 1I9DA 4MZWA 1ZYPA 1G6WA 3FEUA 2GGTA 3FYGA 3LJRA 4Z2RA 2VL2A 2LS5A 1XIYA 3NIVA 5B6NA 1M9BA 3IBHA 5ECPB 1GTBA 1GUKA 5GSSA 4G01A 2NVLA 2C4JA 2WULA 2H1GA 2LV3A 1SVMA 3GTUB 2P31A 1PKWA 2H6XA 2OKAA 5GAND 3TUEA 3WT2A 1LJRA 4MJAA 4H86A 1PMTA 3TJBA 3LFLA 5LD0A 3VPTA 1BF5A 4I2UA 2KOKA 5A4VA 1RW1A 5HR2A 4XRAA 3KTLA 3UEMA 1SVLA 4RQRA 4EVMA 5J4YA 4N30A 2QA2A 2DLXA 4ZXGA 3HVSA 1K0OA 4MDCA 4KCEA 3GKXA 4JR6A 5CRHA 5IMAA 2EIOA 2I1UA 3QFBC 3I9V2 4PXOA 4BL7B 2F8FA 4OWYA 3N9JA 1FVKA 1M7TA 1ERVA 2YOIA 1SL1B 1HQOA 4DSQA 2OADA 3I6AA 1QXHA 5JWRB 1G7EA 4ZILA 2DIYA 1KNGA 2P0GA 1TK5B 1GSFA 1G7OA 1XCCA 4PQHA 4KDUA 2HYXA 3GTUA 6GSXA 1NHYA 1EEJA 5IMCA 2WGRA 3HYPA 3ZVJD 1ZYEA 1BX9A 4I6XA 1EV9A 1DE2A 5COHA 3QMXA 2LRCA 1TRSA 2H1DA 3A2WA 3TKSC 3HJMA 2GQMA 3GMFA 4JBBA 4GLTA 4YAPA 3A5IA 3KJYA 4MABA 2EIQA 2EC4A 2VL9A 3FZ9A 6GSUA 2OACA 2R0CA 4WR4A 2H74A 1UVZA 2OE3A 1GTAA 3IC8A 3MAKA 4POMA 2JADA 2HLSA 4EE0A 2PERA 3LSZA 3A5WA 1XW6A 3LYPA 4MH2A 3KD0A 3KP9A 1VRSD 4BL7A 5C00A 4W66A 2V41A 4F03A 5G1KA 1PQNA 3LWAA 5J9BA 4PTSA 4HU9A 5ID2B 5J3RA 3A3TA 3Q18A 1B8XA 3GL3A 1EOHA 3Q6OA 4KW6A 1G0TA 5IPHA 1ZL9A 4AJ6A 3I43A 3QDNA 3BJ5A 3V1WA 1N25A 2FD3A 5J5NA 1T1VA 5H5RA 3MNGA 1FHEA 3WGEA 2BTOT 1XW9A 2OT3A 2FGXA 1A8LA 1JZOA 1OE7A 2I81A 2R4VA 5IPGA 3UARA 3EVIA 2L59A 1LU4A 1SK2A 1HNBA 4L0WA 1GLPA 5BRTA 5D8IA 1GUMA 2VIMA 1GSYA 4I8BA 2XBIA 2TIRA 1XWCA 3TRPA 4F9ZA 3DGQA 4XS6A 1V58A 2O8VB 3RPPA 3HMJG 1AUCA 3HZ8A 5ID2A 4CW9A 4NXIA 1SVOA 4EF0A 1FOVA 2XPEA 1JZWA 2CX3A 2L5OA 1XZOA 3UVHA 2VLVA 3MSZA 3L78A 1PKZA 4ID0A 1HYUA 4OCFA 1TRWA 2GTUA 5JWQB 3LXZA 2MBSA 4TKYA 2H71A 1A2JA 3Q74A 2JZSA 3LEFA 1SJ6A 1J0FA 2HZFA 2M80A 3RAZA 1EZKA 2F8AA 2B7JA 2YWIA 1ILOA 4TXOB 4YH2A 2REMA 5CRWA 4WBJA 4QQ7A 2RM5A 2WJUA 1EP8A 2K6VA 1SJIA 4IHUA 2JZRA 3NZNA 4Z2UA 1B9XC 4EKZA 3F6FA 2E2GA 4NAXA 5ENUA 1XPVA 4MMMA 4L8EA 1G6YA 3KGKA 5FWGA 4XIHA 11GSA 5IMZA 1B4QA 2GLRA 1W4VA 3GKMA 3N5OA 2YJHA 4FYCA 5H5SA 4RQXA 2FWFA 4L5OA 2YCDA 5KN1A 1R26A 3FR3A 3H4KA 3IHQA 5IO0A 4WBRD 4XCSA 5DVBA 4HDEA 4K2XA 3M9KA 1SKSB 3F0IA 2VCTA 3QR6A 2MMAA 2RUEA 1OC3A 2IN3A 1EGOA 4AKXB 1EOGA 3TKSE 2CQ9A 1OVNA 2C1YA 4I97A 2OE0A 2FNOA 1X5EA 3GHAA 1F9MA 1K0AA 3L9SA 3VWUA 1JZDA 4Q5FA 2YANA 1SU9A 3EU4A 4XHMA 1GP1A 1ZCPA 2UV8G 1ERTA 3G7YA 3TKPA 5L71A 4TXOA 4KUNA 2JSYA 1K0MA 4OO4A 2LJAA 4V2MA 1PN0A 3FR9A 2VM1A 5A4UA 2GZZA 2H6ZA 1JFUA 1M0UA 2L6DA 2XHFA 4WEYA 20GSA 2LTKA 1R5PA 3EC3A 4O92A 5J4VA 3LGCA 4G19A 1YEXA 2IFQB 5DDLA 4XS4A 3VFIA 5J41A 1MDJA 3QAGA 2IIYA 1WE0A 3ZREA 4KNDA 4X0XA 2HRFA 1K3OA 4HOJA 2H72A 2V6OA 4JZQA 3P7XA 2HRNA 1K0BA 2H0HA 5IIZA 3TKSA 5DJMA 2GVPA 1YJ6A 3WGXA 4F82A 1HNAA 5AN1A 4HQZA 1S3CA 1ABAA 1GNEA 2VLUA 1ON4A 3R2QA 1O85A 2JSZA 3LYKA 3HDCA 3DRNA 1TU7A 5D9TA 4TRXA 3UBLA 4AJ8A 4ZB7A 3HY2A 2DIZA 1V40A 4BVXB 4YKGA 1ERWA 1GRXA 2C3NA 3WGDA 4I5QA 3ME7A 4JU5A 3E0UA 19GSA 5ECIB 1ML6A 3KZQA 3HJOA 4L0UA 1ACVA 4MZBA 4KE3A 2F9SA 4G0IA 2ZUPA 4KDYA 1R4WA 1FVJA 2IFQA 4YKFA 3VLNA 2M46A 6GSVA 3R3EA 4O7HA 1MEKA 3GUSA 2C0DA 4MF5A 3SBCA 4Q5QA 1SD9A 4USSA 2MMNA 3GSTA 1Y6EA 4LA1A 1RQMA 2CVKA 3EPTA 1DUGA 3VWWA 4HQSA 3CWGA 3EMXA 3DEXA 5G30A 1Y1UA 1IYIA 1M2AA 2DKIA 2KP1A 1QGVA 3QFAC 1OYJA 3PINA 1URMA 2IPAA 3PR8A 1HNCA 4BVXA 4F2IA 1PD21 3VI7A 1T4YA 5DBQA 2YZUA 1O81A 4J56E 2H01A 2EFEA 4XRDA 2C0EA 3TKRA 5KOWA 4MJEA 2HSMB 4BWSA 4Z7XA 3IAS2 1XFLA 3GSSA 1QK8A 3VK9A 2H70A 2WCIA 3GKNA 2OE1A 1F3AA 2WRTA 2JL4A 2VO4A 5A5KA 2QGVA 4ZBDA 2DKHA 4OFTA 3SWLA 4G2EA 2N5AA 3BOAA 3FY7A 4GCIA 5HFKA 1F6MC 1FW1A 1GUHA 2MMOA 4N10A 1MTCA 2FWEA 1K0DA 1HD2A 5IMFA 1OC9B 4IELA 2CZ2A 4GSTA 2D2ZA 4DEJA 2OJLA 2FCHA 2A4VA 2DJKA 3TKQA 1J08A 4O5RA 4OO5A 1R5AA 5DCGA 2G2QA 4AI6A 4MJBA 5KN3A 5ABRA 1V57A 2H66A 1YEPA 4KSOA 2K8VA 3HVXA 2QKEA 1THOA 1MDIA 4LMVA 4A5PA 2LNTA 1DSBA 5DQSA 1BEDA 2GZPA 1GTUA 1B48A 1GSQA 1KBNA 4NPBA 1OKDA 2VM2A 2HRKB 4K0GA 2HSMA 1YF1A 2OBIA 4DSSB 4V2LA 1ZZYA 3U6VA 5ECSA 2ON7A 14GSA 9GSSA 4EXJA 1ST9A 2KLXA 1A0FA 2P5RA 2X4AA 2B5YA 3C7MA 5DAKB 3DD3A 4NHZA 4K1FA 5A1NB 4TR4A 4OCEA 2OA7A 3ZMKA 5IM9A 1YF0A 2LQQA 2GSQA 1ERUA 2BJXA 2DMLA 2IJYA 3PH9A 2C0GA 1PN9A 4E8EA 5A5HB 2ALBA 3ME8A 1BAYA 4GQFA 1OC9A 2VD0A 2B5XA 3H8QA 4N0ZA 1XOBA 3EU3A 2CX4A 2JZTA 1O8XA 1X9WB 3TJJA 2NBSA 3ZITA 5AISA 4IP6A 2K9FA 2DSAA 2PU9C 3US3A 1CQHA 2VL3A 1O8WA 3KH7A 5EL8A 1EV4A 2HT9A 6GSWA 3W8JA 2L4CA 4JEDA 1YQ1A 2K18A 2EFDA 2B7KA 1GNWA 2A4HA 4X4JA 1GTIA 3LORA 5J47A 4DSSA 3HXSA 4KCAA 1TDIA 2XBQA 4K5RA 4FIWA 5F0GA 2B3SA 4FO5A 4PUFC 2YJ7A 5F8BA 3FKFA 1TJDA 3L0HA 3RBTA 3TU3B 5DAKA 1H75A 5G2ZA 4CHSA 4ML6A 5A1NA 2HSNB 1FOHA 4TVEA 2R2JA 2GT6A 2YWNA 4LMWA 4DSRA 2I9HA 2IMFA 5CYYA 1XVWA 3TGZA 5A5HA 2IMEA 3TJFA 3GURA 2H0IA 2GQLA 4OFNA 2O87A 5C04A 2CT6A 4AJ7A 1NW2A 4FYUA 1YKCA 3GRXA 3D22A 2XC2A 3KH9A 3W8SA 2VCVA 5LCZA 1RK4A 1QUWA 3TOUA 1DE1A 5HR1A 1MD4A 2A2PA 2MZCA 17GSA 2A2RA 3UL3A 1GSSA 4RI6A 4DVCA 4KDXA 2HSNA 4MPFA 2QSIA 1T3BA 2CAIA 2MYGA 1WWJA 4ZIJA 1J9BA 1W89A 22GSA 1EEMA 3DIEA 4ISDA 2NTOA 5CNWA 2R6KA 2JU5A 2VCQA 4KB3A 5CP1A 1QFNA 3APQA 2FWHA 3ZFBA 4WXTA 2KP2A 5AGYA 5HQPA 3M9JA 4PX1A 4GQCA 5IOXA 3L9UA 2R0PA 2YZHA 5A34B 3ZRDA 1PL1A 5JCWA 4EIQA 4MLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8U A;  1O6J A;  1OE8 A;  5D93 A;  4EO3 A;  4K2D A;  2PGT A;  4V1A g;  5ECR B;  2BMX A;  4ZL7 A;  3KIJ A;  4WET A;  4MPG A;  2H1A A;  1BJX A;  3GIX A;  1XWA A;  5JWO B;  3FZ5 A;  6GSS A;  4MP4 A;  1UN2 A;  5EPF A;  2IMD A;  4NV2 A;  1S3A A;  4ECI A;  1AW9 A;  4P3Y B;  1TTZ A;  2H1B A;  2PN8 A;  1K0N A;  3D5J A;  5ECN B;  3UJ1 A;  1SL0 B;  4ECB A;  4YQV A;  4QL9 A;  1E2Y A;  2VCZ A;  1THX A;  4JRR A;  4HS1 A;  1I5G A;  2J23 A;  4FH8 A;  2DC5 A;  3EYT A;  1U87 A;  2MBT A;  3NOF A;  4L5L A;  1WIK A;  4TR1 B;  5DAL B;  12GS A;  4MK3 A;  1TXX A;  5HR3 A;  4IVF A;  2DJJ A;  2AV4 A;  5ECM B;  5ECL B;  5CRG A;  5HFG A;  4BVY B;  4QL7 A;  2E7P A;  1K3L A;  4K9Z A;  2EIR A;  2R5G A;  1GSD A;  1T8E B;  4ZBA A;  4HUA A;  1T4Z A;  2LJR A;  2F51 A;  3KEB A;  1B9Y C;  3IDV A;  2E2M A;  1V2A A;  2CV4 A;  1A23 A;  3DVX A;  2AAW A;  2WZ9 A;  1VF2 A;  2N5B A;  16GS A;  1VF4 A;  2F3M A;  2B1L A;  5DCH A;  2AYT A;  1PX6 A;  1BQ7 A;  2WB9 A;  1S3D A;  1TI3 A;  4YAV A;  4OD7 A;  4NMU A;  1NHO A;  4TW5 A;  1VF3 A;  3BCI A;  3EMP A;  2B5E A;  3MWH A;  4HU7 A;  4TR1 A;  5DAL A;  1UC7 A;  2H75 A;  2V1M A;  4GXZ A;  1Y25 A;  1KEB A;  2PVQ A;  1Z9H A;  3CSI A;  3DWV A;  4HEA 2;  4K7O A;  3PPU A;  4HJM A;  4BVY A;  1AXD A;  5G1L A;  3G9B A;  3D0Z A;  2FY6 A;  2DMM A;  3UOM A;  1SYX A;  1VGL A;  1Z7P A;  1GSE A;  3F4S A;  1X9S B;  4IQ1 A;  2VUP A;  3F3Q A;  3GX8 A;  4ZL9 A;  4POK A;  2AHE A;  2L5L A;  2YNX A;  5JCG A;  2ES7 A;  3DVW A;  4EDY A;  3UAP A;  4JE1 A;  3IR4 A;  3GN3 A;  3AY8 A;  3ZTL A;  5F06 A;  4IBP A;  1WPI A;  5B8B A;  3LXT A;  5ECO B;  1TK8 B;  3APO A;  4ECJ A;  2L57 A;  2KUC A;  3KP8 A;  5HFI A;  3IAM 2;  4WF4 A;  4PNG A;  4JR4 A;  2DJ3 A;  3EIN A;  4PNF A;  4OFM A;  3I69 A;  4N11 A;  1B4P A;  2K8S A;  1NM3 A;  4V2N A;  1M9A A;  2FWG A;  5E59 A;  1SK0 A;  3F8U A;  2CA8 A;  3J7Y b;  1N2A A;  4K0N A;  1GWC A;  2YPM A;  5J4U A;  3G7J A;  13GS A;  4IKH A;  2HQT A;  3ISO A;  1TRU A;  1Z3E A;  3ED3 A;  4NWY A;  2XPD A;  3VUR A;  2GS3 A;  3GKK A;  1SK1 A;  4LL1 B;  2PBJ A;  3IC4 A;  4N0V A;  5IMD A;  2GZY A;  4J57 E;  3CYN A;  3KCM A;  5ECK B;  1YDK A;  3CRT A;  4KH7 A;  4NHW A;  2QC7 A;  4EUY A;  2RII A;  2YN1 A;  4GWR A;  4HZ4 A;  3P2A A;  2C3T A;  1TOF A;  5H5Q A;  2VCX A;  1XVQ A;  2VLT A;  3KXO A;  5CAX A;  3D4M A;  3CXG A;  4HZ2 A;  2R37 A;  3C73 A;  5DQY A;  4CDO A;  3HCZ A;  3O3T A;  5B8A A;  4YQU A;  4TN8 A;  1GLQ A;  4WKW A;  4BA7 A;  1T00 A;  1TP9 A;  1JLW A;  1K0C A;  3BBY A;  2FLS A;  1JZR A;  4G0K A;  1OC8 A;  3P8W A;  1OKT A;  1WP0 A;  2YP6 A;  2B6M A;  1U88 A;  4D73 B;  2HI7 A;  3ZL5 A;  3KMO A;  3F6D A;  3D21 A;  4YQM A;  5IMV A;  3APS A;  1PL2 A;  3ERF A;  5KEJ A;  4RI7 A;  1CQG A;  3HKR A;  5D9W A;  5E4W A;  1SJZ A;  4GSN A;  2LRT A;  4BWQ A;  3FZA A;  5ECH B;  3A2X A;  1AIU A;  2H6Y A;  4E8H A;  3RHB A;  3Q19 A;  3GV1 A;  3O76 A;  1SKR B;  1U3I A;  2X99 A;  5IO2 A;  4MZC A;  3ZLP A;  5D9V A;  4X43 A;  4EL1 A;  2FA8 A;  4IQA A;  3TOT A;  2HFD A;  5D96 A;  3DKS A;  1SD8 A;  4GTU A;  3QAW A;  2X8G A;  3KM6 A;  1U6T A;  2ZNM A;  4BPY A;  1X5D A;  2J9H A;  4ML1 A;  1LBK A;  1SL2 B;  5AIV A;  3D6I A;  3TJG A;  10GS A;  2P5Q A;  3FRC A;  2N5F A;  2X8H A;  3FZ4 A;  3EE2 A;  4I2T A;  3D4T A;  4ULX A;  1TW9 A;  4PUA A;  4MCU A;  5FHI A;  3EWL A;  2G0F A;  1YZX A;  3KMN A;  2Z9S A;  2AJQ B;  1WJK A;  4D73 A;  4K7N A;  3TCO A;  4Q5N A;  4ZB6 A;  1Z6N A;  1ZGN A;  1DBY A;  3WD6 A;  5ECQ B;  2H30 A;  3ZIV A;  1GL8 A;  4GSS A;  1WMJ A;  2HRK A;  2C3Q A;  5G5F A;  2VAF A;  1H4O A;  3GFK A;  3CTF A;  1EWX A;  4IS0 A;  3TJK A;  2KHP A;  1Q4J A;  1Z6M A;  5B6M A;  1QQ2 A;  5LNK e;  1TKD B;  1XWK A;  2DJ2 A;  5GAP D;  4PQI A;  2X64 A;  1A2L A;  3GH6 A;  1IYH A;  3EUR A;  2H73 A;  3IXR A;  3PGT A;  4Q5R A;  3IE3 A;  3G7I A;  3VI5 A;  3QCP A;  1N8J A;  3HVV A;  4RUV A;  1MD3 A;  2H0G A;  3IV4 A;  4LLR A;  3QAV A;  1M2B A;  2GST A;  2O89 A;  2ZCT A;  4IJ3 A;  5G31 A;  4TOP A;  2PMT A;  3ZFL A;  4KA0 A;  4KF9 A;  4POL A;  4IW9 A;  3IK7 A;  4PQ1 A;  3M8N A;  3FW2 A;  2IL3 A;  3UIW A;  1FAA A;  1ZMA A;  3U5R E;  3FK8 A;  3OR5 A;  4XTS A;  1E6B A;  2OBK A;  5D73 A;  5FT3 A;  4K8M A;  5B7C A;  4ILF A;  2IMI A;  3CRU A;  3IA1 A;  1FB0 A;  2DJ0 A;  4IGJ A;  4EC0 A;  4V1A p;  2VCW A;  5F07 A;  1OAZ A;  1GSU A;  3CTG A;  4IN0 A;  3CSH A;  3H93 A;  1VF1 A;  3CMI A;  4ACS A;  1O73 A;  3L9V A;  4WR5 A;  1NSW A;  5CRE A;  3RDW A;  1TK0 B;  1YY7 A;  1UA5 A;  3C1S A;  2O7K A;  2CVD A;  3FR6 A;  3O6T A;  5GST A;  2AB6 A;  3BCK A;  1A0R P;  3P90 A;  5CRD A;  1X0R A;  1R7H A;  4XS1 A;  1AAZ A;  1AQV A;  3RHC A;  4MF7 A;  2VL2 C;  2HNL A;  3FHK A;  2R3X A;  3DML A;  2H19 A;  1X9M B;  4KX4 A;  3UMA A;  1BG5 A;  3GA4 A;  3KTB A;  4FYB A;  1TU8 A;  3TRX A;  4TR3 A;  1JHB A;  5A4W A;  3HA9 A;  5BMU A;  4IJI A;  1ZYQ B;  2GQK A;  3DYR A;  2C80 A;  4J2F A;  2B1K A;  3BD2 A;  5D9X A;  1KTE A;  2H76 A;  1PSQ A;  1TRV A;  3C71 A;  2CAQ A;  4GF0 A;  2HSH A;  3LQ7 A;  4OMV A;  2TRX A;  2MMZ A;  1F37 A;  1XOA A;  1XXU A;  3F3R A;  1A8Y A;  5AIX A;  1PRX A;  1GUL A;  2PVO C;  2AUV A;  1PGT A;  1SYR A;  2CVB A;  3ERG A;  4NV5 A;  1YKA A;  1XWB A;  2HSY A;  5JCU A;  3WYW A;  2C0F A;  2A2S A;  2H8L A;  1FO5 A;  2V32 A;  2DBC A;  3J7Y k;  3IRA A;  4XS4 B;  4EDZ A;  2YV9 A;  4LL4 B;  1X5C A;  3IOS A;  2LJK A;  5ELA A;  3ZZX A;  1PA3 A;  2PPT A;  2WFC A;  5CO3 A;  4PUR A;  3QPM A;  4AGS A;  6GST A;  3HHV A;  2M72 A;  2CZ3 A;  2PUK C;  3C8E A;  2RM6 A;  5ELG A;  1O7U A;  3GH9 A;  4IP1 A;  1Q98 A;  8GSS A;  1GH2 A;  3F4T A;  4ZBB A;  1QMV A;  3GL5 A;  2HXK A;  2IMK A;  2L6C A;  2LQO A;  4G0L A;  3F4R A;  2FHE A;  3M1G A;  2NPB A;  3TRQ A;  1FG4 A;  3VPQ A;  3VWX A;  1K3Y A;  1JLV A;  2RUF A;  1WOU A;  1SKW B;  4O32 A;  4FQU A;  4G9H A;  3QOU A;  2LRN A;  2LST A;  2I4A A;  3LG6 A;  4ZB8 A;  1XW5 A;  3GX0 A;  2I3Y A;  1XWG A;  3UBK A;  2FA4 A;  2WS2 A;  7GSS A;  1EP7 A;  2GSR A;  5DJL A;  1MDK A;  4TXV A;  5HR0 A;  4KGI A;  1M99 A;  18GS A;  3GYK A;  3JCM L;  1TI1 A;  1SEN A;  2HZE B;  2YWM A;  2FUG 2;  3L4N A;  4ZL8 A;  3ZYW A;  2WDU A;  3IPZ A;  4HI7 A;  2LKU A;  3H1N A;  4POB A;  5IOW A;  4MJC A;  1A2M A;  4TR0 A;  2LUS A;  2GSS A;  1F3B A;  5G5E A;  3IK9 A;  2HE3 A;  2NDO A;  4MA9 A;  2ON5 A;  4ZB9 A;  2TRC P;  2HRA A;  3H79 A;  2LNS A;  1WRY A;  2GT5 A;  1A24 A;  3TB2 A;  2V6K A;  4HJ2 A;  1ZOF A;  2VOC A;  2VD1 A;  3UVT A;  1M2D A;  5J9C A;  3CBU A;  5IQY A;  2PWJ A;  1XBS A;  2L4Q A;  4ECC A;  4KSM A;  3ZIJ A;  1C72 A;  3E3E A;  3ZML A;  4GRF A;  1Z5Y E;  1F2E A;  2YV7 A;  3VWV A;  4K6X A;  3TDG A;  2RLI A;  4KAE A;  3F9U A;  5EY6 A;  1AQX A;  4WF5 A;  3HZ4 A;  3DXB A;  3GNJ A;  2HZE A;  4MH3 A;  3K8N A;  4PGT A;  3HD5 A;  2IWT A;  2LEG A;  1EGR A;  4F0B A;  1BYE A;  3M0F A;  2GDR A;  3ERW A;  5KN0 A;  3S9F A;  1AC1 A;  1AQW A;  2DJ1 A;  4K7I A;  3RPN A;  5GZZ B;  3A2V A;  1Z7R A;  1FB6 A;  1V98 A;  5EVO A;  3E9J B;  4MF6 A;  3WT1 A;  3F63 A;  3M3M A;  4F0C A;  3HJP A;  2O85 A;  2X8C A;  3ZVJ A;  1T7P B;  5KN2 A;  2V2G A;  3QD9 A;  1USB A;  3C1R A;  1PX7 A;  3CSJ A;  5F05 A;  4AF2 A;  2JAC A;  6GSY A;  4X1U A;  3MDK A;  2UZ8 A;  2E0Q A;  5INY A;  1U3A A;  1V9W A;  4G10 A;  3W6G A;  2YWO A;  1I9D A;  4MZW A;  1G6W A;  3FEU A;  2GGT A;  3FYG A;  3LJR A;  2VL2 A;  2LS5 A;  1XIY A;  3NIV A;  5B6N A;  1M9B A;  3IBH A;  5ECP B;  1GTB A;  1GUK A;  5GSS A;  2NVL A;  2C4J A;  2WUL A;  2H1G A;  2LV3 A;  3GTU B;  2P31 A;  1PKW A;  2H6X A;  2OKA A;  5GAN D;  3TUE A;  3WT2 A;  1LJR A;  4MJA A;  4H86 A;  1PMT A;  3TJB A;  3LFL A;  5LD0 A;  3VPT A;  4I2U A;  2KOK A;  5A4V A;  1RW1 A;  5HR2 A;  4XRA A;  3KTL A;  3UEM A;  4RQR A;  4EVM A;  4N30 A;  2DLX A;  4ZXG A;  3HVS A;  1K0O A;  4MDC A;  4KCE A;  3GKX A;  4JR6 A;  5CRH A;  5IMA A;  2EIO A;  2I1U A;  3QFB C;  3I9V 2;  4PXO A;  4BL7 B;  2F8F A;  4OWY A;  3N9J A;  1FVK A;  1M7T A;  1ERV A;  2YOI A;  1SL1 B;  1HQO A;  4DSQ A;  2OAD A;  3I6A A;  1QXH A;  5JWR B;  1G7E A;  4ZIL A;  2DIY A;  1KNG A;  2P0G A;  1TK5 B;  1GSF A;  1G7O A;  1XCC A;  4PQH A;  4KDU A;  2HYX A;  3GTU A;  6GSX A;  1NHY A;  1EEJ A;  5IMC A;  2WGR A;  3HYP A;  3ZVJ D;  1ZYE A;  1BX9 A;  4I6X A;  1EV9 A;  1DE2 A;  5COH A;  3QMX A;  2LRC A;  1TRS A;  2H1D A;  3A2W A;  3TKS C;  3HJM A;  2GQM A;  3GMF A;  4JBB A;  4GLT A;  4YAP A;  3KJY A;  4MAB A;  2EIQ A;  2EC4 A;  2VL9 A;  3FZ9 A;  6GSU A;  2OAC A;  4WR4 A;  2H74 A;  1UVZ A;  2OE3 A;  1GTA A;  3IC8 A;  3MAK A;  4POM A;  2JAD A;  2HLS A;  4EE0 A;  2PER A;  3LSZ A;  3A5W A;  1XW6 A;  3LYP A;  4MH2 A;  3KD0 A;  3KP9 A;  1VRS D;  4BL7 A;  5C00 A;  2V41 A;  4F03 A;  5G1K A;  1PQN A;  3LWA A;  5J9B A;  4PTS A;  4HU9 A;  5ID2 B;  5J3R A;  3A3T A;  3Q18 A;  1B8X A;  3GL3 A;  1EOH A;  3Q6O A;  4KW6 A;  1G0T A;  5IPH A;  1ZL9 A;  4AJ6 A;  3I43 A;  3QDN A;  3BJ5 A;  3V1W A;  2FD3 A;  5J5N A;  1T1V A;  5H5R A;  3MNG A;  1FHE A;  3WGE A;  2BTO T;  1XW9 A;  2FGX A;  1A8L A;  1JZO A;  1OE7 A;  2I81 A;  2R4V A;  5IPG A;  3UAR A;  3EVI A;  2L59 A;  1LU4 A;  1SK2 A;  1HNB A;  4L0W A;  1GLP A;  5D8I A;  1GUM A;  2VIM A;  1GSY A;  4I8B A;  2XBI A;  2TIR A;  1XWC A;  3TRP A;  4F9Z A;  3DGQ A;  4XS6 A;  1V58 A;  2O8V B;  3RPP A;  1AUC A;  3HZ8 A;  5ID2 A;  4CW9 A;  4NXI A;  4EF0 A;  1FOV A;  2XPE A;  1JZW A;  2CX3 A;  2L5O A;  1XZO A;  3UVH A;  2VLV A;  3MSZ A;  3L78 A;  1PKZ A;  4ID0 A;  1HYU A;  4OCF A;  1TRW A;  2GTU A;  5JWQ B;  3LXZ A;  2MBS A;  4TKY A;  2H71 A;  1A2J A;  3Q74 A;  2JZS A;  3LEF A;  1SJ6 A;  1J0F A;  2HZF A;  2M80 A;  3RAZ A;  1EZK A;  2F8A A;  2B7J A;  2YWI A;  1ILO A;  4TXO B;  4YH2 A;  2REM A;  5CRW A;  4WBJ A;  4QQ7 A;  2RM5 A;  2WJU A;  1EP8 A;  2K6V A;  1SJI A;  4IHU A;  2JZR A;  3NZN A;  1B9X C;  4EKZ A;  3F6F A;  2E2G A;  4NAX A;  5ENU A;  1XPV A;  4MMM A;  4L8E A;  1G6Y A;  3KGK A;  5FWG A;  4XIH A;  11GS A;  5IMZ A;  1B4Q A;  2GLR A;  1W4V A;  3GKM A;  3N5O A;  2YJH A;  4FYC A;  5H5S A;  4RQX A;  2FWF A;  4L5O A;  2YCD A;  5KN1 A;  1R26 A;  3FR3 A;  3H4K A;  3IHQ A;  5IO0 A;  4WBR D;  4XCS A;  5DVB A;  4HDE A;  3M9K A;  1SKS B;  3F0I A;  2VCT A;  3QR6 A;  2MMA A;  2RUE A;  1OC3 A;  2IN3 A;  1EGO A;  1EOG A;  3TKS E;  2CQ9 A;  1OVN A;  2C1Y A;  4I97 A;  2OE0 A;  2FNO A;  1X5E A;  3GHA A;  1F9M A;  1K0A A;  3L9S A;  3VWU A;  1JZD A;  4Q5F A;  2YAN A;  1SU9 A;  3EU4 A;  4XHM A;  1GP1 A;  1ZCP A;  1ERT A;  3G7Y A;  3TKP A;  5L71 A;  4TXO A;  4KUN A;  2JSY A;  1K0M A;  4OO4 A;  2LJA A;  4V2M A;  3FR9 A;  2VM1 A;  5A4U A;  2GZZ A;  2H6Z A;  1JFU A;  1M0U A;  2L6D A;  2XHF A;  4WEY A;  20GS A;  2LTK A;  1R5P A;  3EC3 A;  4O92 A;  3LGC A;  4G19 A;  1YEX A;  2IFQ B;  5DDL A;  4XS4 A;  3VFI A;  5J41 A;  1MDJ A;  3QAG A;  2IIY A;  1WE0 A;  3ZRE A;  4KND A;  4X0X A;  2HRF A;  1K3O A;  4HOJ A;  2H72 A;  2V6O A;  4JZQ A;  3P7X A;  2HRN A;  1K0B A;  2H0H A;  5IIZ A;  3TKS A;  5DJM A;  2GVP A;  1YJ6 A;  3WGX A;  4F82 A;  1HNA A;  5AN1 A;  4HQZ A;  1S3C A;  1ABA A;  1GNE A;  2VLU A;  1ON4 A;  3R2Q A;  1O85 A;  2JSZ A;  3LYK A;  3HDC A;  3DRN A;  1TU7 A;  5D9T A;  4TRX A;  3UBL A;  4AJ8 A;  3HY2 A;  2DIZ A;  1V40 A;  4BVX B;  1ERW A;  1GRX A;  2C3N A;  3WGD A;  4I5Q A;  3ME7 A;  4JU5 A;  3E0U A;  19GS A;  5ECI B;  1ML6 A;  3KZQ A;  3HJO A;  4L0U A;  1ACV A;  4MZB A;  4KE3 A;  2F9S A;  4G0I A;  2ZUP A;  4KDY A;  1R4W A;  1FVJ A;  2IFQ A;  3VLN A;  2M46 A;  6GSV A;  3R3E A;  4O7H A;  1MEK A;  3GUS A;  2C0D A;  4MF5 A;  3SBC A;  4Q5Q A;  1SD9 A;  4USS A;  2MMN A;  3GST A;  1Y6E A;  4LA1 A;  1RQM A;  2CVK A;  1DUG A;  3VWW A;  4HQS A;  3EMX A;  3DEX A;  5G30 A;  1IYI A;  1M2A A;  2KP1 A;  1QGV A;  3QFA C;  1OYJ A;  3PIN A;  1URM A;  2IPA A;  3PR8 A;  1HNC A;  4BVX A;  4F2I A;  1PD2 1;  3VI7 A;  1T4Y A;  5DBQ A;  2YZU A;  1O81 A;  4J56 E;  2H01 A;  4XRD A;  2C0E A;  3TKR A;  4MJE A;  2HSM B;  4BWS A;  4Z7X A;  3IAS 2;  1XFL A;  3GSS A;  1QK8 A;  3VK9 A;  2H70 A;  2WCI A;  3GKN A;  2OE1 A;  1F3A A;  2WRT A;  2JL4 A;  2VO4 A;  5A5K A;  2QGV A;  4ZBD A;  4OFT A;  3SWL A;  4G2E A;  2N5A A;  3BOA A;  3FY7 A;  4GCI A;  5HFK A;  1F6M C;  1FW1 A;  1GUH A;  2MMO A;  4N10 A;  1MTC A;  2FWE A;  1K0D A;  1HD2 A;  5IMF A;  1OC9 B;  4IEL A;  2CZ2 A;  4GST A;  2D2Z A;  4DEJ A;  2OJL A;  2FCH A;  2A4V A;  2DJK A;  3TKQ A;  1J08 A;  4O5R A;  4OO5 A;  1R5A A;  5DCG A;  2G2Q A;  4MJB A;  5KN3 A;  5ABR A;  1V57 A;  2H66 A;  1YEP A;  4KSO A;  2K8V A;  2QKE A;  3HVX A;  1THO A;  1MDI A;  4LMV A;  2LNT A;  1DSB A;  5DQS A;  1BED A;  2GZP A;  1GTU A;  1B48 A;  1GSQ A;  1KBN A;  4NPB A;  1OKD A;  2VM2 A;  2HRK B;  4K0G A;  2HSM A;  1YF1 A;  2OBI A;  4DSS B;  4V2L A;  1ZZY A;  3U6V A;  5ECS A;  2ON7 A;  14GS A;  9GSS A;  4EXJ A;  1ST9 A;  2KLX A;  1A0F A;  2P5R A;  2B5Y A;  3C7M A;  5DAK B;  3DD3 A;  4NHZ A;  4K1F A;  4TR4 A;  4OCE A;  2OA7 A;  3ZMK A;  5IM9 A;  1YF0 A;  2LQQ A;  2GSQ A;  1ERU A;  2BJX A;  2DML A;  2IJY A;  3PH9 A;  2C0G A;  1PN9 A;  4E8E A;  2ALB A;  1BAY A;  3ME8 A;  4GQF A;  1OC9 A;  2VD0 A;  2B5X A;  3H8Q A;  4N0Z A;  1XOB A;  3EU3 A;  2CX4 A;  2JZT A;  1O8X A;  1X9W B;  3TJJ A;  2NBS A;  3ZIT A;  5AIS A;  4IP6 A;  2K9F A;  2DSA A;  2PU9 C;  3US3 A;  1CQH A;  2VL3 A;  1O8W A;  3KH7 A;  5EL8 A;  1EV4 A;  2HT9 A;  6GSW A;  3W8J A;  2L4C A;  4JED A;  1YQ1 A;  2K18 A;  2B7K A;  1GNW A;  1GTI A;  3LOR A;  4DSS A;  3HXS A;  4KCA A;  1TDI A;  2XBQ A;  4FIW A;  5F0G A;  2B3S A;  4FO5 A;  4PUF C;  2YJ7 A;  5F8B A;  3FKF A;  1TJD A;  3L0H A;  3RBT A;  5DAK A;  1H75 A;  5G2Z A;  4CHS A;  4ML6 A;  2HSN B;  4TVE A;  2R2J A;  2GT6 A;  2YWN A;  4LMW A;  4DSR A;  2I9H A;  2IMF A;  5CYY A;  1XVW A;  3TGZ A;  2IME A;  3TJF A;  3GUR A;  2H0I A;  2GQL A;  4OFN A;  2O87 A;  5C04 A;  2CT6 A;  4AJ7 A;  1NW2 A;  4FYU A;  1YKC A;  3GRX A;  3D22 A;  2XC2 A;  3KH9 A;  3W8S A;  2VCV A;  5LCZ A;  1RK4 A;  1QUW A;  3TOU A;  1DE1 A;  5HR1 A;  1MD4 A;  2MZC A;  17GS A;  2A2R A;  3UL3 A;  1GSS A;  4RI6 A;  4DVC A;  4KDX A;  4MPF A;  2QSI A;  1T3B A;  2CAI A;  2MYG A;  1WWJ A;  4ZIJ A;  1J9B A;  1W89 A;  22GS A;  1EEM A;  3DIE A;  4ISD A;  2NTO A;  5CNW A;  2R6K A;  2JU5 A;  2VCQ A;  4KB3 A;  5CP1 A;  1QFN A;  3APQ A;  2FWH A;  3ZFB A;  4WXT A;  2KP2 A;  5AGY A;  5HQP A;  3M9J A;  4PX1 A;  4GQC A;  5IOX A;  3L9U A;  2YZH A;  3ZRD A;  1PL1 A;  5JCW A;  4MLY A; 
#chains in the Genus database with same CATH topology
 2C8U A;  1O6J A;  1OE8 A;  5D93 A;  4EO3 A;  4K2D A;  2PGT A;  4V1A g;  5ECR B;  2BMX A;  4AKG A;  4ZL7 A;  3KIJ A;  4WET A;  4MPG A;  2H1A A;  1BJX A;  3GIX A;  1XWA A;  5JWO B;  3FZ5 A;  6GSS A;  4MP4 A;  1UN2 A;  5EPF A;  2IMD A;  4NV2 A;  1S3A A;  4ECI A;  1AW9 A;  4P3Y B;  1TTZ A;  2H1B A;  1PFO A;  2PN8 A;  1K0N A;  3D5J A;  5ECN B;  3UJ1 A;  2H1L A;  1SL0 B;  4ECB A;  4YQV A;  4QL9 A;  1E2Y A;  2VCZ A;  1THX A;  4JRR A;  4HS1 A;  1I5G A;  2J23 A;  4FH8 A;  2DC5 A;  3EYT A;  1U87 A;  2MBT A;  3NOF A;  4L5L A;  1WIK A;  4TR1 B;  5DAL B;  12GS A;  1M3J A;  4MK3 A;  1TXX A;  5HR3 A;  4IVF A;  2DJJ A;  2AV4 A;  5ECM B;  5ECL B;  5CRG A;  5HFG A;  4BVY B;  4QL7 A;  2E7P A;  1K3L A;  5A34 A;  4K9Z A;  2EIR A;  2R5G A;  1GSD A;  4ICY A;  1T8E B;  4ZBA A;  3MYD A;  4HUA A;  1T4Z A;  2LJR A;  2F51 A;  3KEB A;  1B9Y C;  3IDV A;  2E2M A;  1V2A A;  2CV4 A;  1A23 A;  3DVX A;  2AAW A;  2WZ9 A;  1VF2 A;  2N5B A;  16GS A;  1VF4 A;  2WVZ A;  2F3M A;  2B1L A;  5DCH A;  2AYT A;  1PX6 A;  1BQ7 A;  4Z2T A;  2WB9 A;  1S3D A;  1TI3 A;  4YAV A;  4OD7 A;  4NMU A;  1NHO A;  4TW5 A;  1VF3 A;  3BCI A;  3EMP A;  2B5E A;  3MWH A;  4HU7 A;  4TR1 A;  5DAL A;  1UC7 A;  2V1M A;  2H75 A;  4GXZ A;  1Y25 A;  1KEB A;  1XG8 A;  2PVQ A;  1Z9H A;  2R0G A;  3CSI A;  3DWV A;  2WW1 A;  4HEA 2;  4K7O A;  3PPU A;  4HJM A;  4BVY A;  1AXD A;  5G1L A;  3G9B A;  3D0Z A;  2FY6 A;  2DMM A;  3UOM A;  2O5V A;  1SYX A;  1VGL A;  1Z7P A;  1GSE A;  3F4S A;  1X9S B;  4IQ1 A;  2VUP A;  3F3Q A;  3GX8 A;  4ZL9 A;  4POK A;  2AHE A;  2L5L A;  2YNX A;  5JCG A;  2ES7 A;  3DVW A;  4EDY A;  3UAP A;  4JE1 A;  3IR4 A;  3GN3 A;  3AY8 A;  3ZTL A;  5F06 A;  4IBP A;  1WPI A;  1ZYN A;  5B8B A;  3LXT A;  5ECO B;  1TK8 B;  3APO A;  4ECJ A;  2L57 A;  2KUC A;  3KP8 A;  5J40 A;  5HFI A;  3IAM 2;  4WF4 A;  4PNG A;  4JR4 A;  2DJ3 A;  3EIN A;  4PNF A;  4OFM A;  3I69 A;  4N11 A;  1B4P A;  2K8S A;  1NM3 A;  4V2N A;  1M9A A;  2FWG A;  5E59 A;  1SK0 A;  3F8U A;  2CA8 A;  3J7Y b;  1N2A A;  4K0N A;  1GWC A;  2YPM A;  5J4U A;  3G7J A;  13GS A;  2WW0 A;  4IKH A;  4HSC X;  2HQT A;  3ISO A;  1TRU A;  1Z3E A;  3ED3 A;  4NWY A;  2XPD A;  3VUR A;  2GS3 A;  3GKK A;  1SK1 A;  4LL1 B;  2PBJ A;  3IC4 A;  4N0V A;  5IMD A;  2GZY A;  4J57 E;  3CYN A;  3KCM A;  5ECK B;  1YDK A;  3CRT A;  4KH7 A;  4NHW A;  2QC7 A;  4EUY A;  2RII A;  2YN1 A;  4GWR A;  4HZ4 A;  3P2A A;  2C3T A;  1TOF A;  5H5Q A;  2VCX A;  1XVQ A;  2VLT A;  3KXO A;  5CAX A;  3D4M A;  3CXG A;  4HZ2 A;  2R37 A;  3C73 A;  5DQY A;  4CDO A;  3HCZ A;  3O3T A;  5B8A A;  4YQU A;  4TN8 A;  1GLQ A;  4WKW A;  4BA7 A;  1T00 A;  1TP9 A;  1JLW A;  1K0C A;  3BBY A;  2FLS A;  1JZR A;  3LW9 A;  4G0K A;  1OC8 A;  3P8W A;  1OKT A;  1WP0 A;  2YP6 A;  2B6M A;  1U88 A;  4D73 B;  2HI7 A;  3ZL5 A;  3KMO A;  3F6D A;  4PI2 C;  3D21 A;  4YQM A;  4AKH A;  5IMV A;  3APS A;  3MIX A;  1PL2 A;  3ERF A;  5KEJ A;  4RI7 A;  1CQG A;  3HKR A;  5D9W A;  5E4W A;  1SJZ A;  4GSN A;  2LRT A;  4BWQ A;  3FZA A;  5ECH B;  3A2X A;  1AIU A;  2H6Y A;  4E8H A;  3RHB A;  3Q19 A;  3GV1 A;  3O76 A;  1SKR B;  4E68 A;  1U3I A;  2X99 A;  5IO2 A;  4MZC A;  3ZLP A;  5D9V A;  4X43 A;  4EL1 A;  2FA8 A;  4IQA A;  3TOT A;  2HFD A;  5D96 A;  3DKS A;  1SD8 A;  4GTU A;  3QAW A;  2X8G A;  3KM6 A;  4O5Q A;  1U6T A;  2ZNM A;  1YEW C;  4BPY A;  1X5D A;  2J9H A;  4ML1 A;  1LBK A;  1SL2 B;  5AIV A;  3D6I A;  3TJG A;  10GS A;  2P5Q A;  3FRC A;  2N5F A;  2X8H A;  3FZ4 A;  3EE2 A;  4N3Z A;  4I2T A;  3D4T A;  4ULX A;  1TW9 A;  4PUA A;  4MCU A;  5FHI A;  3EWL A;  2G0F A;  1YZX A;  3KMN A;  2Z9S A;  2AJQ B;  1WJK A;  4D73 A;  4K7N A;  3TCO A;  4Q5N A;  4QMK A;  2O36 A;  4ZB6 A;  1Z6N A;  1ZGN A;  1DBY A;  3WD6 A;  5ECQ B;  2H30 A;  3ZIV A;  1GL8 A;  4GSS A;  1WMJ A;  2HRK A;  2C3Q A;  5G5F A;  2VAF A;  1H4O A;  3GFK A;  3CTF A;  1EWX A;  4IS0 A;  3TJK A;  2KHP A;  1Q4J A;  1Z6M A;  5B6M A;  1QQ2 A;  5LNK e;  1TKD B;  1XWK A;  2DJ2 A;  5GAP D;  2VKZ G;  4PQI A;  2X64 A;  2WW2 A;  4AKI A;  1A2L A;  3GH6 A;  1IYH A;  3EUR A;  2H73 A;  3IXR A;  3PGT A;  4Q5R A;  3IE3 A;  3G7I A;  3VI5 A;  3QCP A;  1N8J A;  3HVV A;  4RUV A;  1MD3 A;  2H0G A;  3IV4 A;  4LLR A;  3QAV A;  1M2B A;  2GST A;  2O89 A;  2ZCT A;  4IJ3 A;  5G31 A;  4TOP A;  2PMT A;  3ZFL A;  4KA0 A;  4KF9 A;  4POL A;  4IW9 A;  3IK7 A;  4PQ1 A;  3M8N A;  3FW2 A;  2IL3 A;  3UIW A;  1FAA A;  4O5U A;  1ZMA A;  3U5R E;  3FK8 A;  4GDF A;  3OR5 A;  4XTS A;  1E6B A;  2OBK A;  5D73 A;  5FT3 A;  5BMU B;  4K8M A;  5B7C A;  4ILF A;  2IMI A;  4CY8 A;  3FMW A;  3CRU A;  3IA1 A;  1FB0 A;  2DJ0 A;  4IGJ A;  4EC0 A;  4V1A p;  2VCW A;  5F07 A;  1OAZ A;  1GSU A;  3CTG A;  4IN0 A;  3CSH A;  3H93 A;  1VF1 A;  3CMI A;  4ACS A;  1O73 A;  3L9V A;  4WR5 A;  1NSW A;  5CRE A;  3RDW A;  1TK0 B;  1YY7 A;  1UA5 A;  3C1S A;  2O7K A;  2CVD A;  3FR6 A;  3O6T A;  5GST A;  2AB6 A;  3BCK A;  1A0R P;  1YVL A;  3P90 A;  5CRD A;  1X0R A;  1R7H A;  4XS1 A;  1AAZ A;  1AQV A;  3RHC A;  4PI0 C;  4MF7 A;  2VL2 C;  2HNL A;  3FHK A;  2R3X A;  3DML A;  2H19 A;  1X9M B;  4KX4 A;  3UMA A;  1BG5 A;  3GA4 A;  3KTB A;  4FYB A;  1TU8 A;  3TRX A;  4TR3 A;  1JHB A;  5A4W A;  3HA9 A;  5BMU A;  4IJI A;  1ZYQ B;  2GQK A;  3DYR A;  2C80 A;  4J2F A;  2B1K A;  3BD2 A;  5D9X A;  1KTE A;  2H76 A;  1PSQ A;  1TRV A;  3C71 A;  2CAQ A;  4GF0 A;  2HSH A;  3LQ7 A;  4OMV A;  2TRX A;  2MMZ A;  1F37 A;  1XOA A;  1XXU A;  3F3R A;  1A8Y A;  5AIX A;  1PRX A;  1GUL A;  2PVO C;  2AUV A;  1PGT A;  1SYR A;  2CVB A;  3ERG A;  4NV5 A;  1YKA A;  1XWB A;  2HSY A;  5JCU A;  3WYW A;  2C0F A;  2A2S A;  2H8L A;  1FO5 A;  2V32 A;  2DBC A;  1I1I P;  3J7Y k;  3IRA A;  4XS4 B;  4CY6 A;  4EDZ A;  2YV9 A;  4LL4 B;  1X5C A;  3IOS A;  2LJK A;  5ELA A;  3ZZX A;  1PA3 A;  2PPT A;  2WFC A;  5CO3 A;  4PUR A;  3QPM A;  4AGS A;  6GST A;  3HHV A;  2M72 A;  2CZ3 A;  2PUK C;  3C8E A;  2RM6 A;  5ELG A;  1O7U A;  3GH9 A;  4IP1 A;  1Q98 A;  8GSS A;  1GH2 A;  3F4T A;  4ZBB A;  1BG1 A;  1QMV A;  3GL5 A;  2HXK A;  3CQF A;  2IMK A;  2L6C A;  2LQO A;  4G0L A;  3F4R A;  2FHE A;  3M1G A;  2NPB A;  3TRQ A;  1FG4 A;  3RFR C;  3VPQ A;  3VWX A;  1K3Y A;  1JLV A;  2RUF A;  1WOU A;  1SKW B;  4O32 A;  2EFC A;  4FQU A;  4G9H A;  3QOU A;  2LRN A;  2LST A;  2I4A A;  3LG6 A;  4ZB8 A;  1XW5 A;  3GX0 A;  2I3Y A;  1XWG A;  3UBK A;  2FA4 A;  2WS2 A;  7GSS A;  1EP7 A;  2GSR A;  5DJL A;  1MDK A;  4TXV A;  5HR0 A;  4KGI A;  1M99 A;  18GS A;  4MNN A;  3GYK A;  3JCM L;  1TI1 A;  1SEN A;  2HZE B;  2YWM A;  2FUG 2;  3L4N A;  4ZL8 A;  3ZYW A;  2WDU A;  3IPZ A;  4HI7 A;  2LKU A;  3H1N A;  4POB A;  5IOW A;  4MJC A;  1A2M A;  4TR0 A;  2LUS A;  3IHG A;  2GSS A;  1F3B A;  5G5E A;  3IK9 A;  2HE3 A;  2NDO A;  4MA9 A;  2ON5 A;  4ZB9 A;  2TRC P;  2HRA A;  3H79 A;  2LNS A;  1WRY A;  2X49 A;  2GT5 A;  1A24 A;  3TB2 A;  2V6K A;  5KOX A;  4HJ2 A;  1ZOF A;  2VOC A;  2VD1 A;  3UVT A;  1M2D A;  5J9C A;  3CBU A;  5IQY A;  2PWJ A;  1XBS A;  2L4Q A;  4ECC A;  4EIP A;  4KSM A;  3ZIJ A;  1C72 A;  3E3E A;  3ZML A;  4GRF A;  1Z5Y E;  1F2E A;  2YV7 A;  3VWV A;  4K6X A;  3TDG A;  2RLI A;  4KAE A;  3F9U A;  5EY6 A;  1AQX A;  4WF5 A;  3HZ4 A;  3DXB A;  3GNJ A;  2HZE A;  4MH3 A;  3K8N A;  4PGT A;  3HD5 A;  2IWT A;  2LEG A;  1EGR A;  4F0B A;  1BYE A;  1TXU A;  3M0F A;  2GDR A;  3ERW A;  5KN0 A;  3S9F A;  1AC1 A;  1AQW A;  2DJ1 A;  4K7I A;  3RPN A;  5GZZ B;  3A2V A;  1Z7R A;  1FB6 A;  1V98 A;  5EVO A;  3E9J B;  4MF6 A;  3WT1 A;  3F63 A;  3M3M A;  4F0C A;  3HJP A;  2O85 A;  2X8C A;  2QA1 A;  3ZVJ A;  5KN2 A;  1T7P B;  2V2G A;  3QD9 A;  1USB A;  3C1R A;  1PX7 A;  2EFH A;  3CSJ A;  5F05 A;  4AF2 A;  2JAC A;  6GSY A;  4X1U A;  3MDK A;  2UZ8 A;  2E0Q A;  5INY A;  1U3A A;  1V9W A;  4K5S A;  4G10 A;  3W6G A;  2YWO A;  1I9D A;  4MZW A;  1ZYP A;  1G6W A;  3FEU A;  2GGT A;  3FYG A;  3LJR A;  4Z2R A;  2VL2 A;  2LS5 A;  1XIY A;  3NIV A;  5B6N A;  1M9B A;  3IBH A;  5ECP B;  1GTB A;  1GUK A;  5GSS A;  4G01 A;  2NVL A;  2C4J A;  2WUL A;  2H1G A;  2LV3 A;  1SVM A;  3GTU B;  2P31 A;  1PKW A;  2H6X A;  2OKA A;  5GAN D;  3TUE A;  3WT2 A;  1LJR A;  4MJA A;  4H86 A;  1PMT A;  3TJB A;  3LFL A;  5LD0 A;  3VPT A;  1BF5 A;  4I2U A;  2KOK A;  5A4V A;  1RW1 A;  5HR2 A;  4XRA A;  3KTL A;  3UEM A;  1SVL A;  4RQR A;  4EVM A;  5J4Y A;  4N30 A;  2QA2 A;  2DLX A;  4ZXG A;  3HVS A;  1K0O A;  4MDC A;  4KCE A;  2WVX B;  3GKX A;  4JR6 A;  5CRH A;  5IMA A;  2EIO A;  2I1U A;  3QFB C;  3I9V 2;  4PXO A;  4BL7 B;  2F8F A;  4OWY A;  3N9J A;  1FVK A;  1M7T A;  1ERV A;  2YOI A;  1SL1 B;  1HQO A;  4DSQ A;  2OAD A;  3I6A A;  1QXH A;  5JWR B;  1G7E A;  4ZIL A;  2DIY A;  1KNG A;  2P0G A;  1TK5 B;  1GSF A;  1G7O A;  1XCC A;  4PQH A;  4KDU A;  2HYX A;  3GTU A;  6GSX A;  1NHY A;  1EEJ A;  5IMC A;  2WGR A;  3HYP A;  3ZVJ D;  1ZYE A;  1BX9 A;  4I6X A;  1EV9 A;  1DE2 A;  5COH A;  3QMX A;  2LRC A;  1TRS A;  2H1D A;  3A2W A;  3TKS C;  3HJM A;  2GQM A;  3GMF A;  4JBB A;  4GLT A;  4YAP A;  3A5I A;  3KJY A;  4MAB A;  2EIQ A;  2EC4 A;  2VL9 A;  3FZ9 A;  6GSU A;  2OAC A;  2R0C A;  4WR4 A;  2H74 A;  1UVZ A;  2OE3 A;  1GTA A;  3IC8 A;  3MAK A;  2WVX A;  4POM A;  2JAD A;  2HLS A;  4EE0 A;  2PER A;  3LSZ A;  3A5W A;  1XW6 A;  3LYP A;  4MH2 A;  3KD0 A;  3KP9 A;  1VRS D;  4BL7 A;  5C00 A;  4W66 A;  2V41 A;  4F03 A;  5G1K A;  1PQN A;  3LWA A;  5J9B A;  4PTS A;  4PHZ C;  4HU9 A;  5ID2 B;  3A3T A;  5J3R A;  3Q18 A;  1B8X A;  3GL3 A;  1EOH A;  3Q6O A;  4KW6 A;  1G0T A;  5IPH A;  1ZL9 A;  4AJ6 A;  3I43 A;  3QDN A;  3BJ5 A;  3V1W A;  1N25 A;  2FD3 A;  5J5N A;  1T1V A;  5H5R A;  4BIK A;  3MNG A;  1FHE A;  3WGE A;  2BTO T;  1XW9 A;  2OT3 A;  2FGX A;  1A8L A;  1JZO A;  2O3E A;  1OE7 A;  2I81 A;  2R4V A;  5IPG A;  3UAR A;  3EVI A;  2L59 A;  1LU4 A;  1SK2 A;  1HNB A;  1M3I A;  4L0W A;  1GLP A;  5BRT A;  5D8I A;  1GUM A;  2VIM A;  1GSY A;  4I8B A;  2XBI A;  2TIR A;  1XWC A;  3TRP A;  4F9Z A;  3DGQ A;  4XS6 A;  3CHX C;  1V58 A;  2O8V B;  3RPP A;  3HMJ G;  1AUC A;  3HZ8 A;  5ID2 A;  4CW9 A;  4NXI A;  1SVO A;  4EF0 A;  1FOV A;  2XPE A;  1JZW A;  2CX3 A;  2L5O A;  1XZO A;  3UVH A;  2VLV A;  3MSZ A;  3L78 A;  1PKZ A;  4ID0 A;  1HYU A;  4OCF A;  1TRW A;  2GTU A;  5JWQ B;  3LXZ A;  2MBS A;  4TKY A;  2H71 A;  1A2J A;  3Q74 A;  2JZS A;  3LEF A;  1SJ6 A;  1J0F A;  2HZF A;  2M80 A;  3RAZ A;  1EZK A;  2F8A A;  2B7J A;  2YWI A;  1ILO A;  4TXO B;  4YH2 A;  2REM A;  5CRW A;  4WBJ A;  4QQ7 A;  2RM5 A;  2WJU A;  1EP8 A;  2K6V A;  1SJI A;  4IHU A;  2JZR A;  3NZN A;  4Z2U A;  1B9X C;  4EKZ A;  3F6F A;  2E2G A;  4NAX A;  5ENU A;  1XPV A;  4MMM A;  4L8E A;  1G6Y A;  3KGK A;  5FWG A;  4XIH A;  11GS A;  5IMZ A;  1B4Q A;  2GLR A;  1W4V A;  3GKM A;  3N5O A;  2YJH A;  4FYC A;  5H5S A;  4RQX A;  2FWF A;  4L5O A;  2YCD A;  5KN1 A;  1R26 A;  3FR3 A;  3H4K A;  3IHQ A;  5IO0 A;  4WBR D;  4XCS A;  5DVB A;  4HDE A;  4K2X A;  3M9K A;  1SKS B;  3F0I A;  2VCT A;  3QR6 A;  2MMA A;  2WZS A;  2RUE A;  1OC3 A;  2IN3 A;  1EGO A;  4AKX B;  1EOG A;  3TKS E;  2CQ9 A;  1OVN A;  2C1Y A;  4I97 A;  2OE0 A;  2FNO A;  1X5E A;  3GHA A;  1F9M A;  1K0A A;  3L9S A;  3VWU A;  1JZD A;  4Q5F A;  2YAN A;  1SU9 A;  3EU4 A;  4XHM A;  1GP1 A;  1ZCP A;  2UV8 G;  1ERT A;  3G7Y A;  3TKP A;  5L71 A;  4TXO A;  4KUN A;  2JSY A;  1K0M A;  4OO4 A;  2LJA A;  4V2M A;  1PN0 A;  3FR9 A;  2VM1 A;  5A4U A;  2GZZ A;  2H6Z A;  1JFU A;  1M0U A;  2L6D A;  2XHF A;  4WEY A;  20GS A;  2LTK A;  1R5P A;  3EC3 A;  4O92 A;  5J4V A;  3LGC A;  4G19 A;  1YEX A;  2IFQ B;  5DDL A;  4XS4 A;  3VFI A;  5J41 A;  1MDJ A;  3QAG A;  2IIY A;  1WE0 A;  3ZRE A;  4KND A;  4X0X A;  2HRF A;  1K3O A;  4HOJ A;  2H72 A;  2V6O A;  4JZQ A;  3P7X A;  2HRN A;  1K0B A;  2H0H A;  5IIZ A;  3TKS A;  5DJM A;  2GVP A;  1YJ6 A;  3WGX A;  4F82 A;  1HNA A;  5AN1 A;  4HQZ A;  1S3C A;  1ABA A;  1GNE A;  1S3R A;  1ON4 A;  3R2Q A;  2VLU A;  1O85 A;  2JSZ A;  3LYK A;  3HDC A;  3DRN A;  1TU7 A;  5D9T A;  4TRX A;  3UBL A;  4AJ8 A;  4ZB7 A;  3HY2 A;  2DIZ A;  1V40 A;  4BVX B;  4YKG A;  1ERW A;  1GRX A;  2C3N A;  3WGD A;  4I5Q A;  3ME7 A;  4JU5 A;  3E0U A;  19GS A;  5ECI B;  1ML6 A;  3KZQ A;  3HJO A;  4L0U A;  1ACV A;  4MZB A;  4KE3 A;  2F9S A;  4G0I A;  2ZUP A;  4KDY A;  1R4W A;  1FVJ A;  2IFQ A;  4YKF A;  3VLN A;  2M46 A;  6GSV A;  3R3E A;  4O7H A;  1MEK A;  3GUS A;  2C0D A;  4MF5 A;  3SBC A;  4Q5Q A;  1SD9 A;  4USS A;  2MMN A;  3GST A;  1Y6E A;  4LA1 A;  1RQM A;  2CVK A;  3EPT A;  1DUG A;  3VWW A;  4HQS A;  3CWG A;  3EMX A;  3DEX A;  5G30 A;  1Y1U A;  1IYI A;  1M2A A;  2DKI A;  2KP1 A;  1QGV A;  3QFA C;  1OYJ A;  3PIN A;  1URM A;  2IPA A;  3PR8 A;  1HNC A;  3HVN A;  4BVX A;  4F2I A;  1PD2 1;  3VI7 A;  1T4Y A;  5DBQ A;  2YZU A;  1O81 A;  4J56 E;  2H01 A;  2EFE A;  4XRD A;  2C0E A;  3TKR A;  5KOW A;  4MJE A;  2HSM B;  4BWS A;  2WW3 A;  4Z7X A;  3IAS 2;  1XFL A;  3GSS A;  1QK8 A;  3VK9 A;  2H70 A;  2WCI A;  3GKN A;  2OE1 A;  1F3A A;  2WRT A;  2JL4 A;  2VO4 A;  5A5K A;  2QGV A;  4ZBD A;  2DKH A;  4OFT A;  3SWL A;  4FXY P;  4G2E A;  2N5A A;  3BOA A;  3FY7 A;  4GCI A;  5HFK A;  1F6M C;  1FW1 A;  1GUH A;  2MMO A;  4N10 A;  1MTC A;  2FWE A;  1K0D A;  1HD2 A;  5IMF A;  1OC9 B;  4IEL A;  2CZ2 A;  4GST A;  3RGB C;  2D2Z A;  4DEJ A;  2OJL A;  2FCH A;  2A4V A;  2DJK A;  3TKQ A;  1J08 A;  4O5R A;  4OO5 A;  1R5A A;  5DCG A;  2G2Q A;  4AI6 A;  4MJB A;  5KN3 A;  5ABR A;  1V57 A;  2H66 A;  1YEP A;  4KSO A;  2K8V A;  3HVX A;  2QKE A;  1THO A;  1MDI A;  4LMV A;  4A5P A;  2LNT A;  1DSB A;  5DQS A;  1BED A;  2GZP A;  1GTU A;  1B48 A;  1GSQ A;  1KBN A;  4NPB A;  1OKD A;  2VM2 A;  2HRK B;  4K0G A;  2HSM A;  1YF1 A;  2OBI A;  4DSS B;  4V2L A;  1ZZY A;  3U6V A;  5ECS A;  2ON7 A;  14GS A;  9GSS A;  4EXJ A;  1ST9 A;  2KLX A;  1A0F A;  2P5R A;  2X4A A;  2B5Y A;  3C7M A;  5DAK B;  3DD3 A;  4NHZ A;  4K1F A;  5A1N B;  4TR4 A;  4OCE A;  2OA7 A;  3ZMK A;  5IM9 A;  1YF0 A;  2LQQ A;  2GSQ A;  1ERU A;  2BJX A;  2DML A;  2IJY A;  3PH9 A;  2C0G A;  1PN9 A;  4E8E A;  5A5H B;  2ALB A;  1BAY A;  3ME8 A;  4GQF A;  1OC9 A;  2VD0 A;  2B5X A;  3H8Q A;  4N0Z A;  1XOB A;  3EU3 A;  2CX4 A;  2JZT A;  1O8X A;  1X9W B;  3TJJ A;  2NBS A;  3ZIT A;  5AIS A;  4IP6 A;  2K9F A;  2DSA A;  2PU9 C;  3US3 A;  1CQH A;  2VL3 A;  1O8W A;  3KH7 A;  5EL8 A;  1EV4 A;  2HT9 A;  6GSW A;  3W8J A;  2L4C A;  4JED A;  1YQ1 A;  2K18 A;  2EFD A;  2B7K A;  1GNW A;  2A4H A;  4X4J A;  1GTI A;  3LOR A;  5J47 A;  4DSS A;  3HXS A;  4KCA A;  1TDI A;  2XBQ A;  4K5R A;  4FIW A;  5F0G A;  2B3S A;  4FO5 A;  4PUF C;  2YJ7 A;  5F8B A;  3FKF A;  1TJD A;  3L0H A;  3RBT A;  3TU3 B;  5DAK A;  1H75 A;  5G2Z A;  4CHS A;  4ML6 A;  5A1N A;  2HSN B;  1FOH A;  4TVE A;  2R2J A;  2GT6 A;  2YWN A;  4LMW A;  4DSR A;  2I9H A;  2IMF A;  5CYY A;  1XVW A;  3TGZ A;  5A5H A;  2IME A;  3TJF A;  3GUR A;  2H0I A;  2GQL A;  4OFN A;  2O87 A;  5C04 A;  2CT6 A;  4AJ7 A;  1NW2 A;  4FYU A;  1YKC A;  3GRX A;  3D22 A;  2XC2 A;  3KH9 A;  3W8S A;  2VCV A;  5LCZ A;  1RK4 A;  1QUW A;  3TOU A;  1S4B P;  1DE1 A;  5HR1 A;  1MD4 A;  2A2P A;  2MZC A;  17GS A;  2A2R A;  3UL3 A;  1GSS A;  4RI6 A;  4DVC A;  4KDX A;  2HSN A;  4MPF A;  2QSI A;  1T3B A;  2CAI A;  2MYG A;  1WWJ A;  4ZIJ A;  1J9B A;  1W89 A;  22GS A;  1EEM A;  3DIE A;  4ISD A;  2NTO A;  5CNW A;  2R6K A;  2JU5 A;  2VCQ A;  4KB3 A;  5CP1 A;  1QFN A;  3APQ A;  2FWH A;  3ZFB A;  4WXT A;  2KP2 A;  5AGY A;  5HQP A;  3M9J A;  4PX1 A;  2WVY A;  4GQC A;  5IOX A;  3L9U A;  2R0P A;  2YZH A;  5A34 B;  3ZRD A;  1PL1 A;  5JCW A;  4EIQ A;  4MLY A; 
#chains in the Genus database with same CATH homology
 2C8U A;  1O6J A;  1OE8 A;  5D93 A;  4EO3 A;  4K2D A;  2PGT A;  4V1A g;  5ECR B;  2BMX A;  4AKG A;  4ZL7 A;  3KIJ A;  4WET A;  4MPG A;  2H1A A;  1BJX A;  3GIX A;  1XWA A;  5JWO B;  3FZ5 A;  6GSS A;  4MP4 A;  1UN2 A;  5EPF A;  2IMD A;  4NV2 A;  1S3A A;  4ECI A;  1AW9 A;  4P3Y B;  1TTZ A;  2H1B A;  2PN8 A;  1K0N A;  3D5J A;  5ECN B;  3UJ1 A;  2H1L A;  1SL0 B;  4ECB A;  4YQV A;  4QL9 A;  1E2Y A;  2VCZ A;  1THX A;  4JRR A;  4HS1 A;  1I5G A;  2J23 A;  4FH8 A;  2DC5 A;  3EYT A;  1U87 A;  2MBT A;  3NOF A;  4L5L A;  1WIK A;  4TR1 B;  5DAL B;  12GS A;  4MK3 A;  1TXX A;  5HR3 A;  4IVF A;  2DJJ A;  2AV4 A;  5ECM B;  5ECL B;  5CRG A;  5HFG A;  4BVY B;  4QL7 A;  2E7P A;  1K3L A;  5A34 A;  4K9Z A;  2EIR A;  2R5G A;  1GSD A;  4ICY A;  1T8E B;  4ZBA A;  3MYD A;  4HUA A;  1T4Z A;  2LJR A;  2F51 A;  3KEB A;  1B9Y C;  3IDV A;  2E2M A;  1V2A A;  2CV4 A;  1A23 A;  3DVX A;  2AAW A;  2WZ9 A;  1VF2 A;  2N5B A;  16GS A;  1VF4 A;  2F3M A;  2B1L A;  5DCH A;  2AYT A;  1PX6 A;  1BQ7 A;  4Z2T A;  2WB9 A;  1S3D A;  1TI3 A;  4YAV A;  4OD7 A;  4NMU A;  1NHO A;  4TW5 A;  1VF3 A;  3BCI A;  3EMP A;  2B5E A;  3MWH A;  4HU7 A;  4TR1 A;  5DAL A;  1UC7 A;  2H75 A;  2V1M A;  4GXZ A;  1Y25 A;  1KEB A;  2PVQ A;  1Z9H A;  2R0G A;  3CSI A;  3DWV A;  4HEA 2;  4K7O A;  3PPU A;  4HJM A;  4BVY A;  1AXD A;  5G1L A;  3G9B A;  3D0Z A;  2FY6 A;  2DMM A;  3UOM A;  2O5V A;  1SYX A;  1VGL A;  1Z7P A;  1GSE A;  3F4S A;  1X9S B;  4IQ1 A;  2VUP A;  3F3Q A;  3GX8 A;  4ZL9 A;  4POK A;  2AHE A;  2L5L A;  2YNX A;  5JCG A;  2ES7 A;  3DVW A;  4EDY A;  3UAP A;  4JE1 A;  3IR4 A;  3GN3 A;  3AY8 A;  3ZTL A;  5F06 A;  4IBP A;  1WPI A;  1ZYN A;  5B8B A;  3LXT A;  5ECO B;  1TK8 B;  3APO A;  4ECJ A;  2L57 A;  2KUC A;  3KP8 A;  5J40 A;  5HFI A;  3IAM 2;  4WF4 A;  4PNG A;  4JR4 A;  2DJ3 A;  3EIN A;  4PNF A;  4OFM A;  3I69 A;  4N11 A;  1B4P A;  2K8S A;  1NM3 A;  4V2N A;  1M9A A;  2FWG A;  5E59 A;  1SK0 A;  3F8U A;  2CA8 A;  3J7Y b;  1N2A A;  4K0N A;  1GWC A;  2YPM A;  5J4U A;  3G7J A;  13GS A;  4IKH A;  2HQT A;  3ISO A;  1TRU A;  1Z3E A;  3ED3 A;  4NWY A;  2XPD A;  3VUR A;  2GS3 A;  3GKK A;  1SK1 A;  4LL1 B;  2PBJ A;  3IC4 A;  4N0V A;  5IMD A;  2GZY A;  4J57 E;  3CYN A;  3KCM A;  5ECK B;  1YDK A;  3CRT A;  4KH7 A;  4NHW A;  2QC7 A;  4EUY A;  2RII A;  2YN1 A;  4GWR A;  4HZ4 A;  3P2A A;  2C3T A;  1TOF A;  5H5Q A;  2VCX A;  1XVQ A;  2VLT A;  3KXO A;  5CAX A;  3D4M A;  3CXG A;  4HZ2 A;  2R37 A;  3C73 A;  5DQY A;  4CDO A;  3HCZ A;  3O3T A;  5B8A A;  4YQU A;  4TN8 A;  1GLQ A;  4WKW A;  4BA7 A;  1T00 A;  1TP9 A;  1JLW A;  1K0C A;  3BBY A;  2FLS A;  1JZR A;  3LW9 A;  4G0K A;  1OC8 A;  3P8W A;  1OKT A;  1WP0 A;  2YP6 A;  2B6M A;  1U88 A;  4D73 B;  2HI7 A;  3ZL5 A;  3KMO A;  3F6D A;  3D21 A;  4YQM A;  4AKH A;  5IMV A;  3APS A;  3MIX A;  1PL2 A;  3ERF A;  5KEJ A;  4RI7 A;  1CQG A;  3HKR A;  5D9W A;  5E4W A;  1SJZ A;  4GSN A;  2LRT A;  4BWQ A;  3FZA A;  5ECH B;  3A2X A;  1AIU A;  2H6Y A;  4E8H A;  3RHB A;  3Q19 A;  3GV1 A;  3O76 A;  1SKR B;  4E68 A;  1U3I A;  2X99 A;  5IO2 A;  4MZC A;  3ZLP A;  5D9V A;  4X43 A;  4EL1 A;  2FA8 A;  4IQA A;  3TOT A;  2HFD A;  5D96 A;  3DKS A;  1SD8 A;  4GTU A;  3QAW A;  2X8G A;  3KM6 A;  4O5Q A;  1U6T A;  2ZNM A;  4BPY A;  1X5D A;  2J9H A;  4ML1 A;  1LBK A;  1SL2 B;  5AIV A;  3D6I A;  3TJG A;  10GS A;  2P5Q A;  3FRC A;  2N5F A;  2X8H A;  3FZ4 A;  3EE2 A;  4N3Z A;  4I2T A;  3D4T A;  4ULX A;  1TW9 A;  4PUA A;  4MCU A;  5FHI A;  3EWL A;  2G0F A;  1YZX A;  3KMN A;  2Z9S A;  2AJQ B;  1WJK A;  4D73 A;  4K7N A;  3TCO A;  4Q5N A;  4QMK A;  4ZB6 A;  1Z6N A;  1ZGN A;  1DBY A;  3WD6 A;  5ECQ B;  2H30 A;  3ZIV A;  1GL8 A;  4GSS A;  1WMJ A;  2HRK A;  2C3Q A;  5G5F A;  2VAF A;  1H4O A;  3GFK A;  3CTF A;  1EWX A;  4IS0 A;  3TJK A;  2KHP A;  1Q4J A;  1Z6M A;  5B6M A;  1QQ2 A;  5LNK e;  1TKD B;  1XWK A;  2DJ2 A;  5GAP D;  2VKZ G;  4PQI A;  2X64 A;  4AKI A;  1A2L A;  3GH6 A;  1IYH A;  3EUR A;  2H73 A;  3IXR A;  3PGT A;  4Q5R A;  3IE3 A;  3G7I A;  3VI5 A;  3QCP A;  1N8J A;  3HVV A;  4RUV A;  1MD3 A;  2H0G A;  3IV4 A;  4LLR A;  3QAV A;  1M2B A;  2GST A;  2O89 A;  2ZCT A;  4IJ3 A;  5G31 A;  4TOP A;  2PMT A;  3ZFL A;  4KA0 A;  4KF9 A;  4POL A;  4IW9 A;  3IK7 A;  4PQ1 A;  3M8N A;  3FW2 A;  2IL3 A;  3UIW A;  1FAA A;  4O5U A;  1ZMA A;  3U5R E;  3FK8 A;  4GDF A;  3OR5 A;  4XTS A;  1E6B A;  2OBK A;  5D73 A;  5FT3 A;  5BMU B;  4K8M A;  5B7C A;  4ILF A;  2IMI A;  4CY8 A;  3FMW A;  3CRU A;  3IA1 A;  1FB0 A;  2DJ0 A;  4IGJ A;  4EC0 A;  4V1A p;  2VCW A;  5F07 A;  1OAZ A;  1GSU A;  3CTG A;  4IN0 A;  3CSH A;  3H93 A;  1VF1 A;  3CMI A;  4ACS A;  1O73 A;  3L9V A;  4WR5 A;  1NSW A;  5CRE A;  3RDW A;  1TK0 B;  1YY7 A;  1UA5 A;  3C1S A;  2O7K A;  2CVD A;  3FR6 A;  3O6T A;  5GST A;  2AB6 A;  3BCK A;  1A0R P;  1YVL A;  3P90 A;  5CRD A;  1X0R A;  1R7H A;  4XS1 A;  1AAZ A;  1AQV A;  3RHC A;  4MF7 A;  2VL2 C;  2HNL A;  3FHK A;  2R3X A;  3DML A;  2H19 A;  1X9M B;  4KX4 A;  3UMA A;  1BG5 A;  3GA4 A;  3KTB A;  4FYB A;  1TU8 A;  3TRX A;  4TR3 A;  1JHB A;  5A4W A;  3HA9 A;  5BMU A;  4IJI A;  1ZYQ B;  2GQK A;  3DYR A;  2C80 A;  4J2F A;  2B1K A;  3BD2 A;  5D9X A;  1KTE A;  2H76 A;  1PSQ A;  1TRV A;  3C71 A;  2CAQ A;  4GF0 A;  2HSH A;  3LQ7 A;  4OMV A;  2TRX A;  2MMZ A;  1F37 A;  1XOA A;  1XXU A;  3F3R A;  1A8Y A;  5AIX A;  1PRX A;  1GUL A;  2PVO C;  2AUV A;  1PGT A;  1SYR A;  2CVB A;  3ERG A;  4NV5 A;  1YKA A;  1XWB A;  2HSY A;  5JCU A;  3WYW A;  2C0F A;  2A2S A;  2H8L A;  1FO5 A;  2V32 A;  2DBC A;  3J7Y k;  3IRA A;  4XS4 B;  4CY6 A;  4EDZ A;  2YV9 A;  4LL4 B;  1X5C A;  3IOS A;  2LJK A;  5ELA A;  3ZZX A;  1PA3 A;  2PPT A;  2WFC A;  5CO3 A;  4PUR A;  3QPM A;  4AGS A;  6GST A;  3HHV A;  2M72 A;  2CZ3 A;  2PUK C;  3C8E A;  2RM6 A;  5ELG A;  1O7U A;  3GH9 A;  4IP1 A;  1Q98 A;  8GSS A;  1GH2 A;  3F4T A;  4ZBB A;  1BG1 A;  1QMV A;  3GL5 A;  2HXK A;  2IMK A;  2L6C A;  2LQO A;  4G0L A;  3F4R A;  2FHE A;  3M1G A;  2NPB A;  3TRQ A;  1FG4 A;  3VPQ A;  3VWX A;  1K3Y A;  1JLV A;  2RUF A;  1WOU A;  1SKW B;  4O32 A;  2EFC A;  4FQU A;  4G9H A;  3QOU A;  2LRN A;  2LST A;  2I4A A;  3LG6 A;  4ZB8 A;  1XW5 A;  3GX0 A;  2I3Y A;  1XWG A;  3UBK A;  2FA4 A;  2WS2 A;  7GSS A;  1EP7 A;  2GSR A;  5DJL A;  1MDK A;  4TXV A;  5HR0 A;  4KGI A;  1M99 A;  18GS A;  4MNN A;  3GYK A;  3JCM L;  1TI1 A;  1SEN A;  2HZE B;  2YWM A;  2FUG 2;  3L4N A;  4ZL8 A;  3ZYW A;  2WDU A;  3IPZ A;  4HI7 A;  2LKU A;  3H1N A;  4POB A;  5IOW A;  4MJC A;  1A2M A;  4TR0 A;  2LUS A;  3IHG A;  2GSS A;  1F3B A;  5G5E A;  3IK9 A;  2HE3 A;  2NDO A;  4MA9 A;  2ON5 A;  4ZB9 A;  2TRC P;  2HRA A;  3H79 A;  2LNS A;  1WRY A;  2X49 A;  2GT5 A;  1A24 A;  3TB2 A;  2V6K A;  5KOX A;  4HJ2 A;  1ZOF A;  2VOC A;  2VD1 A;  3UVT A;  1M2D A;  5J9C A;  3CBU A;  5IQY A;  2PWJ A;  1XBS A;  2L4Q A;  4ECC A;  4EIP A;  4KSM A;  3ZIJ A;  1C72 A;  3E3E A;  3ZML A;  4GRF A;  1Z5Y E;  1F2E A;  2YV7 A;  3VWV A;  4K6X A;  3TDG A;  2RLI A;  4KAE A;  3F9U A;  5EY6 A;  1AQX A;  4WF5 A;  3HZ4 A;  3DXB A;  3GNJ A;  2HZE A;  4MH3 A;  3K8N A;  4PGT A;  3HD5 A;  2IWT A;  2LEG A;  1EGR A;  4F0B A;  1BYE A;  1TXU A;  3M0F A;  2GDR A;  3ERW A;  5KN0 A;  3S9F A;  1AC1 A;  1AQW A;  2DJ1 A;  4K7I A;  3RPN A;  5GZZ B;  3A2V A;  1Z7R A;  1FB6 A;  1V98 A;  5EVO A;  3E9J B;  4MF6 A;  3WT1 A;  3F63 A;  3M3M A;  4F0C A;  3HJP A;  2O85 A;  2X8C A;  2QA1 A;  3ZVJ A;  5KN2 A;  1T7P B;  2V2G A;  3QD9 A;  1USB A;  3C1R A;  1PX7 A;  2EFH A;  3CSJ A;  5F05 A;  4AF2 A;  2JAC A;  6GSY A;  4X1U A;  3MDK A;  2UZ8 A;  2E0Q A;  5INY A;  1U3A A;  1V9W A;  4K5S A;  4G10 A;  3W6G A;  2YWO A;  1I9D A;  4MZW A;  1ZYP A;  1G6W A;  3FEU A;  2GGT A;  3FYG A;  3LJR A;  4Z2R A;  2VL2 A;  2LS5 A;  1XIY A;  3NIV A;  5B6N A;  1M9B A;  3IBH A;  5ECP B;  1GTB A;  1GUK A;  5GSS A;  4G01 A;  2NVL A;  2C4J A;  2WUL A;  2H1G A;  2LV3 A;  1SVM A;  3GTU B;  2P31 A;  1PKW A;  2H6X A;  2OKA A;  5GAN D;  3TUE A;  3WT2 A;  1LJR A;  4MJA A;  4H86 A;  1PMT A;  3TJB A;  3LFL A;  5LD0 A;  3VPT A;  1BF5 A;  4I2U A;  2KOK A;  5A4V A;  1RW1 A;  5HR2 A;  4XRA A;  3KTL A;  3UEM A;  1SVL A;  4RQR A;  4EVM A;  5J4Y A;  4N30 A;  2QA2 A;  2DLX A;  4ZXG A;  3HVS A;  1K0O A;  4MDC A;  4KCE A;  3GKX A;  4JR6 A;  5CRH A;  5IMA A;  2EIO A;  2I1U A;  3QFB C;  3I9V 2;  4PXO A;  4BL7 B;  2F8F A;  4OWY A;  3N9J A;  1FVK A;  1M7T A;  1ERV A;  2YOI A;  1SL1 B;  1HQO A;  4DSQ A;  2OAD A;  3I6A A;  1QXH A;  5JWR B;  1G7E A;  4ZIL A;  2DIY A;  1KNG A;  2P0G A;  1TK5 B;  1GSF A;  1G7O A;  1XCC A;  4PQH A;  4KDU A;  2HYX A;  3GTU A;  6GSX A;  1NHY A;  1EEJ A;  5IMC A;  2WGR A;  3HYP A;  3ZVJ D;  1ZYE A;  1BX9 A;  4I6X A;  1EV9 A;  1DE2 A;  5COH A;  3QMX A;  2LRC A;  1TRS A;  2H1D A;  3A2W A;  3TKS C;  3HJM A;  2GQM A;  3GMF A;  4JBB A;  4GLT A;  4YAP A;  3A5I A;  3KJY A;  4MAB A;  2EIQ A;  2EC4 A;  2VL9 A;  3FZ9 A;  6GSU A;  2OAC A;  2R0C A;  4WR4 A;  2H74 A;  1UVZ A;  2OE3 A;  1GTA A;  3IC8 A;  3MAK A;  4POM A;  2JAD A;  2HLS A;  4EE0 A;  2PER A;  3LSZ A;  3A5W A;  1XW6 A;  3LYP A;  4MH2 A;  3KD0 A;  3KP9 A;  1VRS D;  4BL7 A;  5C00 A;  4W66 A;  2V41 A;  4F03 A;  5G1K A;  1PQN A;  3LWA A;  5J9B A;  4PTS A;  4HU9 A;  5ID2 B;  5J3R A;  3A3T A;  3Q18 A;  1B8X A;  3GL3 A;  1EOH A;  3Q6O A;  4KW6 A;  1G0T A;  5IPH A;  1ZL9 A;  4AJ6 A;  3I43 A;  3QDN A;  3BJ5 A;  3V1W A;  1N25 A;  2FD3 A;  5J5N A;  1T1V A;  5H5R A;  3MNG A;  1FHE A;  3WGE A;  2BTO T;  1XW9 A;  2OT3 A;  2FGX A;  1A8L A;  1JZO A;  1OE7 A;  2I81 A;  2R4V A;  5IPG A;  3UAR A;  3EVI A;  2L59 A;  1LU4 A;  1SK2 A;  1HNB A;  4L0W A;  1GLP A;  5BRT A;  5D8I A;  1GUM A;  2VIM A;  1GSY A;  4I8B A;  2XBI A;  2TIR A;  1XWC A;  3TRP A;  4F9Z A;  3DGQ A;  4XS6 A;  1V58 A;  2O8V B;  3RPP A;  3HMJ G;  1AUC A;  3HZ8 A;  5ID2 A;  4CW9 A;  4NXI A;  1SVO A;  4EF0 A;  1FOV A;  2XPE A;  1JZW A;  2CX3 A;  2L5O A;  1XZO A;  3UVH A;  2VLV A;  3MSZ A;  3L78 A;  1PKZ A;  4ID0 A;  1HYU A;  4OCF A;  1TRW A;  2GTU A;  5JWQ B;  3LXZ A;  2MBS A;  4TKY A;  2H71 A;  1A2J A;  3Q74 A;  2JZS A;  3LEF A;  1SJ6 A;  1J0F A;  2HZF A;  2M80 A;  3RAZ A;  1EZK A;  2F8A A;  2B7J A;  2YWI A;  1ILO A;  4TXO B;  4YH2 A;  2REM A;  5CRW A;  4WBJ A;  4QQ7 A;  2RM5 A;  2WJU A;  1EP8 A;  2K6V A;  1SJI A;  4IHU A;  2JZR A;  3NZN A;  4Z2U A;  1B9X C;  4EKZ A;  3F6F A;  2E2G A;  4NAX A;  5ENU A;  1XPV A;  4MMM A;  4L8E A;  1G6Y A;  3KGK A;  5FWG A;  4XIH A;  11GS A;  5IMZ A;  1B4Q A;  2GLR A;  1W4V A;  3GKM A;  3N5O A;  2YJH A;  4FYC A;  5H5S A;  4RQX A;  2FWF A;  4L5O A;  2YCD A;  5KN1 A;  1R26 A;  3FR3 A;  3H4K A;  3IHQ A;  5IO0 A;  4WBR D;  4XCS A;  5DVB A;  4HDE A;  4K2X A;  3M9K A;  1SKS B;  3F0I A;  2VCT A;  3QR6 A;  2MMA A;  2RUE A;  1OC3 A;  2IN3 A;  1EGO A;  4AKX B;  1EOG A;  3TKS E;  2CQ9 A;  1OVN A;  2C1Y A;  4I97 A;  2OE0 A;  2FNO A;  1X5E A;  3GHA A;  1F9M A;  1K0A A;  3L9S A;  3VWU A;  1JZD A;  4Q5F A;  2YAN A;  1SU9 A;  3EU4 A;  4XHM A;  1GP1 A;  1ZCP A;  2UV8 G;  1ERT A;  3G7Y A;  3TKP A;  5L71 A;  4TXO A;  4KUN A;  2JSY A;  1K0M A;  4OO4 A;  2LJA A;  4V2M A;  1PN0 A;  3FR9 A;  2VM1 A;  5A4U A;  2GZZ A;  2H6Z A;  1JFU A;  1M0U A;  2L6D A;  2XHF A;  4WEY A;  20GS A;  2LTK A;  1R5P A;  3EC3 A;  4O92 A;  5J4V A;  3LGC A;  4G19 A;  1YEX A;  2IFQ B;  5DDL A;  4XS4 A;  3VFI A;  5J41 A;  1MDJ A;  3QAG A;  2IIY A;  1WE0 A;  3ZRE A;  4KND A;  4X0X A;  2HRF A;  1K3O A;  4HOJ A;  2H72 A;  2V6O A;  4JZQ A;  3P7X A;  2HRN A;  1K0B A;  2H0H A;  5IIZ A;  3TKS A;  5DJM A;  2GVP A;  1YJ6 A;  3WGX A;  4F82 A;  1HNA A;  5AN1 A;  4HQZ A;  1S3C A;  1ABA A;  1GNE A;  2VLU A;  1ON4 A;  3R2Q A;  1O85 A;  2JSZ A;  3LYK A;  3HDC A;  3DRN A;  1TU7 A;  5D9T A;  4TRX A;  3UBL A;  4AJ8 A;  4ZB7 A;  3HY2 A;  2DIZ A;  1V40 A;  4BVX B;  4YKG A;  1ERW A;  1GRX A;  2C3N A;  3WGD A;  4I5Q A;  3ME7 A;  4JU5 A;  3E0U A;  19GS A;  5ECI B;  1ML6 A;  3KZQ A;  3HJO A;  4L0U A;  1ACV A;  4MZB A;  4KE3 A;  2F9S A;  4G0I A;  2ZUP A;  4KDY A;  1R4W A;  1FVJ A;  2IFQ A;  4YKF A;  3VLN A;  2M46 A;  6GSV A;  3R3E A;  4O7H A;  1MEK A;  3GUS A;  2C0D A;  4MF5 A;  3SBC A;  4Q5Q A;  1SD9 A;  4USS A;  2MMN A;  3GST A;  1Y6E A;  4LA1 A;  1RQM A;  2CVK A;  3EPT A;  1DUG A;  3VWW A;  4HQS A;  3CWG A;  3EMX A;  3DEX A;  5G30 A;  1Y1U A;  1IYI A;  1M2A A;  2DKI A;  2KP1 A;  1QGV A;  3QFA C;  1OYJ A;  3PIN A;  1URM A;  2IPA A;  3PR8 A;  1HNC A;  4BVX A;  4F2I A;  1PD2 1;  3VI7 A;  1T4Y A;  5DBQ A;  2YZU A;  1O81 A;  4J56 E;  2H01 A;  2EFE A;  4XRD A;  2C0E A;  3TKR A;  5KOW A;  4MJE A;  2HSM B;  4BWS A;  4Z7X A;  3IAS 2;  1XFL A;  3GSS A;  1QK8 A;  3VK9 A;  2H70 A;  2WCI A;  3GKN A;  2OE1 A;  1F3A A;  2WRT A;  2JL4 A;  2VO4 A;  5A5K A;  2QGV A;  4ZBD A;  2DKH A;  4OFT A;  3SWL A;  4G2E A;  2N5A A;  3BOA A;  3FY7 A;  4GCI A;  5HFK A;  1F6M C;  1FW1 A;  1GUH A;  2MMO A;  4N10 A;  1MTC A;  2FWE A;  1K0D A;  1HD2 A;  5IMF A;  1OC9 B;  4IEL A;  2CZ2 A;  4GST A;  2D2Z A;  4DEJ A;  2OJL A;  2FCH A;  2A4V A;  2DJK A;  3TKQ A;  1J08 A;  4O5R A;  4OO5 A;  1R5A A;  5DCG A;  2G2Q A;  4AI6 A;  4MJB A;  5KN3 A;  5ABR A;  1V57 A;  2H66 A;  1YEP A;  4KSO A;  2K8V A;  3HVX A;  2QKE A;  1THO A;  1MDI A;  4LMV A;  4A5P A;  2LNT A;  1DSB A;  5DQS A;  1BED A;  2GZP A;  1GTU A;  1B48 A;  1GSQ A;  1KBN A;  4NPB A;  1OKD A;  2VM2 A;  2HRK B;  4K0G A;  2HSM A;  1YF1 A;  2OBI A;  4DSS B;  4V2L A;  1ZZY A;  3U6V A;  5ECS A;  2ON7 A;  14GS A;  9GSS A;  4EXJ A;  1ST9 A;  2KLX A;  1A0F A;  2P5R A;  2X4A A;  2B5Y A;  3C7M A;  5DAK B;  3DD3 A;  4NHZ A;  4K1F A;  5A1N B;  4TR4 A;  4OCE A;  2OA7 A;  3ZMK A;  5IM9 A;  1YF0 A;  2LQQ A;  2GSQ A;  1ERU A;  2BJX A;  2DML A;  2IJY A;  3PH9 A;  2C0G A;  1PN9 A;  4E8E A;  5A5H B;  2ALB A;  3ME8 A;  1BAY A;  4GQF A;  1OC9 A;  2VD0 A;  2B5X A;  3H8Q A;  4N0Z A;  1XOB A;  3EU3 A;  2CX4 A;  2JZT A;  1O8X A;  1X9W B;  3TJJ A;  2NBS A;  3ZIT A;  5AIS A;  4IP6 A;  2K9F A;  2DSA A;  2PU9 C;  3US3 A;  1CQH A;  2VL3 A;  1O8W A;  3KH7 A;  5EL8 A;  1EV4 A;  2HT9 A;  6GSW A;  3W8J A;  2L4C A;  4JED A;  1YQ1 A;  2K18 A;  2EFD A;  2B7K A;  1GNW A;  2A4H A;  4X4J A;  1GTI A;  3LOR A;  5J47 A;  4DSS A;  3HXS A;  4KCA A;  1TDI A;  2XBQ A;  4K5R A;  4FIW A;  5F0G A;  2B3S A;  4FO5 A;  4PUF C;  2YJ7 A;  5F8B A;  3FKF A;  1TJD A;  3L0H A;  3RBT A;  3TU3 B;  5DAK A;  1H75 A;  5G2Z A;  4CHS A;  4ML6 A;  5A1N A;  2HSN B;  1FOH A;  4TVE A;  2R2J A;  2GT6 A;  2YWN A;  4LMW A;  4DSR A;  2I9H A;  2IMF A;  5CYY A;  1XVW A;  3TGZ A;  5A5H A;  2IME A;  3TJF A;  3GUR A;  2H0I A;  2GQL A;  4OFN A;  2O87 A;  5C04 A;  2CT6 A;  4AJ7 A;  1NW2 A;  4FYU A;  1YKC A;  3GRX A;  3D22 A;  2XC2 A;  3KH9 A;  3W8S A;  2VCV A;  5LCZ A;  1RK4 A;  1QUW A;  3TOU A;  1DE1 A;  5HR1 A;  1MD4 A;  2A2P A;  2MZC A;  17GS A;  2A2R A;  3UL3 A;  1GSS A;  4RI6 A;  4DVC A;  4KDX A;  2HSN A;  4MPF A;  2QSI A;  1T3B A;  2CAI A;  2MYG A;  1WWJ A;  4ZIJ A;  1J9B A;  1W89 A;  22GS A;  1EEM A;  3DIE A;  4ISD A;  2NTO A;  5CNW A;  2R6K A;  2JU5 A;  2VCQ A;  4KB3 A;  5CP1 A;  1QFN A;  3APQ A;  2FWH A;  3ZFB A;  4WXT A;  2KP2 A;  5AGY A;  5HQP A;  3M9J A;  4PX1 A;  4GQC A;  5IOX A;  3L9U A;  2R0P A;  2YZH A;  5A34 B;  3ZRD A;  1PL1 A;  5JCW A;  4EIQ A;  4MLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...