3ZMNA

Vp17, a capsid protein of bacteriophage p23-77
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
233
structure length
228
Chain Sequence
AAVQVGGWGFAWIDNEDFSPTGLAWRSGEYFALAQMKTPETAHFRIAAQERRLRIYLRGQKVVNGRNLSDPDSRTVNLPFLMQTPQGAPTLPSTYHPDVAVWAKVGSTWQPCVITAINYSTGDVTFTEPAGVTASDGIEIYYVHGDGQFRLRVARDDSAATVFNQSFSTMHSVDQNNVETMIAWPQQVELVPGTRLVLEVFTTQVPMVWNERSGHYIQIAAMGRRIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
molecule keywords VP17
total genus 49
structure length 228
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmnA02
2.60.120.1170 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zmnA01
3ZN6A 3ZMNA
chains in the Genus database with same CATH superfamily
3AS0A 1HSBB 3BEVA 4TNWF 1EEYB 3ZYIA 3GFUA 3LKNA 5LBSA 2FB4H 3RVVD 5BNXD 5KEZA 5F1OB 1TKWA 1NBVH 3S96B 5HXVA 4Y5VC 3RJOA 3V5KB 4L1SA 3V4LA 2L0DA 1E5IA 3WKMH 5DT1L 1QQDA 3BDYH 4U2YA 2P28B 2CGZA 3BSZH 5DHVA 5G4NA 2C5DA 1N18A 4AQ1A 1OAZH 1FRGH 3KYMB 4HK3J 1QWRA 2DQUL 4IRJC 1IKQA 1PMIA 2NW2A 3B3BA 3GZKA 5L8JB 5FW7A 3FQWB 3MUJA 3FO9A 3R1GL 5D7LB 1EEYA 1T83C 1WISA 2EDJA 5DJ2B 4HS3A 1UXWA 2BNQE 5DZ9A 4Z0XB 2AJ3A 4XNBA 2WUBL 5A7EA 3N9QA 4ASLA 2ZYRA 5DJ8A 5A2JH 1CGWA 5F7BA 2ZEXA 3VXRA 1LRHA 1KXVA 5J1TC 2OTPA 4LF3A 3GBMH 4I02A 4KDTC 1XH2A 3ZYJB 3BWUC 1CE6B 1NAMB 1IC4L 3I6GB 3L3JA 5AAMA 1OP4A 5JZGB 1ZVSA 4FOMA 1LO5A 1GP6A 5AZEL 1CR9H 1RC6A 1GGTA 3SZ6A 5IB2B 1F8TH 2P17A 3TBCA 4LSPH 1TENA 3IM0A 5FYKH 5C0FA 4XCNB 1U21A 4GQ9H 1K85A 2WJSA 4ARYA 5A40E 3WD5A 2X9WA 4HWBA 4AXOA 2UZPA 5GGTL 5A7OA 3BJLA 1KS4A 2VMIA 2XUEA 3WW4A 3RWJB 4F93B 3IK2A 5IEHB 3HC3L 1G7JA 3PGDB 4OCWH 3T0EA 4MZUA 4XQ4A 1F3DJ 4FPLA 5F0LB 3SE4C 1J86A 1FG2A 4NHUA 3B5TA 3QPKA 1KXTB 1LEGA 3C5ZD 3E97A 1FNHA 1SM3L 2F8VA 1MVQA 2WABA 4XIKA 3L2MA 1JRHI 5L2KB 3ACIA 5EEXA 1AXYA 1K8IA 1A9BB 4MA7L 1NFAA 4X99B 5IG7B 1FYTD 1LHNA 5C9AC 3MRCA 5KVDL 5LRRA 3EFDL 1M4KA 4WAFA 5CS7A 4MCNA 4AXWB 1LE5A 1PZUB 4BKSC 3TIDA 3DX0A 2E7LC 3KPOB 2MPAL 4JDNA 3OQRA 5HBBA 2J1YA 3KGLA 4G9FB 1OAXH 1LD9A 4F2EA 3WD5L 4AUUA 3Q44A 2WLZA 4KHXL 1C8M2 2BOJA 4ONHB 5E89A 1XIWD 3ZN4A 1HSBA 3BEVB 4PJ8C 1AGFA 4HUMB 1FX5A 1F5WA 1FVDA 3ARWA 2DRUA 1QY4A 3WF2A 5FW6A 1SLVA 4WHDA 4MDJB 2ZNXA 3OC8A 2OAAA 4XJ9A 1MLCB 4OJAA 2QKDA 4BQCA 5B1AB 5F2SA 2BSEA 3RL2A 1PLCA 2ZX7A 2IXHA 2H32B 2M2DA 2O8OA 1W04A 4F7ZA 1DGWX 4WI8A 4NSKB 5T5NG 1ED3B 4PG9A 2IH1A 4WO4D 4Y1YA 4FXTA 4O61A 3ZYIB 3ML9A 5J11B 4ZHNA 5E08H 5B3NA 1VACB 2LFEA 3FQTB 1B09A 2DCKA 5FZ6A 1G6VK 4LE4A 4N8PA 3D1MC 3R6SA 1I7UB 4A45A 4TUKL 1BIHA 4QTHB 2I7OA 4GBXB 2JEMA 1J05B 3KLLA 2ZSWB 4OQTL 4Y1ZA 1VRH1 2VO8A 2NXYB 4FSJA 1GYWA 4I48A 5CIRA 1ZA3B 2WXQA 3PHOB 2UVEA 3U4EB 4ZY9A 4P49A 3MV01 1OUXA 1ZXKA 2IBZY 3GXNA 4I8DA 1IEBB 1TDQA 4YVNA 3SOBL 2G9KA 1KITA 3J7MA 3O6FA 1US2A 1JPTL 2VUKA 1KEGH 5EWSA 1NPJA 2ZGPA 3QEGL 4ONFL 5J57B 5T3XL 5HJDA 5C86A 4NNPH 3LGRA 1WIOA 4P46B 1CDGA 2VXSH 3MJ9A 3P0YH 4HFUH 3KPTA 4J3SA 5EH1A 4UM9B 5CCKH 3P1IA 2EXKA 4HZFA 5AUMA 4N9GB 1B4JL 3P77A 1U8PA 5FK9B 2QFPA 4JDVB 2VXTL 2IALB 4K8RH 5LGJA 1LE9A 5JO5B 2UY6B 1X9QA 4U0QB 5IUSA 3WQBA 4EWEA 5JOEA 1FO0L 4YZFE 2HBUA 4KQ0A 1PAMA 3IVKB 3C5ZA 1IFHH 4KROC 1MRFL 2ISDA 1QJY1 3QIUB 3PS6A 4U05A 3ARRA 4DFIA 4NZFA 4E36A 2UYAA 2MRYA 2OZNA 3J7LA 4LBOA 4C56B 5A2LH 3L81A 5L4MA 2HJKA 5FZ7A 5DF0A 5C8CB 5LG1A 4TZDA 1MFAL 3RPIB 2CSGA 4YVUA 4LP8A 1B90A 5DRWA 4P3DB 1I3GH 1JODA 1KGCD 5JOPE 5FPIA 1EXHA 3SHSA 2JIXD 3POCA 4LQFH 3BH9B 4NRQA 1FN4B 2W9DH 4FQ2L 2OZ6A 3IETA 1GQHA 1N0LA 1SOQA 4J27A 5D6DC 1LK3L 4CCKA 3D6EA 2VXVH 1V7NH 4NGHH 3VXSA 2BRRL 4DEUA 1NZIA 3QJFB 1KYOK 1AC6A 2DEWX 4JPQA 3SCHA 4F24A 2JICA 2UYBA 1A4JB 1GGCH 2X3CA 4JM2A 4MAYA 5B1BB 4X6RB 1DDLA 4OCTA 1YIFA 4PCTA 2ADDA 3AB0A 1E7VA 3F7QA 3HMXH 4I2XE 4NZDA 4UF7C 1WLTA 3K3OA 5I0SA 1TTGA 3M88A 1OK8A 4JQIH 1NM9A 3SIKA 3OYWA 1FFPA 4NQCB 1S7UB 3MV8D 1EO8H 3HS8A 4GT7A 4PGJA 4K7PL 4NHKA 3OGGA 3ZDXB 5LN8A 4OM1H 1UJ3B 4QDGA 4MA8H 3SC7X 4JFDD 5IB5B 3IFLH 4D7BA 1M2OA 4UI2A 4B7IA 4HUXB 3C08L 3K71A 3MV7B 4GW1B 4DTGL 3FE5A 3BKZA 1NCOA 4KXAA 1DQ1A 1NSNL 4JFDE 3UPCA 1B3IA 2VLME 2B5HA 4D6QA 1JV2B 2ZP0T 3G9VA 1SJEB 1WH0A 4MMZC 5EHFA 3EZ8A 1XU2A 3AT8A 1DJSA 3UEQA 1KB5L 4NZRH 2CWSA 3TO4C 1FMD2 3BDYL 2XZCL 3D85B 1LK2B 3DPDA 3LXCA 1N19A 3MRHA 1BIIB 3MXVH 3RZCD 3UGGA 2VDKB 3WHE1 1P84K 5TE7L 3SDDD 5J6GA 1UPIA 1FAIL 3VXNB 1JGEA 1CD0A 3EJZC 1AQKL 4UW5A 3LN5B 4DJMA 2CBPA 3WLBB 1LMIA 2CAUA 1PGRB 3ISYA 5G2NA 1R0AH 1YEKL 4NZTL 4MNHA 4BHUA 3KL3A 4AOFA 3WG4A 1E3XA 4W9CC 3QUYA 4XBGA 4G9DB 5D7EA 1O3TA 1JPFB 3SGJA 2JD4A 3AKPA 4IOFD 5JUEH 1EV12 1FH2A 5CD3A 1E6JL 3POWA 1NLRA 2PPCA 4XVUC 4TQHA 1HSAA 2P7TB 5DMGC 2V73A 2BJMH 1NPNA 4J3VA 4QO1A 3TA4D 5A2FA 1REFA 3M86A 4RFOL 1MQTB 4CSTA 3HBQA 5FDWB 4KTYA 2Y5TA 1Y9QA 3ROOB 5GXBB 1EJFA 1K8DB 3B3QE 3KB5A 3MNVA 3REVB 1DANT 1KY6A 4OV5A 5C9AB 4MCMA 1JK9A 1Z5LB 6PCYA 1AGCB 4D9RD 3IS0X 4IGBA 5H35A 5EU4A 4LAQH 2VLKD 3QXVA 3KHBA 4C0BA 4HFWB 3C7OA 4XPTH 4RDQG 4OHXA 4MGQA 2VN6A 2X41A 3V6FA 4BLIA 1Q9KB 3G7DA 3QEHB 1U8KA 3Q6FA 2GTZB 4HLZG 1QI5A 3QO1A 1XGUA 3VBUC 3P69A 4K9EH 4Q6IC 3VRJA 2Z79A 2VABA 2B20A 5KXDA 3D33A 2WWKT 2WO2A 1NBZB 2CNZA 3ABZA 3HRZA 3P2TA 3QD6A 2Y9RT 2X4PB 4L8SA 4QF1A 2GPZA 3I75A 2PAMA 5JIKA 3SJVB 4YDKH 4XRCB 4Z8FL 4FPCA 5TPWL 1JHTA 1HX0A 2HWC3 3T4YB 3SYAA 1LNSA 1RYYA 4LHLA 4XF0A 5DEFA 3TASA 1VEMA 2V2WA 3QUKA 1CD1A 2MNGA 4XMAA 2CV6A 5D7IA 3AFLA 1I8IB 1HRV2 2R0ZL 4R83A 5HGAA 4M5ZH 3AU0A 1X4XA 5E6YA 4MMYA 4L23A 1UIJA 3KV9A 4I30A 2JB6A 2PXYA 3ZDZB 4IGBB 2FHRA 4PJFE 3OZLA 3CTTA 2VC2H 4LHQB 4XHQA 1AQMA 4JRXD 2P5WB 2CK2A 4R97B 4XJZA 5FZ8A 5E9DD 2HJLB 2Q7AA 1RZKL 3RDTA 2H0BA 4CUGA 1W72A 4HKJA 3A3YB 3FB7A 1X50A 1WWYA 3IDYB 5IW6B 4PJDF 4BCZA 4CL7A 3GNML 2KDGA 4Z23A 1TTBA 2YAHA 2Z34A 3HKFA 1JZJA 4HG4J 2BO0A 1YEIH 3E3QC 3S2CA 4WFED 2X05A 3A0NA 5E8DL 4JANA 4MO3M 5GRVK 1T7ZA 1A5FH 3O4LE 3U7YH 4BQXA 1CDHA 4FQXB 1T5XB 3TF7C 4AGGA 5FY8A 4KU1A 4ODTH 2Q8OA 4Q74A 2C9SA 2NNAA 4PJAB 4Z95H 5FAAA 4YX2L 5FYKU 4BKTC 4DT2A 2WT1A 4AAPA 4L3EA 3OM3B 1U8IB 1WF5A 1I85A 2IPKB 1BVLA 2CO4A 3FU7A 3IGAA 3KWWA 3PWJB 4L8BB 4PTUB 4QCIB 3ET9F 5KHJA 4MNQE 4OGYL 4QKTA 1N0XH 3Q8CA 1PJWA 2YMXH 4MS6A 5A3TA 3LXUX 5KVGE 3LS4L 2V4VA 2DQUH 2GYSA 2WD0A 4OIBA 2C9AA 5EDXA 3UV9A 1H3PH 5DMIH 2VR8A 4JO4L 1KYUA 2P5EA 5EOCH 1KB3A 2VXVL 1RJ8A 5JAXA 5IKCB 1UKTA 2YBKA 2JB4A 2PP8A 3GSXA 3QHTC 5K9JL 4HU2A 2HWF2 3V0FA 1AHMA 3LQCA 3H3BC 5A1FA 5FXVA 2BSSA 2XYCA 3CCHB 4GJTB 4ZPVB 3RTQA 1HINL 1QBBA 1EJOL 2JKIS 4YXHL 3W21A 5F37A 2MJWA 4ZMQA 1BK0A 2WLKA 1R6VA 1F8VA 1SFPA 5I66A 5JHLH 3VFNB 4DCQA 1JAEA 2PA7A 4U3XA 5JTWA 5FUOL 2IWGA 4NX0A 3K71B 1ZDQA 4QIRA 2EVJA 1QF3A 3AYAA 1VIWA 4PSRA 3IXTA 4D0BA 1CFQB 4ZMPA 1EAH3 3LD8A 1KIQA 2AMGA 5E00B 3RKPA 2V5RA 4EZKA 3U7WL 3C8XA 4RA0C 4DZGA 1CLYH 1KPUB 1OGAE 5A3NA 3QBQA 2EH8L 3WXPA 1IGFH 3EOAB 1BYNA 3GI8L 2R1DA 4BD4A 5CJXC 4WTWA 3DIFA 5DZNA 4O2EB 1W72L 3UTZA 2JG9C 2ADIA 4YZ1A 4PHZA 15C8H 4EAEA 5CJXA 5GJTL 1G9ML 4ISVA 1G7PB 1T89A 3FMGL 3MLVL 4P9ML 3WFBL 2VXQA 2I27N 1H5BA 3MZTA 3QEUA 2DTWA 5L9DH 1CC3A 3PV6A 4E9XA 3MIHA 1AR73 1ET7A 3A21A 2B42B 1EAOA 1FFNA 4JPKH 1Q0YH 3LQZA 1S5IL 5HI4C 1MZFA 3LOWA 3V0BB 1P4LA 4MMXC 1E4JA 4NKOB 2ZGNA 3P3TA 4GD4A 1PD1A 4HJGA 3LN4A 4LK4A 4XCBA 4JQIL 1IM9A 4WTQA 4Y4HA 3HMWH 4NWUH 1I1EA 1YC8A 2Y7SA 4LEBA 2MQ0A 3BAEH 2VG9A 1AG6A 3CWGA 3MLSL 1DGRA 2ZHKA 4CCCA 2FDBP 4GG6F 3GKZA 5CINL 3MRBA 1FAIH 5LK7B 1QJU1 2BY3A 4GWNA 2XQYK 2J2ZA 2V0AA 3LMJL 4GINA 1FP5A 3EYQD 2XACC 5A16B 5BOZG 4KVCL 2GP5A 4L9LC 1CICA 1V70A 3KEHA 2EDOA 3O3BA 3RILA 1AXTL 1GIGH 3X1BA 1U58B 1G43A 4TUOA 3RPIA 1BYOA 4ZFZA 4DUVA 1NLSA 1YFXA 2BPA2 2UXGA 5TE4L 3QDMA 3VWKC 1SY6L 3H1ZA 2WIMA 3QQ9D 1JYWA 4SLIA 4MYPA 4GKLA 5MEQB 4D8MA 1G9NL 1OAUL 3JWNE 2ATAA 3MYJB 4UINH 1RCYA 5CFCC 3QZPA 4CNIB 5D55A 4ATEA 1TZ8A 3BD4A 4N26A 1ASJ2 5IM7A 4L5FH 2EDRA 2LAGB 4L0PA 3LEVL 4GI6A 2X4RA 2A70A 4HMZA 5MP6H 4Z3FA 3BGMA 4LU5L 4Z7OE 5FB8B 1OKQA 2J8UF 4I5BB 2CRIA 3DVIA 2PXYC 4OGAC 5FTTC 4OZOA 2YRLA 1XGUB 3QUGA 2CJUH 3Q8FA 3WD5H 4TMPA 1K3ZA 4HKXA 2XPYA 4HH8A 3ARFB 3RX7A 1XEDA 4OHVA 3JTTB 3A6OA 4XCYA 5IHUL 3U4XA 2BOCB 4AMKL 3EJSA 1QFHA 2FHFA 1I7TB 2ZPXA 2E7LA 2UWCA 4URAA 1CJPA 2ZUVA 2E9JA 2OPKA 3F84A 3S5YA 3W39B 5LXGH 5J1XA 4EZLA 1YQ8A 3L3HA 2FL5A 2UURA 4FPEA 4YC2B 5AYTA 2A3WA 4XBQA 4PWFA 4Q9BA 1PEWA 3EJQA 4FG6D 5FWEA 1XF2A 4EZ4A 1ZVHA 2X4SA 2V72A 3QH7A 3CZUB 3HAEH 3KPPB 5FYVA 1GTFA 1UURA 2GUOA 2CUMA 1WAEA 2B8OT 2R69L 1IKOP 5TE6L 2P49B 1KIUB 3RWKX 1QTYT 3EQEA 4R7NB 1U92B 3ZDZF 3EHBD 1NMCB 4D9QE 4G7RB 5A3WA 1OVPA 1UY0A 1L5GB 4M6MH 4WWKD 2F53A 2VLRD 2MCMA 2XVLA 3JTBA 2B9BA 2ZCZA 5HJ3A 1SOSA 2H8PB 1X4YA 1S9YB 2C7UA 1CD3G 2D7QA 1CBVH 5I0UA 1OTSC 4HWNA 4O4YL 2ID5A 4YIQA 3WS6A 1X5YA 2ARJA 5HVHB 4K3JH 5KBPA 4G7YL 4DERA 2CH8A 1SFYA 3ZQ9A 4Q0SA 3VU1A 1P6AB 4FQ1L 4XMWA 5I1EL 5D2NA 3MRNA 3VXUD 4TSCL 4R26L 3VQ1C 4GH4A 5EYXA 1WA6X 1JDCA 1UVQB 3VGIA 3MCLH 4K15A 5H37H 4NBXB 3V0DA 4XBEH 5HYQB 4NBYB 4PUBH 1P2CB 3DURA 1TT6A 4JHWH 4M8QA 4B1LA 3B7RL 2P2KA 4KI5M 2NUPB 1TF4A 5A7WB 3I4IA 3V0BA 5C0AB 3FHEA 3I2DA 5DJAA 1OP5H 2QKIC 2VRQA 5GGQH 4YBLC 1NC4B 3DN7A 1S78D 5CIPB 1S7QB 4HSAC 4NO4A 3D2UA 3NCEB 1NSNH 2JKRM 2JJVA 2RMU3 1PIV2 2OV0A 2X0VA 1KBWA 3O41A 1IG3A 2GI0A 5AOJA 3MV7A 3FQUB 5KOMC 1R5IA 4ZX5A 1ZT7A 5AZ2H 5SWSD 2E7AA 1NBQA 3ZR6A 5HYJA 3KL5A 1KXGA 3RA7H 5T1KB 3LH2H 2BZDA 3W9DA 1LLAA 3WUWB 3WMSA 1BD2B 1BZEA 2B77A 4XVSL 1QRNB 1XD1A 5C8JB 1IBGL 1GW6A 4Z7AA 2YPDA 4XDPA 1NOFA 2YDEA 4OI2A 4L3CA 3V52H 5E2WH 4XP4L 3S97C 4P9IA 4Q8LA 3W11D 5BJTB 1VBE2 2AMUA 3JWOL 2VN7A 1Y6KR 4F3FA 1XF2B 1TEFA 3AB0B 3BZEB 1L6ZA 5AB9A 2CJSA 3ZZ1A 4LLQA 4J4PD 4OZHE 1Z7JA 5F5CA 2Y5EA 4JZNB 1UEYA 4DTGH 4EDXA 4YHYB 3MV8A 2ARXA 2EXJA 4FNSA 2PHDA 2VZPA 4F1ZA 5T3ZE 5GKAC 4Y9FA 3BYTA 5IHBA 5KW9L 1C1LA 3QWOB 3ZDYB 1FFTB 5I8KH 1FNEA 2EIGA 2AJ3B 1TME3 5FM5O 1W2TA 4JC1A 2EYRB 3T4YA 1O7SA 1CXEA 2OQ7A 1FYUA 5HHNB 2WYSA 4GH7B 3DUSA 3N5AA 3FQWA 2BNMA 3UBXI 3F3HA 2JCWA 5A7BA 3LKQA 2OZJA 1IHMA 4A6YL 3TWIA 2B0SH 1X5FA 2PW2A 4UQ2B 3GD1C 3F64A 1SACA 4YYOA 1YECH 5JIIA 4MQSB 1UB6B 3KS0H 4G59C 5I1CH 1FJ1B 3D0LA 3V5KA 1YHPA 1LOBA 2GMMA 2FZ3B 1VBC2 3KBFA 5JLVA 1AHWB 3N55A 4KOBA 4RGOH 1QIQA 5C9AA 3HE7B 5BRZE 2SLIA 1NKGA 4TLKA 1WC7A 4NIIA 1GLHA 3RZCA 1PF3A 4N2FA 5C70A 2AJXL 1HXMB 4TN9A 3SE9L 2LS6A 3TJHD 2XY1A 1JK9B 1Z5LA 1JPEA 5LGKA 4X50A 1B35A 3WF0A 1UA3A 2I5YH 4POYA 2NY0B 1IBHA 4U1KA 6FABH 5HCBA 1MFDL 1RUH1 1IS6A 2HT3D 5H37A 4G6FB 3KM5A 5GZOA 2EIBA 1AYN3 4AEDC 1J1TA 3R8BB 1GNZA 2OZ4H 3JUYA 4B9GA 1XSRA 2YPKB 1MUJB 2FX7H 3K3QA 4XP5L 4R6UA 5AL0A 2XZAL 3HG1D 3QPXL 5GGTH 4NDMB 3OGJA 3LQZB 4Q0XH 4ENEC 4Z7IA 3TESA 5CJOH 2YK1L 2V2TB 5JW4M 5DJ6A 5ICZB 2V2WB 4ZS7H 1K4CB 1T22A 2NY2B 2J8UB 4NQVB 1P2CA 3DURB 2CWRA 2Y2TA 3L7FB 4G42A 5HDRA 1S1AA 4NN6B 3EH1A 1C5CL 2WOBA 3HRPA 4ZZKA 2WNVC 1Q5OA 1I9IL 2JB5L 4I48B 2BYVE 1QNYA 5TH2A 1Q72L 3IBOA 1AGDA 4JRYA 1WJ3A 1LU2A 2OQ6A 3EYPA 3H6AA 5AZEH 1SJEA 4IK7A 2YQGA 1Y0LA 3MRJA 3KSCA 1WBLA 3KNBA 4GKSB 5AL8A 5JXIA 2G5BA 4P05A 5DMJB 4EQ3A 5ITBH 4N3UA 4LCWA 1I3HA 4JFFE 3U25A 1EY2A 3GB7B 1FVEB 2UZYA 5CFDC 3MGAA 1Q8SA 2H32A 4Z3EA 4HV8A 2RFXB 3USUB 3O6MH 5IY5B 4NN6C 3H9HA 3DMMA 1G7QA 2HX9A 2YUVA 4K7FA 3C60A 1PIGA 2WXNA 1D2QA 4MADA 1FHNA 5I5IA 5C0EA 3ULUC 1NCGA 3WIIH 4KKBC 4HC1H 3WIFA 5AW0B 1HCVA 1W9XA 5GGRY 3ZXJA 3HLAA 4JHVA 2JIJA 4XE0A 2E9GA 4YHIB 2VSKB 4HOOA 3QJHA 3U0TB 1LEDA 4N2KA 4FGMA 4ZUSA 1HI6B 5CEYB 1SEFA 4Q9QL 2X0UA 3A5VA 4M8UA 1EFQA 4WEBL 2CJUL 4DFHA 2VQ1A 5DD1L 4NQCA 1Z9MA 4QCIA 2EAAA 3ZIWA 4WZFA 3IPVA 4U1HB 1VBC3 1MFBL 3O3DB 2COVD 4G80A 4MJ6A 4Q6IA 3ZYBA 3I3BA 3ZVXA 3JV5A 1IGCH 5IFJA 4IE0A 3ZKYA 3D5OF 4ODTL 3P1VA 3FHIB 2ZOUA 5HHOB 3N85L 4HWBH 4ZUUA 5T8IA 4Q9RL 4HETA 1WFMA 3U9WA 3WG2A 4LCYB 5L7OA 1H3VA 3HG1B 3CDZA 3T3ME 3TN0B 3VA2C 4TQEH 3VWJD 2VZRA 1ZIAA 2BX5A 4XN9A 5GRJL 2E63A 3B37A 4KKRA 3HQUA 5GSVA 4ZOCA 3CFBB 4AYEC 1ODAA 2Q30A 3CHQA 4TVPE 4RESB 2ILLA 1XTMA 4LHUA 2UYLB 1OARL 1EMTH 4BJLA 4UU9A 1N3NB 3QIWA 3QRGL 4ZOBA 3VXMA 5ILTH 4B41A 2GAZA 1FFQA 3TO2A 1JGUH 5EEWA 3QYMA 4PVMA 2DV9A 4LKSA 5EDSA 1PDKB 5MEPB 1YN6B 5D7JA 5A2BA 5D8AA 1X5JA 4ZTOH 3HJEA 2OTUB 3PL0A 2A99A 4J39A 2PQSA 2ICWA 3M46A 4WJ5A 4B7KA 1KLGA 1DIWA 4XB7A 2ZONA 4MB5A 2ETWA 4FZ8L 4XI5C 4B60A 4F9LC 2DMCA 4OGYH 4X8XA 3LN4B 4FFYL 4ESKA 1DN0B 4P2QE 4X7TA 3OPTA 4YZ3A 3U11A 1E28B 2XQYA 4OLZH 3I8TA 4EUPA 5BVPH 4P9GA 3T0DA 1TG8A 2NR6A 3ETTA 3P4LA 5BS0A 5A3IC 4UM9A 2D31B 1AXKA 2HH9A 1ONQB 3UJQA 1IT9H 3X12A 2FBJL 4DIXA 1I53A 3FONA 4MMZA 4FKKA 4FABL 2XG4A 3SGDH 1BYPA 2V5SA 3U83A 1QDCA 5E1RA 1DFXA 3QWNA 2QMKA 1DZTA 2WZPP 4R9BA 2OMYA 1QSEE 5HD8D 5IQ7H 4JKWA 3MTXA 1BKZA 4IRSD 3MFGB 2X1XR 3UMNA 3MIGA 3HS0B 3NIGE 2BP0B 3UTQA 3H9SB 2F68X 5DZGA 1AGEA 2BQPA 3OUHA 4NO5B 1CFNA 5CZVL 3F5WB 5AVRB 4ICXA 4IBVA 2X12A 3B8YA 4W70A 1BEYH 1XF4B 1WD3A 4FZ8H 3QDME 2HJKB 1B2YA 3HHRB 5T1MA 5I2IA 1JPFA 4RGOL 1ZSHA 3DO3A 1POV1 4KRPD 2LE9A 1CDCA 3BE1H 3ORJA 3MBWB 3E6DA 4WFGD 1NANI 1PZ5B 2X38A 4M7LH 3BTYA 5APAA 2PYFA 3OAUH 4JJ5B 4FCHA 5K1JA 2X2IA 5IMOB 1R1CA 3SE9H 4RD7A 5E9NA 2JKBA 1RVFH 2DLHA 3NCBB 1W0YT 2XWZA 4M43L 2LAAA 4MA3B 5HDBF 3O3EA 4AYDC 3TBTB 4XP9L 1CLCA 4EEEA 2WSKA 1B2WL 3ILFA 5EF2A 1OA4A 4JCKA 4FFWD 1AC0A 5EO9B 2J1XA 5T5LA 3ZTJG 2FX7L 3MRGB 2Z4TA 2IADA 3RU8H 3T6ZA 1UZ6E 4HFWA 1FQ9C 3CSTA 4GP4B 2D5FA 2IVJA 1N4XH 3WEXB 3EJRA 1RJZB 3EHKA 3WNMA 1J5IA 4O5LH 2Z8VC 4OD2A 4OB5L 1G7LA 4A67A 1M7IA 5FYKD 1X82A 5EO1A 5I15H 1TITA 3CD4A 5TE4H 3KVBA 1JHLH 1ZE3C 1RMFL 1DQQB 1N6VA 2BNOA 2ZX2A 3TYJA 1HHIA 4NI6A 3S5QA 2GK2A 2CDGA 1QJX2 4FX5A 4KWUA 2DTYA 4RMBA 1QR1A 5FKBA 4GRWH 1QBMH 3KLAA 2X4TB 1Y07A 1WKYA 2K6YA 2W3JA 1F1GA 3FUEA 4PIBA 2EXHA 3L3GA 5H4YA 4XMLL 2PCFB 3SCMD 4MB1A 4ONGL 3JWOC 4RAUB 1IAKA 3N40F 3QUYB 3QUZC 1DBAH 1Z3GH 3HG5A 3L6FA 1CL7L 1N5AB 3LKOA 5DO2D 4ZBJA 3UYPB 3PWVA 2YA1A 5HGDB 4EPSA 4N7UA 1N1YA 2DLTA 2CBTA 2PQQA 4GSUA 1O4ZA 4CILA 4LVNC 3WEBA 5C0FB 3D82A 1NC4A 4OVUA 3CN1A 4M6ML 3QORB 4PD4J 3DEMA 1BVKB 2VNGA 5G5DA 3FH8A 4KO9A 3FTWA 5E8EA 1IFRA 5BW7A 4QF1B 3ZSMA 2YBRA 1BW8A 4IM8A 5I5JA 2WO2B 1G7IB 4AHXA 5C08E 3RZLA 5IROA 5LATA 4Y1AD 1TEGA 1Y1UA 4OQ1A 2Q8CA 4GB33 5FP4A 3AQXA 1KN4H 2WN3A 4XP6H 2FATL 2O5ZL 1VBB2 2OMVA 4A1RA 3WTXA 1AVAA 3DOSA 3JWOH 5DUMH 2O5NA 5H2BB 2HKAA 4AVVA 4ARXA 4D7SA 4AG4L 1ZANL 4Y4FB 1LENA 3B9IA 5L2KA 2WFF1 4I88A 1JZ7A 4YC2C 5J6SA 3FRUB 4NQXA 3KMDA 1HXS3 3BTAA 3SGKC 2G1MA 1WV7T 4BCXA 1X7QB 5C0DB 5IBLD 5HI5C 2TRYA 3HPJB 1DVZA 3A24A 2NY5H 4LHUG 2YFZA 1NA1A 5FDWA 3RYKA 5FYHA 1YUHA 2Z8WC 4K3JL 1KCBA 1WQVT 1VZHA 1PX8A 2E75C 1T3FA 4QRFA 1NC4D 4ZRGA 3UBXB 4F7EA 1H9VA 4JFOB 2LRPA 1LL1A 1GGIL 5CO1A 3WBDA 1ODNA 4X6QB 1HHJA 1J1LA 1M7UA 4BDVB 3UERA 2VXTH 1ORSB 4AJYV 4R7DB 3IDCB 3LPOA 2W81C 4DXSA 1XRUA 3LS5L 5FR3A 5IFPA 3WLWD 3QH6A 4MDRA 3K75B 1B9KA 4Q4V2 1HN0A 1FYHB 2VZVA 1W8WA 2WTRB 3TYGL 3OOXA 4KNCA 2K8QA 3CDGB 4S2HA 1IGML 1VPOL 5CSBA 4Q97A 2IWKA 4MX7A 2V9UA 5JMRA 2K6ZA 4UDUA 2XN1A 3LDRA 1LK3H 1NCRB 4CEWC 4PQ9A 5LA1A 1DGLA 5KJRL 5FYMA 2YUXA 4JN2A 3VGAC 2CO7B 1A5FL 3S7GA 2BEOA 2GMPA 1U91A 4LVHC 3PHOA 3HEIB 5HHPA 3UTPE 3T6WA 4FFVD 4LLDB 5D71H 2D9CA 1OO2A 1GZPB 4N28A 4Y2OB 3UBXA 2HXAA 3I9PA 4MCYB 1HXS1 3L3IB 3WDTA 3VRLE 2N1TE 3CSYA 1KIPA 5C07E 4H8UA 1ASPA 4C56A 2JKXA 2L7JA 3PABB 1BBJA 5CKAA 1DSFH 1WIPA 4K23H 2Q20A 5E4AA 2XNAA 2Y7MA 1UOGA 1UD6A 4OCMC 1A6TB 3TV8A 5FKCA 2VSCA 2IWFA 2WQVA 3OF6A 4DGVH 1DFQA 1F42A 2HVBA 1Q8VA 1U33A 2PF6A 2WT2A 4OUEA 1PNFA 1J12A 3MICA 1AGFB 2RD0A 3MRBB 2IXJA 4GMP0 2J12B 1GWMA 4HALA 3DGDA 5AUMB 1J1XH 4Y19D 3Q2LA 4LBLA 2E27L 1URZA 5IOPA 4DGYL 4N2NA 5J4MA 5ANME 5C92A 1FSKC 4P5KB 1RUJ2 5HGHB 3RZHA 4YFLI 4BSVA 1R46A 4R7VA 4Y4KA 3ILPA 2VH5H 1X9PA 3J9SA 3VI3E 2EVHA 2FQFA 3M3CA 4ALAH 3PPSA 2VR4A 5G5DB 4I13B 5GISL 3ZYOA 1WVZA 4FQPA 4K3HA 1SPPA 1W72H 1T0MB 4HGWB 4XBPA 3MXWL 2J8UE 3EOAA 4PP2A 3P11H 3IETB 1FE8H 1UQXA 1WLHA 5ESVA 3EXJA 1RHI2 3K1DA 3T2LA 2XLGA 3O12A 4HX1A 4PV9A 4R90H 4ELKA 3VFOA 2Y2WA 3SDCB 1CAWA 1KPRA 1DQLL 2WQWA 3L45A 3NRPA 1D4M1 4XO9A 2TRHA 2XFXB 2EIEA 5C3TA 1ZVFA 5CEYA 1W91A 3BGAA 3BP4A 3L5XL 4PJGB 4BZ2L 5A6QA 4KNSA 3MYZA 3QJHB 5DJXA 3VL8A 4Z7VE 1RB8G 1NA1B 3ATFA 3WO3B 5CP7A 3V0WL 4PP1D 1ES0B 1JU4A 4HUUA 4P5MB 4XFCA 3TN91 2UWBA 4XC1H 1NT0A 3PXJA 5EU7C 1B35C 3QJZA 1WT5C 4KAQH 5IQ9B 5KBKA 4Q0XL 5D2LF 5IHZA 4F8NA 1D7DA 4HUVA 4WBBA 2Q8DA 5T3XE 1COV2 4MNQB 2WBJC 1GVIA 2R29L 3O2DL 5IMMB 3RG1C 5PCYA 3T1WA 5IVXF 4BCYA 1QLRA 5CG9A 2QZQA 1J10A 4UV7H 4Y16D 1P5UB 1OE1A 1NLQA 4PJBE 1BBJB 1JHJA 2KHAA 4OQ8A 1A2YB 3ZDSA 5ANQA 2F15A 2QPSA 3ASNB 1IJ9A 1TETL 3V55A 2YSTA 4AGQA 5L9DL 1EEZA 5EXOA 3X1EA 4JFFD 4HWEH 3KXFE 4PRHD 4V1DA 3O81A 1OXYA 5LVEA 1GNHA 4M7KL 5DHVB 4IOIA 5EOQL 1YI7A 1AX1A 3NP3A 3OKKB 4YSUA 4FULA 4IKLA 2BH0A 3B5GA 1CIYA 1TCRB 1AD0A 4HPOH 3OKDB 1V27A 5CJ8A 1QLFA 2OCFD 4FTSA 3VZKA 1SCSA 1AJ7H 1XBDA 3CC1A 3CZNA 2WNOA 4PSPA 3SHRA 2H6UA 1M3IA 2DWDB 2WXFA 2YU2A 1P5VA 3QCTH 5SWQA 1KB9K 2IXKA 4LCCA 2HH0L 4HPHA 1XYOA 5C08B 1UWFA 4IL7A 4WM7C 3NH7L 2JKWA 3CVHH 4IIZA 5FIEA 3LSOA 4DKTA 4NUJB 3RUGE 1CXLA 2CGRH 2PYEB 4WO4A 3L3KA 1FO0B 1JMZA 4OLXL 4AEJA 2DBNA 1JMUB 4ZQTA 1CTMA 3NWKA 3RL2B 3JWNH 2E6JA 3CJIC 1X8MA 3WQ7A 4LGPB 3MI8A 1FIGL 1RPKA 2IOOA 1TZAA 4ZX6A 1Q9WB 1TMQA 4OGXL 4PRPB 1L9OA 4EV0A 4M8RA 5T55A 3IJSB 1TCRA 4Q9RH 4HLTA 5BCAA 3FQRA 1E9PA 1ICTA 4NQUA 4IEXA 3H4FA 3HRZB 4ZTPL 4EBQL 4HHGA 1AX0A 3IM1A 4JQRA 3HC0A 4WTZA 1NC2A 4QRQB 2YD8A 3IAPA 4ZOAA 5KJ4A 4Y4FC 3NT0A 1EGJA 1GZQB 2DWYA 1QXRA 2V8LA 3TEUA 3RZKA 3S7IA 2UY7B 2AJYH 1CESA 3KHQA 4BV1A 4IRZH 1F11A 3DJTA 3UTTA 2DLIA 4WJ5B 5F7EL 4EDWL 2RM22 1UA6L 2VDOL 3Q7JA 3CHOA 3SDAA 4GMTL 1Z2KA 2E76C 1B0WA 4WM8B 3BIBX 4PS3A 3W57A 2KLTA 4WUUE 4PRDB 3E8UH 1J3RA 3I84A 4OKDA 5D7SH 1TPXC 4QDRA 3DHJA 1OLME 1XF4A 1PCSA 1OAKH 4ZX4A 3VD9A 1OD5A 4LFHD 4HVBA 4B96A 1HSAB 4FP8H 3T6XA 4CU7A 7PCYA 5CBAB 5LGHL 3GMMA 3DBXB 3H9SE 3OG4B 5JR1H 5F1NB 4HLJA 2F8XC 2E7MA 1V3JA 1P7BA 2GC4C 3N42F 4RRPA 4RMRA 4AK2A 3C7FA 4A6OA 1C08B 1K4DB 5IW3A 2Z35B 1TJIL 1CE6A 1NAMA 3H9SD 4IIQB 4JB9H 5BQ7A 3WEMA 2XU9A 2V3EA 3B9KA 4NNXB 2XVGA 4NUQA 5ISZB 1DUYB 4MMZB 4S10A 4QGMA 2NY1D 3BPLB 1F11B 2AITA 2CZNA 3CVCA 1SBDA 3ZX7A 4A7ZA 4E2GA 5EO1B 2IXQB 4M6NL 4MXWH 4YHLL 1PIV3 2HKHH 5D1XC 4L4VD 4UBDC 1JD9A 2DCJA 4ZU7A 3AMQA 4B9FA 1GPOH 4FLHA 4PCRA 3BVXA 3NABH 3NCXA 2C4FU 1AFVL 5I1IL 4OBSA 4UAPA 4O51A 1UY1A 3B7MA 2B3IA 4N8VB 5F8RC 2MEV3 4MWFB 1LR5A 4AEMA 1SPDA 2J1TA 3Q5YA 1XF3A 4G7QB 1QABA 2EUZA 1KLGB 1H30A 5F9AC 3NRUA 4PJYA 5CU1A 4HMCA 3TN93 5GLUA 2I60H 1J8HA 5IB4A 3MLVH 2YD6A 4G6ML 4P9MH 3RWFA 2WYTA 1NX9A 4LBQB 2AK1L 3MBED 4YDNA 4YIQB 4B50A 1I9JH 4CDXC 3OGCA 4GKNB 4G2AA 1YG9A 1ZLUK 1ZK5A 5I5MA 2WAOA 3F00A 1XV8A 4BQ1A 3HNVL 4PJGF 1YPZA 2DMKA 4ETQA 2WK2A 4FXKA 1IGYB 5FZEA 4U33A 4A7TA 4IMKC 1S3RA 4HHAB 2OTWB 4PJ9C 3WFHA 4AQEA 4HKBA 5CCJA 3POEA 3BVTA 2YZ4A 2A6KB 4JTNA 4L3AA 3AM8A 3MO1B 1ETA1 4JFVA 3IRZA 4JN1L 1HVXA 4YDZA 3L5XH 3E8VA 3JBG2 4HMDA 4MDIA 4NIYE 1OWRM 5KVFH 3C2AH 4N0FB 3BUPA 1UXLA 4G6AD 1JTZX 4NM4L 3VFRA 1UNBA 4G42B 1NMBH 5CSGA 4W9GC 3G5WA 4M6OH 1U2CA 4PF1A 5ABZA 5EN2B 3WN5A 3DTXA 1AYN1 2C26A 1UXSB 1KULA 1W6QA 2NLJB 2HRPL 4ZYKB 4B1MA 5CBLA 2Y34A 2OZ4L 3VCLA 3L8QA 4GQZA 4DNYA 4KXZH 3FC8A 1GA2A 1HE7A 1NDMB 1QRNE 4WKZB 5LB6A 2NX5E 4LSTH 1JDDA 4PJHF 4Z07A 4WNQA 2WLHA 2WQSA 2AK4E 3B93A 3BW9A 2IQAA 3QH3A 2DQJH 4MBRA 4OJYA 4WI5A 4HWEL 5D7LE 4UT6H 3TNMB 3BALA 2FJHB 4NJAH 5TQ2L 5EUOE 5JCTA 2Q8AH 1CDIA 3FAWA 4OD3H 3WJLC 1JV5A 5HDQL 4NWVA 3AACA 3PDQA 4R3SB 3L54A 4GIQA 1KV3A 2VDML 3AWFA 4PB9L 4PJDA 5EBWB 2BS9A 3S3PA 5KVFE 2IG2H 4CNIA 3U7YL 4PQQA 2XWRA 4JVPA 4G6JL 5FZKA 4FTEA 2WVTA 2FQDA 1T2XA 2PTUA 2EIDA 2F5AH 3CMOH 1OLLA 4ZSOB 4OZ4B 4QHMB 2UVFA 4HISA 4IRSB 1DBBL 3D0AA 4AVSA 3LN9A 2QHLA 4YHPA 1D0GA 1WEJL 2OMVB 4LLFA 2OI9B 1HAWA 3TV3H 4RSYA 3RVWC 5I8CA 1VZIA 4UU9B 4O02L 1NWPA 2G9HB 2AQ1A 2VLKB 2VM9A 1WPCA 4BXSV 3ARGC 1B0IA 3OAZH 4U6VH 5AW2B 3E38A 3DK2A 1AR81 4ISQA 4ZS2A 2GTWB 2VW7A 2LVCA 5DR5H 1N9PA 1SPPB 2GH8A 4G71B 4I0PB 3KV6A 2BFGA 2WNVB 4E9QA 4G8GE 2KKQA 4NQVA 4R26H 3MLPA 4AL8C 2EF6A 4GFTB 4LJHA 5DQJB 5KXBA 1ECZA 4FDWA 4F7MA 5A6MA 4KHTL 4XQDA 2VQ1B 1BMV2 2X9YA 3L95A 1R24A 2EILB 3D87B 4JFXB 5GZNC 1S0JA 2MHFA 3GSQA 4PY8J 1NLDL 2DWTA 2NYYC 2VT0A 1QWHA 4C56D 1D7PM 3TZVB 1G1YA 5J13B 3DPRC 2DVBA 1WHPA 4N0CD 1IBGH 5BNPB 3BVVA 1BEXA 5BMFL 2ERFA 4H25B 3CZSA 2E27H 2V2XA 2YMXL 2J43A 5DFAA 5FY5A 3NJKA 4FNLH 2RS12 1S5HB 1GU3A 1BOGB 2L7UA 1KCKA 3BP6A 4K7FB 5J1AA 4M3HA 1CXIA 1WBXA 2XQBH 5FYJL 5DAVA 4GY4A 1OTTC 2QV2A 3ZYGA 2C1PB 2SODB 2ATPA 2NY0D 5L7OB 1G7HB 4KKLC 3I6KB 4FXGB 4NPYB 1VR3A 2FLRT 3ISWA 4IKIA 5HYEA 2X4QA 2XN9E 1O5DT 1ZWIA 2EDTA 1XB6A 3PFUA 4KQ3H 1AOZA 4QX8A 5KJ7E 5DD3H 5D7SL 2KS0A 2D7NA 5EPMB 4M5YL 4AC4A 5CM1A 1O7VA 2JELH 3L3DB 3OAZK 1DJGA 4FLRA 4JRYB 2WXKA 3GHBL 5F1SA 3DHUA 1SXBA 3HIFA 3IU4H 2RB8A 4ZD3H 4JHAL 1DBKH 4BRVA 3WZ1A 4ACTA 4PBPA 4JO5A 2PKDA 3G5YA 4K94C 4OD1H 5ETUA 3NSXA 1OOWA 4XXCA 5AOMA 3VGDA 5FO2A 3WNNA 5L8KB 4CEYC 4YS4A 5HBAA 3VD0A 3IWVA 4BQ9A 5JXGA 2ARJB 1DVUA 5A2AA 3LH9A 2J55A 3W5MA 5IB1A 3GZQA 1EVUA 3QIUC 5DABA 1S9YA 2C7UB 4LARH 5FYJE 2ZOLA 2FEEI 1S0GA 4JVWA 2A83B 4LPVA 4XXDA 4AFCA 1N5AA 4Y88A 4CSPA 2AZAA 1VBB1 1SY6H 4OZFG 3EYUL 3KCXA 4QPYA 1KLUA 3B2XA 3QE5A 3BIKA 3VXME 5BRPA 3GMMB 1SQ4A 5L7OC 1FV1B 1UZ6F 3KW8A 3LNIA 1UD1A 1CZ8L 3B02A 2O6PA 1D7BA 1YQVL 3QARA 3RTLA 3HMWL 1DVFD 3H0TA 4UNUA 2H6PB 5A2KH 1IZKA 2GUOB 1OB0A 4HJUA 1EXUB 2GG1A 5L9BA 5DJYB 4J6RL 1OT1A 2A1XA 3GGWA 3CC5A 2TUNA 3NNFA 3N1GC 4L8DA 4EN0A 4OLUL 3UYRH 4JHAH 1UZYA 2WYIA 2CTVA 2A7BA 2AQSA 5DD0L 4HK8A 4JQTA 3EUUA 4MS8D 2Y6SC 4P9HC 1MHPL 3F7VA 3GJFA 3KPSD 2R59A 2DQHL 2CO6A 3U6XA 2WBKA 1JZFA 2APSA 2CR3A 3ARVA 5A6IA 5EO9A 3L7EB 1W6OB 2XXCB 5CLYA 1BZWA 1OT2A 1V55B 2AAVA 3P54A 3JBG1 4PJ5E 2E7BA 4PJCE 1EIBA 1PGL2 3BGMB 1VFMA 1K12A 4UQ2A 5GS0H 5TF1L 5D1XE 1MCPL 4UT7L 3X11B 3H9AA 1E4WH 4DPCX 4HKLA 3UKVA 2XWEA 3VV1A 1NBVL 3ILQC 5H8DA 1U3HB 2QTEA 1E5RA 3S3SA 3SOTA 3U0WH 1ULOA 4X6BA 1WITA 2ZOWA 5E5LA 4HN0A 1OXCA 3B2UD 4PJHB 4M43H 5GHWH 1POV3 1Z9LA 4BOWA 2HB0A 4M93B 1DCLA 3IGFA 1F3RB 3HNSL 3J7HA 2GK0B 1DBML 5JOZA 2FECL 1D5MA 1ZLSH 4QHKI 4QXVA 3D9AH 3BSGA 1TQSA 1I1RA 5TFSH 4F8OA 3L3KB 3L5JA 5ADPH 2JG8B 2XWXA 1CFNB 3S35H 1P9MA 4DEPB 3FSAA 3RVTC 1MZ6A 5CAZA 1MIEL 3LOBA 3DWTA 1PNDA 1FL3B 2YGOA 3RGVC 3IGUA 3TBVB 3VDDC 4JDEA 3LDBC 3RNKB 3QCUH 4Z1VA 4IV3A 3MOAL 3SDXF 3APBA 4TUUA 2BNRA 2VUAA 1OZUA 2V8MA 3HZKB 4NO0D 4NO3B 5DLML 4B9ZA 4QLWA 4OI4A 5BNNC 4Y5YB 1WSST 3WUWA 1MG2C 1KDIA 1T89C 3HG1A 1MHCA 4DVRH 1A78A 2QQVA 4L92A 3CMOL 4GLRI 4RFRB 3NFPB 4QRPE 5FA4B 1FF5A 3BAXA 3OBAA 4KI5C 4RS5A 1R9FA 2HWD3 2YN5A 1FPTL 4KQ7A 3L5IA 3GMPB 3UTTE 4Q9QH 4MCZB 4NKDB 1C5BL 2WINB 3HT1A 3MGTA 1BZQK 2BVPA 3MJ8B 4KKZA 4ZMTA 1R083 1S0CA 2OPWA 2W52A 1MJ8H 4B3EA 2QQLA 4IV1B 3U4KA 4I18C 1UVQA 5GSRB 2J88H 3VI3A 5DUPH 5IFAL 2HYMA 2I2SA 1DVFA 3IPEA 3PP3K 2W91A 3DX8B 2NXZD 1XXFC 5IVBA 3C2UA 4M8QB 4K6BA 1EERB 3D25B 5EB9A 2VU9A 1UKGA 2RMNA 5HDQH 1HQ4B 4Q52A 3WIHA 1AO7D 2E6VA 2WB1A 2NDFA 3ZSTA 2NMNA 2B4CH 3JZYA 1TJIH 2J8HA 3OBZA 5IVCA 1MOEA 4HK3N 5I66B 1S9XB 2K8MA 3MLTA 1LTEA 3FBQA 4KHTH 1MI5A 1QBAA 4QRSA 5C97A 6CGTA 4AEHH 4XMKL 3RYMA 3RI8A 4YDKL 5F39A 2P8LB 3L3OB 4N2LA 4FERA 3U4AA 2A4EA 5BW7C 4KK5C 4AUJA 2QTWB 4K5PA 3AVRA 2QSCH 2HPOA 1J3QA 4L29A 2YN3A 4JFWA 5K1NA 1EPWA 2BP3A 3WW2A 4O02H 4AEFA 4BWOA 3SE8L 3K2OA 2JDYA 2AEPH 1HOEA 2YC0A 4Y4KD 4OIFA 2EH7H 1M9WA 3EIFA 1MLBB 4JKKA 4KKQA 2JIGA 4Z2WA 2Q8EA 4NZUL 4OFYA 4Y2LA 3NCFB 4PB0H 2DQGH 2YYOA 4JKMA 2B4CC 2VTXJ 5FPVA 3H2QA 2J5WA 1BJ1J 2AK1H 3PXHA 3AREC 1WD9A 3PV6B 4K7PH 4WEBH 5CCGE 2V2TA 4QPEA 2B8MA 4LIUA 5DQDL 3TCXA 4CP2A 3POBA 4A04A 3PYCA 1NA1C 2HT2D 1UO9A 4MD0B 4E27A 1ZD6A 3K1KC 1EHAA 1IGMH 1VPOH 3UACA 4UNVA 2BU9A 2B2XH 4MNGE 3TBDA 5EZOH 3VBSB 5I28A 4YPGA 1AFVH 4G1EB 1EAPA 4TSVA 4Z7WE 1U8QA 4U6YA 1T5KA 5C0DA 1VB9A 3PQYA 3T04D 1BAFH 4N5ED 3DXTA 4Q4X2 2RR3A 3BDBA 3ZGHA 1ZHNB 4M9OA 5ACLA 3SE6A 2EUWA 2W07B 3II1A 4XH2A 2Y8KA 2BIQA 3WENA 1VF5C 2D3SA 4ODHL 4MJ5B 1YECL 9CGTA 4XTRD 1PD0A 1NBYA 3MUGA 1TPXB 4MZ2A 1OCCB 4IGQA 4RQPC 1JXDA 1NWOA 5BOPA 2ZZQA 4IBZA 3TEWA 4PJXE 2WVVA 1ZBA1 5CFCA 1PZ8A 2FD8A 4TNVF 1UCBL 3HC4H 2ZX6A 1GRWA 4PPTA 4N0RA 1IIKA 5EOCJ 4XVTH 1WK0A 4D9QD 2H0VA 4LVHB 3CFBA 1X3DA 2AJUL 3QUXC 3VA6A 2AJVH 1JI2A 1FNGA 1E3ZA 4L8SB 3DV4A 5E2TH 3ZMNA 4ZMYA 1O4TA 5JYMA 5LCVL 2XTLA 4Q7DA 3N0AA 5EZLA 2YMTA 5IQNA 5I0ZA 2QFEA 1AO7A 3RPKA 4XBLA 2PHRA 2WTOA 3ZYRA 1FFNB 1KDKA 3KWWB 3MRQA 3PWJA 3V0EA 1CD8A 1ADQA 1IG0A 3BP7A 3PV7A 1ZTXL 3HWJA 5T5JA 3SD5A 1NYWA 3LZPA 2V5MA 4G3YL 4GSRA 4HEPA 3AMNA 3QXDA 4N2BA 2ZJCA 4OZGA 5CZXD 5AAPA 2DIJA 4FQCL 4ZZFA 5AVQB 2R0KL 1CF1A 3RHWF 1FPN1 1DLLA 1X6LA 5GZOC 5BNNA 4OVEA 1DQML 5DJ0B 3ACFA 5DRZA 4AE1A 5GM0A 4LCUA 2A3XA 5CN1A 4OFVA 3WL9B 4H1LH 5ABDE 2JECA 1UYXA 5KG9B 3C2SA 2Q9OA 4J3OH 4CDXA 3DOIA 1PIV1 3I59A 3OGRA 4BXFA 1QRNA 5CKNA 2R69A 4GJYA 4BFOA 1T83A 4J6RH 1NAMH 3QG6A 1A6UL 2GUYA 2YUZA 2NNXA 4DMIA 4RDBA 2D6OX 2J1RA 4IJTA 2I85A 5C0BB 3ACHA 4ATWA 1OUSA 5D7IB 1C7TA 1M05A 1T7YA 3LXBA 3Q2CA 2CA3A 4JDZB 4NSKA 2HJIA 1AQKH 1TTFA 2DQDL 3ZQWA 4OUSA 1JHLL 5BS0E 3VW3L 4IE4A 1OW0C 2OSLB 3N0PB 5JIMA 3TBTA 1YEFL 5HXMA 2VW2A 5DD6B 4H20L 1Y6NR 2XFGB 5B1JC 2PPAA 3RTQC 2Y22A 2LW8A 4ONHA 4TYSA 2DBJA 2R1YB 1MS4A 4FQIH 1FNAA 2FCTA 2WAHA 4LIVA 5E95B 5F32A 1MAML 4JG9A 3RVUD 1QSEA 3MLYH 3MV8B 4EQ2A 2VOXA 1JGLH 1PVC2 1DGRN 4QPIA 4PJ7B 3Q6FB 3OD4A 2CDPA 2VN4A 5DD1H 3DGGA 2D7MA 5GALA 3V4VH 2PO6D 1HJFA 1U8IA 4RGMB 3OKLB 5F6LB 2VJ8A 3I6KA 4TRPH 3U2SA 4KRPB 3ME0B 1RURL 4TNEA 4DW2L 2V3DA 3JCIA 4LBEA 3HB3B 4XN4A 3WU1A 1A3QA 1QH6A 4C59B 1D2PA 2AVFA 3BISA 3MV9A 4NNXA 2A6IA 1WWWX 2GNBA 4KXBA 5SV3A 4OM0L 4YLQT 5DJYA 5LA9A 1DFBH 4AIZA 1B6UA 1PK6C 2D44A 1RK7A 2YC1B 4BFJA 2LU7A 3GYRA 3JBG7 2CHWA 4MB4A 4PMFA 2Q7YA 4BJ0A 3ZFEC 3RL1B 4PBWD 1LDPL 2BHYA 3C6LD 2R39A 3UP6A 1U3NA 3UCRA 3EYVA 3SQOA 1PY0A 1W9WA 4XF3A 5BNNB 5HYSB 1ZY9A 1CTNA 5KVMC 3KLKA 1OSPL 4GW4A 3L95B 5IJRA 5K0UB 3WIHL 1AZBA 1T04B 1YY8B 3WOVA 3RS6A 5B7EA 2XG3A 1OCOB 2A9AA 5I1LA 5KYXA 1KCLA 4CEWB 3ZN6B 3SKUD 1W6MA 3AZUA 3T4VA 4HKXB 5A3PA 3HBKA 3PL6A 2XTJB 4RSUA 3RBGA 4F58L 3QA3B 4IRJD 1AO7B 4MA3A 3Q6GL 4YH6A 3PWUA 1TTUA 1JTOA 3M7FB 3OPUA 5T1DH 2WZR3 3I75B 1A4KB 1SYVB 3QQNA 1PZ7A 1ZNPA 1JFQH 3SKMA 4BQ8A 4JPVL 1KS5A 2A6YA 4ZQKA 4PVBA 3CIHA 4TSCH 3OEAA 4UMSA 3SDXA 4TOYH 3NV3A 5D8JH 5HVFB 4Q1PA 1RU9H 2X4QB 4GRLB 4L8DB 2LTQC 1LGVA 3LKNB 5GS1A 1TTAA 3LIZH 2FQGA 1JN2P 3IS1X 4AYSA 3KGTA 5E03A 4PYHA 5E56A 3GSVA 3L9RA 4MLSA 1SXAA 4EVNB 1MFNA 1YA5A 4QO1B 3VGGA 5L7XH 4B27A 4LHNA 5EWIL 2ZCLH 3N36A 3TPUB 3GHPA 4CCMA 3REVA 1AZUA 3QHZH 1OQXA 4OFKA 3VE0B 1UOKA 1ULFA 1UZVA 5FYJD 1KN2L 4BSWB 1BVOA 1G5AA 1QJEA 3CNKA 2EDMA 3IMNA 2W59A 1A34A 4U1LB 4IRJA 4K8RD 1I7TA 5KBDA 1K6QH 5I30H 2JDZA 5CEZL 1YEGL 3Q9PA 3CQPA 5C09A 2H41A 4NNYB 4ZODA 3MROB 4NOBA 4OB5H 5CJQH 5ICXA 1OLQA 2YB7A 3KR3L 5JPMA 1CLYL 1KD7A 2Z65C 2E46A 4JFDB 4Y33A 2IAMA 4NQEB 2WKKA 3N9LA 1KTLA 4EI5D 1MDAA 2AJVL 2Y6KA 1NMAL 1DP0A 2E53A 2YOAA 1QSFA 1B4TA 3IGKA 5D7KD 1O9ZA 1J0KA 5J6GB 3CJXA 2V5DA 4XP9H 4HVRA 4YHMH 5IATA 4FA8A 3M1BB 4FJ6A 4IMLB 4R4FH 3USUA 2XZQH 3FUFA 1DE4B 3F6IA 3ATEA 1TQ5A 4ZZ5A 1PSKH 1VAKA 3U7AA 5HJ3B 4IS6A 3JV0A 2P8LA 2VLJA 4IJ3C 1QLRB 2QLVB 4EI6A 3FLTA 1GZHA 3NK4A 4W9IC 3TO2B 4ELME 1U3HD 3BSZA 4G8AC 4JO4H 1OV8A 3SPJA 2NTSP 5CEZE 5CINH 5E2UH 4Z3HA 5IJKC 4WEUD 4QPIC 4J25A 1DQMH 3VHRA 3DPRA 3OMAB 4YJZL 1T80A 2C3XA 1F6AB 1I9JL 4TYUA 3CZUA 3D51A 1A6ZB 35C8L 2W47A 4ZXEA 3QORD 3NJZA 1WW7A 4JDVA 3SBWC 4CSSA 1KXQE 5LGJB 2JI2A 4LL1A 2OFQA 5FXZA 1W0OA 5HHMB 3EFDH 3LRSB 3MRIB 2NW3B 4NP4H 2NQCA 3K0WA 4WKZA 2D7TL 5AB2A 2WO3B 5E8DH 5ESVB 2P34A 4PJIE 4TXWA 3O6FD 1QDOA 5SX5K 2EZ0D 4ZYKA 2ZUSA 4XBPB 3SO3C 4BISA 1T6WA 5I6LA 4WRLA 1LHOA 1VSCA 1R1A1 1IGFL 1J58A 1Q8OA 1T5WA 1NEZG 1M1XB 3CK0L 3G6AA 4IHOB 4U2ZA 1LO3H 3K8KA 4YZFF 5C0GA 2GJZA 3ZHLA 4GO8A 5BO1H 4UTBA 2RDNA 5F9TA 1NMBL 4HDIB 3NZUA 2LW3A 2ADJB 3L13A 5D1IA 2QBWA 4RAVA 1G9FA 3BEWB 4KJYB 2HG5B 5F1NA 3CBRA 4YZ5A 5IHRA 1JOIA 5HGHA 2VZUA 2X89A 4KJWD 4MRBA 4JQVC 1N0LB 2ZSVA 4ETYA 3U2JA 5ISZE 3IN0A 4FKHA 5C0EB 1H3GA 3IDGA 5LW9A 4U4BA 1RZKC 2NZ9C 5BRZB 2RJLA 1QSED 4GBXD 2ADFH 2IV8A 4WF7A 1H4HA 1NA8A 4R0LC 1MF2H 2XIIA 2E9WA 4F2MB 2KQNA 2CQVA 3CVIH 2VM4A 4PRBA 4R3SA 3S8FB 4OZIF 2PCYA 1GZWA 2JDKA 1IAOB 1QEWB 5FZ1A 1X9LA 2XWJB 4UANA 2MQ3A 2ZJSH 4KVCH 2WV3A 4TVSa 5GGRA 1CU4H 3GBEA 5A3LA 1RPUA 4Z7UE 4XN8A 3N9MA 3CLEL 1DFBL 4BQ2A 2JKNA 3KGRA 1NPUA 2PP9A 1XCWA 2CRYA 5DUPL 3HD8B 1F1DA 3EBGA 1M6UA 3QFDA 1E8XA 4KHXH 3VXUE 3FPYA 3SBWA 3WJMA 1NBZA 5I1LB 1KJLA 2BVVA 2A74A 1N6QH 1P4BH 4XX1E 2HWB2 4TTDC 3GEWB 4JG0L 3AMHA 4LKCB 5GRJH 3JXSA 2VJ0A 2ED9A 2EH7L 3POSA 1BQ5A 4XZUG 1A21A 1T2JA 1I85C 1TVHB 1UH3A 4KK6C 4P3WA 4PS4H 5I8TA 2XJSA 5K9OA 1RZKH 1IEAA 2Y1YA 4YEFA 1KDMA 2BVEA 4CN6A 3ZXDA 1VZGA 3KLHC 1BEV2 4L2YA 1WWAX 2I26N 5JXEA 3MFAA 2D7PA 2XX0A 3QNYA 4HAKA 3JTSB 2PHXA 3FN9A 4GBXA 2GBVA 2V9TA 4X6CB 4L8CB 4L2NA 1TQWA 1DL7H 2KPWA 3Q6GH 4JGUA 4LOUC 3IKKA 1JRHH 1JUIA 1NLBL 3RWEB 5C7GA 3MRRA 3O41B 2OKXA 3NZHL 1NGZA 1UU4A 1S7QA 1M6OA 3NAAL 3TEXA 2DYCA 5FYCA 4XFHA 4LLVB 2DN7A 4XAKE 4YG0A 2FEDC 4ABQA 3MDJA 1VJ2A 3HT2A 1NCQB 2IFGA 3ZMEA 5KYUB 2WO7A 4PG9B 2XQRA 3WUDA 4QRRB 3ZTCC 4GG6A 3GMRA 4X6BB 1O6VA 2ZAHA 4HIJA 2YOCA 5FLUA 2X4PA 1U8HA 1U6AL 1RUI1 4H7MA 4S2GA 3BUQA 4JLRA 3GIVA 2WUBH 3HBGA 4JFQA 4NN5C 4AW7A 2XH6A 4MGSA 1XNCA 1TZIB 3FB5A 1EEZB 1VEPA 4E0RB 4QX5A 2WWKO 4WM8A 3EUDA 2YQ3A 4Z77A 1QSZA 5J3HC 1A4AA 4DO6A 1F9KA 1ND2C 4G1MB 3M1CA 3U9PH 4UWDA 1DQDL 3F7VB 4X4XA 2RS13 3D30A 3AYCA 5K9QG 1JNHA 2WGNB 2YBRB 1N7ML 4NAJA 1SDYA 2FSEA 1RU9L 3X13A 3HR9A 4S1RL 4RS5C 4TSAL 1SYSB 4KAQL 2HFTA 3FCTB 3GMLA 4HSQA 5J12C 3CBNA 5IVYA 3L1OH 4IOFC 1AHWC 4IERA 1U93A 1ZEAL 4NC1E 2XT1B 3ULSA 4ANKA 2A5UA 1QQP1 1ZBE3 5A3UA 3I6LE 5CXPA 3WSQH 2R29H 3KPPA 3BUTA 2JK5B 5FM4A 2Q1MA 3MR9B 1AD9B 1GKOA 3RJ2X 2QQMA 1YO4A 1IT9L 1IARB 2IANB 4GG8B 4AVJA 1BREA 2DVFA 4I0PC 3BP5A 1UOLA 2KUTA 3CSFA 2RDSA 3PAZA 6FABL 3Q2VA 3BIKB 3QUZA 5D93C 2HVKA 4Q29A 3DRQA 1MDTA 4QOKB 2HFGH 2PP7A 3Q2WA 2R2HA 3WCYA 3LEMA 2BNRD 43C9B 1F45A 3CIAA 4X6CA 1A6PA 2KT6A 4L8CA 2J1ZA 3WX5A 3EGXB 2YRBA 4IEUA 5KSAC 2IGFH 3QXUA 1U5ZA 3OHXA 4K0OA 1KPVA 5E2UL 3AS2A 1RUD1 1OP3K 3U79A 1F3JB 3ARYA 1KEML 3IFPB 4M1CC 2FX8H 3AXIA 4HF5L 3OKOA 4BZ1L 3LRHA 3RFZA 3DXAB 2Y26A 2ITFA 3UAJA 4AQ1B 3RGVA 5HHMD 5AOIA 1DLCA 1UM6L 1ZRCA 5D7JC 3PJLA 5T1JA 2CSPA 3IFLL 3T8MA 4P5HA 5CFCB 3SQBA 1AR71 1H1AA 2XONA 1ND2A 3MNZA 5JQHC 1B0RB 1OF2A 1W80A 1KFUL 1L9TA 1JGLL 3ZKXB 5IWLA 1NIDA 3MLYL 4JLRB 4FXGA 2ORBH 4JKLA 3UJIH 1YCIA 3AYDA 1CICB 3TA3B 1I5PA 2G4GA 1N70A 2OL3A 3IAQA 3PNWB 2FZ1A 4XAKD 2G30A 3FUQA 2OS7A 3V4VL 5ACA2 1J5CA 1ETZA 1WGVA 2JWYA 3OLGA 4H88L 4NHYA 3S5LA 3N7JA 5KSBF 1NEPA 3CUPA 2XN2A 3FULA 3UL2A 3BO8A 3L3IA 3ZE0B 3AT9A 3WKPA 4WGKA 5DK3A 3W82A 2RS11 3BP4B 5E9DA 1PVHA 4LPWA 1HZKA 1APNA 4HAFA 3VKFC 1G7MB 3NKGA 3VZMA 5CD3B 4E8CA 2PTTB 2PO6A 2WBJB 2DIAA 3MCLL 3NJXA 4KXDA 4Y7MA 1L6XA 4OZIB 4G83A 4RMWA 3B2VH 2XL9A 5JHDB 3NFNA 2J1EA 4JO3H 5JI7A 4CP1A 3PL6D 3AK0A 2FBRA 4U0RC 1MJ7L 4DH2A 2BSRB 1NUNB 1MS0A 2BJSA 4XCYB 1JTPA 2FHCA 3CXFA 1NIAA 3IJHA 2WXLA 3GI9H 3Q2NA 4H1LG 5DD5L 3B2MA 4X42A 3VWKA 4FPOB 4JAAA 3U6RB 4Z7QE 3LIZL 3C7EA 3ATGA 1NCBH 4KXCA 4L11A 1CLZL 1CU4L 3QEQE 1M7XA 2CMRL 1FATA 3PCYA 4C90A 3NFNB 5I8KL 4NQED 1PL3A 2GVYA 4TL5A 3W59A 4QX0A 3C6LA 5CR1A 4YW6A 3U78A 5EN3A 3WE1A 4IE5A 1AS8A 1YEEH 1ZHKA 1RZIB 1PVXA 5DMKA 2BW8A 4OVVA 4W9KC 5T1DL 1NFIA 4JDTH 1EA9C 3ZT5A 4YK4B 1HYSD 1JDAA 3ATAA 3TOPA 3IMWA 3KPSA 4LPTA 4MXQC 3DYPA 4GW1A 4PIXA 1PLAA 4KV5E 4M4RB 4DN3L 2E7QA 3H8OA 1FO0H 3POGA 1GAFL 3S36H 2ITCB 5IQMA 4YR6A 5GGUB 4CXYA 2EDQA 3S4SB 1K2DA 4JCWA 4KNUA 1AJOA 5DUML 1H2KA 4OSUL 1O9WA 4QWWD 1D6VL 5DC2A 2QQOA 1AR62 4XO8A 1QTSA 1STMA 1HINH 4R7XA 3M1HA 5HI3C 4TUJB 4WK4B 2ATKB 1BQPA 3E6FA 5SWSA 6TAAA 5IR1A 3QQDB 4M3KB 4CC0A 2WJ5A 4W9ZA 5A3OA 4QXGH 4QHNA 4LEEA 2YGNA 2R2BB 4FNQA 3D8MA 5T3NA 5IJBC 4AM0A 5AC93 2IAMB 4NQEA 4NPKA 2CKBL 3HZYB 4PQXA 1ZLUH 4BQBA 1CXFA 1CYGA 4NIAA 2DYSB 3ASIA 1PG7L 2OMTB 2DPKA 4HXAL 4YDLC 3F2LA 5IEKB 1W8FA 3K51A 3QIBB 5K0UC 4B4RA 2A73B 4RFEB 4OCXH 1W28A 5ACMA 5KYWB 2X7LA 1Z0NA 2GDFA 1ID2A 4HOMA 4XVJL 1WCDJ 3GS7A 3G6DH 3VZOA 1KJ3L 3FQTA 4F57L 4C8DA 2FEJA 4GUCA 1D5IH 4KX8A 1KC5L 3LIUA 3RKDC 5GJ6A 2FQPA 5JHBA 3HNBM 2LU5A 3MV11 5HTSA 3NA9L 5TD4A 1LESA 1AD9A 4PJFF 4L4VB 4F83A 4Y5XB 4ELMA 3GHMA 4ITCA 2PW1B 2XKOA 2W65B 2KZKA 4PJFA 1CYWA 3LH8A 4P23C 1BBT1 1XH1A 1JXGA 3A7QA 1W8UA 1MNNA 2I60L 5I9QB 5B4MD 1MVEA 1UWEH 3DHMA 1FVDB 1FSKB 4NQTA 1Q38A 2G5UA 2FQEA 3MRLA 4WHTB 2DQCH 5KVEH 2WXIA 4NPJA 4PLNC 5JW4N 4OLWH 4UW4A 5IKCA 5LCVA 2E47A 4F1SA 3CLFL 1BZOA 2HRGA 2WKGA 2VAJA 3FAXA 1QSFE 2Q76A 4ZO9A 5FK9A 3L08A 2HEVF 1AR1D 4XBNA 4PRIE 5L2JB 1SUJA 2X29A 2K1MA 4WW2A 4TV3A 3ULUH 1D9KB 3AMMA 1CWPA 3KXFA 1Z9SA 2XBO2 4W9FC 3OY8A 4BFRA 3C6SA 1D5BA 4E2OA 4K55A 3N2JA 4P23B 3SJVE 5ICYB 1BVVA 5TH2B 4KZEH 3SDCD 4C58B 2VLLA 3RWHB 3FSOA 4I9WD 5BZDA 1U30A 5KVFL 5EN2A 3WN5B 2P37A 1ECYA 1H8SA 1MFEL 5D70L 1QJZA 4F9PC 3LFIA 4A3ZA 2UUDH 5AD0A 5IIEA 5LBCA 1MCHA 3O6ML 4XCCL 3V0AB 4BFNA 2EIMB 4FG6C 4YDVA 2VDRL 3ZDZE 4F20A 3KMHA 1Z5YD 4X4ME 2RGSA 2ENJA 1FV3A 2ZSWA 4NFBA 2CR0A 1EV2E 2M1KA 3CSBA 1NGZB 4GAAA 2QSTA 1TME1 3J8F1 5FYJU 1J7VR 3CFJA 3L3OC 4AI7A 4B4PA 5FFLA 3PLYA 4KUZL 1AGEB 2M26A 2QR0A 4KH9A 4PGCB 3S5LB 3WEOA 3IJEB 4AJWA 1JXNA 3VYPA 3ULUE 2VCBA 1K9TA 2ZOLB 3NJNA 2R30A 3D4GA 1C5CH 3CDYA 4OW6A 3S57A 5HDWA 5FZBA 3GIZL 3ZYJA 4A2GA 1NE4A 4QX2A 2GY5A 1G1KA 4ADJA 2A0LC 5F7DB 2VLRA 3OVUB 1FFOA 4NOTA 1G8WA 2LTQB 4GO6B 1EFXD 1RUC3 1QNIA 3QZWA 3RIFF 3ETSA 2OR9H 1OBNA 1QUNB 1WA1X 4MLIA 5DZLA 2R16A 4B9KC 2DLFL 2VM3A 5C0CB 3UPAA 3OKKA 5ANMB 5JOFA 3ARFC 3ZT7A 3ARXA 3QJQB 2DU1A 4YFEA 1KCUH 2CM5A 4NO2B 2H1PH 1UZWA 1DZQA 4I7ZC 4X8CA 1FL6B 5DVNA 5C08D 1ZWIB 4UW3A 4LSQL 1U8MB 5FW8A 1OSZA 3QZWB 4AM0Q 5BVPL 2VXUH 3BZ4B 2OSLA 3VHOA 5T5FL 3NAAH 25C8L 4Y7OC 5FKAA 4FFHA 4YXLH 3VXRE 3ZN6A 4AAXA 3S5LG 1RP8A 4NZJA 3P3PA 3E6HA 2IIJA 1AX2A 1S0FA 4AMWA 2WWMC 4FPFA 5HV0A 4ZS3A 4F7PA 1H3PL 2OQJA 5GHWL 3MV7D 4S1SL 1V3LA 4BA0A 1OA3A 4RYDA 2YPLD 3X3GL 1A9VA 4A68A 5BNPA 3KLAB 2YRZA 4OZHF 2QFRA 4PJGE 5F8QC 2EEFA 4Y5Z0 1XCQB 4RQPA 4NKMA 4MAYB 1NLBH 3VM5A 3VX1A 5EEZA 3H8UA 2BINA 4Y8DC 3FT3B 1AR91 1BHGA 1OTUD 2DOCA 2H9GB 3VDCA 5I1KL 3JTSA 3EJTA 4MNHB 4QXKA 5TDPB 2YZ1A 4AVIA 3I49A 2DVAA 4X4XB 3FQUA 4QHNB 2RHPA 3ZFFC 2YIHA 3BZ4A 2P80A 4AEHL 6PAZA 4XUPA 3V9EA 4D3CH 1KBKA 2D7OA 4NQDB 5JNYA 5J0BA 4PCKA 3CN2A 5AVAA 3EYUH 3GF8A 5J7MA 3ZE1E 1CDJA 2CDEB 5LA2A 4D7PA 4Y4KB 5TE6H 1WIUA 1RZ8A 1X7SA 1IE4A 4PVLA 1YQVH 2WXMA 3NIFB 4RMTA 4LRNL 3LEXA 4QNPF 5FYKE 1RGSA 3FN0L 2AQTA 5HYQA 3P3UA 3V6ZA 3EJYD 1JHKL 2CGNA 4OF0A 4XGZB 1ZLVK 2HUHA 4LAJH 2X5IC 2ICWJ 3C5ZC 2MCPH 1JV2A 3PHSA 5EBLA 4QHZA 3KPMA 3ETBF 3MRNB 5LUMA 5IQ9A 2IZWA 3V8OA 1WMEA 2BDRA 4J5VA 3AKTA 5HCHA 5FHAH 1AY1L 2XRAH 2FJSA 3F58H 4M56A 4RNRB 4RX4A 2R061 3F6LA 1UJ3C 1MCEA 3AVEA 3ISRA 3ZBMA 4DEPC 1RUF1 2NQDA 1WZ1L 4NO5A 1YYLL 1SVZA 3GSNB 1ND3B 1RZFH 5FBJA 3HS0A 1ONAA 5K9KA 4F27A 4HA1A 2VZ1A 4HX1B 1GZPA 1CAWB 3KGZA 3ECBA 1XHHA 1AR83 2DWRA 4YVWC 4W9HC 3X1GA 1KIUA 3E5QA 4L4JA 5FCUL 5GLWA 3GUFA 3VXPA 3K2MC 1E4WL 2FO8A 4JY5L 3A4AA 4NKIH 4LO4B 1N3QA 5GS3A 3TYFB 2OS2A 1O7DC 4P3CL 4UINL 2E3VA 3SGJC 1KB5H 4NZRL 3TH2T 1JXJA 2YR3A 5IEKA 1CIUA 5IK4A 2R83A 4BK5C 1KCSL 1QX1A 3MV9D 5F44A 1ZA3A 4CSWA 1XE0A 3VBUB 3KH3A 1JGDA 3D9AL 5F7YC 1ACZA 2NY3C 4RGNB 2Q0ZX 1UOFA 4XVSH 3IFOA 1MRCH 2YBPA 3BO8B 1FZKA 1NDTA 4E9YA 5FMDA 4HIIA 2OMZA 3PMEA 2WB7A 4JZJA 3ARSA 3WGVB 4K1ZA 4ZUSB 2YAFA 3VQMA 4UNIA 1DYKA 4RFNB 2AEOA 5E9DB 5GS0L 4JRXB 3MPCA 1MJJA 5JIHA 5L6YL 1HILA 1WHOA 1WMDA 5BOJA 2VWEC 1U9KA 5AEAA 1PK6A 4N2EA 1X7QA 4DVRL 4XTPA 2Y36L 4CMHC 4WTZG 5JLZA 4R90L 5FPXA 2WHVA 1CT8B 1FGNH 1PEZA 2UX7A 3UC0L 4YUEH 2H5UA 1W0WB 1BJMA 2VLJB 3C12A 2JE9A 1O4YA 4EQVA 3BXNB 2QGBA 3EJCA 4Y2NA 2DQIL 3RGVB 1OGTA 4X8JB 2R0LH 3U4BL 1LE9B 1EAH1 3TZVC 5J13C 4XXWC 1O5UA 1UX6A 4XMPH 1HT6A 2DWXA 5IJCC 2YD4A 5D1ZI 4Z3TA 4L99A 4HJ0C 2IXQA 4H13C 5DS2A 3S3CB 4XZPA 3ATDA 2K46A 1CGSL 3F7KA 1N8OE 3AGWA 3LQMA 2ZKMX 4YFZA 5C5UA 2VGLM 4JJHA 3UKTA 4KGLA 1OAQH 5EZWA 1NEUA 3P02A 1O9VA 3DETC 4DGYH 1BVKA 1EHLH 2OXBA 4J1WA 3SN6N 2FO1A 4UF0B 4V2BA 2BCKA 2DQDH 4GKOA 4DUXA 1EEQA 3HOBA 1OANA 4Y2DA 3MRPA 3GSRB 1L9MA 4JREC 5I1HL 2DMHA 2GMEA 1QEXA 4LEJA 3UZQA 1F58L 4N2HA 1RINA 1PJ9A 4EKJA 3UTSE 3F62A 1BXXA 4DKEL 3PJSB 5AYUL 1PY4A 3TGXA 2MEV1 1WS8A 1X5ZA 4WQOA 4PWHA 1GC1H 3HCVB 3SODB 3GBLA 5FLHA 4JK0D 3LXAA 2B7YA 1AR63 5A33B 3W56A 2ZGQA 2ZTNA 4GP5B 1OOPA 2DTSA 5I73C 4APQA 1KB5A 2D4DA 1E4KA 4ZMVA 3GB7A 1A1NA 3RI5K 4K23L 3JZVA 3W9AA 5F88A 4E5XA 2AI0H 5HCFA 2WQ4A 4NQEE 3QDGA 2NCEA 3J2PA 3IBEA 1AHWA 4L4TA 2X2YA 4UUJA 4WGVB 4OD2B 4E41A 1ND2B 3JUZA 1SBSL 2PETA 3BI9X 4RISL 2X9ZA 3HR6A 4MA1B 4PLMA 4TQ8A 1IFHL 1L7RA 2WFPA 4PIYA 3QIWD 2WLPA 1QQDB 3UX9B 1MVFA 4I1PA 3GSXB 1X9TA 2P3IA 4PGDB 3INUH 1BQHG 1J9CT 3WXVH 1S7RA 4UTBL 1D5IL 1U91B 2NZIA 4FS0A 4J3XA 5HHQA 3QCTL 4K3DL 3TH4T 4LEOB 3U7WH 1YEFH 4M02A 1JS9A 5DHDA 2YD2A 3V0GA 5FZOB 1NCQA 4DXRA 1VBD3 4IMKA 3RZZA 2FTAA 3HS0C 5DO8A 3RPBA 2PAKA 4XJWA 3TV3L 1S7VB 5LEJA 3RZGA 3RE0A 3VKMA 4XOEA 3SY0B 3S5ZA 4L9BA 1A6WL 3MFFA 1SBBA 3NIFF 3WHXA 2YEZB 5LBSH 1LMKA 4M48L 5FGCB 4N43A 4O2FA 2PCFA 3P30H 3R4DA 4UFKA 5A6ZA 3A22A 2P46B 3ZKXC 1A8MA 4AI2A 4IRSC 1ORSA 2H1LM 2CM6A 2YBSA 1DUZA 4QGLA 2AI0L 2ZP8A 4GEIA 4JFOA 5MHSD 4BCUA 1HOCA 3DKHA 4HKZA 4LRNH 5CUSL 1F5FA 1VLXA 2OIIA 3P0VL 3HLKA 4FTVE 2OCJA 1HQLA 2HN7B 3HN5A 2Z7UA 5AAWC 3LB9A 2DICA 3LH2L 2V4LA 4QDSA 2AR6A 3O1OA 5LGYA 1E30A 3FCGA 3SSGA 1ZRFA 1QWUA 4H8WL 1FMD1 2H6CA 1VJSA 2VERN 4Y4HC 1E27B 3NUKA 3Q06A 3BZFA 3DX7A 4G3YH 3RWHA 3S5AA 4O2CA 1TTRA 3ZTEA 4M1DH 4P46C 5FZFA 3RYRA 3HZ3A 4HS3B 4Z0XA 1LWHA 2EDLA 4JUSA 3QFDB 3SKMB 3WJMB 1EDYA 4LMFA 2LTNA 4Z77B 3CH8A 4OFYD 1TVHA 1RZQA 3PNAA 5CLTA 4PBDA 4OJFL 5AVVB 1TZIA 3FB5B 4L9LA 1NY72 4P9JA 1GY2A 4XFIA 1F3DH 3OG2A 4KUZH 3BRFA 1W90A 1SN5A 2VIRA 4L5FL 3SMHA 4WHYH 2WQAA 1JK8B 4LVEA 2GW5A 1BX2A 3MRLB 2JDAA 5K0UA 2ZHMA 3ENRA 4HIJB 4XX5A 2IBGA 4YBQD 3QQXA 1RUKH 1D4VB 2VUCA 3C7GA 4W4OA 4LB8A 4LSVL 1NFDA 4E4SA 3V5HB 1BM3L 4JGNA 1RK0A 2C34A 2CBQA 4YSDA 3UG4A 5D70H 3GJEA 1GZWB 1ZZBA 3E5UA 3H7LA 3LZFH 3U4SA 2B1AH 2IGLA 3TEYA 2ZHNA 2YC4A 2IH3A 2MPAH 2J57A 4MD4B 4GRLC 4L3FA 4NQDD 3OXSA 2YFNA 3T0EE 4ZNCD 2X09A 4DSYA 5KS9B 5A33A 4OI0A 2WLYA 4D0CA 1L7TL 1QI4A 1YC61 1UYWH 1T0PB 3QRBA 4OCRH 4PJXB 4YSTA 3PIGA 4A6SA 4MG2A 5EU7E 5KVDH 1G86A 1K8DA 3KZ4C 3SD2A 3JV6B 2JK5A 1CN1A 5EJ3A 2Y3NA 4J1XA 3CO2A 2QVKA 1KGUA 2EVIA 4C1XA 3I2CH 3WELA 3ZKUA 4KJQC 1NAML 1G7LB 5JXED 1UH2A 1IPKA 5DHMC 4V33A 4A3XA 3CGTA 2E0PA 3BAEL 4U1IA 3MA7B 5HHOE 1YJKA 2IXCA 1QASA 3LEYH 2KQMA 2HJFB 3L1EA 3GXPA 3RI5F 3EXLA 2NTFA 5F8PA 1SBFA 3G6JE 5EOTB 3U0PA 1PU0A 1JPGA 2ZUWA 4YFWA 3EO9L 2P1YA 1W9SA 4RWYH 1C16B 3BN3B 3PAVA 1M56B 3UZEC 3FO1B 4XJUA 2K9ZA 4A42A 1E5ZA 1K2DB 2AK4D 4KG0A 1UZGA 2X4RB 4N8CL 3LHAA 4HWUA 2Q86B 4CCLA 3UAEA 2DQ6A 4X83A 1MHEB 1QWNA 1XH3A 4R2GC 3FZ3A 1RUQL 2XETA 4PRBB 1W6NB 1W0NA 4DP5X 3X2QB 3TBWA 2OXHB 4WM7A 1RHI3 5MI0B 3J27A 3AG1B 2QUOA 3VBOC 4F8AA 2X3AA 1GY1A 1PTZA 5FMBA 2XSKA 3MA9H 2BXYA 5I5RA 4RGMC 4YWGL 1V7NL 4NGHL 3SGEH 3V4PA 3OQ3B 3EBHA 2FUTA 1XJAA 2D8KA 3FB8A 1NL0H 4MB3A 3BP6B 5J1AB 3D25A 4NIGA 4WCYL 4LUMA 4N2AA 2Z4QA 2UXTA 5TDNA 5IW0A 2H1PL 5D1QC 3KD4A 1IS5A 1RUD2 2WOYA 1PY9A 3VWKB 4AEEA 1ZBA2 1SHXA 3V5DB 3GPEA 4NN7C 1HESA 5IWLC 2V17H 8FABB 4KK8C 3MV7E 4IDJH 2PUQT 4IRJB 4AZ8B 2PYEE 4E9LA 3WCRA 1Z1WA 4UT9H 4WJKB 1UXSA 4GMSL 3BRDA 3PUUA 5JHDA 3S3BB 4P9WA 1XCXA 5C09B 2P5WE 1NKRA 3WFEL 3ZUCA 4I4WA 2HVJB 2PTTA 2WBJA 5CSZB 1EH9A 1XIWA 4X4KA 3VRLF 3HI1B 4AL8L 4C47A 2IANE 1LODA 3UNPA 2WSDA 4D3CL 1J1PL 1UU5A 3MLXL 4CRPA 3B1UA 1RZPA 2QVIA 1A6ZA 1M3JA 3VGBA 4O9HH 3FU6A 5CEHA 4K8RL 1DEEB 2GTWA 3D0VB 3IDIA 1AZZC 4Y9CA 5DZVA 5LY1A 1F4YH 2X28A 4TSBH 1KJRA 3BUYB 5GRYA 4U1KB 1G6RB 4LPXA 4PJEE 4DZ8A 3V9CA 1WLWA 4DEVA 1MCWW 3KF3A 1IAOA 1QEWA 4M7ZB 4JHUA 5IFHH 2IUWA 2YU1A 3OGOE 3URFA 2VR6A 1HAUA 3K6FA 3WLUA 4MKMA 3FK3A 3RDJA 3PU8A 4K2UH 3TLRA 3BVNA 2R0ZH 1A8DA 5IP4A 2N1KA 5F9WC 3HOGA 4U2AA 2JQAA 2XRAL 3CDFA 3MCKA 4A63A 4F3JA 4OZ4A 2DS4A 3ZR5A 4BH8B 2VC2L 4JO1H 3ROLB 3WS6C 5J8OA 1BQKA 1D3CA 1G6RA 1OW0A 4A2EA 2YSSB 4D2NA 4ATTA 3NPSC 5K9JH 1I75A 1YI9A 2WSUA 1BZDA 1AGDB 5JORB 4YPGB 5EA0L 2PW2B 4P2QA 5D7LD 4UTAA 5F7KC 1W06A 4KL1A 4KJPD 2IFFL 4OV6F 4FFGA 1HDKA 3OJ2C 3KPRB 2HFFB 1HHGB 4OD1L 3EYQC 3MTRA 4ZFQA 1X6NA 1IAIM 4GW4B 1K5WA 1W0VA 2VDKL 3MX0A 2IBBA 5C0BD 5EOTA 3KPQB 4BQ5A 1EJ8A 3HHMA 4YHZL 5INCA 2Y69B 3H54A 5HGDA 4Z95L 4MX3A 2APFA 3KJ6L 5J06A 3QPXH 3FSWA 4NAMA 3KAAA 5I19L 2DDUA 3KCWA 4MA8L 1ID5I 2GJRA 1XGQB 4M1GH 5KVGH 1R1A3 4Y5XA 3DUIA 4BA8A 3LRSA 2JWPA 3VFWB 4YE0A 1SEBA 4RVBA 3ZL4H 4Y1XA 5ERLA 1S46A 32C2B 1UB5A 2K3HA 2DQGL 3FUNA 5ID1B 3MV9B 4D0BB 2YD0A 1VIWB 2VDQL 3GBML 1MCOL 3OJMB 4IEVA 3VVWA 1ZJBA 3QS3A 1I3RA 5E70A 35C8H 4PGBB 1NGWA 2XG5B 1W72B 3K7UA 5CMAB 3CV5A 4PREA 4NOFA 2W46A 3JYCA 1T1ZA 2CPUA 1T21B 5HHVH 1IL1B 4I3RL 5C1MB 3U82B