3ZMNA

Vp17, a capsid protein of bacteriophage p23-77
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
233
structure length
228
Chain Sequence
AAVQVGGWGFAWIDNEDFSPTGLAWRSGEYFALAQMKTPETAHFRIAAQERRLRIYLRGQKVVNGRNLSDPDSRTVNLPFLMQTPQGAPTLPSTYHPDVAVWAKVGSTWQPCVITAINYSTGDVTFTEPAGVTASDGIEIYYVHGDGQFRLRVARDDSAATVFNQSFSTMHSVDQNNVETMIAWPQQVELVPGTRLVLEVFTTQVPMVWNERSGHYIQIAAMGRRIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
molecule keywords VP17
total genus 49
structure length 228
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmnA02
2.60.120.1170 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zmnA01
3ZMNA 3ZN6A
chains in the Genus database with same CATH superfamily
4K9EH 5DRWA 1ZHNB 1W6QB 2J5LB 3KLAB 1RV6X 2TRHA 3RZCC 4AQZA 2FZ3B 2V17L 3DGDA 2F7OA 3QWRD 4FI6A 3V0BA 4V2CB 5B39B 2ZS6B 1BAGA 5F97E 4Z8FL 3MNVA 3UTSB 2KQNA 2FQEA 1K2DA 1E3XA 4XCEB 2WYSA 3G6JA 3UBXB 5DUVA 3NOIA 2YBSA 1CFTA 4DTGL 5DJ2A 4C55A 5HV4A 2R39A 3QUXA 5DK0A 5FHBH 2TEPA 1YNTF 1E28B 3N2JA 3FMGH 5DZJA 2YWZA 4PJ5E 3MJ9L 3KNBB 1X6NA 4JZJA 4PJGF 2B4CH 4NUMA 3NFSH 1F86A 1FG2A 8FABB 3ZDYE 3S2AA 1MQKH 1II4E 3KB5A 3QJXA 3F85A 2E7CA 2W0XA 2V5RA 1URXA 3RUGA 4QWNA 1MEXH 1JDDA 3C6LA 1UKSA 3FRPB 4FFZA 1PX3A 1M7UA 2D31B 4LVHB 5F7KC 1OP5K 1TZAA 3FQNA 4NNXB 3MUY1 4AENB 1LKNA 3ARBA 4EWDA 4CPBA 4CCDA 4AK2A 4XE9A 5D1ZA 1RIUH 2XWBB 4BUGA 3N3HA 3ZIXA 5GRUH 4XPHL 1OAXH 4M43L 1XZWA 2DYPA 1YMMA 3JWNG 4RX4A 1JTZX 4JMXA 2OKMA 2HLAA 1OL0A 3MLYL 1JHNA 4XILA 4F8OA 4XXAA 1BMZA 3P4OA 4Z5RA 3FQYA 1AFVL 1R1CA 4BH8A 2DJ4A 4EJRA 1M56B 2BNRA 5C1MB 3RVHA 2GTZB 5HGAB 2AJSL 2BTVC 4LSTH 2RMNA 1RPQA 1ODUA 4XN9A 5A7PA 2FDFA 2XFGB 3C7GA 5CN2A 2BVPA 2IBZY 3RVTC 4L5FL 5CWSB 4DQAA 4Y4KB 4LLWB 3UJJL 1KDJA 2CCWA 4L0YA 2LW8A 3PIJA 5L73A 2XWXA 3ZXDA 3JZYA 4OHVA 3VWKB 5CIPH 3UTSD 5IK5A 3HT2A 3E6CC 1WA2X 5HGBB 1UD4A 2JK5A 3QIUA 2AANA 4IEPA 5DD5L 2HSIA 5DUUA 4FXGA 1T4KA 1Z9NA 5ANNA 2EO7A 3DX9A 1X5FA 2AJUH 2VLJD 5DZGA 4KKQA 4HKZB 5K9KB 2E7AA 1AHWC 5E08H 4MQ7B 2CLRB 5FA4A 3RGVC 2P43B 3RJDA 2R7EB 3MXVH 1TPXC 2GUYA 2X3AA 5E0QA 2EYRB 4G3YH 4LLMA 2F74A 4LPXA 3K2UH 5I2IA 1D4M1 4LCWE 2WZR1 4XP4H 4QYOB 5DUML 5E6IA 3ATFA 5HY9A 4GQQA 2YC1B 3DROB 4XP1H 5H94A 1EO8H 4DEUA 4EN3A 3MLSL 1DJXA 4CGTA 2X6VA 4M8VA 4PBDA 4TSCL 4ONGL 4X9BA 4FNQA 2A74C 3DIVA 2E33A 1GNYA 3TNNA 3ETBJ 3ZXEA 1BECA 5JHDD 1DIWA 3ESMA 2YBRB 3LNIA 4P23C 2IMNA 3T1MA 3QUZC 4JGNA 2EVGA 4CSSA 1FVDB 2EICA 1LJMA 2Z31D 5FZDA 4F58L 1TQSA 2DQUL 4CN4A 4HULB 4XMXA 3MCG1 5SX4I 1F41A 2F1BA 4JKMA 3REWB 2DL2A 4BDVA 1RTVA 2NQYA 4WM8A 1BM7A 5FHAL 4OLYH 3AGWA 2BXYA 5CBAB 2I45A 1JPTH 5MHSE 4CVZB 4NPJA 4LK7A 4WJKB 5BZDB 1F5WA 4ZW8A 5D1ZD 3KJ4C 2BNRB 5LEKA 4JO3L 3MRLA 2GTZA 2ZWZA 4MA7L 5FO7A 2OSLA 5I82A 4P4RB 3VFSA 2XWRA 2XQYK 3WN5C 2UWBA 2ZQKA 1T5WB 3D39E 3SO3B 3WD5H 2G5BA 4OLXH 1IQDC 1RUH1 1V70A 4FZEL 4MYPA 1G8WA 4L48A 3NV4A 1YQCA 3FO2B 4O9HL 2PLTA 3O3EB 3V5DA 4LBOA 4O7XA 1UZGA 4AQEB 4UUJA 2WZPD 5K69A 3N9NA 4M0NA 4BCUA 2Q1FA 3S36X 4QHUA 1NGQH 3VBOC 5CG9A 3JWOL 2P4EA 1BQSA 1CFMA 4TQIA 1QHQA 1QLFA 3RY5A 1AD9A 2Z31C 3N0AA 3QB7C 1LK3L 2AQTA 4NQUA 2W0FA 4OIFA 4FNSA 1KLGB 2EUXA 4OZFA 1LE5B 5I8YA 3IGKA 1IGYA 1I9JL 4D3CL 3GBWA 4U6YA 1F58L 3FB6A 2EYRA 3ES1A 1E4KC 4HC1H 4NIAA 4OCRH 4PU2A 2VGLM 5KVGE 2XQ0A 1VRBA 4BKTC 4MGTA 1D3CA 3O12A 2VLRB 4DXZA 4YL4A 3L9JT 3GIZH 3WGUB 5A1FA 4CILA 2PR9A 3LKSB 4QCIA 1QY4A 1WWWX 2J1EA 1F3DH 4U4BA 1OLRA 1ULFA 1KRIA 4FFYL 1DJZA 4P4KA 4DKFH 1V6JA 1JK8B 4JJ5B 3KGUA 4DP8X 1CAWA 1RXFA 1H3XA 4HWZA 5T1KA 4AQ8C 1PGSA 4Q4W1 2WYZA 4L4VE 5EEVA 2BSTB 3SBWC 3IDXL 4V1DA 3ESNA 3STLA 4DW2H 1U8PA 4ARXA 1G0XA 4WM8B 4HOZA 3UACA 4B9ZA 5KWYC 3KHQA 5CNAA 2FJHB 1MNNA 2K6YA 3ZFGB 5D1QC 4N86A 4LKXB 1A8DA 3QG7H 1HKLH 4BWTA 1MIEL 1AL22 3IFOB 3VXMB 2E51A 1AHMA 4IXLA 2VW1A 4RHV2 3QCTL 1EANA 1W0PA 3BFQG 1GQGA 2IG2L 1N26A 5A3UA 2NXZB 1KPRA 2P80A 3OMIB 1A7OH 1HSBB 4P4RA 5I9QB 4MMXB 4Q4Y2 4OU3A 3EYUH 1WFMA 2MTAA 3DO4A 1MZ5A 2ALAA 1QOSA 1O7SA 1LD9A 3MLRL 1WLCA 4XP5L 1XOYA 2QQJA 1CGPA 2OQJB 1XGYL 3ESOA 1HEJC 4GMSH 3FO2A 4N87A 4I2XE 1H0BA 2CGYA 3DSFH 5E1QA 2X4RA 3VBRA 1MR5A 4ELME 3WV0A 1NY72 4FEIA 1WCSA 2ZUYA 1NLQA 5IOKA 1YEGH 1T0OA 4P5SA 1KGCD 5BS0E 2J71A 5TH2B 3S7IA 4ZU7A 4FN0A 2ZOWA 3AMLA 2MQGA 1COV2 2IOMA 3MR9B 4Z76B 2QKIA 3CE1A 2E9IA 3NT0A 3QUYD 4RGMB 1RL3A 4AK3A 4CA4A 1I8UA 1WZ1H 3FTGA 1F00I 5IB3B 2PXYB 4HCRL 2UZPA 4PJ9B 4U6YB 5DTFA 4LESA 1XX9C 3PWPA 1O6TA 5HXVA 3NK4A 3VDDC 4E41A 3N35A 4ZUWB 4OZGA 4JTNA 4QTIL 2HT3C 4GXUM 2BP0A 1CGWA 4W68A 4TTDD 5CZRA 4QGMA 5CN1A 4UTBL 1U3YA 2A6IA 2EIZA 4CBZA 1ETZB 1CAUB 1DVXA 4OGXH 1R3HB 4G3YL 3MNMA 4HISA 4HWZB 5T1KB 4X6FB 1S6NA 4J1UA 1X9RA 4XXWA 5HHXL 3GSUA 1NG0A 4M7ZC 1MWAA 1F18A 1J0HA 2X41A 4X5LA 4KK6C 3QXUA 4MNQA 2AJ3B 4MXQC 3MRRB 5A3ID 1J86A 1G7LA 1HDKA 3C7EA 3DXUA 4Z3EA 4TUUA 1KFUL 2CE6A 3AS3A 5KJRL 2B8OT 2VN3A 1K8IB 4LKXA 4YFWA 3L3OC 1R083 1K4CB 3PP4L 2D2CC 3HC2A 1JODA 2GJJA 1HHJB 1HV0A 5J6GB 5SV8A 4KI5M 4XDQA 1RFDL 4RAVB 1LGCA 3OX8B 1U8IA 2C3VB 2MPAH 2JI2A 4ZQKB 5ICXA 1AOZA 4FZ8H 4HFUH 4PJAE 3JUUA 5FKPB 1BG9A 4XB3A 3UTSE 2KPWA 2E4TA 4M6AA 2YYOA 4OF0A 1J48A 4HJ0C 3TP4A 2EXIA 4M1DH 4G6AD 1E43A 3MKGA 3NCJL 2AV7A 4NOFA 4XUPA 3WG2A 1N3QA 5ENWB 3P73A 2LOEA 3S37X 4F7MB 3E38A 2C4FU 4GAFB 4BHUA 1WTLA 3KPPB 2Q5TA 4JV4A 5AOZA 1RZJH 4LLAA 4ZTPL 4FNLL 4ZUUA 2YEZA 2ZHNA 1U21A 3BQUA 1MFEH 5E99L 4HIJA 3DSNB 5D1XE 3GSNB 4J4PC 1E27A 4LB8A 2BSSA 4JY5H 5TE7L 3VVWA 1E4HA 1I3GL 5IHLB 4N90A 2ET1A 4CPBD 1XGYH 4XMAA 4KRLB 3TTYA 3MR9A 1L3WA 3EGXA 4FABL 3KPSE 1E0OB 2ZX6A 2E63A 1MUJA 4KK9D 2GNBA 4PJ9A 4LEXL 2ZCKL 5L8LB 4Q6IA 5B4MC 2HH0L 2KUTA 3HAEA 4KJWD 3SE3C 2I85A 4BK5A 4EI6A 1VAVA 3ETQA 3FFQA 2X4PB 3EF7A 2BHZA 5LRSA 4EE2A 4YLZA 4ANVA 4R2GB 3HE6A 4LSSL 2AK4A 4RISL 4Y4KC 3BTYA 3V4PB 3HHSA 3NAPC 1N10A 2NY2B 1WUNT 3WAKA 2ARJB 2GMEA 1K6QH 4GPVA 2BWDA 3OR6B 1G7LB 5AW4B 1BXXA 4OI7A 1U8KA 1ANUA 3NACH 4F7EB 5I15H 3VZJA 4R7XA 5IWLA 4JGZC 2EDKA 4YDLC 3SE9H 1RPKA 3GZTB 3KMHA 3TN93 5EDSA 3GPSA 3FJSA 4P5MA 1C8M3 4YVWB 1K4CA 3GLAA 5HHXH 1S7RA 1A1MA 5LASA 1IC7L 2Z4QB 3A4UA 2JQAA 2R56H 4BCZA 1JK9B 4KZDH 5F89B 3W1ZA 4B27A 4BMBA 2C3VA 2MEJB 5F88A 3PUCA 5D5MB 4DN4H 2EVFA 3APCA 3MYJA 3SISA 1AC6A 4RMTA 5AYTA 3QG7L 3UGEA 4PRAA 1CC3A 3VXPA 5JCTA 1ZIAA 2Q7YB 3ROLA 3V4PH 4JEGB 4QRPB 4F91B 1ZZBA 1TXKA 2NY2C 4F7MA 4X50A 4JFXA 1RZ7L 2YO3A 4K3HA 1EHAA 3L4WA 4EVNA 3U0TA 2AAVA 1CF8L 4MX3A 2YFUA 1WFIA 2AJVH 2KLTA 4HGKC 5F3IA 4PJHE 3LHPH 4KKNA 5F8RC 1I53A 4X5PA 3H42H 5I0DA 1BMV1 3RGVA 4YBQC 3EO0A 4GXFA 5JW4Q 3VQ1C 3S8WA 3EGXB 4C54A 2O6CA 1AYN3 4ILDA 3ATBA 3CVIH 4N3UA 4PDWA 1SMAA 3PWUB 4R2GD 4DY5A 4G9FE 2C7FA 3MLZL 1SUHA 5JZGB 2P5PA 5L4JA 3VZOA 1BF2A 2D03L 5E88A 2VDMH 4X0NA 1T7WA 3D4YA 2B1OA 4XOAA 2VJ0A 4BIOA 4KK9C 4A6YA 1AGFA 5JIQA 5I18L 1E4XL 5FY7A 1Z32X 1KB5B 4HWNA 1O6SA 3C5SA 3CHOA 5EF3A 4GB31 3W20A 3EOAB 3BODA 5IHZA 3NV3A 2R0FA 3WN5B 3BJ91 4FNPA 2NY3D 4KMLB 1KGJA 2B3IA 3LS5H 4P2QE 3PGDA 2O6EA 2QSVA 4NEHB 1QG3A 1OAJA 3L95B 3KDPB 2UVEA 4JHUA 1QSEB 4NN7C 3ZE2B 1HRV3 1XSRA 2QADD 4POUB 5C9JA 4X0KA 2VLKA 3OR6A 3ZE0B 3HVNA 5EU5A 3RI5K 1OTUC 2WQZC 2K9ZA 3EFFA 4X4MA 1IC4H 5KSUB 4M5YH 3ETPA 4O2EA 5DUMH 3VU1A 1HX6A 3MVSA 3PUUA 1TYJA 1MFAH 1GZWA 5D6CA 1QW9A 3HQXA 4XNXH 2ZTNA 3EADA 4PGCB 4LVOC 5KJRH 5F88B 1OGPA 2ZKLA 3T71A 1CFBA 1UKQA 2Q3XA 2CGZA 5E6YA 4HJGA 3JUZA 2F53E 5FM4A 3VXPB 5DDJ1 1DQJB 1K4DB 2NSXA 1HB1A 5AD0B 1A14H 2XKUA 1B0GB 4ARYA 5I75C 4LDLB 3KT7A 4JL1A 3MBEA 2J7LA 4JFXB 2IFWA 1KGUA 1ULEA 4PBPA 4QD2A 2VDQB 3QUXD 4PGDB 2Z5WA 3T3PB 3UK9A 4Z7UA 3VM7A 3O3AB 4R90H 3ZYRA 4PH8A 3ES6B 3PXJA 3QQNA 1MZEA 2FK9A 5C9AC 4WI7A 1T66D 1W0NA 5LAXB 2VQUA 4AI3A 5C9AA 2WCGA 2YPLA 1YJDH 4FFWD 4OLVL 3ZGIA 4F7CB 1B35A 1E4KA 5J13B 3HI5L 5F3HA 3H1MA 3GC3A 1JS4A 3U1SH 1O7DE 3VH8B 2DYSB 2XY2A 1T0PB 3Q6FA 1OUSA 3P0VH 1PLGH 3D34A 4HAKA 2JQZA 4PJ8D 2RFXB 4IE6A 1GC1L 1UYXA 4AI2A 2QQKL 1YRKA 1GKOA 3QWQB 1TJGL 2Z4FA 2OCCB 3RDIA 4OQTH 5ANMB 2IJ0C 5KHIA 2VB5A 5JXEA 4MAYA 4L3EA 2WCPA 1G7IB 4CU7A 3VXME 4M6ML 1X8MA 5DHMC 4AXOA 1U8CB 5A80A 4RAUA 2L3BA 2WXLA 1PY4A 1KITA 4LHNA 2W80C 2XWDA 4LPLA 3ZSEA 4K3JL 4AJ0A 1QJY3 1XF2B 3MNWB 4NJ9L 1W6MA 2VIRA 4PV9A 2NYYA 4HBNA 4Z2AA 4D0BA 3GIZL 3MKKA 1JBJA 1QFWH 3AT0A 3H0TB 4LLYB 3HE7B 3FCGA 4P06A 5I1HH 5B22A 2FT8A 1K85A 1WLDA 4LLOA 3AM8A 4ANUA 3DHPA 2KZBA 1FUNA 1H19A 3VMPA 3KW8A 5BNPC 1K5MB 2XBO2 2DVDA 4LPCA 1SUJA 2AC1A 3ME2A 3USUB 4Z7IA 4W4NA 4ELMB 2P46B 1JPTL 5IJVA 1IFHL 1VBB3 4PBOA 2ZSVB 4Q26A 2H1PL 1AS6A 3HG1B 4YDNA 3MXVL 3ULUE 4AWDA 4GB33 3U6RB 4PLMA 2JJUA 5GGSB 2AEQH 3NV2A 4B9YA 2MHAA 1GLHA 5DEZA 4XRCA 5IK3B 4FP8L 4N90D 3VXSB 3R0MA 4WWNA 4MCNA 1ZLWH 2HYMA 5IIEA 5BVJB 1QWRA 3G9AB 1BWMA 5IB1B 5ESAB 4HT1T 4ONGH 4AZUA 3HCVB 4I02A 4WHYG 4XWGH 3E6FB 2K0GA 2X2HA 3LHAA 3WIHH 3Q01A 5GALA 4BV1A 1WEJH 3EBAA 2KM2A 3ZHFA 1G7PB 5D96B 3W9DB 3FOLB 1I7UB 3IJYA 5JOFB 3KYMB 3VFGH 1FO0B 1K3IA 1VALA 1B2WL 1I82A 3J8F7 2BU9A 2WWJA 4MVTA 3DA0A 2JCCE 1CLOL 1E5YA 4RLDA 5J1AA 3NJJA 1VB9A 3GEWB 2OMWB 4JREC 4F5CE 1F35A 2P7TA 2Y8KA 3KVAA 1OK8A 3TJHD 4GS7C 3UTTD 4JCWA 2MFNA 1FPTH 3V52L 1TFPA 3DOHA 1L9OA 4R5TA 5TTRA 3D87B 2AI0L 3C12A 2JDKA 4L3EB 3D9AH 1V55B 2EDTA 2UWEE 3BE1H 3FT3B 2CUMA 4R96B 1ZLUK 3NIFF 3VV1A 1Z9SA 2XVBA 5J6SA 3MNVB 1SZNA 1L4IA 4J8RA 1V6KA 1W6WA 3PS6A 3MNWA 4XYXA 2CGPA 3KLDA 2FO8A 3FRPG 4GEIA 4Q9RL 1FORL 4XH2A 4CP0A 3VL8A 4YLCA 3VWJA 4JQRA 3AADB 2V33A 1PO22 4RVBA 5C6TH 1VBA1 3GXNA 2R062 1WZLA 4MJ6B 1A0QH 1QZNA 4P49A 5E8NA 2RM22 3FCUB 1ASOA 3QPQC 2XJKA 4OCSL 4OSUH 4YK4B 1A1NB 3LN4B 3RFZA 2LE9A 4QXHA 5HYSB 2TSBA 5E03A 1THAA 2YGMA 1NCHA 3QEHB 3C6LB 4MJ2A 5FYZA 4GYBA 3AAZA 1OCCB 4XPHH 4K94H 1O91A 2HPOA 3JTBA 3FONA 4WJ5A 5D1ZB 4PCKA 2DTSA 1XRUA 4FG4A 3GJFH 4IHOA 1D6EA 1CLVA 4P9JA 1XZ0B 3ZVXA 3QIBB 3OKNA 5A6MA 3D6GA 1RJ7A 2ZUUA 3CVCA 3RZCA 4PRDB 1W15A 3NA9L 4BH8B 1ST8A 4FPYA 4EI5C 1NC4A 2WVVB 1IGIL 2QDRA 4CEYC 4L5FH 1HOCB 2XPZA 4RRPG 3RVXC 3DX0A 4PRHE 5ID1B 4X5XA 1QAWA 4XB8A 3QXVA 1FZJA 5GS3A 3TC9A 5TD4A 4NQVB 1Q38A 3TPKA 4LSDA 1M1SA 4NT6A 4RZKA 1R9FA 3I75A 4TULL 3RTQA 2DV6A 1ENQA 1F5FA 4ANXA 1FO0A 4HIQA 5KC6A 1E65A 2IH1A 4PCTA 4WNQA 3HI5H 5LN8A 1T0NB 3S3CB 4Z7VB 5J1AB 1IGFL 2VKWA 3HS9A 1UZ0A 1E2ZA 2P7TB 1UXSA 4TF4A 4L1LA 2HWB2 3IPFA 4QHPA 3MA7A 2GC7C 3BZFA 4EN2A 4IIQA 3CIQA 5GGVH 2G2RB 3PNRB 4Q5OA 2CJUL 2JB5H 3D05A 4LSUH 5EUOB 3TA3C 1IC1A 4IKIA 3TBWB 5EYYA 4L9BA 4AVSA 1AJOA 2WNKA 2XTJB 5DEJA 3QDJA 2WXPA 3C6EA 4TQEL 3MI8A 2MH4A 3GT6A 2VZRA 1R5VB 1KJVB 3UBXA 1JV2B 3ZR5A 4DVRH 4HT1L 3BPZA 4I48B 4YUEH 1HJBC 5C8WA 5DJ2B 3IF1A 4QRPE 1OEZW 2D3NA 4B6ZA 2OJZL 1ITCA 2YXVA 4JPVL 1HNGA 1T6WA 4JZJB 5DRXB 4F1ZA 4XHBA 4NI3A 3WS6A 3X14A 4GEJA 3TT3H 3UBXI 5GRYA 4XXPA 3R1GH 1M53A 1O5PA 1GICA 3OUIA 3DBSA 1XGTB 4WLCA 4LIQH 5FIEA 1FVDA 1FAYA 4OY9A 3UKVA 1PQZB 1JZEA 4YQXH 4K8RD 3D3VE 4UTAA 1C5BL 1QNZL 4QHKI 3V5KA 4J1WA 5LNEA 1A0QL 1Y6KR 2W39A 3Q2NA 4FFIA 4M6OL 4J6IA 1GPOH 3L3JB 1ACYL 2JJWA 4DEPC 1OW0C 1PZBA 1E57A 4A7ZA 2P5BA 3ZXFA 1KN4H 3NCJH 1AR63 1AP2B 2XXZA 5JI7A 2EH8H 3NNGA 4XN2A 5JOEA 3HC3L 4X5XB 3TBCA 3OD0A 2J1WA 5HGHB 4NQVA 1U5XA 4NT6B 5DD3L 1BVLA 4I9WE 4P9HH 2YXSA 4PMFA 5J1XA 4V2VA 4M3CE 4RMSA 5CWSA 1NM4A 3FQTA 1XR9A 5SV4A 5K5YA 2CNZA 1IGJA 5JOXA 1I85C 4IV3A 1DBKH 1YO8A 2VNRA 3NCCB 5SV3A 4L9DA 3ZT6A 3ZVVA 3P5BA 2OL3H 4L1HA 2E6VA 4E4DX 2VRAA 2YJLA 1WQVT 2PR4H 3BZFB 3BIAX 4XMPL 2IZWA 4W4OC 4HUMB 4L3ED 5TDOB 2OIIA 1I5PA 4EDXA 5I75B 1MZFA 2SLIA 3VJ6A 1MCSA 5T55A 1CICB 1OAZH 3ZDYF 2V7HA 3HEIA 3W0WE 1BQHB 4WVMB 3D9AL 3LRHA 3OAZH 1PZ7A 5I1EL 1UM6H 1BVNP 2TNFA 2O6DA 4FDWA 2R1WB 1OA2A 2EACA 1YLBB 3C8KB 1CB4A 5C0DA 1J05A 3FFCD 5EV7A 5HY9B 2CUIA 1KFXL 3GJEA 4ZO8A 1JF1B 3VFUB 1TVBA 2V5TA 4PF1A 2E8ZA 1RJZA 1HE7A 2AAAA 2WNUC 3QIWA 2WD0A 2YBRA 3S6CA 3S0PA 1PQZA 1AZBA 1JDCA 4LE4A 4H5SB 3T04D 5KSAB 2VDLB 2WO2B 4LOTA 1MJ7L 4EJ1C 4WHCA 4EUPG 2ZHLA 4MADA 3U0ZA 3CSTA 3Q3GB 1S7QB 1QJEA 2OMNA 1VGEL 3I6KB 3MREB 3ECUA 3U1PA 2BVYA 1T6VN 3IU4H 1DQDH 3TYGH 1CLZH 3MXWH 1GW0A 4OKVB 4N9OB 1VBB1 2TBVA 5IBUB 1ZKAA 2PFWA 1AQDA 1NMCB 3FYIB 3H53A 3K91A 1FE8H 4PCSA 4L2NA 4DP7X 1YWKA 6FABH 1SJEA 2D9QB 5CGMA 2IXHA 1EWHA 3L1OL 3BP7B 3ULUC 4H88H 4JDTH 5FUOH 3IB4A 1A6WL 2CY6A 5LAPA 1XD1A 3ABKB 4CBPA 5KHKA 3O3EA 4NGHL 2H32A 3V5DB 1EXUB 4BCYA 3NNJA 2K3HA 4JGJA 3HQRA 5HJDA 4PS8A 4LKSA 4DN4L 4DPCX 5AAWC 1SZBA 4H4NA 1Z9PA 4PJ7B 2XHNA 2IXQB 4Z23A 4XUQA 4MHHI 5TDOA 2QLYA 3V6FB 4LA2A 4G8EA 3RGHA 4QKDA 1G87A 4UQ2B 1UGNA 1E4XH 3DN7A 1DBKL 3TU6A 2DTMH 1UL9A 5D1QB 2VYRE 3O7OA 2G5UA 3GGWA 3WD5L 1A7BA 3VXSE 1SHXA 4CUBA 1OC1A 4BZ1H 4B1MA 1JXKA 1NWPA 4GBXD 4S1RH 5GS0C 4BH9A 3SDDD 2CO6B 3OAYH 4WHYH 3VSUA 5D7HA 2DKUA 4B9JA 4AVJA 2EIZB 1IB5A 1CVNA 1QFUH 4JRLA 3B2UD 3K81A 1QA9A 4PSRA 2MQ3A 4ZUSA 1ZA7A 4J3OD 1T21A 1EO5A 3QIBC 4X8CA 4S0HA 3QIWB 3SYOA 1T83A 3JTTB 2NMSA 1VZGA 2HUEA 2OJEB 1HJFA 1HRI1 2XWJB 4Y4HD 1DJSA 3O2VL 4C56E 5DXDA 4AVKA 1WGOA 4F8AA 1HL9A 1EAQA 2BY1A 5C0CB 2PYTA 4WNSA 2ZOOA 3VFMA 4GW5A 5I6KA 4YGEA 2LGNA 1U8LA 4QHMA 2QQNH 4XMLL 3WW3A 3VMNA 1KPRB 1TMF1 2QDNA 1RLBA 3WFHA 5CFCB 2ADGA 5I6LA 1J59A 3Q9QA 1IX2A 4MYWB 3GS0A 4N0CD 2E31A 1I7ZA 2WJ7A 5ENWA 1YEJH 1CLZL 1VZIA 3MXWL 3IS0X 4ZX5A 3NEXA 3WFBL 4KO5A 4NHUB 4OCLC 3S8GB 1QQP2 5FUPA 4MMYA 1EFXD 3CCHB 4YHPA 5D1XC 1S3KL 1F6LL 1UB6A 4GB9A 4OJFH 2IGFH 1J88A 25C8L 2YEZB 2YJQA 3Q5YA 4JN1H 2H32B 2KS0A 3FTWA 4P9HL 1OF2B 3BAJA 2V2TB 2BUKA 2FHRA 1I1CA 1OT1A 9PCYA 1DQVA 2QSCH 3JXAA 3V4VB 2I5YH 3KPOA 1C5CH 4J7RA 4WM7C 3EHKA 3OF1A 2XQYG 4UQEA 4AAXA 4GFTB 1L5GB 1AR62 4AIOA 5DQDL 3CLWA 5D1QA 1WKYA 2QKIB 4P04A 1IGCH 1TME1 4HVRA 3KCPA 4JW3A 5DAWA 5J37A 4PRPA 2OSWA 4OZIE 4Q1PA 3ZFFA 3I2GA 4XCAA 3T1WA 3F01A 2HWD2 4PJ9C 2BVQA 1J8HE 4Y16A 1AIFA 3MLUH 1DDTA 1R3LB 2DQEL 1AYM1 2BQPA 4NRYA 3P9MA 3IDYC 2UWAA 2EZ0C 2V8LA 1OH4A 3AL5A 2A74B 4Z78B 1Y9MA 1CGXA 3QEQA 5C0JA 3FX3A 2JB8A 1ZDSA 3PUSA 4BKLA 2NR6A 5LXGL 2WXIA 4QMAA 2ZXQA 4GP5B 2WA4A 3RSJA 1KB9J 2PTMA 2UWCA 3QAZC 1WWCA 1NA1A 2E56A 4RA3A 5K9OA 1WTGT 2Y34A 4QXCA 3ZE1E 1MCBA 1J9QA 2VLME 3THPA 3VI3E 3ARDB 1FBIL 4ODXA 3PDOB 4FP2A 4RQQA 1YEIL 1HZHL 4Z7OE 1WZAA 5DR5L 5L8JB 2GCYB 1POV0 5CJQH 4ZTOL 4DOUA 2O0OA 3B2MA 1DUZB 3EG9B 4P9HC 3O11A 4KQ4L 4X6EA 3LAFA 2UY8A 5EUOE 2EZ0D 1FXZA 1A9EB 2QQVA 1UM4L 2UWEF 1EUUA 5T1DL 5FUCC 2BIMA 1JUFB 1DGWA 2V9UA 3NFPA 2JDYA 3WHXA 3FFOA 3ROLB 1VB2A 2P6HA 2XBTA 1CIDA 3KYNA 5IFAL 1I4FB 4AI9A 2FBJH 3RZMA 5I1HL 2O6FA 4FFWC 2JG9A 3QEGL 3DL3A 1UWGL 2HJFB 2X6AA 4RDQF 1UXMA 3O6KH 2ZGMA 4JY6B 3HRPA 4FTVA 4IKNA 4JDTL 4DRRA 5T5NF 2JIXB 3KPOB 3CLFH 1QBML 1XD0A 2P5WD 1MI5D 2MCG1 2CBTA 4HMEA 3SDCB 5FLUA 4KXBA 1ILSA 4HHGA 3O4LE 3HNMA 4NB7A 1NCCH 5E2VL 4CMHB 2EDBA 3AWFA 4R4ND 1Z9MA 2C7UA 4HU2A 4O2CA 4JS7A 3QJTB 5E2WL 1VBB2 2V4AA 5FYHA 5I8OH 5AQ0A 1H5BC 4OZFH 3EYQC 5EU3B 1QYGH 2VDKB 4XZUA 3U83A 2D98A 4QNPF 2YR3A 4Q6IB 2H9GB 4ZTPH 5DEGB 3RZHA 3WN5A 1A8MA 3T0BA 1OD5A 1FH5H 2OL3B 2JKTM 2ZUWA 2AJZA 1FGVL 2ZOLA 5GS0L 1D4M3 1KGXA 5KJ4A 3LEGA 3J8F2 5EWSA 2ZOKA 5AZ2L 4M7LH 1QSEA 3HE7D 5DXWA 5CKMA 3E8UL 3BSZH 4S11A 1NA1B 3O6LH 5ICYA 5IMMA 1E4XI 4QU1A 2FLMA 3LRSB 4OUSA 1G1YA 4XBQA 2QVTA 3N4MA 3L2MA 1OWRM 4AQTA 1GGUA 4N20A 1YEEL 1SBBA 1I6XA 1I7TA 2Z91B 4GQ9H 5H4YA 5M0TA 1QEXA 3MO1B 4KNSA 4QF1A 3MPCA 3LQZA 4LOUD 4XAWH 3EJKA 5A16A 2CO7A 4DO5A 1TEIA 3WQBA 5A2LH 2NUPB 5C3SA 4N2GA 4DP9X 4UW5A 3D69B 3GXMA 4FMKA 3S36H 1RINA 2A7AA 1DANU 3GUFA 1FOD1 3RPKA 5C0RH 1A6CA 4IDJL 2FJFB 3KYNB 1U42A 4BQ4A 2Q7YA 1FN4A 1JVOA 1I1YB 3MBWB 2CGOA 3C09C 1NX9A 5HHMB 4JQIL 3KL0A 1UH2A 4Z3FA 1QQDB 1U8HB 4EVNB 2J1RA 2WO4A 2HMIC 4Q0UA 5JHBA 4K94C 3TOJA 4JO4H 4Z0BH 3K72B 5J96B 1UFGA 5IEHA 5CYYA 4PWGA 1U93B 2NNFA 3GRWH 3FF8A 4G8GA 2X38A 3AU0A 3ZMEA 1Z7S3 2IADB 1X5ZA 5KVMC 3O6KL 3B9KC 4WRLA 4HA1A 1YEGL 2WZ6A 5ANQA 1XH1A 3WQ0A 4RS5B 4MZ3A 4F93B 4Q9BA 1N0XH 5F3CA 3V5HA 5DI8A 1EAH1 5FYJE 2G1MA 2BJMH 3E2HC 1DBJH 3OHXB 2YMTA 3C09B 1KB5A 1U4EA 2FWSA 2YMXH 4I0BA 1RULL 3NBNA 2FRGP 2WYFA 5E2TL 4HKWA 4N2DA 4GQZA 3WY3A 4JK0D 1Y9GA 5EIQA 1U95B 2R8SH 4IQHA 4B4PA 1L0QA 5EPAA 3CDYA 1KJ2H 4L8CA 1LO5B 3GB7B 2DFBA 4ASMB 2PLV1 4LLQB 5JR7B 2WN3A 2CCLA 4G43A 5FZ8A 4EYUA 1QASA 1KDMA 1ZANH 4PV9B 2Y06L 5GZDA 4D0BB 4X0KB 3UYJA 2EA7A 4B1LA 4ECNA 4AIZB 1T5KA 2BCKA 3EFFB 3ARDD 4AF9A 1XGQB 2CBOA 4Z7NF 1C1LA 4BWUA 1JU3A 1RVF2 2FDBP 2M1KA 1VPOL 3HMXA 4FQXB 3ZQWA 3OSKA 4I2XA 5DK2A 3WTSA 3NJHA 5L9DH 1OQDA 3VXOB 3RNQB 2ENYA 3TN0B 1CFNB 1UC6A 2BNQD 3CUPB 4NZFA 3T6QC 3RTLA 3OCPA 1WITA 4HJSA 3UTPD 1QPKA 5LWBA 4UZGA 1P4BL 4R9HA 3RI5F 2H6PB 1H8VA 2NM1A 4AKPA 5EC2B 2RQEA 4FQ2L 1IC4L 3HPJA 5DFVC 4FQZA 1NBVH 2Q8BH 4R84A 4X9YA 1KEML 5FZFA 4W9FC 5DSCA 4BQBA 4H8VA 1YFWA 3HLAA 5KWRA 3RIKA 3POFA 4R7LA 2XXCB 3BO8A 3L3KA 4G7VL 3U1QA 1R64A 2X53S 2F19H 3WUZA 1S9WB 4IM8A 4H40A 5KSAD 1J3RA 1ODMA 1JNNL 5IEHB 2WM0A 4XFIA 1LQBC 1PZ8A 1BVNT 1BYPA 1I7UA 2BOCB 4P9WA 2H8PB 3WW2A 4KZ0A 1AKJB 4HZLB 3VG0H 3WP5A 3FT1A 3WF4A 3OBRA 4CCNA 1VEMA 1UKRA 4XMPH 4C91A 4OJAA 4P05A 1H2LA 4NROA 3V5HB 2UU8A 4BLIA 4L4TE 4ZPTA 4XXDB 1G6VK 1U4FA 3WKQA 2WT0A 3LY6A 3CGTA 1LL1A 3OYWB 2NY6D 1XXNA 1DLFL 4YVSC 4GKXA 1NDTA 1AZCA 3QDMB 4JM4L 4R2GC 4N9HA 1Z5LA 3FQWA 4FULA 3M46A 4BQ9A 5E1AA 1Q72H 4NUJB 1AUYA 4GKYA 5C7XH 1AYN1 3UGFA 1UIJA 4L8CB 3ZUNC 2P6CA 1G7IA 4PJCF 4UBHA 1NAMH 1XPWA 1MVUB 3OGVA 2IFFL 4PCRA 3HUJA 2C8NA 3MV7D 4WEBH 4PJAA 4H1LB 2YY1A 1S0BA 4LVNB 4K8RL 5AOJA 3EOTL 2YMXL 2VIRB 1FFNB 3MLSH 5IK4A 2Y22A 1MFMA 3CPLA 2YHGA 3CK0H 3BP4B 1Z7JA 4OHWA 3CBJB 4PJIA 1WO2A 4XCEA 5F0JB 1PAZA 1ZRFA 3G6JB 5AVYB 3RBGA 5DS8A 3BRGC 4TPRH 1CFTB 4OLWL 1X9TA 4MBRA 2ZGQA 3V9FA 1GIGL 1E28A 1X5KA 5D1XA 1D2SA 3RYMA 3TURA 2WB7A 3V0IA 2HEYF 5MEPA 5L0QC 2R0WH 4HX1B 2Y7SA 5BQDA 3WY1A 5E5RB 3QI9A 4GIOA 4D9QD 4FFFA 5EC2A 3TFBA 4ENZA 1O3RA 2XWBA 3KPSA 3QIBA 1PIV2 5GGSA 2AC0A 1XB3A 3RZCB 2MHAB 5F2SA 3B2VL 4AENA 4N1EA 3J07A 5DJZA 3UCQA 1OXCA 3AX4A 1RZGA 4C1WA 3NRFA 4ODSH 2WKOA 2D6NA 4AVCA 3B5GA 4JB9L 1XH0A 2YC4A 4E0RA 4LIVA 2WSUA 1Y07A 4WI3A 2MEV1 2X2YA 3I2KA 5E8EB 3SIKA 1W05A 3O8XB 1DJWA 1U2HA 2AJVL 4KDTA 3I75B 4NO0D 4P02B 5BNNB 2BVTA 1UM5L 3FOLA 1S3KH 1IE5A 2A1XA 1KTCA 1YEKL 2QQLL 3QJHA 5AG8A 1WCKA 1H1MA 1ZEAH 2UY7B 2X2UA 5AYUL 1M7IB 1JCVA 5JHAA 2ZGLA 2QQNA 2JDNA 2COQA 2OMYB 1QSVA 3UZVB 4ELMF 2I7SA 1F4WH 3C8DA 4MQSB 1AACA 1JXJA 3K6NA 1HWWA 4KXDA 1MHCB 2ZYSA 4NXKA 4FS0A 1UT9A 5G4MA 1CO1A 1LAJA 4FXGB 4P23B 3CXDL 4YDJA 5DFAA 3N42F 1ZE3C 4YE0A 1RGSA 2DTYA 1RZ8A 5CIPB 3KWWB 1OD9A 1NE4A 2W87A 1G9BA 1HHIA 3FNKA 4RDBA 3HMYA 5CJOH 3FE5A 4WEEA 3DUUA 4ZDHB 3IFPB 4HIHA 1CFVL 3DX9B 2IAMC 2X4OB 2VTFA 3OB0H 1FNSL 5DMYA 3MLWH 3VWJB 2VN7A 2GJPA 3WCYA 4DT2A 5I2IB 2CLRA 9CGTA 2Y06H 1EHLL 3IMUA 1U8OB 4EN3B 3X14B 4KDTC 4EEEA 3QHZL 4XMVA 2E4FA 4J3OH 4X6CE 5I1LB 4YDMA 3T8MA 5IFPA 5D1XB 3RB5A 4CL7A 2ITFA 4Y16C 1AY1H 3LOWA 5BNOA 1YPZA 3EO1B 3IDMA 5CAZA 1DU3D 1TQUA 4P48A 1A64A 3QI9B 4KQ3H 4L37B 3TH3T 1Q8PA 3ZN4A 2DBJA 4J12A 5IWFA 4YO0B 2OULB 2KZ1B 1OKOA 4LO7A 4GWJA 3MBXL 3V4VH 1AMXA 5F96H 3BH8A 5IW1B 1YYNA 3ZE0F 4URTA 3LEVL 4N2LA 3IN9A 1EFQA 4G1EA 4UV7L 3SDCC 5LXVA 2VW2A 4NFBA 1NMCC 2X89A 4X42A 4E0RB 4IBTA 1CBJA 1SYSA 3LKOA 3OKEB 3UGGA 3FZUD 1BVLB 2VXQH 4INDA 5D9SA 3N3EA 3JWOC 3EB7A 4JKLA 2CK2A 4J1XA 3QNXB 2OSLB 3H6AA 4LARL 2HN7B 4WI8A 4LPTA 5TFSL 2FB4H 1M7IA 4ZZFA 1OWWA 2VLKE 1IL1A 5B1KA 3DUIA 5L7XH 1NCAL 5CM1A 2YSSB 1T5WA 5ES4B 1NL0L 3ZXLA 3Q2CA 3HTLX 4AV0A 2NXZD 3LEKA 5DQDH 1NCQB 3WG1A 1CZSA 4GIPD 5F1SA 1BZWA 3LFIA 2ZKXA 4IIQB 3VJ6B 4HJJH 2LVEA 3D85B 4NIYE 3KWWA 2B5HA 1YI7A 4OZHA 4QHUB 3GJFB 2XL7A 4XE0A 5KG9B 4W6YB 5HHME 3B5TA 1ZZCA 1I9EA 4ZDHA 4X5QA 4D6QA 1RCYA 5KYYB 2X4OA 4BZ4A 5GZEA 4PSPA 4ODTL 2DF7A 4ZMWA 5C0DB 4NPLA 1CXLA 3VHNA 4JQTA 5BNPA 1HXKA 1VBD2 1G6RH 1OTTD 3TZVB 1EPZA 4O9GA 4NM8H 3CG8A 1Q8MA 5IROD 1JF1A 4XP9L 3D8CA 4HPYH 3ULUD 2N0KA 3TH4T 4N85A 3WO3B 1XAKA 4JKPH 2Z79A 2V8MA 1BP3B 2O1AA 4PWJA 1BGXH 4K5LA 4CVWA 1RP9A 2BSBA 4PJBE 2BSTA 1KXGA 1L9RA 2XX0A 5FHBL 4PJEE 1R0AH 2OZJA 5JXHA 5FFLA 4KOBA 2NUTB 4Y5YA 1A1OB 3PP3K 4KXAA 1XIWA 2PCPA 3CFTA 1KCVL 3RTQD 4RQPA 2Y6LA 2KYIA 5BPPA 4DVRL 2YPVA 4ORZC 2B14A 1W2TA 4KJWC 4Q7DA 4MAYC 3WNXA 5I6XB 1W6NB 5IW1A 1KEGL 4RFRB 3AGVA 1U8PB 2AACA 1NZIA 1M2VA 4EZJA 1EPWA 4M1DL 4PGZA 5JIDA 2YOCA 4M93C 4H8WC 5DAQA 1CT8A 4P2OA 4CC0A 2IH3B 1A7NL 1AI1H 4KUZH 1I1FA 3WNNA 5I1AA 3ULUH 2UURA 4ZO9A 5ALBL 2JB4A 3OAUH 3UC2A 4WVVA 4NZTL 1JWMA 3THDA 1CGVA 3VVVA 4B9CA 2KH2B 1FNFA 3ESVF 2VBBA 3ZIWA 3HZYA 2B9BA 4NGHH 3CFKA 5K1JA 4A44A 3VBSB 1W8TA 1U8MA 5GPRA 1JHTB 5DAXA 1XR9B 2JI1A 2V3DA 1IL1B 4AMKL 2EIGA 4XNYL 4Q9QL 3GBFA 2IANA 4ADIA 4LIQE 1ZZ7A 4MH0E 2WQSA 5C09E 3AZUA 3P77A 4H25A 5SWSA 1N64H 5DYOA 3MF9A 4YXLH 4GXVH 5BNXD 3PV6A 4G7YL 5HI3C 1TO4A 3IXTA 4YDVA 1IIIA 5HDBB 3SCGA 1RUNA 2VR5A 1NFDA 2ENQA 1MW3A 3KDMA 4GO6B 4JZNA 1KTBA 3GGWB 1JZ3A 4NRMA 2R1YA 2B2XL 5F7MC 2V5YA 1CICA 1I1AB 4Q4IA 5KVFL 2XQBH 2QZQA 5TDPA 3GSNL 3MRCB 1QRND 1QFUL 3HN5A 1EAH3 4OCWL 5E8AA 3POSA 2R1WA 1VACB 1YC8A 3QEUA 3TZVA 1HQLA 1I9RA 3IZOA 1BJ1J 1HXYA 2NRDA 2ZD0A 3QULA 5JORA 5ACA2 1A6PA 3BZ4B 4L1TA 4U7MA 3KV9A 1FORH 5BZWA 1Z0NA 4UT6A 4S10A 5DHYA 2BP0B 1GZPA 1CE1H 1P6AB 5AB1A 1E7VA 2W1QA 1D2PA 1UUNA 1MWAB 2ZJSL 1IM9B 3IMVA 5FGCB 1I85A 4PGEB 1OM3H 3AYAA 4FHBD 5IT6A 4D2NA 5JXIA 4H5SA 5KSAA 1ZSHA 5FOJB 4U6VH 4X6FA 4XCFL 5M94B 5DHVA 3TBSB 2DEWX 5I1EH 1DP0A 4BWWA 4DKTA 1S7QA 5IB4B 1W6NA 1X82A 4WKXA 4LP4A 5D4HA 4KNCA 3G7DA 1PO13 3ARED 5J6GA 5K0UC 2QTEA 1K8IA 4OKVA 3ZYIB 4LKDA 1JYXA 1HZKA 2XN0A 3FQ1A 5DGRA 4PBWD 2G9FA 1B3JA 3HC4H 4XETA 2GAUA 4RAVA 32C2A 2F8OA 1MACA 3WFDH 2AEZA 3TNPB 4ZS6C 4LOSA 3BAEH 2AFNA 2NXYC 4Z3IA 5FC9A 3D82A 3INAA 1PZSA 2GJ6A 3V2AR 5G4OA 1DQDL 4DKEH 5ERWA 3P73B 1A2YB 1VGKB 5DUWA 3UZQA 3ULVH 5FDWA 1O9WA 1DF0A 2C9UA 4G70B 4XCCH 3LB9A 1B90A 4O5LH 5FCUH 3RRQA 3WFZA 5C3TA 1AHWA 4AQ1A 1EHNA 3BQUB 3KBFA 3MOAH 4IOFD 3DO7A 2ZAAA 5I23A 3KF5A 1O4YA 3VUOA 4YHML 2VQ1B 2XWEA 4B97A 2JG8A 4JQIH 1HVXA 2VUCA 4AVVA 5I1DA 3M8OH 2GNTA 3ISYA 4I89A 4WFHD 4JHWL 4G7YH 1R3LA 1DSYA 4FQ1H 4NR1A 1D5MB 3BUTA 1HXYB 1DSFL 3LEYH 3NCWA 3QULB 4Y19E 1AL0G 5LGHH 2HFEB 4N24A 1ND2A 4ERSL 3ZSLA 3QHFL 3HQUA 5L0QB 1DQ1A 2X4PA 4JHAH 5I17B 1AQMA 2JJTC 3LSOA 3QRGL 4DH2A 1SBFA 1O7VA 5G5DB 3JWDC 5JW3H 5LCWL 1DVFB 1Q9WA 4AEMA 1HRI2 2AMUA 3FQ4A 4FQIL 1U8KB 3V4PA 1SXCA 3TT3L 1GP4A 3CFBB 2HBTA 3HBQA 4BZ1L 4KKAC 5IB4A 2HWZL 3FS9A 3U7YH 3SHSA 3BKMH 2ENRA 1SJMA 2HTLD 2LU4A 2RQ8A 4DNLA 4K3UA 4QPIC 3O1UA 4ATWA 3QCVL 1J9TA 4DK5A 1GS7A 5IKCB 3OQRA 2L9LA 1IKPA 3X29B 3T1LA 4M7KL 4OR1A 2W08A 1VMJA 3MYJB 1JUFA 3PHOB 5BW7A 1KEGH 2HJIA 4R0LA 1XHHA 1RUG1 1I8LA 32C2B 2X6MA 4U2AA 2CJTA 3CFEB 3X12A 1HQRB 3VKMA 4XFGA 5L4IA 1VHPA 1G9NL 5JPMA 4U1JB 1HHGA 3HG1D 3RMXA 3B9IA 1W04A 1WWAX 3GXPA 2FJSA 3HS0A 5F8QC 4HUVA 4KJQD 3MUZ1 4X4YA 4XBEL 3MZTA 1OOAA 5I73C 4MJ5A 3N6YA 1K45A 2D3SA 2XIDA 3WKMH 3H42B 4NO2B 3WFDL 3SY6A 1FYTB 3KPSD 2XDHA 2J8OA 4LCIL 4Q4EA 3BT2L 4NPKA 5CJ8A 1O75A 3WEAA 5B1BB 5HDQL 4A63A 5JDBA 4PB0H 5MENB 3FTSA 3SGEH 4KRMB 1Z7S2 4AQAB 2OMXB 3PVBB 2FDKA 3RZCD 4EN6B 3EDFA 3OTTA 5C0FB 1IU1A 4GWNA 4H7MA 3APBA 3WSQH 1OSPH 4H8PA 4X7CC 2XDVA 1R3JB 2BP5M 3F7YA 2D44A 5A7QA 4G3YC 3D3VA 2X4NA 4JVUA 4ANKA 1BBDL 2GC0A 4KPHH 3T2NL 25C8H 1AGFB 2DF3A 5FCUL 2A75A 1E5UI 1Q5OA 1MXDA 4NDMB 1QLEL 2AJZB 5DA4A 5JQIB 3LPWA 5A6YA 3CBKB 1EJFA 3VFVB 4A6YB 4TMPA 4HVQA 4YPGA 1NGZB 4ZAKC 4NN5B 2GNDA 4MA3B 1OQXA 4DETA 3IPEA 1J5OH 2ZF8A 3JBG2 2X89D 1P4IL 4PIRF 3CSFA 4FQPA 1EFXB 4W9HC 2VISB 1E67A 5KTEH 1ES0A 2YKLH 4RQQB 3QHZH 5B4MD 1A9VA 4HG4K 1RUG3 2XLAA 3AMQA 2VH5L 1KLFA 4MGIE 1FX5A 5HCFA 2DQFB 2KKQA 2P3YA 5J36A 2MEV3 2R0WL 4IE4A 2Y33A 2XIBA 3CVHL 5FKBA 1H6UA 4HJGB 2IPTH 2GBAA 2BOJA 4YRDA 4HIIA 4AGQA 3TVMB 1VBC2 1ZZ6A 3RZLA 4AVIA 2O5XH 3GZEA 1INEL 5F96L 3ARRA 4K3EH 3GZAA 3HG5A 4NN5C 1N4XL 4WCYL 4G42B 2XTJE 3CK0L 2X05A 4HL0A 4FPGA 2ZONA 4MHUA 2ID5A 2ZGPA 3SCMC 5FYLE 4KMQA 2ZUVA 5ACA1 4PGDA 4W65A 3DKQA 1G7QA 4MJID 4UQ9A 2NY0D 4NIDA 5EF0A 3MBEB 1BPVA 2DU0A 4JM2B 2Y3NA 4AVTA 5IK8A 4TSAL 1O7DC 2ADJB 4UFKA 1JNHA 3T0ED 4Z7UB 4FQXC 4GRWH 4YM3A 1RZJL 1BYOA 1KJ3H 3KPRD 1TR7A 2WUBH 1OGAE 4N43A 1B35B 4HPHA 1MEC2 3E6HB 4HF5L 3RY6C 1YY9C 3GHNA 3FCSB 4FQHA 1T6BX 2W0LA 5J3UA 1DEDA 1HILB 5EOCH 1HW5A 4LPUA 1F1GA 4UILL 1MS9A 1UQSB 5E00B 3SQOH 3ZRFC 1MF2H 4ZUVA 1X8EA 2UYLA 4G43B 2WS92 2GHZA 4N2KA 2H32H 3NGBB 3K2UL 3OEBA 3AFLA 1AYN2 2JB6A 5IW0A 4OQ8A 5ICZA 1V7NL 5ITBL 5AAMA 3OZLA 4PRHD 3SYQA 1IM3A 3AXDA 4XJ9A 2ZTBA 5C7ZA 1L7LA 2PAKA 2LQRA 3H9YA 3SHRA 2PELA 2XGXA 1MG2C 1CGSL 3G5YA 4GKSB 3RWHB 4WI9A 1D7DA 1S5IL 4LLYA 3LQZB 1H9VA 3QORC 5GS0H 3ARFC 3ET9F 2DWRA 4QX2A 3C08H 4UQAA 2W0KA 4BUQA 1L0YA 1C1EL 2W95A 3ABLB 1YJDC 4PJGB 4ZPVA 3MLPA 1WFOA 4NJ4A 5DFWH 4Y4FD 5FCCA 3VYPA 3BPOC 3Q2VA 3RVVD 5FZ0A 4F2FA 2Q1EA 4RFNC 4TXVB 3U6RA 3AFKA 3OGRA 3MBWA 1E8WA 3SYPA 3TBTA 3I97A 4KMTL 5E95B 3DJSA 4PIBA 3F6IA 3VXSA 2JE9A 4KGJA 2QNKA 4Y4KD 1U8HA 3SOTA 1C8M2 1KFGA 1IZJA 3UAJC 3NABH 3H3PL 1H8TB 3N9PA 3WTVA 4YZ1A 1L6PA 2SEBB 4LBQB 3ATGA 4RGNC 1RL1A 3E97A 4F2ME 4OQ9A 4AEIL 5JXJA 4UQBA 4PF5A 2IADA 3UETA 1XE8A 4EIGB 3NJMA 2VMJA 4TUJA 3OPTA 4MWFB 2ESVE 3E6HA 3JWOH 1TKWA 4HJ0D 3UC0H 4OZOA 3WOVA 4AOFA 3FCSA 3QG6B 5DI8B 5T5FH 3CXHJ 5GZCA 3NIGF 2XA3A 5DRNB 4NVPA 2HXAA 3JBG7 3RVWC 1I3HA 1B4RA 3CF6E 4NAOA 1GSKA 1JRHL 2BP3A 2QQMA 1S7SA 3LZZA 5T3NA 4FADA 2OMWA 4IEOA 2YRLA 3A22A 3HUJB 3BW9A 2NXYB 1Z9SB 4AVBA 1VBE1 1P5UA 3BU0A 1LO5A 3GB7A 3T0VA 3WZ1A 5DRWB 4LLQA 1TG8A 1NQBA 1ZHNA 2VDPH 2Y3AA 1OV8A 2LU3A 2YD8A 4OCRL 1BEV1 3SITA 3VHPA 2NZ9C 2AZ5A 4LT5A 3GFUA 4D8PA 4N0FA 2Z7ZA 3SEEA 2ZICA 1REFA 2BCKB 1UZWA 1MFDL 1YECH 3RX8A 3L48A 1N6UA 4J3OC 5HJBA 5M7QA 2O1QA 1X7SA 2DLFL 1AJ7L 2Z1KA 4C57C 5AG9A 3S98A 5FZ9A 4YW1A 2YEVB 4XH2B 1HHKB 3MO4A 3BVNB 3LN4A 1SMVA 1ZREA 5K33A 3B9KA 5HYSA 1FNHA 1GMEA 1A9BA 2PPDA 1GTFA 2VZTA 3L17A 4RGNE 4IRZH 5C3RA 4N0UB 3N0PB 3L3HA 2Q7AA 1Y6MR 3AU1A 4XBGB 1ZANL 4TZDA 4XVOA 3W11D 1E9OB 2FJUB 4J6RH 1EDYA 1I9JH 4G2AA 4XNUL 1NT0A 2OPKA 2RS31 1UOBA 5AW1B 3V6ZA 2A1WL 4PRDA 2D31A 4M29A 4NNXA 2VXUH 5DD0L 5I0TA 1DDLA 5A7NA 1KCLA 4FQ4A 1UM5H 2ARJQ 1EZUA 2P9RA 3TFKC 3ATDA 1FNGA 1ZVHA 2YAPA 2B16A 4XP5H 2YPKA 2H3KA 1NCGA 5E9DA 3M2MA 2BSEA 3LSDA 1WLWA 3W9EB 2XN1A 4K73A 3MRMA 4PGBA 2ZKNA 4MJ4A 4CDUA 4AEEA 5HBAA 1AOHA 3FSAA 5DAPA 1D7BA 3QJHB 5CEYB 1Q9KB 5IP4A 4L8BB 1ROCA 2AJXH 5AW2B 1GS8A 4NQTA 1AKJA 1FZJB 4H8HA 2E9QA 5FZ7A 1TYRA 2YAQA 5I28A 1TVGA 4OCMC 2K9FB 3VQMA 3LZLA 5FXCH 3QG6A 2OW6A 3RTQB 3VI3A 3QDAA 4EBQH 3NNLA 4BSVB 4Y9EA 3U4BL 1NCJA 1QXJA 4UAPA 3LEXB 4QDSA 4AVAA 2ZPXA 4EDWH 3D25B 2BSRB 2FVNA 3TWIA 4A45A 1X9LA 3K6DA 2DY2A 2GK0B 3RVWD 3ZO9A 2QFEA 2WZPP 1FHNA 4X8JB 3MJWA 2HKHH 4G8IA 5EUOA 1VBC1 1RJLA 4NQEE 3ATEA 2XA8L 2HVJA 3O0RL 2O8OA 1ASJ3 3LQCA 4ZY9A 4G9DB 2VMHA 2XBZA 1CWVA 2Z8RA 2HWE1 5FP8A 2YG0A 4Z2WA 5IFTA 4AQ1C 4QNPE 1UOJA 1PVC3 4MNGE 3VD7A 3ETSA 5HV0A 4W4ZA 1WCQA 5FFGA 2A2QT 4ZXBA 3DX8B 4FAGA 1CGUA 3VGAC 1PNFA 3JYBA 1VMFA 2XJUA 4QDQA 4I48A 4BFFA 1IS5A 3GMQB 3PURA 4WWKC 1KBWA 4P57A 1JZGA 1XGTA 1YPZB 1UXLA 2RE9A 1IBDA 3L4ZA 4N0UA 5E6IB 4OB5H 4LO5B 3WO4B 1FPN3 3PP4H 3PJYA 3TIDB 5FRAA 2BX5A 4P46C 4RR3C 3VGIA 1E9OA 4WZ9A 3K5SA 2WO3B 4ZMLA 4YZFF 4FMVA 3K48A 5T54A 4UOJA 5JPNB 1AO7B 3DURA 1RUJ3 4AK1A 4R9CA 5FK8A 2FWUA 4W9DC 5DJZB 4D9QE 2OTUB 1GJIA 4BDVB 1HU8A 5AYQA 4HAFA 4TPRL 1QXPA 2VQAA 2PPCA 2WKOF 4DO4A 4XO9A 4HUCA 3IRZA 4XOCA 2C0ZA 3ZZ1A 3T6WA 2WJSA 2YPKB 5E9DB 4NWTH 2J44A 4NN7B 5CJ5A 3IKWA 1F3JB 2WLHA 1HN0A 1HXS3 1G7MB 2QFPA 5IFHL 4HXAL 4C8XA 3NZUA 3WDVA 3EJUA 1OCWL 1URZA 2JKNA 1X9UA 3K1KC 2A3TA 3NABL 4RETB 1TQWA 4FNLH 5FO7B 5HGHA 2C4XA 2Q8OA 1MWAL 4DO0A 1ERNA 3UIZA 5E99H 4Y7MA 3TEXA 4AH2A 5I0SA 4IGPA 2OMYA 3QXAB 5KN5A 3H7BB 4HK8A 1RUI3 2VZSA 5L7OC 4HUNB 3WX5A 5J5EA 5KS9F 1J9SA 4JDVB 2D97A 2BSRA 3DV6B 2X9WA 2EDHA 1AGBA 1OSGA 3PAZA 3NCXA 3GJFA 3UAJD 5L88H 4XNAA 1ZHKB 1BQHA 4HCGA 3Q5OA 5C8JB 1F97A 2WFF2 1TF4A 2WLKA 5LJYH 1YQ6A 4YW7A 1MHHB 2VUYA 1RURL 6PCYA 3H8UA 5DJ8A 2ZOUA 2BM3A 1IM9D 4JRXE 2QKDA 2WHVA 1JNLH 4ZNCD 3VD4A 2VW0A 3NIGB 1ZK9A 3G04A 1XDTT 2OV0A 5HPMB 4CCJA 4Y33A 4NIIA 1RJZB 3O2VH 4GRWB 4M48L 5EHDA 1I3GH 2VLRA 4UU9A 5KZCD 2QSQA 1RUML 1UY1A 2C9XA 2ZKHH 4K3GA 3TN0D 4QCIB 3U0PB 4FABH 3GJEB 1S7VA 3OBAA 2WO2A 2QL1A 3R4RA 2JJVA 3HZVB 3MODH 3HIFA 3CXFA 2RDRA 1YNKL 1Q0XH 2QPUA 2DWSA 3SJVA 3ZQXA 1DQ6A 3I6KA 5JOPD 3HMWL 3WKPA 2JELL 2OTUA 2C1FA 1BHGA 3U46B 2G3NA 2KHAA 1TETL 3EKCA 3F64A 2I07A 4HK3N 4S1SH 2WBJC 4OLXL 3IVKB 3LKOB 2RHEA 3OKEA 4LHUG 3HKZA 1LU1A 2RJMA 1PZCA 3MFFB 4R4NC 1SJEB 1AYRA 1GS6X 2VR4A 3FSOA 3SO5A 4UI9L 1BLNA 1GGIL 3O1RA 4PQ9A 1GC1C 5FO2A 1CF8H 5CF3A 4D7SA 1S7TA 4DAGH 1N59B 4LK6A 1X9PA 3NJNA 1NGYB 2NY1B 3I3BA 3LWCA 1C5CL 4NRXB 1ND0B 4JZOA 2ZZJA 5KN5B 4WGWB 2HCZX 3H7BA 4APQD 2ICWB 1HC1A 4Z7AA 4DEWA 4LGPB 2VSDA 4WHTB 3UYPB 4PJ7A 2YGOA 2RS32 2VERA 4JG1L 3BGMB 5FK7A 1NFDB 1HHHB 1XSJA 2HFGH 4P5TB 4NE9A 2DWDB 1TJMA 2BNUA 2F2HA 2NOYA 1Y6NR 5EBLB 1P7KA 3SDCD 4ZG1A 1J5HA 1HCFX 3GSXA 3CLEL 4B96A 3DEMA 1SEBA 4XQ4A 3DIFB 1F2NA 3BD3A 4OFKA 4UNIA 5LQBL 2APBA 2FX9H 3KPMB 1KOAA 4UM9D 2R23B 5FYJD 4F9LA 2Z34A 5KYYA 3T2OA 1AR93 2Q0AA 5IVFA 4LQFL 2J2ZA 1FG9C 3IJHA 3WDTA 2R4SH 2DQDH 2NQ3A 1OTUD 3SQOL 4QJ5B 1W0YT 4JFDA 1HSAB 1QKZH 1MFBL 4M8UA 1J0JA 3EOTH 3SDXB 4DP6X 4L05A 4E4ZA 2BRRH 1XWVA 5IVXA 4DGWC 4HH8A 3KPLA 4KKAD 2ZBJA 3EH3B 1YEIH 5IQ7L 1PU0A 5JMOA 4L0PB 3VH8G 4QX5A 1MPAL 4ZMYA 1AZVA 1HKLL 4TUKH 1R3HA 1LCLA 4TV3A 3QQ4A 4IRSC 2A9MH 4IMLB 3AW5A 3PAVA 3GUTA 3POHA 4D3CH 1CAVA 4JE0A 4PJAF 4BWOA 3I49A 2XWJA 3MRRA 1JNJA 2WXKA 2K8QA 2WY3B 3OGOE 2V3FA 4M7JH 1KYFA 1KBBA 4U1KB 2BVEA 2Y07H 1VJ2A 1H2NA 1I1FB 5IQMA 4YHOH 1TLKA 3U4EA 4GJYA 1H30A 3B9CA 4XHXA 4I3RH 2O6PA 4BQXA 3BKCH 3CX2A 1BLNB 3FU3A 4N2FA 3SKNB 1JD9A 4LFHG 1U8IB 2WTOA 3F6JA 3HZYB 2E0PA 3ZKMC 2GC4C 3B5HA 2Z4TA 1UHVA 4PWIA 1UF2C 2W68A 3IGLA 2EF6A 4GH4B 1ZD6A 3RP1A 1KB5L 5D70H 4D9LH 5IW6B 5L6YL 1E6OH 1W2UA 3TAYA 4KRNA 3K4ZA 5MP6L 1WA6X 1KXTB 2LLNA 2FR4B 2DI8A 3LKNB 2AJYH 4MGYE 3UBHA 4ITCA 3WF2A 3WEMA 1HRV1 2D3JA 4LBLA 4M02A 4BELD 2PNDA 5TPWL 4E41D 2IAND 3VGEA 3MRHA 1ND3C 2J43A 3AS2A 4N25A 2PETA 1RITA 4MUVA 4MAUL 4X7SL 1E5SA 4K8RB 5TDPB 3MRCA 1PZ3A 2ZKYA 3S88H 3LNDA 2YD7A 3LHPL 1Q0YL 5T3ZE 1VACA 3QEUB 3DPRC 4MZ2A 3ASNB 5C0ND 3OUJA 5F9OH 2GUOB 3FO9A 2XMLA 1MVYA 3FHIB 2E6PA 1TZOA 4YGCA 4BKLB 3LSOB 4GXVL 2IVFC 2VAJA 4EN3D 2Y2TA 3VBUB 5DHYB 3H9AA 3N7JA 3MFGB 2WLPA 5INCB 4YFLI 4CYDA 5IMOA 1KGYE 3MGOB 3AMNA 5HXMA 1XF3A 5AOLA 4A2FA 4DHLA 5BNQA 5EBMA 4KDWA 4U31A 4E42B 5A2JH 3HHSB 2XVLA 3I6GB 5JZ7D 2X09A 4JJHA 4HCRH 4EQVA 2ZKHL 4PY8I 1CIWA 4GAJH 1QGLA 1LO4H 3MV7E 4KKLD 5B1CA 4KGQA 7CGTA 35C8L 3EJYC 2HA1A 3HG0A 3WNLA 3L1FA 1ZVNA 5KYUA 3LS5L 4X6EB 3S5YA 3UKTA 3ILQC 3O3BA 5CCKH 3H9SB 4MCYA 3AQZA 3NFSL 4JN2B 4FP3A 3IRPX 2VAAB 2WKGA 5T1LA 4L0ZA 3VXUA 4J3OF 3BX7C 4Y2DC 3RVUC 4R5XA 4P5KA 2W1WA 1JK9A 4Y5XC 3MYZA 4POYA 3MJGX 4D9RE 1H6EA 4XBEH 4F15B 4CXWA 3WXVH 5DLMH 3ZN6B 2GHWB 3WLWC 4FA6A 1IJ9A 5GGUB 4EQ3A 3UPRA 1NLDH 1IILE 4JFEA 1LOBA 3QS2A 2DMGA 4PRAB 5A43C 3FPXA 1TMCB 5DJXA 3MV8E 2D6MA 4PB0L 2L4OA 3FUEA 4FTVB 2I9TA 3RL1B 5AZEL 2XJTA 1L7TH 1LEDA 5F93C 1JXGA 3WLUA 2XJQA 2ARWA 1MXGA 4KJPD 4EI0A 2AUYA 1NCAH 5BJTB 4NO4A 1QI4A 3TO4C 2ZCKH 1AHWB 2JIXA 2JLLA 4YHZL 1JYNA 2H1PH 3JVFC 4OIIL 1DL7L 3CQQA 4CN6A 4A2HA 4U7KA 15C8L 1AKJD 1HB2A 4YEFA 4YHKL 4BSWB 4K9SA 4XUOA 2ZOTA 1UD1A 1HQWA 3QUMH 1J9CT 4B3VA 5EQUA 3IDGA 2DN7A 1D5MA 2GUOA 3FO9B 4XN5A 3T8VA 5D2LB 2BIHA 3MCLH 3V8OA 4PJXA 1CDBA 2OZ4H 2PAMA 2XXMB 1TTRA 4JZJC 1UPIA 4PJDF 2R1BA 3M8LA 3VBUA 4NIHA 1UCBH 1O6SB 3C5SB 4NM4H 3SGJA 3T0AA 1JG9A 2E7QA 4KI5E 5IHZB 5IMOB 5GGSY 2OL3A 5H2BA 2OTWB 2AJUL 2PW1B 3C9NB 5IMMB 1MJ8H 3VXQB 5EBMB 5C07E 4D7TA 1HB3A 4HQQL 3OV6A 2YHJA 3PU7A 4AQ6A 4XNXL 1QU0A 4DRVA 3QQ9D 2NPLX 1I7TB 2Z91A 2WSVA 3GJAA 5FZAA 5C9JB 4WSKA 5JZ7C 1GL4B 3VI4B 4QHOA 5FECB 5A16B 3PGCB 3K6SB 4YSUA 1RUC3 1PKQE 1UKTA 4LMQI 2WXNA 5D6CB 2B46X 3PWJB 3OL2A 4KKPA 3BQUD 3BE1L 4IEQA 5E1IA 3MO1A 4QF1B 4TRPL 4POZC 4OGAC 1OB1A 1XH3B 5CLYA 3N9QA 3JQXA 4XMKL 1ID5I 3T1FA 2XUEA 1A02N 4RSUA 3UJQA 3ROUA 1F3DJ 4YM0A 1XL4A 1ULGA 4NO5B 4AQOA 4ELDA 5G04L 3LEIA 2I60L 1T4WA 5AD0A 1I1YA 2WZ5A 4JM2A 2NT0A 4MJ5B 1YSOA 1KENL 2OXGA 3QZBA 1L9MA 3ECBB 1RXLA 1UOWA 3X1GA 4JFYA 4A4AA 3NJLA 2XTJC 2KL6A 4P3DB 4Q9QH 3JV6B 3ME0A 1OTSD 4MA7H 3W38A 1S0IA 1H6YA 3AABA 3LB6C 2BW5A 3WF1A 3ES6A 2B1AH 2QSTA 3O8XD 4WUKL 3UKNA 1E9QA 4FFHA 1EO7A 3F7YB 3TNQA 1RK0A 2BFUL 3RZZA 3POYA 4FPKA 4OFYD 1V6MA 1MN4A 2VXUL 2W38A 3UEQA 2JXMB 3BSHA 3EZJB 5GGVL 1WA4A 4W9LC 3NA9H 1HINL 4PJ9D 5DK3A 2DWTA 2L04A 4A7QA 4MJHA 1A7RL 3SE4A 2JKWA 1ODAA 2ERJC 5AL8A 3H1YA 1BKZA 2VMDA 5EIIG 2ZGTA 4K3JH 1GAFL 4YPGB 3GXUA 3HN8A 1TZHB 5EOQL 3QJSB 2CU5A 5ICZB 3JWNH 5CLWA 1J8KA 4OLLA 4K5PA 2CHNA 1LOCA 1N68A 1QUNB 5IROC 3I2HA 1B4TA 1EJOL 3L81A 5HDBF 1CR7A 1KD7A 1ASPA 2EC9U 5F0PB 3RDTB 3WIAA 1NOVA 3LA3A 3RQ0A 1HEZB 2P5EE 1F56A 1XF2A 2ZMKA 4AIZA 4KG8A 5BRQA 1XBFA 3CFCL 4HLEA 4ONHA 1C1EH 1YRZA 2P42B 2CHZA 2UXTA 2QMJA 1CFNA 5HHVH 3H0TA 3W82A 3PWJA 1TZ8A 4Y5Z0 2C1PA 4I2XB 5DK2B 2APTA 1CD1B 1MZYA 1FI2A 4NHYA 4UW6A 5DDJ3 3TBYB 4HIIB 4UIMB 3TN0A 5EO1A 2ETWA 3FB7B 1RUE2 1WAAE 3CUPA 2D40A 5LA2A 2RMU3 3WTXA 4KQ4H 3H50A 3E8VA 3LIZL 4GBXC 5GS0D 4UT6L 4K1ZA 2ZSVA 3HG1A 2EDRA 5FGSA 4HFWB 5D4QA 2D5HA 3MRPB 1FNYA 1H8TA 3IN2A 3SBWA 4DXTA 4JFYB 3PUHA 2N56A 3OLIA 4XRCB 1RUD3 2ZMNA 1A25A 2SEBA 1R24A 4QXWA 4MGXA 2E7LA 1U5YA 4PV1C 4U6HA 5IROA 3L2LA 1EZVX 5IB1A 1S9WA 3V0VB 2I60H 1E3FA 2VWEC 4KO9A 5DRZA 4PPTA 4P9IA 2QQKH 3EFDH 5A32B 2PR4L 2PCFA 2WPGA 4WCYH 1KENH 3UTTA 4H7VA 3X11A 4BK5C 1ZBA3 3NKTA 2EDNA 1UTDA 1G7PA 1DDHB 3W9DA 3N06B 3AM8C 3DO3A 4YHZH 2YGNA 5FGBC 3Q6GH 1OQEA 1BXVA 1XCTB 5FK9B 2YUZA 2A5ZA 5FYMA 1HILA 1HYSC 4OIIH 2R0HA 3JB4C 2BZDA 5D93B 5DS1A 5L9BA 2XN9A 1SLUA 2O30A 5G4NA 5GGTH 4ZZKA 4O51A 4AI1A 1XVSA 4ZUVB 3GXUB 4XBPB 5EU6B 3QDMA 1SDDB 4P4KC 3PHSA 1FVEA 1UEYA 3SKUD 1JOJA 3ACIA 1FDLH 2GBVA 4D8PB 2IOIA 2OZ4L 4TVSa 5LGKA 1I8AA 2NP0A 3NCBB 2JLPA 4B0MM 3VXNB 4LVNC 4R96A 3WD5A 2XZZA 3B7UX 3CH1B 2FEDD 1C12A 1F8TL 3FQXB 4UDUA 4DFIA 2C9VA 1G9FA 1V9U3 2WZEA 3G5WA 1STMA 3GHEL 1Z66A 4OLZH 4DY3A 4KHXH 4Y1YA 1K5NA 3WVJA 3TWCH 4ZOCA 2JB5L 1YQ5A 4LA3A 5FYJL 3S5AA 4TSVA 4AYFA 4NRZA 4PJGA 4XO8A 5MEPB 4GQ9L 4MJ6A 5E8NB 3GBNL 4RMVA 3FF7A 1NGWA 1SBSL 3QNYA 4J25A 3KM5A 2X40A 3ZYFA 2NZIA 1QH7A 5DWUL 3C60C 3TBTB 1XU1A 2FDHA 2SBAA 1XNBA 5HYJE 3AAZB 1OLLA 4PP1C 3HPLA 2PP9A 2PXYD 5IT2H 1E50A 3EGSA 4MHRA 2B9UA 5C7GA 1WD9A 3EDKA 3INOA 4X83A 1G1KA 3B34A 4XURA 1ZZ9A 1JOIA 4R7DA 5D4JA 4YM1A 2I9LA 2EDXA 1FH2A 4U1IA 1D6EB 3GS7A 2OYLA 4IEYA 5FW6A 3QQDA 4HETA 2N3JA 1KLUA 3W9EA 3BYWA 2MPVA 3MYXA 2DQCL 4FPEA 1LTEA 3PHAA 4XAEA 3IGUA 1MOEA 3N91A 2ZXAA 5CEYA 4WTXA 4ZU4A 3T0EA 3BAIA 2LT9A 2J1UA 4IEVA 1QJFA 3C2AH 4Z7VE 1MCOH 1MW1A 1UVQB 4MWFA 5C0AA 4DP4X 1IGML 2JECA 5IVVA 1E30A 3S30A 5CP7B 4UBDD 3U14A 4B29A 2X7LA 3ARZA 3OPWA 1WE5A 3O2DL 2IH1B 2V6HA 3LKPA 4J6GA 4DZGA 1TTUA 3KL3A 3AT8A 2R072 4WEUD 1S7SB 1WLHA 4IRSB 4Y2LA 2DCJA 1JN2P 3ENRA 4XBPA 3AG3B 5EU6A 1NXMA 4LQFH 4XWGL 2GSIA 1BQLL 2NYKA 1BD2B 3D4GA 4PW3A 1EP0A 4G9DA 3OKOA 4F9PA 4NRPA 2FH6A 1RUOA 2LW3A 2BGPA 4QKFA 5FQ0B 2G2RA 3N42B 4MA1B 2AQRA 2YD4A 3OB8A 3PU8A 1A6UL 1DO6A 1HKFA 3GSRA 3EAKA 3M1BA 2A99A 4ZXBB 4NWVA 2WIIA 4Y1XA 1KC5L 5CKGA 2H1XA 4G80A 4IK7A 4YVSA 2WS93 4MSVA 3W5MA 2OUHA 4Q0VA 4BISA 2YIHA 1LVEA 4OTXL 5DK0B 2PP7A 5FX3A 3POGA 3NQKA 2VDOH 1QJU2 4YSAA 2FAUA 3KNBA 4U3CA 4XN1A 3SGDH 3ECWA 4A37A 5BS0B 1AHSA 4XDPA 3IDMB 4PJHF 1N8OE 1ND2C 3HE6C 3I9GH 5I1LA 4HV8B 3ARSA 3NRQA 2HRPH 1OAKL 3DMMB 2QDVA 4HSAC 4FPJA 4YZ4A 1AO7A 3VZMA 3EO1A 1ZGLP 4P3CH 2JIXD 2E7DA 1SJXA 5FY9A 1WISA 4L37A 3BWUC 4G1EB 3TBVB 2YMZA 1ULVA 4Y19B 3H8XA 1SYSB 1CPUA 2GITB 3BYTA 1U3JA 3WFBH 4Z5RB 5C5UA 1CDUA 3SH5A 3GALA 2E8YA 4PLKC 2CHWA 5MP6H 3T0EB 2DYPD 2R0LL 4L8BA 1ZTXL 4KZEH 2XTLA 3LB6D 2GK2A 1OHQA 3HJ0A 4FP8H 5B8CA 4X4XA 5IJDC 3VBUC 1BD2D 2P26A 2PF6A 2OJ1A 3A67L 4HKBB 1EAPB 3AY4C 4Z7OB 3UXFA 1OZUA 3VWKA 5DHEA 4IV3B 3LGRA 2WLNA 3VNZA 5L19A 1BCIA 1QD0A 2CRYA 1W9FA 2DH3A 2GSIB 1YUHB 2X9XA 5GRWA 4NQCD 4AQ2A 3TFKD 5FMDA 4FF9A 4WTQA 2PHDA 4YEEA 4NS0A 1ETA1 2CMRL 4TLSA 5TF1H 4RGAA 1E5CA 2VLJB 1YHPA 1AE6L 2ZJSH 3HA0A 4OIBA 4EI5A 1J3QA 1D6VH 4XVUD 1Y3TA 2WXRA 2WWKO 1UCBL 4NM4L 1I8MA 2MOVA 1U3HB 2CRZA 4N0RA 3GMQA 2CD0A 4H0GA 1UMZA 1W6PB 4J3BA 2VRKA 3DYMA 3QARA 3DROA 5KBPA 2XPJA 4FTEA 1O0VA 2HEVF 1S7VB 2AXFA 1CX4A 2EAEA 3QS3A 3IWUA 4IJ3C 1I8KA 1XIWB 2EUWA 1LEMA 3QZWA 4G59C 2IWFA 4UV4H 4XMIA 1EEQA 1WFNA 4OTXH 3FBMA 2R29H 1L6ZA 4HEMA 4QGTA 4BM7A 4F1SA 3CMGA 1HYSD 5AVUB 2YRZA 3TBVA 1YFUA 2I07B 3ABMB 2NT1A 5ABJA 2AQ3A 3S3PA 1JWMB 2NNXA 3MFFA 4Z82A 4F7TB 3S7EA 4XP6H 1HWHB 3E6DA 4WI4A 1JZ6A 1CT8B 2ATKA 4P2OB 1CU4L 2ORXA 2XPYA 5FJHA 2WZPA 1N59A 3N44F 1AR2A 3I59A 2BLFA 1G9AA 3SZKC 3FB5B 5D1IA 5AOIA 1L3NA 3THML 5MEOA 3D39D 1AZRA 5E6ZA 4XCCL 3LXCA 4FFTA 5B8CB 2F18A 4JRYA 2IXIA 2WNEA 2IANB 3ISWA 4XVJH 3U48A 4DN3H 1PG7L 1EAPA 1JHTA 4S1QL 1RIVL 4PCYA 1FRGL 4TNWK 3U30B 4UF0B 1YEKH 3MAWA 4N5EC 1HHHA 4OF7A 4XO5A 5KANI 5T1DH 2OFQA 4LBEA 4LEBA 4GG6B 3MUGB 1SEBB 2JICA 1IEHA 2EXYC 2YMOA 2JDPA 2XZQH 4D6SA 1I1AA 2IXQA 1NE6A 3AACA 3VGDA 3FT2A 4IIZA 4P4KD 1GYKA 5KXDA 1MCCA 2DLGA 3CFQA 3HFML 4U6TA 3TLRA 4FPFA 1YFXA 3K8MA 1MHHA 3CQOA 5F0LB 4KBZA 2F8VA 3L8QA 5A6ZA 3HHMA 3W57A 5JORB 1QOOA 5DUXA 3FB6B 3GQFA 4R8WL 3VDDA 2QQPA 3BZ4A 4K7PH 4PJ8A 3KH4A 4FLOA 4QDGA 4N43C 3F58H 4AJWA 2LS6A 1W6PA 1BFOB 1HN1A 2WGNB 4EN0A 1KC5H 1XB9A 2GVYA 3AXHA 3MLWL 3T2LA 2AXFB 2Q3ZA 1TE1B 1CXHA 4KROC 2ZUQC 5BZWB 3ZKSD 2OS7A 5SWQB 1R3IH 4J8QA 1SCRA 1I8KB 1FZMA 4BQ8A 2BHUA 5DA0B 4AXWB 2C6SA 2APXA 1Z3GH 5DHVB 3TBSA 1FC2D 2FBOJ 3WDHA 2FD8A 4JFFD 4HMCA 4QQLA 3AP7A 1QFWL 3ZFEC 2ZYHA 4BH7B 2OJEA 3FHAA 1RKRA 4BYYA 2N01B 3ZTNL 2E27L 1GGCH 1OAKH 3QUMB 5K4LA 2DQMA 3U46A 2LFEA 3EO6A 4N7UA 2B1HH 4LTAA 1AXSA 1B0RA 3VWKD 4OQ1A 2K2SA 3E5XA 1IVTA 4X5WA 1PIGA 3NA4A 3D48R 3IVKA 1IAOA 1UEMA 4Q29A 1P1ZB 4XGZB 4JKNA 4MMXA 4GH4A 3DVGA 4BFBD 3RWFB 3B1TA 4N7IA 5LBSA 3TPUA 2AEOA 2ZP8A 3P30L 4XAAA 3LPOA 1LD9B 2HZHA 3B56A 3UPCA 1I7ZB 3GRWL 3S5LG 4RGND 2ICWA 1JI2A 2FDIA 4YVSB 2EDFA 2BNNA 5ERWB 1A2YA 4WSJA 4UINH 4KKBC 5C08E 2QVIA 2VT0A 3R7QA 4UZSA 4JQXA 4E4SA 4I0CC 1R4XA 1WD4A 1BQPA 5LNGA 1DBAH 5J48A 3GTVA 2X9ZA 4ZRGA 3FT2B 4AQ1B 1V10A 2EE2A 4QJ4B 4DP5X 4XN8A 5D72L 5E94A 2OZ4A 5D71L 1LWRA 2EC8A 5E6ID 2JG8B 5DZEA 1Q9OA 4X9HA 4R9DA 3VDDB 2E9JA 4F15C 4NAMA 1SLCA 4O58L 1BLZA 3CH8A 4R7NB 1A21A 4RD7A 4CDXA 1WMDA 4IBZA 5B3JE 1AGEA 3QQ9C 1QX1A 3CZGA 4A7TA 1AE6H 3ZE1B 4BK4A 2A6IB 3UG4A 1XNCA 2XH6A 3E5QA 5G5DA 4DPRA 3P9MB 4RRPM 4YX2H 2VO8A 3KSCA 4F8LA 5SWQA 1X5HA 4P2RA 1FZMB 2NQCA 3CFCH 5CEZE 5L9DL 1HS6A 1CVSC 3CFBA 3KBPA 4Y1SA 3H2WA 4TVPE 1YLLA 4QHLA 5FR3A 4D8MA 1ADWA 3OG4B 1DVFA 1Q9WB 4PJDE 2GSYA 4ZFGL 3NVQA 5E24E 3ZT5A 1UD6A 2HT3D 3CDZA 3K5RA 3SQRA 4BJ0A 3BTZA 2FNWA 1NUNB 5CZVH 2MQCA 4BEIA 1SQ4A 3PDOA 4FQ2H 3IB3A 4W8JA 2WZ0A 3GBNH 3ZUCA 1BD2E 1P7BA 3PHOA 3CNAA 2WLIB 1KEMH 3AK0A 4PIXA 2D6OX 2F7QA 1JW6A 2CA4A 5IM7A 5ICXB 3AREA 3QW9A 3ZN6A 4LNRA 5FKPA 1KTDA 1IGOA 4QRSA 3AMPA 3BTXA 4HHAB 3W56A 2D7FA 3MDPA 3EYPA 5C0IB 2IWGB 5E6IC 4WWKA 2Y7QA 1BVKB 1KUMA 4H55A 3QVAA 1BSIA 1WMEA 3F95A 3RL1A 4MNGA 4LO6B 5GJTL 1SFDA 3MJ9A 2WA3A 1WUZA 4LHUA 2JWYA 3GM0A 3ZDZE 1FYTA 1PFOA 3GHMA 5I5JA 3WG3A 2VC2L 1ASJ2 2EDOA 1FE8L 4YSTA 2IBZX 1LRHA 3UESA 4EV0A 2NYZA 2BNQA 2IDQA 4U1LB 4HIJB 1IMHC 2W5PA 1W9XA 5C0FA 4HSCX 2XPGB 1WCUA 4LCWB 3KBHE 4G72B 3MLVL 1QNYA 4IRJA 4X98A 3IKCB 3SDCA 2CLVB 4CCKA 2M2DA 1UURA 2WXOA 5GXBB 3PIQA 3RE0A 1PM7A 1OLME 5E94B 4MZRA 1IPKA 4UINL 2HWD1 5F1KC 3PXLA 4PJXB 4BCXA 3NO8A 3WO4C 2ADFL 5TK2A 4CCLA 2BWCA 5IAVA 3BSZL 2VSKB 1JL8A 3G6AA 3FU7B 4CP9B 4MA3A 2OTWA 3C9NA 4FLRA 1JZDC 1MH5A 5DHXB 1YMME 2ZA9A 3VGHA 1VFOA 4GO8A 4HIXL 4NUGH 4OLWH 2RR11 1Z9LA 4MX7B 2JG9C 2ED6A 2BNRE 4E42A 2APVA 1W9SA 4FL4B 3B6SB 4MQXC 4F3FA 1YZZA 4MA1C 5FECA 1FQ9C 1SMOA 4IV1C 1ES0B 1NZRA 2GIXA 2FBEA 4XVTL 4ZMOA 3QPXH 3H9SA 4MCYB 3L4CA 1OB1B 1ZGLM 4AC2A 2RS51 4FFYH 2W9EL 4YC2C 4YVUA 2DICA 2E74C 5IM7B 1ULPA 3T1FB 1OHZA 5I1CL 5FZKA 1VAHA 3AY4A 2X6CA 2IWGA 4OF8A 5C0IA 3NSTA 1YIPA 2P34A 3HC4L 2FT6A 4XO4A 4U36A 5DJXB 4MNGB 4QOKD 3PQYA 2NQDA 4G42A 2WTPA 3PUQA 5A3WA 3ZKYA 4UIKH 1XGRA 1PIFA 5E2WH 3JV6A 3WEZA 3ASOB 1JNHB 1XEUA 2ZCLL 5AYUH 1IS6A 1G7QB 1FVCB 1KCRH 3MN8A 3PAYA 2NMNA 5BJTA 5IJBC 5FYKD 2Q87A 4Z1VA 4E5XG 5CFDA 4I0PC 4LCWA 2VLRE 5C92A 5EEZA 1RUD2 1NBVL 4H13C 4CDQC 1PVC2 3ZMRA 5GJTH 3RWKX 4I3SH 2PKDA 3OMZA 4PY8J 1M4KA 2ZAGA 1F11B 5DMJB 3UP1A 1OZTG 2CWRA 4JPQA 4YHLL 2VC2H 2F1EA 3PWUA 2WANA 5EEWA 1G9MH 2KXLA 2ENPA 2W92A 3A23A 1SOXA 4A2DA 3HB3B 5L2KA 1UU6A 1G6RB 3SPCA 1EX0A 4RS5A 5D2LA 3IMWA 1I3RB 3EH1A 3FSWA 4DTGH 2VNCA 3VYOA 1BXHA 3N41F 2DBLL 4MXWA 1ZRIA 4ZS7L 2ARAA 1QFWM 1RUPH 1MFBH 4K23L 4M6NH 4XODA 1EVTC 1UQSA 4XZ4A 5E00A 2Y6KA 4KTDH 4M3CF 5HCAA 2FSEB 3PGDB 4XP4L 1IGMH 1KJMB 5E2VH 4X8PA 3RDTA 3FH5A 2VQTA 3P54A 4AW4A 1AYOA 4QQOA 1EEYA 3B6SA 1REEA 4NENB 1KDKA 4LVHC 1BV8A 2A71A 4IRZL 1UX7A 4R4ZA 3H0OA 1UMHA 4Q0XL 4RSYA 5TGBA 5IHBA 4DB5A 1IBBA 1UWYA 3MCLL 1CDIA 4FQIH 4GG6E 2QGBA 3NMBA 4AM0Q 2EIDA 4K7JA