3ZMNA

Vp17, a capsid protein of bacteriophage p23-77
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
233
structure length
228
Chain Sequence
AAVQVGGWGFAWIDNEDFSPTGLAWRSGEYFALAQMKTPETAHFRIAAQERRLRIYLRGQKVVNGRNLSDPDSRTVNLPFLMQTPQGAPTLPSTYHPDVAVWAKVGSTWQPCVITAINYSTGDVTFTEPAGVTASDGIEIYYVHGDGQFRLRVARDDSAATVFNQSFSTMHSVDQNNVETMIAWPQQVELVPGTRLVLEVFTTQVPMVWNERSGHYIQIAAMGRRIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP17
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
total genus 49
structure length 228
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmnA02
2.60.120.1170 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zmnA01
3ZMNA 3ZN6A
chains in the Genus database with same CATH superfamily
2A4ZA 2Q5TA 1FYUA 4PB0H 4W50A 5IVXE 4DPCX 4XP4H 2NY1C 1G43A 2G60L 1EJOH 1WSST 4BLIA 3D12B 3B9DA 3QUXA 4JPSA 1Q9LB 3BDYL 5D70L 1R091 4KRPB 4IMKC 1CD1B 4U1JA 4S2SB 3RVXD 4YSEA 4PF5A 1F02I 4OI1A 3WP4A 5A1FA 5I1EH 5C8WA 5HHVL 3I50L 3NESA 1L0QA 5HDOA 5J57B 1NXMA 3OD4A 1UXXX 4KU8A 3QIBA 3SJVD 3VSUA 1P7QD 4J8RB 4ZFFB 1AXTL 3V6OE 2A6JA 2AJZB 1Z7S1 5HVHB 4CEWC 2H9GB 4HLZG 4AQ8A 4XC1L 2ZYSA 2NLRA 1OLZA 1Q38A 2R69H 4JTNA 1CTNA 1M7IA 4MA7H 2ZUSA 3ULUL 2QQIA 2V17L 2XFXA 5GRUL 5K93A 1AGCA 4HUWB 2X4RA 4PWEA 2KZBA 4LCVA 3AROA 4M3CA 3GZPA 2FZ3A 1MCLA 4U1LA 3NIGE 5GQBA 3LKNB 2IZWA 4R7NB 5EOCH 2DEXX 3SCMB 3TO4C 4DEWA 2Q7AA 3UCQA 3AABA 1WG3A 3PWPD 5E0QA 1XMEB 3MODL 1EEYB 2AABH 4BM7A 4LHLA 1BPLB 3B37A 1ZZCA 4PRBB 3HNSL 1LWRA 4D2NA 1IG3A 2G3XA 2Z9TA 1N0LB 2DBJA 5FYKE 1OUSA 1B6DA 3D08A 1RVF1 4Z7WB 1BOYA 3CZNA 2PCYA 2YXVA 3D0VA 3KPLB 1RZJL 1FNAA 2APVA 4RHV2 4EI6B 2IXJA 3VZMA 4L3EA 4UWQB 2XUEA 5E2TH 4M8VA 4XNQA 5C0RH 4FQZA 3DSFL 3D7PA 4NJAH 5AQ0A 3X14B 2IBZY 4H4NA 3QARA 4S0TD 5I2IB 5G05L 4IBQA 4QI3A 4F7EA 1N4XH 2Z7YA 1UXSB 4G3YL 1M6UA 1RURL 5T1LA 2PTMA 4L97A 4XVUC 3QUML 4BDVB 3RZKA 3RWJA 3VGIA 1UD5A 1HDMB 1QTPA 2BIHA 2F5AH 5EQUA 4MRBA 1IAOB 1D6EB 4TPRL 5EFIA 4FP2A 5D1XC 3WSOA 1MN4A 1OCWH 2TRHA 3P0GB 3S3JA 2EYRB 4N53B 3UJTH 3D3VD 1WT5A 5CCHE 2O5ZH 4FE9A 1C8M2 1CLYL 2GG1A 5DQ9A 4MA3B 5FUCE 4DW2H 1VGKA 5E08H 5C9JA 4J4PC 5HGBA 4NI3A 4NQDD 3LZLA 2JIJA 2CO6B 2FBJH 3B2UD 5LN4A 1YMMD 4WI5A 5A7SA 2W9LA 1OPMA 4XN1A 3IGFA 5HJBA 1VEPA 4ZTPH 1DIWA 4Q4W3 4U1MA 1RZFL 1OA3A 2P17A 3WCRA 2ZP9A 4NJ9L 4GKSA 4HK0A 1XF4A 1DFXA 4Z7NF 1MZ5A 3FT0A 3CNKA 3GFUA 4ZI8A 1MF2L 3F6LA 3FRPA 4PQ9A 3EYSL 1E43A 4XN7A 4Q9CA 2RS13 2GJ6A 4JFFA 4XCCL 2X89A 4E42A 4WGWB 1EUUA 5A6MA 3IKCA 5B8CB 3FH8A 5SV4A 3KMDA 2XI9A 3IU4L 1NCBL 4Z0BH 5IBTH 2K8QA 3MO1B 5I1JL 4QYAA 4O9HH 4WVRA 2AEPL 3RVUD 2VXVL 4DKEL 2Y64A 1T7ZA 2DQHH 1CICB 1MS9A 2DJMA 3V4PH 4L92A 2J4WL 1UWXK 3TTSA 4B27A 2VKXA 3PL6A 1S7RB 1L3JA 3ARFD 4XWOD 3RG1C 2W9DL 4MQ7B 1BF5A 4AV0A 3LKRB 4EEEA 3WEXA 3JUZA 1E6JL 4AX3A 4Y4HC 3QIWA 1CF8H 2DBIA 4LBQD 2ZUUA 3OX8B 3QCTL 2A73A 5IMOB 2EDYA 4UI2A 1RUMH 3NSDA 3ZYIA 1U8LB 3WAJA 3MRDA 2XH6A 4YDJB 2B5HA 4GXLA 1EAH1 2JXMB 4LXFA 4XXDB 2W0FA 5CLTA 3WKYA 3BW9B 4U0RC 3M17A 2FT6A 1SUHA 4GKOA 1A3LH 3UERA 4BCZA 1QUPA 5EUKB 5BUVA 1X5JA 2MEJB 4Q74A 4TLUA 3QVAA 5SX4I 2J3SA 1L7QA 4GLRH 4L37B 1N64H 4BK4A 3BDXA 3ZO0B 2CUHA 1F6FB 2ADGA 5BY5A 4L1HA 3KBFA 1E5HA 2IAMC 3ZYRA 5KSBA 3JVGA 3O4LB 2DKSA 4XAKE 4OZGF 1WZMA 3X3GH 1T2QL 4COYA 1DLCA 1T6WA 5FBZA 4RQPC 1EV2E 1LGVA 1X6LA 3DK2A 3LH8A 3C6SA 4Q0QA 1EPFA 4RFNC 1UWGH 1VZIA 5TDNB 1IVTA 1AE6L 5HVWA 4LPCA 4HCRA 3S5YA 3SDAB 3SHSA 4Z76A 3D3AA 3RPBA 3TVMB 2GCYB 3QDMB 4KU1A 2JI1A 2QQJA 5L9VA 3O1MA 3QDHA 4DOHB 2DQJL 5F6HI 3CVHL 4BZ2L 5F44A 5SV8A 5E1AA 5ABJA 1K4DA 5FQ0B 4HVBA 4Z8FL 3ETBF 3FF7A 3Q48A 3UPAA 4NQXA 5A7EA 2Y6HA 3M3EA 4K5LA 4OZFG 3ARVA 5DO8A 1T1WA 3CJJA 4QX7A 1CFBA 3DV4B 4PJEA 4POZC 3EJRA 1WAAA 2HCZX 1YPZA 1PGL2 2HFFB 1ASJ3 1PMJX 3MJ8A 1J83A 1SBBA 2MEV1 4O2FA 3TN92 1HKFA 2X4SA 5TPWH 2IQAB 4IEWA 2UXVA 1XCQA 3DPDA 5TE6H 3WNLA 4TZDA 1RZKC 5AW5B 3N50A 2EQDA 2FD6H 5TH2A 3O8XC 3U2SA 3VSTA 2W47A 3GMMA 3QHZL 4AKQA 4R2GB 3KVPA 1NOAA 2HLFD 4U1NA 1J1PL 5IAVA 4I2OA 2VMFA 2GNTA 1UQSA 4WAFA 4JW3A 5EO9A 5I1LA 3C7EA 3O2DL 2UVFA 3DOHA 1RZ7L 2Y6TE 3UIYA 3MA7A 4WSKA 3ZIXA 3EO0A 4I48A 3SDXF 3MNZA 3R4DB 4NP4H 1HNFA 3I02A 2EKJA 3BH9B 4HDIA 1QJU2 3MIBA 5D1ZD 2DM3A 4FFVC 3UGHA 4DEPB 5FZAA 2FWSA 4Y4FC 1F4WH 4F9PA 1L7TL 1X5XA 5KW9H 3FU7A 1G9HA 1PVHA 1PY0A 2XZAH 1AKPA 3MN8A 3KJ4B 3EOBB 2DPKA 4B9CA 1AYN2 1E8WA 4NN7C 1AYM2 1P6WA 1MWAA 3OJMB 4L4TA 3VXMB 1D4M1 1SXSA 2OW7A 2GN7A 4LZKA 4UF0A 2FL5A 4NNYB 2VNGA 1BQSA 4G7SB 1CO1A 4H8HA 2YYOA 1LB2A 4CCMA 2GSIB 3OPZA 3WDXA 4N43A 1UZ6E 2IUWA 3OHXC 3PIQB 5KC6A 1NCIA 3O1UA 4J3VA 2ARJA 4BBWA 1RK0B 5FYJU 2ZAAA 2XBO2 2XJUA 1UA3A 5E9DA 5IVZB 2IV8A 4V33A 4WBBA 2I74A 2E32A 2DRUA 5IQLA 2SEBA 4IKKA 4KTGA 1J1TA 2DIJA 5C0EB 4LU5H 3H3LA 4PJXE 3PCYA 1CE1H 1OL0A 4CW1B 4EZKA 1KMGA 3GBWA 4X7SL 3ZDXB 3TXAA 2CWSA 3MNVA 2RGSA 4JRWA 4XPGL 5I28A 2QKSA 4MGYE 4EYUA 5I1GL 2IXHA 1LQBC 5ICYB 5DVMA 3GMOA 1I82A 2G0KA 4ZO6A 2XX0A 2X6MA 3VW3H 2XLFA 3OBRA 3OZLA 1EMTH 3UZVB 1H4GA 1M57B 2YXFA 3VAEA 2J88L 4HKOA 1BZEA 2ZONA 3VBOB 5DDHA 3ETQA 4P00B 4NQEE 4JM2B 3U46A 2DQUH 4M43H 4HMEA 3CZSA 4U6VH 2XJLA 4XE5B 2Z31A 4YM0A 4RMVA 1RIUH 5GS1C 1AJ7H 2ORZA 3EDDA 1NICA 3ZFFA 2J7MA 3REVB 2ZGRA 4HU2A 4CC4A 3IJEB 3CHXA 1OZTG 4JR9L 4WKZB 1TEIA 2VJXA 1AAJA 1PQZA 4I85A 2OMUA 1MFEL 1A1NA 2WAQA 5TF1H 5ACZA 3CXHK 1H8TB 3D5OA 1XIWB 3TCLB 2BCKA 1OT2A 4CU8A 4I88A 2XZQL 3TV3H 4QT5A 3QDJE 5C9AC 3DIVA 2BW5A 2WLHA 3WQ0A 2WS91 4FTBA 4GQRA 5C4WA 3T3YA 3FT2A 2WT1A 2Z4QB 3BUQA 3UJIH 2AV1A 3JUUA 1DE4B 1MHCA 1GCFA 2P5BA 1SXCA 2OI9B 1KEGL 4PQXA 4BA6A 2YUXA 1W2AX 3OF1A 1UCBL 1Q8QA 4LKCA 5I71C 5DMGC 3EYVA 5CR1A 1VBD3 4HKZA 3KL5A 1JWSB 3D69B 4KK8D 4F58H 3IDJB 4APXB 3QUHA 4KJPD 5B7FA 2HH9A 1WC7A 2FNWA 2VQ0A 3HLAB 1XL4A 3FTYA 2IXCA 4MXQD 1RUOA 1IC5H 5L9DH 5FHBL 2H0PA 2QQWA 2CO4A 3DROB 1CU4H 3HBPA 4KTDH 4NIYE 5A16B 3RRQA 3A6CL 2EIZB 3LQAC 1U3HC 3WZ1A 1R3HA 5JLZB 5F7WC 4BWOA 5GGVH 3QPXH 5I0TA 1W6WA 2FECL 3CXDH 3K4ZA 3FQYA 4GS7C 3TBSB 4M5YH 3FLTA 4OIBA 2ORBL 4M1DH 4JJOA 5C4WC 4S2HA 2IJ0C 2YPJA 4UQ3A 4LUKA 2Y69B 3FCGA 4PJFE 4GWMA 3AQYA 4KBZA 1GMEA 4PJBA 3EAKA 5E16A 2OCCB 2H26A 1NMAH 2Q86A 1KN2L 3DHMA 3KCPA 4G43A 5JIMA 2O93L 2R062 3TWYA 3QIUA 3WF1A 5IQ7L 2UUDH 5T54A 5J37A 1V6MA 2YROA 1PCSA 4AI2A 3VXQB 1OPGL 3VXSE 1UWXH 2VB5A 4XBGB 1OQXA 3IFLL 3F2LA 4Q2FA 1OVZA 1AR1D 3CX5J 5D7JD 4GB33 1P84K 1UWEL 3GQFA 4P9XA 1EH9A 3W11D 3DVFA 3U9PL 4JJ5B 1X7TA 2QKDA 1U8IA 2DS4A 2QEJA 3ELNA 3ZDYF 2ZXGA 1A4KA 2ZEXA 1WEJL 2G0LA 5KYWA 3FQNB 1OQDA 5KBLA 2ZP8A 4X9HA 3P1VA 4EN2A 1O4YA 4XETA 2J1WA 1O6VA 2Y07H 3HAEB 3QEQB 5CR8A 5DGRA 4HANA 1OAKH 4XIOA 1DFBH 4P49A 3GHMA 1GZWB 3D07A 3HG4A 1AHSA 3H7JA 1B0GB 3EH4B 3LV3B 3ARFC 4PJ8D 4XWOC 2D4DA 4NUGL 4PJHB 2ZE0A 3KYOB 4AXWA 4GP4B 2Z2SB 1ZZ8A 5CJQL 4BQYA 2BY1A 2ZGPA 2D3SA 3ARBD 4PRIA 1MAML 4ZMVA 1Q0XL 3ZXLA 1AI1L 1ZANH 3MLSH 5BO0D 1OA4A 1CAUB 3ARWA 1MCPH 3DUUA 2LUWA 3ISYA 3IPEA 3DMMD 2H2SD 3QAQA 4Y5YC 4G9SB 4ATTA 2E4FA 5F5AA 1E7UA 2Y72A 5GS0L 4QX5A 3MGUA 1W15A 3MV7A 4HWEH 5T3ZH 3CVIH 1XSQA 1ZV9A 3NAPC 1EHKB 3EZ8A 3D4CA 3LD8B 4XH2B 4A3ZA 4X8GA 3WFHB 3AZZA 1Z32X 1NCAL 4XP1H 3EKCA 2K9UA 4LAJH 1A8JH 3W0WB 1N3QA 1WBXB 2EP6A 1ONQA 3BVDB 2OMBA 3LIZH 4EN3D 2Q8AL 3BGAA 3MLKA 4LJHA 4KPHH 2CIKB 2B9VA 4WENB 1NXD1 4BMEA 1I85A 2XQYK 1RUC2 4HS3B 3BPNC 4XF4A 4S1DC 4AM0Q 3GJFA 4JHUA 3EG9B 4Q4V1 2DCZA 5I0UA 5E2WH 4F3FB 4LOTA 4N90D 3ON7A 1FORL 2C1FA 4BXFA 4K0OA 1LAJA 3INAA 1X5FA 3DGGA 5LBVA 1JPST 1MVUB 2PYFB 4IRSA 1N2RB 3KV4A 4LCUA 4GW4A 5EWSA 2VUYA 3AUVA 1XB6A 4K5OA 5D7LA 2V0AA 3QO0B 4QHBA 1LEDA 1IFHL 2WT2A 3HIFA 4YS4A 4AEIH 2F19H 4MVTA 4YBQC 3D85D 5FYTA 4NHLA 3EJPA 1AYRA 4WM8A 1N68A 2AKRA 2EDLA 3L45A 3VYOA 4EIGB 4YGBA 4B3NA 1W9XA 4G1MB 4Z23A 4ODBD 5EN2B 5AFBA 3I3BA 3R06A 4LMQI 3IJYB 7FABH 2UY7A 2R51A 3SYAA 4UTCA 1SDDB 2OSWA 1QBMH 5AKRA 1QA9B 1RMFL 4L0PA 4YSFA 3U2JA 3K81A 3MROB 3Q2CA 1I8LC 2BOLA 3KXFB 4ZUVA 5KHHA 3M7FB 4J1UA 4P4RB 4UOW0 1E5IA 1G9NH 5I17A 5D1ZC 1Z9SA 4F33A 4DO5A 3MLJA 4XMKL 3BGFB 3HE7B 2J1SA 4IOIA 1LD9A 2WLMA 1K8DB 4QXGH 2G5BB 3MUHL 1APNA 1KT2A 3ENEA 1OAQH 3NP3A 1L9MA 1WRFA 5E8OA 3NIFF 4A7ZA 2XBDA 2XQBH 3BIBX 1ANUA 4A2HA 2YD3A 1JNNH 4NWUH 1K12A 3LNFA 4G8FA 3CC5B 3JU9A 3STZB 1BXVA 4K3UA 5E6IB 3U83A 5GGSY 3ROUA 1CGVA 5E1QA 3MLTA 1SQ4A 4K2UH 4MS6A 1MLBA 2ICEA 4NZDA 4ZRGA 5A2LH 5C0CB 2FBRA 1OOPB 2R072 1HRV3 1CVSC 4ZAKA 4OGXH 4CVUA 4YDVA 1ADQH 4KU7A 2WN2A 1QMJA 2XN9B 3COOA 3P30L 4JY6A 1RIRA 1HX0A 1ZWIA 4MQSB 2R29A 4JDZA 2YEQA 2R23B 3X1BA 5I6MA 2V4AA 3D4YA 3RGVA 4DK3A 2WNUC 4U1IB 5LAXA 5F93C 5IB5A 4HPHA 2CM5A 2ENPA 5ERLA 3V4UL 4DP7X 4AY0A 1KTLA 4B7EA 4LLVA 1NUGA 2AJYH 1VIWA 3FHEA 3M88A 4YL4A 3WJJA 2C9UA 4DY5A 3BTYA 2PMZA 1NCQA 5I82A 4JDMA 3T8MA 4OB5L 3ZPOA 4MJ5A 3AITA 1YWKA 5JORA 1N1YA 3CQQA 1D5MB 2Y0SA 1WWWX 3T2PA 2AGJH 5FHAH 1Y1DA 4X5WB 1C8M3 4P2YA 4ZMWA 4BH8B 2EVHA 2BBAA 1C5CH 2AV7A 2JJWA 3MOBL 3WNNA 2X2JA 4XBLA 4PG2A 1DYZA 4X0KA 3ATAA 4FC3E 1CE6B 1ENQA 2ZSWB 4B9PA 2VW2A 2ZXAA 2N4IA 5LBSA 2H41A 4AAPA 2MOVA 4TL5A 2D5HA 4OHYA 2OPCA 3CUPB 3KM1A 4OLYH 4ZS2A 3WBDA 2H3XC 4I2XA 3MV8A 1F11B 2ZKWA 1Z66A 1T1XA 3N43F 2RH0A 2CSGA 3GJBA 3EYQD 3BVXA 1R19A 2WINA 1DQLH 3K80A 5C8JA 4OV5B 3IZOA 3D39B 4AENB 4MDIA 3KT7A 4P05A 1EK3A 3GF8A 4ZFOB 1Y1UA 3O6LH 3KWTA 2HJLB 4AIEA 5BVPH 2OSLB 1CESA 2VXRA 1MPAH 3U4EB 4ZU5A 3T77B 1FUNA 3T09A 1H2LA 3AG3B 5D6CB 3WE6A 4ODUB 1N5YH 3D50A 1BZ7B 2X70B 5FZDA 1GYUA 4XGZA 3EO9H 1DBBL 3MIDA 1RUD1 1V27A 4MXQC 4NDMB 5LO7A 3QO1A 3WIHH 3SY0A 1PK6B 3AMQA 2RDRA 5A7PA 4PJIA 1KC5L 1WISA 3T3ME 4LEXH 3CSGA 1CPMA 2Y1ZA 3PPSA 3MLWL 4DO4A 1SHWA 1CZTA 2NTSP 3LS4L 3OYWB 4FGMA 2YWZA 3L7EA 5D7IA 3H1YA 4PJGF 4JPVH 2D6KA 2RM21 5H4YA 3WF4A 5IR1B 1W3VA 4UANA 1MLCB 5DYOB 4RRPA 5CVRA 1N18A 5B1JC 3ESUF 3IN9A 4OV6F 1K5NA 4A2LA 1JOPA 1E5ZA 1HB1A 4M4RB 1WHOA 3I3QA 3WJMA 4AJVA 4Y3OA 3A6BH 3WX5A 3RZCB 3THML 1WA0X 4LEBA 1OAZH 2BPA2 4CMHB 1QFWM 2MRYA 2P1BA 1BOGA 1GAFH 1WFIA 1ZHBB 2XT1B 3IAPA 4KOBA 4PGCB 3NJMA 2IVIB 4YXHL 4OUSA 3U0PB 1G0YR 2W1QA 2XWEA 5DHEA 4ELME 4FNTA 2Y34A 4IEVA 3RIKA 2VLJA 1OK8A 4O02B 1UMHA 2ID5A 2RACA 4N2NA 2FDGA 2BPBA 4RGNE 3ARGA 3I59B 4P5KB 1C28A 5ELIA 4LSUL 4RZCB 2X44D 3BESR 4A7KA 1H8LA 1IC7H 5KYUA 1NGYB 5F8QC 2JJ6A 3SYCA 2VAAB 4UT9L 2OA9A 4PJ5E 4H3WA 4UT6A 5KJ4A 4E5XB 3PWJA 1ZGLM 4RGOL 1JTPA 3LB9A 4HBQA 4MXWB 2HZHA 2VLRA 4QEGA 4TSBH 5L88L 1E3FA 3VXRD 3E3QC 4JFOA 1QJY1 4YSQA 2YBRB 1OI6A 3NL1A 1BQHG 1L0YA 1FL3A 3GALA 4PJ8C 1T03L 2Q1EA 3CU7A 4KBPA 4KUCD 4DPBX 1AO7D 3HW7A 4HUVB 1HJGA 3PTRB 1SGKA 1TTAA 4UV7L 3ARBC 1CL7H 3ULVE 3P4NA 1LGBA 2QTEA 1JGLL 5L4IA 1PZ9A 4SLIA 3WDWA 2WNKA 3G5WA 1G9BA 4OFYA 3MBWB 2HTLD 2CAVA 2K45A 2YD9A 1ZTXH 3O9WB 4X5XB 5FV2A 3VXPB 4E9VA 4QRRA 1IPKA 3QJZA 1OC1A 4GAGH 5E5LA 3GMRA 4KVCH 4Y4KA 2HWB1 5FPLA 2ERFA 2WSPA 1VBC2 1WCSA 2XXCB 4KO6A 2YSSB 1ACCA 4HJ0C 1T0MB 1AS7A 4JO5A 1JI6A 5EZLB 4B53A 3CBJB 3DHPA 1ST8A 1ZEAH 1UIKA 4YWGH 4Y16B 5CEZH 4OJEH 1SY6L 1CWVA 1QJU3 2H0VA 5J1SC 1NEPA 4QRSB 1V0AA 2J20A 2E31A 5KSAB 1NMCC 2PW1A 1LE9B 4YYOA 3D4GA 3FBQA 2A83A 1AYN3 5JOYA 5LBEA 2WQSA 1AYM3 4UQAA 2BHYA 1SEFA 4NPMA 1MZZA 3ALQA 4JZNB 3LF7A 2Z8WC 5FYKL 3LIHA 4OIIL 3UTZB 4F2MB 3G6DH 1AX1A 3S0MA 5FLUA 5C92A 4Z7VB 3F2ZA 3KLKA 4N0CD 3QLQA 5JOWA 1IBDA 4LHUG 3VUAA 5BV7L 2NX5A 4Q4Y2 1T5WB 4YW4A 1E8XA 1KCKA 2H0JA 1DUZA 2AMGA 4P3DB 1RD6A 3CFJB 4PFEA 3V6ZB 3VA2C 2XBO3 4QXTB 4A7GA 4GIAA 3ATFA 1YRZA 4WVVA 2F8IA 5L7XL 3X2QB 1BD2D 3NG5A 4HS8H 3PABA 5IEKB 1AXIB 1AMYA 5JWPA 1J0KA 3ZE0F 1CZSA 3KHBA 4NRMA 3VGEA 1AC6A 3D33A 4JGJA 2ISDA 3HNBM 3FO1A 3RURA 1IBBA 4R9CA 1EEZB 4M3KB 2JDZA 9CGTA 3JZYA 4IEOA 4Y5Z0 4FQHB 5BNOB 2EAKA 4QU1A 1V6KA 2DMCA 3B2XA 1WS7A 2W60A 5EC1B 1P5UC 3WLWD 2VXTH 2WZ0A 4FQ2L 4WFGE 4YHOL 5ESVA 2QVFB 3T0WA 3E6HA 5L7OC 4YBHA 4U6YA 2WV3A 2WZ5A 3EH2A 3KLQA 3MX0A 3ZDZE 2O0OA 2JD4A 4CXWA 2YKLL 4LEEA 3TZVA 4YHKH 4OJFH 1IGFL 2WCGA 5HDLA 3WMPA 4PJDE 4C8DA 4UBDD 1NDGB 2VXUL 1B2WL 4PB9L 1BM3H 2B5IB 2CNZA 2WNWA 5DFVD 2H4EA 2VKWA 1KBVA 3I74A 5DHMC 1DU3D 5LY1A 1G7PB 4MNGA 3WUCA 3L95B 3LH2L 4WV1A 1OGAA 1D6VH 3UAEA 4JO2L 1KEXA 3POYA 1T0OA 4DVRH 1SLLA 3F95A 1QFWI 3GBML 4EOWH 4FPCA 4KXBA 2HWZL 1E4XL 3FSVA 3VTMA 4PUBL 3QYMA 4Z7OB 4YHZH 4LLMA 2A1WL 2D3RA 1POV1 4OZOA 2NLJB 4NO0D 3UGEA 2WO3A 2AEQH 5FFOA 3T4HB 3NCCB 5J6SA 4XJ8A 2BVPB 2R16A 4TSVA 1CDIA 3ZZ1A 4LCYB 1D5XB 1UOVA 2PR9A 3SZ6A 5HGHA 5KBNC 2J5WA 1PVC2 2PPCA 2QKIC 2PWEA 4XR8C 3PQYB 4B95C 5MHSD 2J1YA 1A7PH 4MDJA 5EO1A 5KSBF 1ZGLP 1CAXB 2EH8H 4CDQA 4RISH 4X7TB 5F71A 1QLFB 3UP1A 4C57C 3NT0A 2LU7A 4M1GH 4YFEA 5JOPE 4HBNA 4H88H 12E8L 5EIVA 2CNAA 4DPNA 4Z7IA 4UUJB 2AI0H 5IJKA 3C6LA 4XP6H 4YE4L 3QAZC 4XN2A 3OMAB 2AHIA 4JG0H 4F7MB 1UZYA 2JEMA 3ZSKA 4INDA 5A32B 4NRYB 1DJHA 2RCSH 4NRXA 1TZIB 3VFVA 3ZSEA 4D9RE 2JIGA 4WEEA 5K0UC 2YA0A 2K8MA 1IAIM 2RBLA 4UIKL 4KGQA 3HNYM 4XUTA 3KVDD 4OFQA 2G4EA 2R063 4AGPA 2EADA 3K48A 3EF7A 2CRMA 4PJEF 1LEIB 4I3PA 3LHPL 1S9YA 1WAAF 1FFRA 1YPZF 1T5XA 3MRCA 3T4AA 1ROCA 4P9LA 2A1XA 5EOQH 3VD3A 4ORFA 4UFLA 4LVOB 3V0AB 4HIXH 3ZXAC 4N2MA 3P3RA 4E9TA 3RLSA 2Q76B 3EYQC 3FUQA 3PIJA 4B3VA 2XWZA 5ALCL 5CGMA 4DCQA 4KHTH 3CJIA 3EH5B 4YZ3A 2A74B 1A6PA 3UMNA 2DU1A 3T30A 1LDPL 4HCFA 2J6EH 2AITA 4UILH 3SH5A 1NLRA 1XGUA 1H8NA 3C5SB 3Q6FA 3U4KA 3I3DA 4YX2L 1U8KA 3RDTD 5C8CA 1P7BA 1GSLA 1N8ZA 1NZRA 1USZA 1PSKH 3INUH 4ODSH 2CDGA 1A14H 4O02H 1HEZA 1HXMB 3PGDB 4XPBL 4RL7A 5C07A 4GALA 4QXHA 1PDKA 5HI4D 4G1EA 3DWTA 2I9TB 1YYLL 2BVEA 2VC2H 1C5DB 5DR5H 3BCDA 1BIHA 1D5IH 3EOTL 3TF7C 3VN4A 2CLRA 1XNTA 3G08B 3OL2A 3SKUD 4QIRA 4CL7A 4RS5C 2XIIA 5T1KB 2KPWA 2VDML 4MXWH 2VBBA 2NOYA 5ITBL 2I5YL 3EXUA 2OZ6A 4EI5D 1AXSB 2EDWA 2NNXA 1PKQB 1TEGA 2OMZB 3BSZL 2WXQA 3GO1H 1AXZA 1YQ8A 2DMGA 3GSRA 2XQRA 4N2LA 1W8TA 5ISZA 3ZXKA 1ZA6A 2NY2B 2PKDA 4CEWB 3IB4A 1P9MC 4KDWA 1KLGA 2F5BH 4LFHG 4AQEA 4FG6D 1RJYB 2W0XA 2P42B 4NWTL 1GY1A 1W9FA 4AVAA 3LXCA 1QYGL 3WP6A 4K3EL 1I7UB 4JGYC 4ASMB 2WA4A 2JDYA 1KBPA 3L3KB 3T8VA 1QNYA 2VDNB 4LSRL 1MPXA 5D96B 4XBPA 5D7SL 4QOKA 4WI2A 2LFGA 2MIZA 5HD8D 1QLEB 1RUC3 1EDYA 2J1TA 2B16A 2NYYA 4P4KD 1F1GA 4ICXA 3TO4B 4PR5B 1RTVA 2EIBA 2FX9L 1C1EH 2VISA 4HX1A 1JZDC 1Q72L 3O45B 4UAOB 4JHAH 4PGJA 1AY1L 1IEAA 5KSUB 3D25A 2O5NA 3C5ZD 3HNVL 4ZMAT 5I5IA 5C0IA 2EVIA 5EIYB 2FHRA 1IGYB 3AREA 5FZ4A 1OB1A 3U30C 3QCUH 3LFIA 2C9VA 1JYVA 2P1YA 5BRZD 3TN0D 2JG9B 2R2EB 3OR7A 5AUMB 3VDDC 1H5BC 3HR9A 1H1MA 4G6KH 4H7LA 1NY72 1TJXA 1X5ZA 3NABL 4GJZA 2Q8EA 1NWOA 1L6PA 5AOMA 5EUOA 5D1XB 1JNHA 1YNTA 3SE9L 3EJJX 4KMQA 3X1EA 5I8EA 1JK9A 2YIHA 3OAUH 1OXCA 4TNFA 5F37A 3THCA 1UGNA 3CPLB 3I2CL 3MCKB 2VDLB 2VQ1B 3M70A 1NL0H 1WFUA 3B7RL 5DJCA 2JB4A 4H40A 4AMXA 4M5ZL 5J89A 2F61A 1RUF1 3MLZL 2KLTA 3WFBH 3I2GA 4LLUA 4H8UA 1PFCA 4OUOA 3T3PF 3SLIA 1UOLA 2F0CA 4TNVF 1S9XA 3O4LE 1K45A 2D3PA 4G9FD 5HCBA 4OCRH 4AYFA 3QI9D 4QPEA 3DX6A 5JHDD 1WIUA 3W5NA 1OP3H 25C8L 4RQQB 1IAII 4ENZA 2X2HA 5IJBC 3UAAA 1C8PA 4LSPH 2NYKA 2PO6D 3H8XA 1W6MA 2CHNA 2YGOA 4DRRA 1NWPA 3QDME 4Y9GA 1NEUA 4M5TA 5IMLA 5IT6A 2JI2A 4HF5H 1IILE 4DOHE 1AZVA 2R073 2W9XA 1I9IL 4OI8A 5DHYA 5SWZA 1EGJL 3ZTCC 5FZBA 1LJ7A 2V9TA 3WS6C 2IBBA 2R7EA 4XPFL 4PJBF 5GRYA 4OQTL 4OLWL 4QTIH 2QPUA 3WKML 4HONA 1O8PA 4ALAC 4JMNA 5B3SB 3QUXD 2QPSA 2E9IA 5CSZB 1N70A 4OUUB 3KPSA 5GGUA 1EDHA 1KPVB 1ZBA1 3MYJA 1J86A 3GXUB 1MRDL 3NZHL 4L3CA 4GI8A 4UINL 5DYFA 2VZUA 4DAGL 4Y4HB 3KNBA 3VFWA 5BVJB 1A9VA 3UJOA 4E2QA 4NPJA 3VFUB 3WLWC 3BZEA 3B8YA 3MRRB 4L1TA 4M29A 2APFA 4HWBL 4N1CA 4J5VA 2D7TL 4QHOA 5DFWH 4QKFA 2FWOB 2X40A 3B5GA 3H1ZA 3VBFB 1LE5A 3MKKA 4JN2B 4JPKL 3GDCA 5ALBH 3UYOD 1FDLL 3DX7A 5F2FA 2FWLB 3I2OA 3BAJA 4I02A 4DUXA 5G4MA 2X29A 4QXBA 3L9RA 4OGYH 1WV7T 2ZZUT 2ZD0A 1A8MA 2LT9A 4K8RD 1DYOA 1GGUA 3M45A 1MCIA 3SE3C 1PZ7A 4IJTA 2XL7A 2J5LC 3L8QA 1U2HA 3PWUA 3ATGA 4R84A 1MFBH 5DFAA 4B4PA 1JRHH 4YLBA 3WVJA 1HOCA 3TJEH 4RQPB 2NXYB 2JH2A 4JG5A 3N1FC 5E9AA 3VXME 1TMF1 4RFNB 4POYA 4X9BA 4KI5F 4AQ6A 3QUMA 4BQ4A 1E27B 3VG9C 1F13A 5FUPA 1JPTH 2EDTA 4QRTB 2WA3A 3HMYA 4NHUA 3GBNL 2DLHA 5CU9A 2E9WA 4AVHA 2OW4A 5JTWA 5A3MA 3VFNA 2ESVB 1Z2KA 2GFBA 1SMDA 2N59A 2DDQH 3B9KA 1RY7B 2DL9A 2GT9A 4LP4A 2ET1A 3UFIA 4HG6B 4JFEA 4JFXB 3QG6B 4HEPA 3TEXA 2HVKA 3APDA 2VJ8A 1DUYB 1BYHA 2V9UA 2YBGA 5T1LD 3ROOA 1ITCA 2O5YH 5EIIB 1KXHA 1L5GA 2WO7A 1S7UA 4MRCA 3RVTD 2Z4FA 3ZDXE 3J8F1 2CDEB 2ICWA 2AEZA 4FPKA 5EZJA 3QW9A 1BCIA 4ENED 1QSVA 2P8LA 2GTZA 4WFEE 2BSCA 4Y22B 3LNIA 2C0ZA 2Y3AA 1RLBA 1ODMA 1FFOA 1A5FL 1LO0L 1RUG2 1IKFH 2ITEA 3BZDA 5DSCA 2GY7B 1DQMH 5HHPB 5JZ7C 4H25A 3AJ7A 2QSCL 4JFTA 1ZAGA 1SRDA 3OJ2C 2P5PA 2E7LA 5HHNB 1JYIA 4Q0SA 2QQNL 3E2HC 5E24E 4ZNEE 5DD3H 3R1GH 1NQDA 1A21A 4C0HA 1QSFA 5HHQA 1WAEA 3OGGA 1KEML 1E28A 3H1WA 1F4YL 3SN6N 5F8RC 2PN5A 4NPRA 1KGWA 5L6YH 4X98B 2W38A 6PAZA 3SBPA 1IM3A 1JFQH 4J6IA 1MJUH 3IGLA 1W6QB 1BHGA 4J39A 3PFQA 4ZQKB 3CV5A 4OLXH 4XAEA 2GJ6D 4JFFD 3FB8B 2JWYA 1KCRL 1I8IA 5L2KA 2GK0A 2ICES 3WELA 3NFPB 1ZHLA 3UZEC 1C12A 3CNAA 4OYUA 4H0HB 3HRZA 3QZNA 1V05A 3WO4C 4XNXL 4UYBA 4RFOH 5KBFA 3FU5A 4IBLT 4XX1G 2WXRA 1HT6A 1QUNA 3RDTC 3MRPB 4F37K 4QPGC 5EFUA 2MQ0A 2EINB 2LU5A 4JDTL 1H8VA 2WAHA 1OSGA 1H1IA 4EWEA 4MADA 2PXYB 3PL6D 4IK7A 4XCEB 1M7XA 2MMXA 2AREA 4AGRA 4HIEB 3QIWD 1WGVA 2VDNH 1PGRB 1MDTA 2DEWX 5DJYA 5CIPA 2VSKB 3GMQB 1QLEH 4MCZA 1SYVB 4NKIL 5AW7B 1ZY9A 3WMQA 5JNYB 2RR12 1IGCH 3A67H 3L1EA 5IHHA 1UM6L 3CSFA 3QZWB 2AMUA 3AB0C 4O51A 2I60H 2AVFA 3NCBB 1UCXA 2R32A 5HBBA 3V0IA 1OSZA 5BMFH 1NFKA 3ATDA 5I18L 2GITA 2ZSVA 3GXFA 4NIAA 5TQ0L 1JP5A 1S9VA 4EI5C 1AGFB 1VBC3 3NWKA 4F20A 3IPVA 3GBEA 2EE2A 3DA0A 3BAIA 3SQBA 2I26N 1PEZA 3TYGL 5MEPA 1J8HB 4LLWA 1AR92 4ZUSB 2WZR2 4IDZA 1E6OH 2FQFA 1AR62 4PLJC 3QQXA 4BLJA 3KLHD 3TCTA 5I8YA 2ZCLL 4HKBB 4XACA 3CVHA 5ESAB 4PJ7E 4BZ2A 2WXJA 2PAMA 2DM4A 2IDFA 3FAXA 2XONA 3R0RA 2IVFC 4FG6C 3T0EB 1A9EA 2CGPA 1FH2A 2HJKA 4J3XA 2EYTB 2FLBT 1ULOA 4FPOB 5ICXB 4XNMB 1DQ0A 1SYSB 1O6SA 3VWJB 5KBDA 4FQXC 4LASH 5F9OL 5C0ND 4LHSA 4A45A 3HPLA 1AIFA 32C2A 4CADA 5L8LB 2BNUB 1MHPH 5HD8C 4K7FA 2Z1KA 1W72L 5JSOA 5GGTL 5DJ8B 3STLA 1E4HA 2YU1A 2ZOKA 4HAKA 5KUKA 1JU3A 4JDEB 4QF1B 2E74C 4XP5L 5C9AB 4AYUA 4TOYH 1PZ2A 4GI9A 3TNPB 1GGTA 4PJAA 3UYPA 5K9KB 4TLFA 3FOMB 1YEDB 5DJXB 3LJ3A 2BNRB 3RNQA 3OSVA 2KQMA 2FZ2A 3MRBA 1U5YA 4Q4Y3 4R9BA 3LKQB 4G7YH 4R9DA 4EN7B 3ILNA 2YGMA 2DI9A 3RIAF 3O2DA 1R3JA 1CG9B 3MFGB 3QEQE 2ATAA 1HZLA 4UDUA 4QRQA 1FNFA 5JXJA 2ITFA 3QQDB 4A6YH 4L9DA 3HD8B 1BEXA 4PLKC 2A3YA 5HDBF 2YC0A 2A77L 2DQDH 2ODHA 4JCKA 1YEEH 4PJCB 3PP3H 4JPWL 4PJHE 1A02N 4JFQA 2X2YA 3TBWA 4XCAA 3VFTA 3Q6GH 4H1LH 4M56A 2PHTA 3GRWL 4MZ3A 3GHNA 3GUFA 1P2CA 1U3HB 5I26A 3IDXL 4FG0A 1VBE1 4CVXA 1GYCA 4I9WD 2ZZJA 2WL1A 3LEMA 1LOFA 1X36A 1WFJA 3GXNA 2W1NA 4N8VA 3GTVA 2EDBA 5BZZA 5IB1B 4DZBB 1F4AA 5AW3B 4LVNC 4W9KC 2CLVA 1NCDL 3X12B 1Q56A 1MCOL 3I9AA 2V7NA 2DQCH 2VITB 1L7IL 3NH7L 3CZFA 4J6RL 2RS32 4QXUH 4L4TD 4NHMA 4WQOA 4XB7A 3MHZA 4FAGA 1PFOA 4TVPH 4L8CB 2J7LA 1IFGA 1MWOA 4G6AD 4ADGA 2A9AA 4PJIF 2X88A 2BMKA 1NGXB 1CIDA 4Q14A 5A2JH 1IKNC 2P46B 3IFPA 1ODUA 1NAKH 4XP4L 1JODA 3DVNA 1MJ8L 5D7IF 5PAZA 1GXEA 1CQKA 1KITA 3C8XA 5ID1A 1N3NB 1TQWA 1QKZH 4W81A 4FA7B 2D9QB 3M86A 3OGOE 4W4NA 2H6CA 3HB3C 1GZHA 4D8PB 2ADIB 5D71H 5EO0A 3MYXA 1HEHC 5F7DA 4MMZC 3SYOA 4JFYB 4MAUH 5HVFB 5I8OL 1U3JA 3IE4A 2F4LA 2EAEA 3F7KA 5I73C 3JQWA 2X0VA 4S1SL 1OTTD 2FLMA 3MTRA 1PVC3 3FLRA 1O3QA 5CEZE 5LA1A 2FIKA 4MA7L 4FHKA 1OT1A 2OMTB 4XB3A 4Y1UA 4E2OA 2VDKH 5APAA 2HG5A 2R27A 1IC4H 5C6WH 2WYZA 3A23A 3QIBC 5CISA 3I9GH 4GINA 5EOCL 2VG9A 2IPUG 2X53A 3KPMA 4JHZA 3HJEA 3ZR5A 1YEJH 1NDMA 1NUDA 3FO9A 5E94B 3W56A 1DQKA 4AQ8C 5BOPA 5F3BB 2CK0H 2JFCA 1PZ5A 4LKXA 5E5MA 3T6XA 1R64A 4NO4A 2Z31D 4NO5B 3KXFE 1MCHA 1QHPA 2Y7OA 2XPZA 1XGYL 2J44A 3RIFK 3NYKA 4MBRA 4YG3A 4UF7C 1MS5A 2XTJD 4K8RC 3LSEA 2E8YA 2QR0A 4Y9EA 5E2TL 3RA7L 2WNVB 3ZXGA 4I0KA 3MRFB 1RZKH 3UYRL 4NJAL 1L6XA 3WL9A 2FYVA 1BMWA 3AC0A 1S3RA 4LK6A 1N4XL 2GHZA 1WIOA 4XCFH 5D7EA 3NQHA 1C9SA 3PWNA 1SFYA 3D2UB 1T0PB 5F7NC 2WZEA 3VBHB 4BCYA 2F5AL 1FYTA 4KK5D 3P9MB 5FPAA 3MNWA 2V4VA 5D1IA 4K3HA 2JICA 4G7RB 3BKJH 3FZUC 4D7YA 1CX1A 4RAUA 5I1AB 1SFNA 4JY5H 1US3A 1OK0A 4P99A 1SLAA 5AVVB 5C0CE 3HVNA 4JZJB 1OAXH 3WEOA 4FQCL 4HJGA 1Q90A 5BXXA 4XXAA 2F2HA 3T4YB 2WJ5A 2VZ3A 3CZJA 2XN9E 4PTTB 3VFMB 1RUJ2 3GBFA 3VKNA 3ZUCA 4Q56A 3ULVL 5TE4L 2FBJL 4DP4X 4PBOA 2VR8A 1AG0A 4A2MA 3DXAB 1QJZA 1C7TA 2BHZA 3HS9A 1YQCA 2E4TA 4ZXEA 1A0QH 3MYZA 1IKPA 1SPDA 3DX9A 3THTA 2H32H 4ENEC 4IV1A 2CK2A 4OQ1A 5FM5M 2C26A 3V0VA 2IIJA 3BPCA 5B2GB 1IS4A 1RJLB 4AFCA 3MGOB 1ENRA 4LE3A 2BRRH 1HK6A 3W37A 1U9KA 1HWHB 4X6FB 4XNYH 4RMWA 2YBSA 5FECA 5JZGA 5LW9A 2Q3ZA 1NCRB 2B59A 3A3YB 3ARDC 4KZCA 4R9AA 4Z0BL 1JIBA 3QIUD 4GY4A 4U0QB 3JTTA 4EQVA 1MFNA 3PUQA 2QLVB 1GL4B 1PAZA 4A7GF 1LJMA 3VKLA 4D7TA 2UY9A 1OAYH 1N26A 4JKPH 3LH9A 3VD5A 3KAAA 3VRLE 2GUYA 1MW2A 1UKRA 3VHOA 1CGWA 1QJX1 4R4BA 1CDUA 5SX4H 1LOEA 1H8OA 5C2BL 3X1FA 5CFHA 1CF8L 1FGVH 2RB8A 3UO1H 1GJIA 2C5DA 4CUBA 4L1LA 1GC1C 5IAXA 4G7QB 4HMCA 3D39E 1FNGA 1BMZA 3AL5A 4NQSA 2XIBA 3A47A 4GP5B 3GEFA 3QXAA 2RE9A 3KQRA 2YO3A 3IXAB 4ZX4A 3PL6C 1ZLDA 4M1CD 3WQBA 5KJ7E 3P9WB 3VFSA 5BXFB 4ZUUA 4W9EC 4PGEA 2JXAA 1Y3TA 2B46X 4KI5M 4WJ5B 2BP0B 4PRID 1JZ7A 5EOTB 2WNUB 1PJWA 1NBZA 4UZGA 4KI5D 4X6RB 5D8JH 3X3GL 2TSBA 5FYJD 4HIIB 1WD4A 1RU9H 4AYMC 2ZX9A 3OVUB 1V70A 4ADJA 3HC4H 4FL4C 4NRZA 1KFXL 1KJLA 2FT7A 3MV7D 5CG9A 2OMWA 3SKNA 4JHWH 3L4YA 5FXWA 1NCGA 3PHOA 1XF5B 3KPRB 4JGZB 3PE9A 5GISL 5JR1H 3GM0A 1Y7VA 1UF2C 2E9JA 3TBTB 4M6OL 4WM7B 4GMSH 2G4IA 4FQQB 1YNLH 3QBTB 1UN1A 2DYPA 4YGVA 1LNSA 3L3HB 4N2KA 3C75A 1PZ8A 4XO5A 5JIPA 1HIXA 3OY8A 3DBXA 4G11A 3E5QA 4MGIE 4EDXB 4LNRB 3LQAH 3OKDA 5L0QC 2DCTA 3ES6B 5GZEA 4U4IA 3HS0A 1NOFA 3PGFH 5TE6L 1YEFH 4KXCA 2DBLH 2W2IA 5BYNA 5LK7B 2Q6WA 1HHHA 1ZLEA 2RFXA 4FNSA 3CCHB 1CR7A 5C3PA 2NQYA 3AVEA 1RL3A 1TJHH 5CHNB 4MOAA 2X9ZA 4LRNH 2Y6SD 4NC1E 3MPPG 2VW1A 1KXVA 3Q7JA 3VM7A 1ZMYA 4H55A 1EO5A 2AXJA 1U2YA 5D7LD 3VQMA 1D9KD 4UOJA 3KPPB 1DLLA 1LILA 5SWSB 1UM4H 1TJIL 1ZIBA 2BC4B 3WFCH 4DGYH 3ZKMC 4Y2NA 5TK2A 3RWNA 1HH6A 3ZIMA 1FL6A 3P73A 4B9YA 5C6TL 3MC0A 3A4EA 4YEEA 5F5IA 4EIUA 4AVCA 4LLQB 4JFDD 1HHGA 2P3KA 2XJKA 3GSQB 2YD2A 3B83A 4ERSL 5DHVH 1WCUA 4AJWA 4MD5B 3M7OA 3ASNB 4ZO7A 4D0DA 3HG1D 1WLCA 4IE4A 1NE4A 2DI7A 2GMPA 2VAUA 2ZOOA 4WFFE 2YAMA 3IBOA 4GWJA 3V5KA 2V7HB 1NC2B 1JWMB 2WWOA 2LFEA 2XA8H 3DRQB 5IM7B 4W8JA 1ZLWK 4CDUA 1KXQE 1OTUC 1N12A 3MU3A 3K4AA 5JPMC 1QJFA 3V52H 3ILFA 1OD7A 2VVDA 2NY6B 5JDSA 1LO3L 2CHZA 2Z6FA 3MLVH 2BYVE 4XCYB 4K7PX 3WLBA 5BZDA 4M02A 2AERT 1YEWA 1UWWA 4UM8A 4KG8A 1FO0H 4I3SH 2BWIA 1RUE1 5EBWB 4XBMA 4E41A 2P2KA 5DD0H 2Z5WA 1JZ2A 3T6QC 3IDYC 5F1KC 3VNYA 2VGDA 4ANWA 3L5XL 3PIGA 1IGMH 2W0KA 3DJSA 4N43C 4JGUA 4M8RA 3IF1B 2DQEH 1XSJA 3WQ7A 1TO5A 1Z5LB 4MAYA 3MBEA 2P24B 4ZAKD 4PCTA 4F2ME 2OK0L 3T8XB 5BO1H 2Y06H 4Z7VE 3HWJA 2JJUA 3K6IA 4U3XA 4HSQA 1EMTL 1VJSA 2VN5A 4J1XA 1NA8A 3RGVD 1I8KB 2ZGTA 1T0NB 1OHFA 3J26N 1ASOA 2CRIA 2DQTH 1D5ZA 2W65B 1R3KB 5L9BA 1JVLA 3W9AA 1EZLA 4M43L 1KYDA 4UQ2B 5FYKU 2YRPA 1RINA 3FU3A 2B4CC 3BH4A 3GS7A 1RIUL 4G8EB 1AJ7L 1E3XA 5I74C 1GGCL 3O3EA 3HC0B 4R3SB 3LSOB 3QNYA 1I7TB 1SJHB 1A9BB 2GC4C 2NZ1A 3AM8A 3VFRB 1TEFA 3OKLB 4JFZH 3WNJA 1LP9F 1OARH 4G6JH 4GIOA 1MIMH 4QRAA 5TF1L 1SCRA 3L16A 3IFOB 5JW4N 2VULA 1TME2 4ONHB 1ZK5A 4RIRA 5C1MB 5ADOH 5FYVA 3IGAB 1ROWA 5D2AA 3TRSB 1EXUB 1B3JA 4G7VH 1RUG3 4ZSOB 5EULV 1BFVL 3V0HA 2JDMA 4G82A 1I3HA 1TO4A 4Z6AT 4CCOA 2DV9A 2YKKA 1MAKA 2AK4A 4L5FH 4JB9H 5F96H 2OJEA 3FT3B 3QJOA 3ZFFC 5JXIA 5FC9A 2FDKA 3TESA 3MGTB 2XTJC 3CFEA 4HZLB 1O3SA 1COV1 2ZUQB 3VD1A 3KM2A 1G7YA 3WG2A 5ACA1 1T2JA 4J2QA 1OURA 1HQLA 5HYQB 1AR71 2FMDA 5KYYA 1IC5L 1NMCB 3KL3A 1OD5A 1SBSH 3IFNL 3G6JA 3NAAL 3HMXH 2BDNL 4DN4H 1QNZL 5D72H 1TJGH 2Y6LA 2YMXL 2X05A 1Q0YL 1XWVA 4NROA 3OAZK 3UTSD 4KMTH 1F90L 1GPOH 5GGVL 1T22B 1UCTA 2Q8BH 3UC0L 1HH9B 4M5YL 4KX7A 1C5IA 4Z7OE 2FJHA 4BFOA 3UAJC 4XPTH 4NJ4A 5JR2A 4E9WA 5A2AA 2Q3AA 1S7TA 4FZEH 1JZIA 1JAEA 1A3ZA 2AJSH 5FUZH 2FBOJ 4AMWA 1LO5B 3IMVA 5KOVC 3CL1A 5AC91 1DVQA 1NMAL 4NNPH 1KGJA 4Z7NB 1AD9A 3FSOA 1QG3A 1NSNH 5DTFB 1E4WL 3OR6A 2XMLA 3PQYE 3ROLB 4C59B 4RRPM 5JOFA 3BOPA 5JPNB 2RR13 5C3IA 2YS4A 1KCUL 2VLKA 4RAVA 1DJIA 4PS4L 2JLPA 2UWEA 4LA3A 1CFSA 4XF0A 3MVSA 3BE1H 5T5LA 2OTUA 2NY7H 2E5EA 2NM1A 3AMNA 4IE7A 2X4TB 4XMWA 3HUJA 4I0CC 2PPEA 4PRDA 5DEGA 1H0BA 5LASA 2JENA 3GXMA 3JV4B 3QFDB 1P5UB 2FX8H 4YN3A 2Z92A 2WZR3 1KULA 4KWLA 2W0PA 1HQRB 2YWYA 3K0WA 3QIUC 5D55A 1AR63 1TVDA 4XQWA 4UT9A 1A7OL 3RTQC 3ECVA 1JV2B 4P2OA 3MA9L 1CLCA 2JB8A 3J7LA 5BCAA 5IVOA 1UYWL 2Q87A 1GCYA 1T21B 1IBGH 3AJYA 5ABZA 3DHUA 1NM4A 2GC0A 2VLJD 4BCUA 1MSPA 2BNMA 2WQAA 3BP4A 4LO9A 3ARGD 4KWKA 3RWFA 1RZGA 5J9PB 1B3IA 3UTTB 1MEC1 1M05B 2IGTA 4OZFB 5G2NA 5B1BB 2KL6A 4L2NA 3QUYA 3FTVA 5DK2B 1URLA 2VE6A 3F3HA 4BFIB 3ULUF 2BU9A 1BZDA 3MLSL 4TXVB 1T04A 2IFGA 1F3DH 3C8KB 3CU1A 4Y2OA 5F0LB 1MS1A 3M1HA 1IM9A 5JUEL 1CXFA 3OAYK 4GAYB 2VLRD 2AJVH 4DGVH 2IMMA 2XKNA 3FH5A 5MEOA 3LKPA 3MLYH 3RUGB 1H9PA 1YEGH 2HWE2 2NP0A 2R0WH 4QHLA 3RVHA 2CUIA 1TKWB 1SNRA 4H8WL 3V6OA 5MEQB 4Q9RL 2O8QA 4M1CC 4XNBA 1J7VR 1FZMA 4H8VA 2PWHA 2R2HB 2X5IA 3FFQA 1SXNA 3HR6A 2WVTA 3KV6A 4FFYH 4B5ZA 5KG9A 2X0WA 4X0NA 4PW9A 1SY6A 4KI5C 1F3JA 2SBAA 4OFYD 2GPZA 4Y20B 5K9JL 4QRRD 4Z18A 3RWDA 4KV5E 1OALA 1ZHNA 1OLMA 5FYLE 5GJTL 4FTSA 4PJ9A 4Y4KD 1RHHB 3U79A 2QFEA 1OGPA 1UY3A 3L3DB 1DEEA 4KPHL 3WD5H 1KXTA 1YN6A 4ZD3L 2P37A 1WQVT 1HFUA 4QHMB 3E8UL 2X28A 1H4HA 4JHVA 4WUKH 2X8KA 4ODXA 3UL2A 2D43A 1USQA 4ELKB 2ZOWA 2XWCA 3QAZB 2NSQA 5KS9F 1X4ZA 3B3IA 1HCZA 4CCEA 3H53A 1ZA3A 3D9AL 4G9DA 3DTXB 1LHOA 3N06B 1L6ZA 4HPKA 3H2WA 2OZ4H 1JGEA 3F7VA 4JFWA 4MGZE 2NPLX 4BQ3A 2QQKH 4N26A 4PWFA 4YAQA 3PVBB 5SWQB 1PGW2 4XCNA 4HLZH 2RS33 5H9PA 3VFOA 4E8DA 3ILPB 3QQ4A 3UZQB 1I85C 2R2BB 1REEA 2F19L 4K21A 4HLEA 15C8H 4JL2A 1YUDA 3PAUA 1DBKH 4KKBD 5A1LA 4JFPB 1QO3B 1ZSDA 3DUSA 4DJMA 2E7BA 1QVOA 3SDXB 2NX5D 5GGRY 4QYOA 4IRSC 1CGTA 2Y6SC 3QYNA 1BFOA 4K7PY 1W90A 1DQQA 2Y4SA 5KN5A 4QXWA 4Z8BA 1RQ5A 4A2GA 3SBQA 1FXZA 3FUHA 1I53A 1HINL 2UY8A 3VFGH 4AE0A 1FNEA 2WOBA 2YPVH 1ZLWH 4DN3H 4UM9B 2VOXA 5HGAA 4WM8C 2J1ZA 2PHWA 1IAKB 3FKUS 1T1YA 1JPGA 2YA2A 4GKNB 2XWDA 1GWLA 3SXWA 1FZOB 2P4EA 4PSPA 3SKOA 1BQUA 3QDGB 5HPMA 1KDMA 4META 1A7QL 4U1GC 4HPOH 2YSTA 1S4CA 4XFBA 5E89A 2C1OB 3KPNA 1ZX5A 2ATPB 4HEPG 1G7QA 4X4ZA 4KROB 5HDRA 2A6IB 5C3TA 4NWUL 5T5OA 1B09A 1TCRB 4RFEA 1NUFA 1J0ZA 1YNKH 3NZ8A 5D1QC 2P3IA 3OPUA 5D1XE 3RI5K 3WFEH 2FK9A 3DPBA 5T33L 3F7YA 3GK8H 4RS5B 1ZVSB 1X5KA 2OP4H 3AS1A 3MJ7A 4YZWA 3L4XA 2WP3O 4F8TA 1DVSA 3LWCA 1XGTA 1FIGH 3FO2B 4R4NC 5B1KA 1B90A 1M2OA 1BX2B 4LLYA 2EDHA 3QJHB 4XVTH 5GZND 4L29B 4BFGA 1BGXL 4LGSB 3L3JA 1OGAD 1W6PB 5LBBA 2CM6A 2YAOA 3C08H 4HGWB 4O2CB 2H5UA 2UX7A 1XR8A 5EF1A 1OSPL 4LHKA 1F8VA 1BF2A 5D5MB 1MJJB 3T1WA 2VUKA 1JPFB 2MHAB 3KGUA 1N8OE 1TSHA 5FO9A 1H2KA 4JGYB 2AXGA 2Y7QA 2AJYL 2ICEC 3QISA 4N2GA 1DQDH 1PU0A 4ONGL 2GNBA 2ORXA 2VW7A 3QBQA 3VKOA 3TO2B 5FA3A 4LLFA 4NZRL 3NSYA 3ESMA 4ZAKC 4Z3HA 1PHMA 3L4WA 2NTFA 4FKEA 5F1NA 3N41F 3S7GA 2J1EA 4PS7A 3NACL 1BP3B 1PLCA 2CJSA 1X9RA 2WZ6A 4N2AA 4R96A 2ED6A 1LODA 3FHQA 1P5VA 3ZX7A 5D2NE 3N4MA 1MEXH 2ZOTA 1BDYA 5F9WC 3RGVC 4E0RA 1Z78A 4GQQA 4FFIA 1QRNB 3PUSA 3P69A 1C5CL 5BOZG 4X6CB 1RUJ3 1QFOA 5CAZA 3WJJC 2B1AL 4LCWB 1RK1A 3U30B 2D40A 4ODWA 4XMVA 1CAVB 1HI6A 2EC8A 1NCQC 4HIQA 4XWGH 4AOFA 1N59A 2IG2L 4MA8H 1NCJA 3GLAA 4FP8L 2ERJC 4NKDB 5AW0B 3C6LD 1OCOB 2VSMB 3GYDA 3VDDB 4DP8X 1D4VB 2K6WA 5AYQA 1IO4C 2HKHL 1BLIA 2XWBA 4G83A 2H6BA 1AHKA 3ZKUA 2NT0A 2WO2A 1XBRA 4GW1B 5AVRB 2H1PH 4Y4RA 4PG2C 4CCKA 4BB3A 3Q8AA 1V6IA 2AK1L 2EXTA 2W81C 3GMLA 2PQSA 4PJAF 1QABA 5IT2H 3B9VA 5E5UB 4OKDA 4BHUI 4GJYA 4S1RL 5GSVB 1KJ2B 2DYCA 3ME0A 1IL1A 4YH6A 1N3OA 3V0EA 3SQOH 1N5YL 5DD5H 4BH9A 2JIXD 4BRJA 2FR4A 1WW7A 3LAGA 1LO4H 5DVOA 3HI1B 2ATKB 4U31A 3HQXA 4MGQA 1I3GL 1UG9A 3BZ4B 4NX0A 4C90A 3A5VA 2W0LA 4GSDL 4KQ0A 1H3PL 4LEXL 4CDWB 1ZK9A 3H8NA 3NJNA 4WO4B 4UOQA 4Y5XA 5EC2A 2GC7C 2Z7ZA 5C0JB 1DF0A 4U33A 2UXTA 3DXUA 2I24N 3EHBD 4AEJA 3FUIA 4IBTA 5GLWA 4YXLL 1DTUA 1X5HA 2A7BA 2VL4A 2OPKA 3APFA 1EAQA 4TSAH 4JE0A 3HE6C 1AL21 1VACA 2ESVE 2IDCA 4X8XA 2VSDA 3FB7A 5MP6L 4PVBA 5C07D 2QFRA 3BSZA 5AB0A 4LVHB 4R7DA 3CN1A 3K71A 3W38A 3A6BL 4FNLL 4M6NH 4OZFH 1PX4A 1OAZL 4FXGA 5HXMA 3A7QA 4M8QA 5LNGA 2AS5M 1CT8B 1IC0A 3PNWB 2FGZA 4M7LH 1IGTB 3EGSA 3NDYE 2X4QB 1KFAH 2B1HH 1UZ8A 4OCLC 3ZDYB 1C1FA 1IBYA 1WJ3A 1Y6KR 5GPRA 1QOKA 2GI7A 3BAEH 1OM3H 1Y07A 1I8MA 4Y1AB 1BYNA 2UURA 1UATA 3H7BA 1M6OA 4N8CH 4PRNA 4N2DA 2X6AA 4NZFA 3QEHB 4QKBA 4WTWA 1U92B 4AFDA 2XZCL 2ADEA 1SLIA 2J42A 2DKMA 2Q3XA 1ITBB 4L4VD 3EYOB 5HVGB 5IHZA 4LCCA 3V9CA 4UZUA 3TCXA 5FPVA 4LL4A 3R4RA 3O7OA 5K39B 4D6RA 4XF9A 3MV01 2W88A 1S0IA 1G7JA 1QGLA 3BVCA 2R6QA 4AL8C 4OM0H 1AVBA 2PAKA 4OCNC 4PDWB 3L4UA 4PJXA 4ZDHA 4N8VG 3ARGC 2NQ3A 2QV4A 1U8CA 2DF7A 2R1BA 3LS5L 3IXTB 4OF7A 4QOKD 2NYYD 4AT6A 5JHLH 2J5LB 4H26A 4FXLA 3VXUD 2CRYA 3U7WH 1H0DB 3FBYA 4P9HC 2XN2A 3M1OA 1K72A 4B29A 2XJVA 3WS3A 2XNAA 4A7VA 4K5PA 5K5YA 3KGSA 1I7ZA 6CGTA 4GAGL 4KVCL 4X99A 3QJSB 3S96A 1IE5A 3VG9B 2Y0OA 1YCSA 3SGEI 3LNHA 2IOIA 5LGKA 3ARED 1OTSD 3HI5L 1MHHA 3N9PA 1HNGA 2YMOA 4JQXA 3FTZA 3U36A 3ZKQD 2YFZA 4NQEA 1ZEAL 4YWGL 3TEZA 3ZTJG 3MRKA 4YM2A 4HFWB 1RJZB 3VGFA 5CEZL 3RNSA 4PTUA 1CR9H 3TL5A 5HY9A 1CAWB 4ZUWA 4YQXL 2VERN 2OYPA 3LDBA 4DXZA 5ILTL 3UNPA 4PWJA 5DZ9A 3L2LA 4GWIA 3APCA 2EXWD 4TQPA 3RWEB 4OKVB 3NUKA 1IE4A 2XPGB 4Y4KC 5FGBA 4P9JA 4YWAA 1R17A 3GZAA 1CUOA 4FJ6A 1CXEA 4Y2DA 3QDJA 5GRJH 1W9SA 4Q27A 3DV6A 3EJYC 1WBYA 4LUMA 2R1DA 3KB5A 5DU7A 2AJUH 4PV8B 2HYMA 1FFNB 3L5HA 3U0ZA 3UP6A 3RL1B 1J8HE 1E7VA 1WUZA 4UFJA 3R8BB 4Q1RA 2PR4H 8FABA 2R1XB 3EYUH 2HB0A 1EBAA 1DBML 1AQ8A 3B3QE 5CFDA 5B38A 4AI8A 3R7QA 3PU8A 3BYTA 4PLNC 1CS6A 4IQPA 1EGJA 1LHZA 3T0EE 4NS0A 3UTPD 4I5BB 4HS8L 3NIDB 5B39A 1KIUA 4CP1A 1YA5A 4OQTA 2MPFA 1A7RL 4HV8B 1H2NA 4ZU7A 5LWBA 3BU7A 4X6DA 5DRXA 1XT5A 4W9DC 5DMYA 4FA8A 1DVFC 4XTPA 3RKDC 3H56A 4HK3J 1I3RA 2IPKA 2X42A 4N0UB 1EIBA 2WN3A 4OGAD 5FREA 5SWZD 3IDIA 5DD6B 2ARBA 2NW2B 1CFVH 2HWD1 4BU2A 4K3DL 5EF3A 2BNRE 1S7QA 1G6NA 2VC9A 1U0AA 1TYEB 2J12B 4PJFA 3RX9A 3MRMB 4HWBA 2RS11 4OHZA 3HHRB 3PJSB 1EAOA 5I23A 3OXSB 1FZJB 3TNMB 1I1AC 1QFWH 2R56L 1GP6A 5IV2A 3OGSA 2VMIA 3FQXA 3KPSD 3ZSLA 1T1ZA 3ULUD 2NT1A 2C9XA 4ONUA 3VRIA 2XJPA 3NP4A 4PJCE 1BWMA 3RX5A 3GHEL 2MNUA 3VXSA 1KTKE 5HI3D 5JIHA 4LF3A 5I8TA 3CK0L 1TZGL 1TME3 1ODAA 2JQZA 5JIKA 4QQHA 1YUHA 3II2A 2X2IA 3AG4B 3Q06A 3PGCA 4MD4A 3K2OA 3TZVC 1ZBE2 2H6PB 3SMHA 1D5RA 1U2CA 3KV9A 4XVJH 2HKAA 3O6ML 1YJDL 3CVBA 2K6ZA 5I8KL 1JXNA 5F8PA 1I9RH 1JGVL 4QGNA 1BV8A 4H20L 4R7VA 4MNQA 5BUGA 1OD3A 2OQJA 3OZKA 4K6BA 1G5GA 1G1OA 2I07A 3SPVA 1U8QA 3FSWA 3VA6A 4WV1C 1DSWA 2RIKA 4PIZA 3MF6A 3HTLX 4FRWA 3K2UH 5EEWA 1U3ZA 4QD2E 5J96B 3FO0H 1CXIA 4X80H 5ENWB 1G7LB 2IH1A 3CZKA 1RXFA 5EBLB 4RISL 1JYCA 2MCPH 4FQXB 1CMOA 4O5LL 1GTFA 1MREH 3O1SA 3ZVVA 4MJHA 3GIVB 3HKFA 4M1GL 4S0SD 2G2PA 3P2BA 4H88L 4KY2A 4ACTA 4ZFOL 4OT1L 5C6PB 1RHI3 2ZUVA 5FFOC 1W0VB 2AI0L 3VO0A 1SOKA 4FFTA 3ZTNH 3D09A 4XP6L 1TQCB 3FH7A 2QADD 3GHBH 4JG0L 3TB0A 1SLTA 2V3FA 4JFED 1NBQA 3REWB 1KPRA 1TZOA 4U3SA 3RX7A 3VSVA 4B50A 4K7JA 2FO4B 1J9SA 2VOTA 5AFAA 5E99H 2WLIB 2G75B 4PG9A 1J5IA 1QQDB 4E9RA 1QAWA 1FP5A 1I1YA 1TNFA 3JWOC 2OJZL 4YPGB 4LBEB 2VABA 3N43B 3N9GL 3NFSH 4GXUM 3RWHB 5IMMA 1FX5A 1RLWA 4ZPTB 2QQNA 1ULVA 1ND3A 1Q94A 4HJJH 3K51A 1BFTA 1XGPB 2LU3A 1NFDF 3VMOA 4EXPX 5IJKC 4KK9C 1VKXB 3VVVA 1QOOA 1J59A 2ZXCA 2M83A 3WN6A 3G6AB 4YHIB 1EP0A 2PHFA 1LNUB 4G6FD 4P23A 5KVDH 4Z1VA 4Y2LA 4AIOA 1YFYA 2DBNA 2NMOA 1WZ1H 5KYXA 3P4LA 5INDA 3FQUA 2E9BA 2B4KA 3V9EA 4F15C 5K9QG 3SE4C 2OMNA 3OJDA 4JN1H 4WI0A 1A2YB 2VDQB 1QSFD 4HIHA 5H8DA 4LVNB 3JV6A 3C5JA 2BUKA 4E4ZA 1MQTB 1OF2B 3H9SB 3NCYS 1D2OA 4XMLL 1XGQB 2WJSA 2CIIB 1JF6A 4ALAH 5B3JE 3UK9A 4Q4X1 5GZOC 1IM3D 4PP2B 3KYKL 5F3CA 4ZFGH 3RFZB 5C5TA 1WLDA 1A4BA 1VFAA 1ED3A 4KKCD 5E2UL 3SCFA 3HZKB 1R3LA 3RG0A 5K7PA 3EMRA 5I66A 4HUUB 5IIEB 2NCEA 1L9OA 4OGQC 2UWAA 5KHJA 4GEJA 5CJBA 1LK3H 3LEXA 1LOGA 1BQHB 1L0PA 1KBBA 3MMEB 4V2BA 5DR5L 3UBXB 3I9PA 4CGUB 2G1MA 1UJ3A 3JQXA 4BSWB 3EFDH 3U11A 2A2QT 1JUIA 1YFWA 1XH3A 2KZWA 4JFDE 4MXWL 5IQ9B 2X4OB 4I18A 4PBXA 5CKQA 5C8CC 4HCGA 2WXHA 2Y2TA 3HB3B 2HWE3 3LEKA 5HJGA 4I1PA 3GPSA 3GO1L 3HG1E 1JK8B 1G9AA 4MMZB 4BZYA 1VJ2A 2VUJA 2EIKB 4M4PA 5A6LA 3TLRA 4K3JH 2MQ3A 4PEEA 5I73B 2P43B 1CDYA 2F5BL 1WMEA 4OI9A 5IK7A 1VRH2 3DXAE 4O2EA 2VT0A 2W39A 2FDJA 1E4KA 5CN2A 1EO8L 1PEWA 4XMPL 3U9WA 4R8WL 4PRAB 4WW2A 1KBGH 3C2SA 1AR81 2JG8B 4XT1C 2DQGH 4BRVA 2Q7YA 2D6NA 4LKFA 3FJSA 3R4SA 5CLZA 1M3JA 4FEIA 3QIBB 3PHQB 1UA7A 1W72A 5GGTA 2AENA 1NLDH 4IS6A 5DUVA 1PCXA 4KQ3H 1C1EL 1J1XL 5I9QC 1HRI1 1LR5A 2VTXA 4KL1A 4OLZL 1DQ4A 5JOEA 1IRAY 1M7IB 4GUPA 4XF3A 4HN0A 1B4LA 1IEHA 5FY8A 4YM3A 4LHUB 2XY1A 1UPSA 2NUTB 3HHMA 3QCUL 5A3ID 4RYDA 5EYXA 5FZLA 3OB8A 2OZNA 3BZFA 4BK8A 4K1YA 1FG2B 1PPIA 3CXFA 4FG2A 4W6WB 2DQIH 4ZODA 1BVNP 2NY4D 3C60A 3K2KA 4FXKB 1WUNT 2GJJA 3GRWA 1XBDA 4N8PA 4FCHA 4AUYA 3D0VB 2ZHMA 3P4OB 4CAGA 1ES0A 3AREC 5LCVL 3RQ0A 4AVIA 1CQYA 2AZAA 1FJ1B 4D3CH 4L3EB 4ETQA 4P46B 3WINE 4XDQA 3O2VH 4XNQB 1IAIH 2E53A 3N7KA 4ZX3A 4MZUA 3AP9A 1MFDL 3DXTA 4P2QD 3ARZA 4JLRB 2OW6A 4JGMA 5ANMB 3VM5A 4F7EB 1QX1A 4YW6A 3WNPA 2ZKMX 2EXWC 2ZHKA 4AWJC 4YVSC 1N5AA 4OCRL 4HIJA 1F4XH 5GIRB 5CJOL 2VR7A 3I85A 2ICWI 3O3BB 5HDWA 3IMNA 1XHHA 1WW4A 3TYFA 2VW4A 3BIKA 3V8CA 3CZUA 3BPZA 5DUPL 4N86A 1J84A 2I9LA 4GG8A 3QORC 4R97C 1SM3L 1FBIL 3J7MA 1M1SA 2JTDA 3IT8A 2EIEA 4W9HC 35C8H 3KPRE 1IIIA 3S5LA 5I30L 1UIJA 1YQ6A 4BINA 3PJLA 3MRIB 5L9RA 4X42A 1S9WA 3ZE0B 4C1XA 1FHNA 3ARDB 3FN0L 4UW6A 3LKOA 3J27A 5KVEE 1BXXA 4QTIL 2AQSA 2F54B 3GUTA 1JGDB 4OZHE 5AVYB 5IK4A 4B7KA 3NGBC 2WFF1 2BM3A 4PVMA 1QSZA 3JWNC 2FB4L 2A6DB 5FY7A 1F0LA 4XAWH 2PMWB 4IGOA 2IEPA 5CXPA 2UWEF 4Z3IA 3HQUA 4XOGA 2JB6A 1BA9A 4MD0A 5LB1A 2YAQA 1VFMA 3VGBA 3N5AA 2QQOA 3HNMA 3ZXDA 3HUJF 3ZJAA 1PKOA 3CSYB 3MBXH 1XF2A 4J3TA 4NXSA 4IE0A 4P5TA 5I15L 4GT0A 2NXZC 1WMDA 4EJRA 1UOFA 2OR9H 1TQ5A 4KKAD 4WKXA 5CJ5A 1AH1A 1RPKA 5E8AA 3FQRB 2E75C 3M1CA 4HS6B 4TQEH 4J25A 3ULUC 2V2XA 3F5WA 2TNFA 3WU1A 4LQRA 2WVVB 1GZPA 1X5MA 2OBGA 4HH9B 4P57A 5HI3C 4ELMA 1BZ9B 3TFBA 1S2EA 4I3GA 3AP6A 1CIWA 5FXCH 1ZT7B 5I0XA 1MFBL 4OMDA 2DWYA 4HWNA 2KT6A 2GTQA 5F7KC 3TJEL 1WKYA 1WZXA 3RZZA 3US9A 4Y5VA 1EYBA 2X1PA 5DJAA 4ZXBC 3PL0A 2JNZA 2MKLC 2HX9A 2XUWA 2PYED 4FL4B 4I3RH 3UPRB 2HKFH 1KZYA 4Y9BA 1DCEA 2ZJCA 3U14A 4J3OD 1CTOA 4LPWA 1JN6A 1KDJA 4MNHA 2BFGA 4PJ5A 5CBAB 3GI9H 2NW3A 3ZZSA 1W9YA 2R042 1QI4A 4W93A 2R4RH 4LORA 2XDHA 1DGRA 2ADGB 5ICUA 2QBXA 4OM1H 2DWDB 3QR1A 3GNMH 3WW3A 1NPNA 1PMYA 4UW5A 4YUEH 2HLEB 3NEEA 2J8OA 2G9KA 2H8PA 1MFCH 1SHSA 2H3NB 4JG1H 2HFGH 9PCYA 3H8UA 1RUNA 2DCJA 4G3YC 2O5YL 1FN4B 4TUOB 2IDUA 3VXNA 2G9HA 4YLCA 1YEKH 4AYSA 1OT5A 4UQDA 3PDOB 4FERA 5L0QB 2AQPA 5F0MB 4Z76B 3FMGL 3ESVF 4MASA 3AL6A 4OLLA 5DQ0A 1XH1A 1E8ZA 1CX4A 2DY2A 4P5MA 4BSVB 2OX0A 1HE8A 1KTBA 5C09B 3FB5A 4O4YH 4XN5A 5JQ6H 1S1AA 4AQ2A 2K0RA 3B9KC 2QADC 4OFKA 4CRQA 1KJ3L 3M46A 4TULH 4NOBA 5I1DA 1P53A 5I1CL 4Q0PA 2BVYA 5GHWH 4PJEB 1YFXA 2Y38A 4L9LA 3SCHA 2PTTA 3KD4A 2O30A 1IKOP 4NUMA 4XHJD 3WUWA 3T4VA 3MJ8B 2PTUA 3LNDA 5DD3L 4B5EA 2Z1PA 4MZ2A 3NRFA 5A2BA 2X09A 5FYLL 2BP8B 4LCIH 1P69B 2GNDA 5FAXA 4DY3A 5L6YL 2D31B 4LT7A 1FFPA 4L99A 5LNEA 5E00A 3CH1A 1ZYBA 1IOAA 3L9EA 1AYOA 5JI9A 2WWKT 2V33A 1C08A 4OLXL 5EPMA 2IQ9H 1XNBA 4QHNB 5E9NA 4JKWA 3UAFA 3BI9X 4P3CH 4U1HB 5DJDA 5GXBB 5FY5A 4ZSOE 5F3FA 2YGLA 1W04A 3CFKB 4Q6YA 2CGNA 1Q0EA 4M7ZC 4D9LH 3WHXB 2QPFA 3MLRH 2M8XA 3KHOA 4HKXA 3O1RA 5JPMB 2AUYA 1G86A 2HJFA 3ZKND 3DARA 2C3WA 3ZN6B 3PP4H 3FOLB 4KKCC 3NKGA 1W2NA 2WLJA 3NJJA 1EAH2 3CTTA 2L0DA 3WDTA 2VDNL 4IU3A 5CWSB 4UB0L 1QLEL 3SGKA 3T2NH 4HGMA 4KZDH 2CHWA 4WHCA 3HRZC 1IGCL 4QGTA 4U4BA 1Q9KA 4X5RA 3U2IA 1OF3A 2W80C 3IU3B 4WHTA 3H0TA 2I60L 2OMVB 4EROA 3ZYHA 3JB8A 5BMFL 1A4AA 3RWGA 1BSIA 3O6FC 4OLVH 1U41A 2KDGA 4NO3A 5E9DB 3ULSB 5GS0D 4I4WA 2F17A 4XZUA 4QXKA 4KY1H 3UT0A 3LZFH 1JZFA 2V8LA 3P9LA 1C16A 2W9EL 4I7ZC 4IIQA 1MZEA 4JDNA 3BKZA 1E6OL 4HP5A 1NMBL 3MRNA 4K8RH 1Y43B 1AHWC 3NCFB 4BQ6A 2BOBA 4WNJA 1ZPLA 3PNRB 4PJDA 4OVUA 4AVVA 3KYMB 2OCFD 4NENA 1E5AA 3PS6A 3ZR6A 5BS0B 3Q3GA 4RHV1 3UACA 3OXRA 4Z7NE 2WT0A 1HU8A 3KDMB 5FCUH 4WJG3 1EDQA 2MTPA 4NC2B 2QZ5A 5DEJA 5F1IA 5H2BB 5I74B 4WNQA 2RDQA 3LOBA 4AUUA 1BEV2 4KJYA 1CIYA 4LASL 1H6YA 3B7YA 1XH2A 4M3CF 4TUUA 1NT0A 1T3FB 2PCXA 3B2DC 3H6JA 4BGDA 4HK9A 3KWWB 3AAZA 2ADYA 3ZY7A 2P6HA 3RYRA 1NINA 1TVHB 3BEVA 4TOYL 2GUOB 1FPTH 5DDHB 5KBKA 3MFCA 2VDLL 4L8BB 2WO4A 2DYPD 1YI9A 2QVSB 2P52A 2CGRL 5EXOA 4JRFA 4F7KA 3V65A 4J3SA 5BNNB 4KNSA 1BM7A 3PY9A 2F53B 2O1AA 4FAAB 3ML8A 2J73A 1PQZB 2VGLM 4DVBA 3PJNA 4HUNB 3L3IA 1LU2A 8PAZA 2D6MA 1FYHB 4ZMNA 1LEKA 1HV1A 4QT5B 2DQDL 4CVZA 3V56A 3UTTE 2JKTM 3NQKA 3QRFM 2P4AB 1UT9A 4NFDA 2GBUA 4R6UA 2VMDA 1DZTA 5LRSA 3Q6GL 4YDKH 3BPSA 1ZVYA 4LSTH 5JMRA 1Q9LA 1OZUA 1OAUL 4QRUB 6PCYA 3AFGA 3MV9B 5CKGA 1VA9A 3ECQA 4S2SA 5E2VH 2GI0A 2P5EB 5J7MA 5FYHA 5JLVA 1JHKL 3N2JA 4YFDB 5CMAB 3AY2A 3ZT7A 3RUGE 3T3PB 2DYRB 2FECI 3HRPA 4GO6B 3O0WA 2FATH 4J8RA 2H6UA 5JYMA 4U6XB 5I1HL 1Q1JH 2AJZA 1B0WA 2H9GA 1D4M2 1GICA 2DQCL 3HFML 5FYSA 2PXJA 4JRXB 2LHAA 3ASWA 3WIIH 2ZYRA 5I6XC 1W28A 1JZ8A 3S35H 3CSTA 3PTYA 1WS8A 2FAUA 2QHRH 5IROA 1G1YA 1DVTA 4HUWA 1MFAL 3UROR 1LOFC 1Y4WA 4IE5A 1RUAH 2APBA 4XNAA 3EB7A 3ILRA 3RYKA 2EEBA 1GC1H 2IFWA 5BQ7B 3LKNA 5CEYB 4R7NA 3SCMA 3QQ3B 4AEDB 3AMHA 1ZJAA 1EEYA 2CNYA 2E76C 2A6KB 3MLUL 1ZBE3 1DSFH 2J21A 4JPIA 2TUNA 4PRBA 3ZUNC 4PJBB 3HZVB 2GNMA 1N0LA 2KLSA 3CN3A 2GW5A 1YEHH 4HAGA 3S36H 2X12A 3S35X 4YSCA 3UG4A 1DL7L 3RTQB 4E41D 4EI6A 2WQVA 3OKMB 1E9PB 1MFUA 1BQLH 4G2AA 3AM2A 4S2GA 3RQ3A 1NLSA 3NSFA 5F88B 3X14A 4JO3L 4KMLB 1JPEA 4PW4A 4YGDA 3GLZA 5I2IA 1CXLA 2F7IA 1JDDA 4GRWF 1UXSA 2JDUA 1Z9LA 2E27H 3LRSA 4GRLD 4MAYD 3MBED 4TF4A 4DERA 1JZGA 2EYSB 1GZHC 4NHCH 1DBAH 1HDMA 4EUPG 4PY8I 5AAWA 1D6EA 5AAMA 4PIYA 1E5YA 3EOAB 4LOEA 3IMMA 3SDXE 2CBOA 3BO8A 4MJID 5IW6B 3MOQA 4NHKA 2EYRA 4N53A 1UZ6F 1QHDA 4F8QA 1T4KB 1QPPA 1YEJL 2CK0L 1I7RA 5TGBB 4JQTA 4CA4A 3HI6H 1X9UA 5LQBH 3DO4A 3AYDA 2R0LH 4CSSA 2OXGA 2DWRA 2CO6A 4OQ9A 1NOVA 2NY5L 4AOCA 1M1XB 3WP3A 3ULAB 5IFJB 1SZBA 3DVIA 5K9QI 3QDGE 3DUUB 3O2WH 4ZFQA 2VDRB 1XSIA 3Q5TA 4CDXC 4IK6A 4D9QE 3TN91 1SOXA 5EP9A 4C8XA 4AI1A 3DPRC 2QVKA 1NGWB 2ETEA 1RJ7A 1RSYA 2AK4D 3VQLA 1BLZA 2FRGP 4UQ9A 3DIDA 3L5WB 4XN9A 1SBFA 2IOOA 1SJEB 5TQ2L 4EMZA 3VXUE 5B8CA 2CDPA 1EV13 3S4SG 2JECA 2PFWA 3JBG2 1Z0HA 2J1RA 4IUGA 1LQSR 3L4VA 3MO1A 4QDRA 2EJ1A 2EXYD 4QT6A 1SFPA 3GJFK 2YC1A 3CHPA 4N87A 1ONQB 2BOCB 1CICA 5CIRA 4I09A 4LSVL 5FUIA 4Y1YA 5TDPA 2AVGA 1WCQA 1H3UA 4A3XA 1XTLA 3PXLA 3RY6A 5CD3B 5D5ME 5EYYA 1S7RA 3TIDB 2WWJA 4OU3A 4JAAA 3LMJL 1Q8SA 4BUHA 2YGVA 2O6DA 2OTPA 3FFCB 1KZQA 1FMD1 1XQNA 3VB8A 1QPKA 3DJTA 3OX8A 5IMOA 3WIFA 1NCCH 3SYQA 4XCBA 1U8LA 4XZPA 4YDJA 4BFBD 4PIBA 1FE8H 2JXMA 3LXAA 4Y7OC 4IRSB 2QDRA 4XXDA 1R6VA 5D2LF 3BW9A 5IB2B 2C7UB 3SDDC 5FP4A 3GLEA 3DHJA 1QRNE 3JT0A 1PX3A 5HJDA 4GXVH 1KB9J 3KLSA 1H9WA 1W3XA 2HBTA 5EHDA 1HWGB 4L37A 4X6CE 3T0VA 5FPZA 5ERWB 4WM8B 3CLEH 4IV1C 5DAPA 2VLKD 1M2VB 3OPZH 4LCWE 3O4LA 4ZBJA 2LTQC 1CTMA 1UB6B 5H94B 4CN1A 1HN1A 1AGEB 1BF8A 5JO5B 4JKPL 5FP9A 4DP0X 1A7BA 4U2YA 4U1GB 4X6DF 5EU6D 1WFMA 5BQDA 5JZGC 1XZ0B 2OLDA 2XOMA 2WGXA 5TDNA 3AZUA 3OG2A 1O3TA 3SDAA 1FGVL 4PCSA 5HGDA 4QB1A 2QQLL 3ASOB 4EBQH 3TVMA 2GCYA 3NMEA 3QDMA 2YEZB 4JO1H 4P2OD 5D1QB 3B2VH 1GGBL 4JCMA 1W9TA 4BFFA 4ETYA 1YXWA 1C4RA 3GSNB 4JDVB 5DCCA 3ZIYA 1XCXA 5FQ0A 4PJFF 3ARPA 4A1RA 1FAYA 3NSJA 5E8OB 2EVFA 3KR3H 4DQAA 3JSSA 3IEAA 2M1KA 5IHUH 2P26A 1LTXA 2YQ3A 3KLDA 4ANXA 4XO4A 4AYID 2HFFA 5IW1B 1QW9A 3NCYP 4UMGA 2DQMA 2C5DC 1TTRA 2IQAA 4GAJL 1HHJA 1IM9D 3WHE0 1NA1C 3G5YB 2WKOA 1RU9L 4XC9A 3O6KL 1P4BL 4M7JH 2AZUA 2HXAA 2ICEB 4OSUH 5EF0A 1T7YA 2CO2A 3AW5A 3BUPA 3NJVA 3IETB 4UTAL 1QTYT 5JHBA 5C70A 1C1LA 1DJWA 5GS0C 2YPDA 3AQXA 3UL4A 4YVNA 5D6DA 5JR1L 4G5ZH 1XCWA 4N9GB 1G9MC 2GYSA 4U7MA 3U6RB 3R4DA 2ET7A 2JWPA 4HKJB 5FK9B 1OFNA 3BH9A 4FI8A 2OAAA 1ODNA 3V64A 2IXKA 3PHSA 1KTLB 5HXVA 4PJ9D 4YZFE 4PI0A 1OANA 3RIAK 4NT6A 4RA3A 5H4ZA 1OWRM 5FV3A 1RUKH 5FXXA 3AYEA 4Q4V2 2QCSB 1NCQB 2OXBA 2ID4A 3LQAL 4M93C 3EOBA 4RBPH 1BIIB 3GMPB 1UZ0A 2BS8A 5T3XE 3CFQA 3ZDYE 4QPIB 2P3JA 3VXMA 3BJLA 2VZ1A 3MJWA 4BK5A 5HBAA 4O9GA 3BVNB 5FYKD 1JZ4A 1IC1A 3BAYA 4NNYA 4Y1AE 4UOW1 4XNUL 5JCTA 2GSIA 5KJRH 1BLNB 1TJHL 3GJEB 1IS6A 5FZHA 2JCCB 2O14A 2WZPA 1GIGH 1RI8A 2BP3A 2L8AA 1UY2A 1HXS1 2KI6A 4FMKA 3WE1A 3Q1SL 5DG2A 5HDBB 3PXHA 1P6FA 2FVNA 3BKYL 2KA3A 5DUML 1Y9GA 5IVZA 3BUYB 1YN7A 3WOGA 1U4FA 4LIVA 3D18B 1UM4L 3V8OA 4DGYL 2BWAA 4I2XB 3MV8B 4U7SA 5C0EA 4WEBL 4U36A 5JUVA 1O4TA 1H6FA 4Z2AA 3GGWB 3FUKA 2ADFH 1B4TA 3MZTA 4MDRA 3VD4A 2KERA 1KXVC 1NANI 2QGBA 3WKPA 3T9WA 3UABA 2G3ZA 3S0PA 5ICYA 2VR4A 3V4LA 1LDSA 4I87A 1Z7S3 4WK2B 3R4UA 4E27A 3V0FA 4WFHD 4MSVA 2EVXA 3UZVA 4PREB 3WE6B 2ZABA 4QX8A 4AAXA 4HZ1A 4XGZB 1ZE3C 3LKSA 2DD8H 2DTSA 3HE6B 3V52L 4ZNEA 4ZQTA 5IREA 4GQ7A 3VBOA 2YZ8A 4N2FA 4JM2A 3OKOB 3SY0B 1VADB 3U4BH 3MLVL 4FVVA 3QACA 4H8QA 4LT5A