3ZMNA

Vp17, a capsid protein of bacteriophage p23-77
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
233
structure length
228
Chain Sequence
b'AAVQVGGWGFAWIDNEDFSPTGLAWRSGEYFALAQMKTPETAHFRIAAQERRLRIYLRGQKVVNGRNLSDPDSRTVNLPFLMQTPQGAPTLPSTYHPDVAVWAKVGSTWQPCVITAINYSTGDVTFTEPAGVTASDGIEIYYVHGDGQFRLRVARDDSAATVFNQSFSTMHSVDQNNVETMIAWPQQVELVPGTRLVLEVFTTQVPMVWNERSGHYIQIAAMGRRIEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP17
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
total genus 49
structure length 228
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zmnA02
2.60.120.1170 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zmnA01
3ZMNA 3ZN6A
chains in the Genus database with same CATH superfamily
5LY2A 4ODTH 1DEDA 1G7PA 3HNSL 5F70A 2Y64A 5E1GA 1UD4A 5JZ7D 4AVVA 3ELAT 5I19L 2GIYA 4PJEE 1Q9LB 4G42A 1U91B 1SLBA 4QQLA 1MW0A 3ULVF 1AX2A 4QXWA 4TYUA 1E4XL 4WM8C 4KJYA 4GKSA 1BPLB 1EFQA 4FRWA 4UILL 5BZWB 4D0BA 4OIIL 4P2RE 4PG9A 3APNA 2HVJB 5IB4B 2N1KA 3WJJC 5DC2A 4KFMA 3RAJH 2WBWB 4L5FL 1C5HA 3AXEA 3B2UC 3ORJA 3ARQA 3IDJB 4BA6A 3S3JA 1OY3B 2VXTH 2WWJA 2OKXA 1IGCH 1SN0A 3AUWB 3ML8A 2RIKA 4ZS2A 1U3NA 3LQAL 4XPBH 4ZK8A 3W38A 1XF3A 2QL1A 1R4XA 3DSFL 3CSBA 5C7ZA 4DVBB 4YHOL 3VXNA 1WD9A 3CQQA 5BRZD 4DVRL 3GXTA 1HH6A 3MLYL 3ZPOA 4DPRA 2AITA 3RRQA 1A6CA 1ZHLB 2IDFA 1V9U3 1NEZA 3QPXH 4XVJH 5DI8A 4QRFA 3HRZC 4OHZA 5IJCC 4PRPA 3TVMB 3QG6B 1QSEE 1FL3B 4WHDA 2NY6C 4QRBA 3BZDA 4UW6A 3W1ZA 3DC0A 4XO8A 2WT1A 3UTTA 1XGQA 2ZP0T 1JK8A 2APTA 4U1IA 3BVTA 3H42L 3UZVB 2GAUA 1NCDH 1FZKB 1Z9MA 1XBFA 1QVOA 2NMSA 2ZHNA 4CDWB 5IWLA 2JJTC 2AEQL 2JIGA 2WUHA 1Q0EA 2PPAA 3APFA 3C7OA 1FUNA 1HH9B 2R8SH 4HIPA 1T1XB 3DTDA 6PAZA 3ULVE 2K0GA 4XO5A 4X5XB 3MRPA 1JV2A 1JI2A 4HGWB 3CFJB 4LQ1A 1Q4NX 2WIMA 3R4DA 5KYWB 1JDDA 3F6IA 1GR7A 1HHKB 1MCIA 3W9AA 5D70L 2PW2B 1RUF2 4KRNA 2WABA 1J3RA 3LA2A 4HKOA 1OAXH 4KUZH 4OZGB 5FLJA 3PURA 1RXLA 3IAQA 1KEML 4YSTA 4S1DD 1IBFA 2X4QA 1KACB 3GSWB 4WEEA 2PWEA 1VADA 3RP1A 4RDQG 2K7PA 4P02B 3MZHA 5DJ2A 5CGYD 5JO5B 4FQXC 3S7GA 1DBBH 1HZHH 1WFTA 2GTZA 3VXUE 3T6VA 4Y4HB 4U1JA 1DDHB 3DETC 5L2KB 1BAWA 1HNGA 3RTQB 3MPBA 4NERA 3MR9B 4NPRA 1YUDA 3DRQB 3LPGA 3MACH 2R2HA 4Z95H 3SDXA 2AJXL 3J07A 1T6GC 5LA2A 4RMUA 1IPKA 3AP7A 4W9JC 5C0BB 4KPHH 2R59A 3QIBA 5EB9A 3OBTA 2E63A 1U8QB 4YSPA 3KB5A 5BO1H 5M7QA 1UNBA 4P00B 4KJWC 3FB6B 5FKBA 2B3RA 1E43A 2C4XA 1D5RA 2QSVA 2WAHA 3M17B 5HYFA 1AR83 5ANHA 1MHEB 4UIKH 4D8OA 5C3IA 4Q14A 1HV0A 5F88A 3DJTA 2KR2A 2J4WL 2X9ZA 1TCMA 2ZEWA 4KVNH 1KYUA 2YMTA 2VUAA 1GZQB 3L4YA 3IRZA 3I6KA 3BP4A 5HJDA 4DWHA 4MLSA 5INDA 2BSEA 5F7FA 2UX6A 3FHAA 4N9HA 3WUZA 4G6KH 4QDGA 5A1LA 2HH0L 4R0LC 3HE6D 1QNZL 2DMHA 4P23B 4AITA 4PVLA 3R7RA 4C56A 2WLPA 3QQDA 4WTZA 2GABA 2VXQL 4JPWL 4V2WA 4KI5D 3ZE1B 1G7HB 3GPSA 3ZX1A 1GA2A 1WTGT 3LN5B 1NX9A 2BU9A 1QPXA 2DMKA 4QHNB 5TE6L 3T2NL 1XAUA 1JUHA 1G9BA 4IBUA 1BG9A 5IK4A 3D3VE 4Z77A 4MQTB 2RS31 1BEYL 4DGYL 1XIWA 4LLQB 3IBMA 3BVUA 1CL7H 5BVPH 3E2HB 4J5VA 1LO4L 5C09B 1U3JA 4RWYL 2P1YA 2DWRA 4IBYA 3SH5A 3USUA 3I2FA 3VD1A 1CXKA 3REVB 2Z8RA 1UU6A 4YWAA 3VD7A 3ZY7A 3TF7C 2R062 3FU9A 4OH2A 4MJIE 3C5JB 4PJBF 3LZQA 4HJTA 1CFSB 1JTTA 4JFDB 4TVPL 3UAFA 1KLGB 3BI3A 4UV4L 4Y16D 4Y5XC 3C8DA 2VH5H 1JXNA 3ZXGA 5CZVH 1ND0B 2ZHKA 3AKQA 4HZLA 2ALAA 2R2EA 4HX1B 3UKVA 1DGWA 4HUKB 3RNSA 4CU9A 3BTYA 4KX9A 1PSKL 2GITA 3BRDA 4DKTA 1HRI1 5JQIB 2QQOA 1OSZA 2XKOA 4WV1A 2VBPA 5CWSB 4ZJ9A 4QRPD 1NGQH 4FL4C 1G9FA 3OBAA 4QR7A 5KYXA 1VB2A 4LK6A 2NCEA 3PJQA 3N40P 3Q8AA 5FDWA 2Q8CA 2OYKA 1KB9K 3VZMA 4DEQA 5FYJE 1YLLA 4CCNA 4RDQF 4UBDD 4LKEA 5J36A 3MNVA 2XJSA 2JG9B 2VITB 2VQUA 1NCAL 4NT6A 5LDSA 5K9YA 5CD3B 1G7JB 2ZNWA 4JY5H 1WS8A 2WFF1 1C5CL 4Z0BL 5IT2L 1R092 4A2FA 5IP4A 4CU7A 2VR9A 4ZS3A 1A6TB 1SHSA 2D4FA 4S2GA 4W8JA 4QRQA 5KSAA 1L0YA 2IADA 3QHZH 5D4HA 1ONAA 3WVJA 3SGDI 2PPCA 2M8XA 1QF3A 2ADJB 4AI2A 4N86A 2IPKB 2BRTA 3UH8A 3KV9A 1I85C 5DA0B 3VRJB 1NKRA 4R4FH 2PAEA 3BPCA 2XQBH 7PCYA 1MG3C 1MFDL 2AK4E 4V2CB 4UQ2B 3FU0A 3EGDB 1TVBB 4FDWA 1JHNA 5FUOL 4JFOA 3DKWA 4Z07A 5C3OA 1MLBB 3PP3K 2Q76B 3W0WA 3U9PH 4NHXA 4LO9A 3C3VA 2BOBB 5KANI 3AMQA 4NCC1 4XZUA 3VRIA 3WV0A 4I01A 5IK3B 1PL3A 4G6AC 1JDAA 4GIAA 2J5WA 3KBHE 4WFHE 4K94L 3G5XB 4H0IA 3B8YA 1CYXA 4Y20B 4OZIB 4N53C 4KDVA 1SLAA 1K6QH 4XBPB 1ZT4A 1MOEA 1P84K 1AR72 3GRBA 2IXQA 3MIGA 3LNFA 5LY1A 2CLRA 3NSJA 4HUXA 1NCIA 2Q1ZB 1A1NB 3M3EA 1ZRRA 1KELH 4PWJA 4UYPA 3IDIA 5CCJA 5EIIB 5LBBA 1MCQA 1S7UB 4P2RD 3TFKD 2XJVA 2H32H 3BZFB 2R0FA 1QWRA 3P3SA 4AY0A 4AM0B 5AL8A 3BLBA 1FSKC 4ODSH 3PWUA 4JO2H 5DRWB 3CHXA 3DX8A 2VR5A 2ICWA 4ANKA 1AZCA 4YSQA 3LDBB 5EEYA 1PGRB 2CDEA 3SODB 1WWYA 3RVHA 1DQDL 4YSRA 4WO4C 2GK0B 4HCGA 5ABJC 1GC1C 1S7XA 1NQBA 3D34A 4OKVA 4I0WB 2XNAA 3BKML 2IGLA 5DK0A 2XQYG 1ZVHA 4NDMA 2D0FA 4HVBA 5T5LA 2BZ7A 4AGGA 1QH6A 4XUQA 1OVZA 4MKTA 4A7TA 5IOKA 3HRPA 3HFML 4Z3FA 4P4KA 1H5BA 4LRNH 2R1WA 2CIKA 2F8IA 4KHXH 1FZJB 2QR0A 9CGTA 5FY8A 4NQTA 1WIUA 3PFQA 2CUHA 2X4TB 1RZGB 3KCWA 4WZFA 3O8XA 1C9SA 4XHBA 3VBFC 3B3IB 1JHTA 1CI3M 3KPRA 5MENA 5KYNA 2KM2A 5EP9A 5C3PA 4X4ZA 3C6LD 4Q6YA 3ULVD 3NH7L 3NPSB 2YPKA 5E6UB 4AEIH 4W9HC 1MWAH 2HX8A 1G9EA 4AHYA 3Q2LA 3QXVA 1FLTX 1A0QH 4O9GA 2WAAA 1W2AX 3CJIA 4C4KT 5FK9B 5GRVK 3JWOH 2ZX8A 3VTAA 2HXAA 2CBPA 5ILTL 3NRUA 1AZVA 5LQBH 4QX2A 1O0VA 1U3HC 5EF1A 3FTSA 1DYOA 3MJ8A 4R97C 1SZNA 5TGBA 4M8UA 2E8YA 5D1ZB 2A9NH 4MMXA 1GQPA 1UASA 3DVGB 4PP2A 3BT2L 5DS1A 3ZN6A 5JHLH 5MEOA 3H7JA 4MJ2A 4JFQA 1W28A 5MEQB 3K6OA 4QHOA 4JAMB 1NBZB 5LB1A 5CIRA 5FKCA 2VY0A 4G5ZL 1KEGH 1A9BA 2C9VA 2UWEA 4BQCA 4PGCB 3VXUD 4L4VB 4WDIA 4UTAL 1QQDB 5IM7A 3JD73 4NE9A 1AR62 3NJYA 4FXLA 1LQBC 2BZCA 3BOWA 4HPOL 5C0CE 1KCRH 1UT9A 1H6EA 2OXHA 3GSRA 2VH9A 5C86A 4J25A 1ICTA 4F7MA 2KKQA 1K4CA 4NZ8A 3EYQC 3ZE0B 1XU2A 3VKFC 2TSAA 2VMCA 1DVYA 1F11A 5H35B 3BQUB 2YHGA 2CM5A 2QQLH 4LULA 2HCZX 2WKOA 1LHUA 1M05A 4F37K 3OGRA 4H1LA 5GGSA 3V52H 1BQSA 2VVEA 3U46B 3GJFA 3ZDSA 1IRAY 4WTQA 3VV1A 4Q74A 1RUG1 2AK1L 1REFA 5HXMA 3AT8A 4WUUB 4BQ5A 3N42F 1W04A 2KQMA 1MQTB 3PCYA 5ALBL 3O3DA 1YMMB 2NY4B 2VKXA 1AR1B 3OY8B 4MZ3A 3P30H 2FEJA 5IVXF 2P45B 4LFHG 5FP8A 3VM7A 2XH6A 5C3RA 2HLFD 1O4ZA 4YUEL 1KY7A 2UYBA 1A2YB 3GMQB 1XB8A 2ZXWB 2VL5B 3UTOA 2XG5A 2ZG1A 3O45A 3SQBB 5CJ5A 3GSQA 5CGMA 3SYOA 1RZJC 3GIZH 3RDIA 1NJ9B 3D3VD 1XH1A 2ZSVA 1POV3 2R2BB 4MAUL 3BB6A 3LEIA 4M7KH 5AYTA 4ZPTB 5E2WH 3EHBD 4GY4A 2C1FA 2HWZL 1HQRB 2WC2A 1S7VA 4LCIL 5DJXA 1KBPA 2AS5M 1EO8L 3FCTB 2HEWF 1DL7L 4FN0A 1DZTA 1HCVA 4WHYH 4XO3A 3OKOB 1S78D 4I5BA 3HLAA 2DWDA 1TLKA 2H6OA 4AZ8A 3RVXC 2AXWA 2KH2B 1NBQA 4GP8B 4TUOA 5I9QB 2TRHA 2DUPA 2W0FA 4QNPF 1GYUA 4NBZB 2AJSH 4DIQA 4XCFH 2PLV3 3MIHA 4K7PL 1E27A 4R90L 5HGBA 1U8MA 2RR11 1N1VA 2PF6A 4AH2A 2ICEA 3J7MA 4G3YC 2WINA 1SYSA 3GZOA 3NABH 4P9YA 4OQ1A 5INCA 5HY9B 4OHXA 1F5FA 2V5DA 3CH8A 1LP9F 4LBJA 3D0AA 1D5XB 4MRCA 1EJOH 5IKCA 3IDMA 3S36X 4GAZA 1MHCB 5I6XC 1ADQL 3DVIA 4C8XA 3FFDB 1IEAA 5A7QA 3FQUA 1T04B 2UUDK 2HX9A 4DXTA 3OXRB 5MP6L 1II4E 3KM2A 4Y0GA 4APQA 3WDTA 1ZWIA 1H8LA 4IRJA 1ZA7A 4PCSA 2E6PA 2ZXQA 3QUZD 4MCYB 3N06B 3TT1L 2X0VA 2C5DA 1BQLL 1TVHA 2APBA 4Z0XB 4IEXA 5ID1A 2IWEA 1DFBH 1QLEB 2AK4D 2RBLA 2WXLA 3J27A 2UY7B 5EV7A 4XMAA 1QBLH 4Q6KA 3NJZA 1EJ6A 1E4KC 3L4ZA 1N59B 3MRQA 5FREA 4P59L 4NRMA 1KB5B 2FJFA 3P73A 3VHRA 2IFFH 2D3NA 3IETA 3RVWC 1FGNH 4QNPE 1F2XK 4MD4B 7TAAA 3QDJA 5KVDL 1UW8A 5I8OL 1DQ4A 3UAJA 1I7TB 2GEEA 4A6YH 4AQ1B 4XTMA 4LOEA 5AVZB 2XBZA 3M7AA 2BNUB 5I0RA 2VSDA 4QYAA 4H7LA 1PLGL 4XNXH 2VR4A 5ISZE 2FJGB 1LP9E 2DF3A 1MI5E 2FCVA 3V0VB 3QDGA 1JYVA 2CJTA 4F20A 4PJ7B 1WHPA 1OOPA 3N85H 4PWFA 5HHXH 1FHNA 2ED8A 3TEUA 4QHUB 4BFFA 4EJRA 3MBEA 5I93A 3TA3B 4IRZH 1RIUH 3QCWA 3HHRB 2WLNA 3THML 1NGYA 1CGXA 4JR9H 5D1QB 5JHDE 4ZNEE 3WG7B 3N43F 1RUC1 2I5YH 4XXPA 1AQDA 1D6VL 4XOBA 3B00A 4G9FA 1P5UA 2X6CA 4V1DA 1Y6KR 4EI5D 4KITB 4UM8B 3INOA 3HB3B 5F0PB 5FOJB 1A7OH 5BPPA 2Y3AA 3ARXA 1BYHA 4PDWA 3A4AA 1R1A2 4URTB 4AYDC 1DVFA 5C8CB 4EMZA 1VBE1 3VGBA 3QI9C 4G7RB 2MSPA 5B39G 4JZJB 3V4VL 2GJZA 5ECGA 1AHWA 3HE7B 3RKDC 4TSCL 4ZFOL 3O3EA 2HWF3 2RS53 5LZ6A 2GHWB 1KJ2H 5IFJA 3DA0A 4E8DA 3RZZA 2D3VA 2YBGA 1MLCB 3I2GA 2Y2WA 4M8QA 3P77A 2J1WA 4UF0A 1NPJA 4OAWB 2AXHA 2KDGA 2WO2B 3O9WA 4HUVB 4OSUH 1ZXKA 1AFVH 3M86A 1SVBA 1S5HA 5FYUA 4YXKH 1FYTA 4BFKA 3HKZA 3MLRL 1OD7A 1KLUB 3NSCA 2ZP9A 5F7NC 2VDQL 1R1CA 1V05A 1QBMH 2VOKA 1A21A 1QX1A 2B8OT 5ESVB 3T77B 2OQJA 3ETBF 3VZLA 1S5IH 3LS5H 3GM8A 1RK7A 3H9SB 1QASA 1J48A 2YA0A 4ZAKB 2Z1KA 1N6VA 4JO5A 1MS3A 2YG0A 3VVVA 4LF3B 4JTOA 4BU2A 2C9XA 1JPFA 1MZ5A 3CSYA 4PLNC 1CICB 3VWKA 3S3SA 4UQCA 5IBTL 1A1OB 1S7RA 2QDVA 4HV8A 3NG5A 3UJIH 1KTLB 1Y9MA 1UD3A 2BWIA 2DMGA 4Y2OB 1G5GA 1H9PA 5HP5A 2P3IA 1ZHKA 4X6DB 3UP6A 1AI1L 1VSCA 2IVJA 1AXTH 3MN8A 4CE8A 5E94A 2EO7A 5C08B 2Q3XA 2OTWA 4PJAE 2W1WA 1AQ8A 2EALA 2W9XA 3EOBA 2NY1D 2FWOB 3VH8G 4HUUA 5C0CD 1ULFA 1EVTC 2JNZA 4RFEB 1AL0G 4MGXA 2ZUXA 1FZMA 1BXAA 2A1WH 2WV3A 1U3ZA 2YBRA 2BDNL 4Z7UF 1AR2A 5KJ4A 5EU4A 1WZAA 3K1KC 2YPLB 3L4UA 3PRZA 4ZS6C 3TNMB 4GG8B 1YEJH 1V7MH 4PJGB 2HWB2 4TN9A 4V2BA 2W91A 5FPXA 3K2UH 3L17A 1KD7A 4NO2A 3SN6N 4FQIL 3ULVH 4OFDA 2WN2A 2XFGB 4XP4H 1C8PA 4H0LC 1D6EA 5IESL 4RFNC 4CP1A 4BYYA 2ARJQ 2FSEB 2JXMB 4M5ZH 4PJXE 3B7YA 1KG0A 3IKCB 4MGIE 2B7DT 1Q9WA 3CZUB 4LSQL 5BYNA 5JZGC 4L1BA 5G55A 4KZEL 1MEC1 5T1LA 2YA2A 2EE2A 4CDUC 1FE8H 3I9AA 5FZLA 3ZM8A 5JNYB 5AW6B 2RM23 4CEWA 3T08A 1FPN3 4E9SA 3UKTA 1SBBA 3CQFA 3MOAH 3REWA 5C6WH 3BIAX 4FX5A 1OA2A 3BVWA 1LWJA 3ARGB 3J8F7 1ACYL 3P4MB 5EIYB 3MLVH 4M7ZB 4Q9RL 1CUOA 1OAZL 2IGFL 4NHUA 4LEOA 3O6LH 4HEME 5C1MB 4YFLI 2P26A 3MCLL 4KGLA 4XXDB 2V5YA 4GO9A 4L3FA 5DJZB 1EPZA 2F19H 4NO3A 4YM3A 3F01A 2P5EB 1GHFL 4Z7UE 2W07B 1CQYA 3TPKA 2FL5B 4XXAA 4MFHA 4NJAL 5F3IA 1UQXA 4P5TC 3JTTB 5A3PA 2AQQA 3AG4B 4IDJH 4OD1H 4ZNCD 5I76B 5DEZA 1PIV1 1YQVL 1WMEA 4HHAA 4RFT0 5DD0L 1Q94B 1HE7A 1DQQB 4FLRA 3AXHA 5C0AE 1IPSA 3L5JA 1MY7A 1QTYT 5EZIL 1ONQB 3UTZA 1AQMA 1DDLA 2PCFA 3QUMB 3TCTA 4YSDA 1J3PA 2C3XA 3SCMD 3VB8A 2HBUA 1AP2B 4LASL 1KNOB 1MNUH 3ES4A 3F62A 3RZLA 1NCJA 4TUJB 4YFDB 5J48A 4RRPM 5BXFA 4UTCA 2FX8L 5CBAA 2J1AA 4OJEH 4NZUH 4LA3A 3MZTA 5BNQA 1OAYH 4UIMA 2VW4A 4HXBH 3G6JA 1RUD2 4HZAA 4AHZA 4AXWB 4C83B 3ZFGB 2UZIH 3RX9A 4K07A 3FQTB 3WEOA 1QJY1 1WWAX 3SLIA 3JWDL 4KNTA 3EOTH 4WO0A 3WTUA 3FMGA 4YXLH 4XMIA 1S9XA 3LH8A 3MRJB 4QWWC 2GMMA 2A9CA 2GH8A 4C90A 3TZVC 1E6JH 1XR9A 4HIQA 4NP4H 2EC8A 3UEZA 1HSBA 4FPFA 2CRIA 3KYOA 2XPGB 3MW4A 4HC1H 2BPBA 3ETBJ 2WBJA 1R082 1E5UI 1NA1A 4IIZA 4YBLC 3QS3A 1JWMB 1RJLA 5E08L 1CFVL 4MA3B 3UTPE 5IB2A 2JJSC 3C87A 3DXAD 4Z3EA 3IU3B 4KAQH 1D4VB 2JE7A 3PL6B 4E9LA 2ATKB 3ZYJB 5JXEA 2FRGP 2VCOA 3ZXJA 3DHUA 3QO1A 1NIEA 2A9ML 4FQCL 2BBAA 1QD0A 4GAAA 2CDPA 2F54A 3PLQA 3X1BA 4CCEA 1W9WA 1DSFL 3OF6A 1EO7A 5EBMA 3GBLA 1NM9A 2HRPH 3MRRA 5ISZD 4DTGH 2ZACA 4LBOA 3MLZH 1YQ8A 2VXSL 2MOGA 3WHXA 3BUTA 1MI5D 3GBEA 5FYJH 1KPUA 1QFOA 2QVSB 3HIFA 5DDJ1 2Y0OA 2VTXJ 1O6SA 4TQIA 3FCBA 1H3VA 5HHME 1BMV2 4XBEL 1UWGH 4L1HA 5GRXG 4UOZA 4KU1A 4DGIL 5FZ9A 3AREB 2BX5A 1F4XL 1RXFA 1LO2L 1M2VA 3EYOA 3FO9A 4GBXA 5I8KL 3GZEA 2WP3T 3DVNA 5JQ6L 3WG3A 3PMEA 3GSNA 3TH3T 1JUFB 1P2CB 1Q90A 1Q1JL 2Z7WA 4ZMLA 4AEJA 3WR0A 1YMHA 3VGGA 5D8JL 1R3IL 5CO1A 3ZBMA 2K4AA 1SF3A 3VSVA 3B2UD 2I9LB 5GQBA 3S3BB 2COQA 5JXGA 5FBZA 4ZUSA 2NMNA 3KE0A 2RQEA 3OLIA 5HI0A 5EWIH 3OSVA 5E8OA 1J9QA 1U6AL 5ADPL 5CJXA 3A0NA 2H3NB 3QARA 1HINL 3NAPA 5C9JB 1GWMA 1OHQA 4KKNA 2VIRA 2VLJB 2PTUA 2VLME 4ENEC 1LQSR 4HFUH 2NUPA 2I9TA 4XFHA 3MICA 2DCJA 4MAYC 4FG4A 3AROA 4Y5Z0 3T1WA 5I0TA 3OQ3B 5IROA 1C8M3 1L9NA 2PYEB 4IBZA 3PHOA 1QOKA 2NY6D 2Y34A 3TT3H 5EF3A 2HYXA 4U1NA 1J9SA 4LFHD 3F04A 4XNMB 5I1DA 1ILUA 4FQQB 1JDCA 1KFAL 2C7UA 2FE0A 4GSDL 4EN2A 4NUMA 1OKQA 5LNEA 1WA6X 2Z8SA 3PWLB 4RS5A 3N9GH 1UZGA 4HPYH 3FCUB 1W91A 3FKUS 1OT4A 1QI4A 4YHNA 4PBVC 3BZEA 1RAMA 3GTNA 4LLAA 1RK0B 4YM1A 5EWSA 5ID0A 4QO1B 4F91B 1RHI2 3M7OA 1BFVL 4AV4A 1O6TA 1RMU2 4FHBD 1IARB 1LODA 4QPEA 1MCDA 4JO3L 4ZXBB 4KG8A 3D0LA 3RZCC 3O11A 2XY2A 4JQXC 3SGKC 4AYUA 1I7RB 4WK4B 2YQBA 1QEXA 3W9DB 2XDHA 2RS33 2BCKA 3VD0A 2J20A 5FZAA 3O6KH 1RULL 2R1BA 1CXHA 3NCBB 2ZWSA 5JA9A 4QI3A 3G5ZB 4TM9A 3DPRB 4GXVL 5DRXA 2VC2H 2WNVC 3HAEA 2BP5M 2Y5QA 3AWFA 4M48L 4M93B 1WTLA 3WXWL 4PRPE 3N9QA 3QDHA 4N6RA 1NIFA 1WCQA 5GS1A 1L5GA 2BVQB 5DYOB 2A83A 3FN9A 1I5ZA 1SYVA 1RUE2 4AOCA 1S9WA 4M1GL 3SDXF 2CJUH 1TQBC 4UUJA 3PREA 2LW8A 4AG4A 3DETD 3JZVA 3UO8B 5CMAA 3BOVA 2NNAA 3H9HA 2NLJA 4M00A 1PO11 1NFIA 1VPHA 1IAIH 2P80A 1TNRA 3WKMH 1U12A 1HRI3 5HDBF 5FV1L 1OF2B 5D6CB 2Z6FA 1GNZA 4LE4A 3MCKA 3O41A 1V7NH 3GT6A 2PO6B 1OCOB 2VDMH 4PU2A 3QHFL 1QOOA 2VD7A 4X6EB 3X1EA 2N59A 3KDMB 4XZUG 2GSGA 3TN93 4A4AA 2Z3FA 4Y7OC 5D93B 5GKAC 1W8EA 3QIWD 3NPZB 5FW6A 4AZUA 1QJX1 3IDNA 2A4ZA 2V8MA 4NUQA 5IR1A 3N44F 4FQ2H 4ZX6A 1AH1A 5DK2A 2NUTA 3O4LA 2K3TA 1EAJA 4GW1A 4Y5VB 4F7TA 4D0DA 1I8IB 2WXRA 1JVKA 3I8TA 4MJ4A 1IBDA 3KEHA 4IOFC 2GU9A 5E56A 4IETA 3EH2A 3GD1C 1OB1B 3BEVB 4HVOA 4CPBD 5DUMH 4S2FA 1RI8A 3TN0B 1KGCE 5E9NA 3O14A 3BGMB 3KWTA 5C6CA 5TPWH 1NINA 2V7NA 1PDKB 2FX7L 1L7IH 1BCIA 3F5WB 5ALCH 3VXOB 3SKMA 5EU3A 4DO4A 3SDXE 3KGLA 4K94C 1RUI2 1MIEL 3HVDA 2ZGOA 1IFRA 2YC2A 4XNQB 2VZ3A 1UJ3B 5TDNA 3T4AC 3ATGA 1Q8VA 2V2XB 2X9WA 3H2QA 4FEMA 4RZKA 2G0KA 1B9KA 3ARSA 1RZ7L 3JV6B 5F0MB 3WFDH 4D7PA 4IMKA 1UXWA 4KZDL 3EGSB 2CKBB 4BSWB 5KBKA 5FPUA 2B4KA 2Q5TA 3QZNA 2W87A 3SDCD 4AJWA 3VX0A 2ZOTA 1CTMA 2Z7YA 5C0AD 3RJDA 3OPZH 3X1NA 4BQBA 2CWSA 1IM9A 3OPUA 4XB8A 3RBGA 5M95B 5BNPA 1BAFL 1O3RA 1TYRA 1MCJA 5IVCA 5ADOH 3HUJA 1HQ4B 1F6AB 4C56E 2EYSA 3FO1B 3TBBA 1DQ6A 5T5NG 4B27A 5I0DA 2V9RA 1WMXA 1YEIH 1SDDA 2GG1A 3ROLB 1WYJA 2DBJA 4OCRH 2X5IC 4R3SA 3NA4A 4JQVA 4P46B 2XBO2 3VBSB 2H0EA 2IEPA 4NRZB 1YI7A 4JB9H 3KLHD 1WUZA 4IBVA 5A3IC 4ZZ5A 4IHBA 2EKSB 1G0YR 4NN6C 4RGNC 2VXVH 2A6DB 3ULUL 1A8DA 3MRFA 4K9SA 3G6DH 1V6LA 5A7SA 4FXKB 5IZ7A 2EUXA 5C6TH 3WUWG 3ZU8A 1LOAA 3KT7A 5IMKB 5GS0D 1OAUL 4H44C 2A6IB 2DQTH 2MCMA 2DL9A 2ZKXA 2PHDA 2XL9A 3KJ6L 2FBRA 3KJ4C 1AR92 3ARVA 5I2IA 2E9BA 3RY6A 3QEHA 3WO4B 3L5HA 4XC9A 3ASIA 5F1NA 1MQKH 1H3PH 2NCMA 1U8IB 1RUAH 2IIJA 1RUQH 3GF8A 3T8MA 5T50A 2WLJA 1BLZA 3CV5A 1BD2A 5LGYA 4CW1B 5APAA 2XWBA 4ZT1A 5FB8B 2MOVA 4YDVB 3QJHB 1UM5L 3HMXL 3QPKA 5CJ8A 3PDQA 1EAPB 1MCWM 2B15A 4AWJC 3KV5A 1VFBA 3WNKA 1FO0B 4Y2DA 2SBAA 1FNEB 1BSIA 1ACZA 5JR7B 4OJCA 2BS9A 2VL4A 4A2HA 4OF3A 4B6ZA 4F33B 4FG2A 3EXUA 2DQMA 3KWWB 5FF6B 4B0MM 1ZRIA 4FHKA 4AQAB 1NL0L 1MS4A 1WUNT 5I15L 4PCKA 4I0AA 4IEOA 1FNLA 3ARBC 3KL0A 1IBGH 4R8WL 1CAXA 4XAAA 1BBDH 1T1WB 1ZE3C 4Q56A 1FJ1A 2J21A 5LGHH 1SLTA 4HSLA 2L7UA 4J6IA 4QRUA 5HHMD 1JFQL 4H1LG 2RFXA 3GSVB 3RIAF 1X5GA 4G5AA 3FN0H 3WFEL 4X6QB 1KCBA 2HWE1 2G5BB 4NQDB 3DPBB 5T5FA 3AJZA 3MZGB 4A7SA 1GZWB 2FK9A 1UC6A 1W2UA 1ZNPA 3LKPA 2VC9A 1SJEA 4JRLA 1NCCL 1R33A 4CDQA 5HJ3A 1OLRA 2GNMA 4ODVH 1D5IH 1KLFA 3MRMA 3WNMA 4D0CA 4NYLB 3S35L 3AB0B 3CN2A 1NMCB 4L8BA 2CDFA 2C8NA 2W1QA 3VBHC 3M3CA 5DUBA 2ZKLA 3U0PB 3PU8A 5KZCD 2YUEA 2FDIA 5B7EA 4XP9H 3W0WE 1ENRA 1GGTA 2Y22A 4N1EA 2E27H 2VLMD 1IGML 1O4TA 5LEJA 3BIEA 3OF1A 4FKHA 1RUH2 2P8LB 4JN2B 1K8DB 1KJ3L 1W15A 3VGAC 2CHDA 4BSVB 4HWBL 4Y1YA 1UD2A 3UYOD 5L4JA 1OQOA 2OX5A 1OKEA 2WZR3 1INDH 2XKNA 4HEPA 1NFDB 4M3JA 4OV6F 5CLXA 1JNNL 5J4MA 2JDHA 4PRAB 3IPVB 1NAEA 1JP5A 2FZ3A 4WSKA 4Y1ZA 4F93B 2B0SH 1FVEA 5KVGH 5HHPA 1RUG3 4DINB 2ZMNA 4BZ1H 4LOSA 3O0LA 1CLZH 4WM8A 5IHWA 4IKNA 5J9PB 2D93A 2QZ5A 5FMOL 4MSVA 1SLWA 5CA6A 3VSTA 2MNJB 1JCVA 1RK1B 3WJJA 1UWXK 3FU7A 4LLUA 4HIXL 1KN2H 5IQ7H 3OOXA 3KLDA 1NCRC 4M43H 4B53A 3FLTA 1IJNA 3T6XA 1OLZA 3D39D 3HFFA 4BZ2A 3NNFA 3F2LA 4I3RL 1YYLH 4Q89A 2CGYA 2KZBA 3T71A 4H3WA 5B21A 2J56A 2Y7OA 5HHOE 1TKWB 2PPDA 1EBAA 4N2EA 1HZKA 2D7FA 4XBQA 2NYYC 4I89A 2L7QA 5E1HB 3VXTA 4NIHA 1TMF1 3HLKA 2UWEF 4JVAA 2ZOLB 1G9NL 1FG2A 2G9HB 3LN4A 3LRGA 2IQ9L 4TULH 1ZOXA 1X7QA 3O4OC 2OMZA 1JRHH 1E65A 3ME0B 2XV3A 3QEUA 4RQPC 3I02B 4WW2C 3L3DB 1NCQB 12E8L 3WAJA 3DOHA 1H2LA 2H6PA 1VRSA 3QDAA 1BJQA 4LHKA 4E2QA 2BHFA 4A6OA 4OLZH 5AWNL 5CFAA 2VISB 1NY71 5ESAA 2GJPA 3L13A 3WY6A 2QSTA 2WKOF 4OD2A 4XXCA 1MRFL 1A6UH 4QHKI 4OGYH 4Y4KC 5MENE 3WLBA 1XZWA 4L3EE 3FZUD 1NUDA 3QPQC 2RR13 2LLNA 5KJ7E 4R8HA 2UZPA 3OGCA 4X9YA 4KY1H 2PP9A 4XAWL 1G6RH 1KIPA 1P4BL 3BCDA 2J1ZA 4OZHA 5FA3A 2ZGRA 1N1SA 2YC1A 4JKPL 5AVSB 1Y6MR 4GRLC 3BQVA 1UZ8B 5A7BA 4UMSA 1T83C 1HHGB 2UYLA 4NIAA 4P3WA 1TCRA 1PO21 2Y25A 1X7NA 5EORL 2GT9B 3J9SA 3N91A 3BTAA 5FZGA 4OGAC 2HVBA 4LCWA 5CP7A 5SWSB 1C8NA 2VW0A 1MHHA 1O8PA 5CZKA 4TNFA 4N5ED 5K9KB 4HKWA 2GNDA 1KGCD 1HXMA 3FT4A 1UKTA 2F7OA 2XQYK 2ZX7A 1PGW2 2VERN 1M71B 2YK1L 5I1JL 4ZO7A 5K4LA 3FPXA 3N7LA 2BGOA 2ITDA 5IK7A 4CC1A 3BDYH 1OVPA 1I3RA 2FQPA 2AQPA 1OHZA 4FZ8L 1FQ9C 4PSRA 3T1FA 2CRYA 3UC0L 3QJTB 3QIBD 4HQQL 4HA1A 5IBLD 1HQNA 5GGUB 3N9MA 1W6OB 2VR7A 5HHQA 1NSNL 3O0XA 2Z92B 3FONB 4DOHE 2I60H 3NJHA 1BJ8A 2LE9A 2OMXB 4HETA 5CLYA 3TBYA 4DZBA 4PRBA 4J23A 3IWZA 4U1MB 2ICWJ 1JE6A 2H26A 1YJLA 3WOGA 4Z5RA 3S36H 3NFSH 1E3ZA 4UQIM 1AE6H 3T65A 5HI5C 2DU1A 1ZRUA 2FQEA 4UAOB 1J5OH 4GMP1 1LEIA 1MS5A 3U10A 4NUJA 3OYWA 1WZ1H 3RZJA 1QLEL 3D2UA 4JDOA 4BH7B 1OOWA 2Q8BL 2ZWNA 3FSWA 3OX8A 4TPRH 4C56D 1KITA 1NG0A 3CN4A 2B9UA 4CA4A 3P2DA 1OTTD 2X2JA 3IWUA 5I5MA 3HG2A 4ALAH 4ZSOB 2KC0A 4E9YA 2VG9A 5FP9A 3POBA 2YYOA 2UZXA 2KMWA 2X2YA 5JPNB 4MZIA 1JN6B 3S0MA 1OZTG 4OZFG 5HGDA 1A7PL 4KV5F 1X3DA 3BWZA 4UW4A 4Z82A 4OY9A 2G3MA 3DLQR 2FYYB 3QJFB 5GZOC 2BGCA 2WC7A 3ECQA 1XGUA 3VXSB 2BNOA 3ZFEA 4BGLA 2HJKB 4AVHA 5C6PB 5FECA 2BFUL 3KBPA 3VFRA 3LD8A 3L3KB 1X5YA 4XO9A 2AJZA 2ZPKH 4XP1H 2JJWA 2PTTA 1KENH 1WCBB 4OBSA 4DKEL 4LSPL 1BX2B 2F53B 3EOAA 4ODXA 5JW3H 4JFZL 4YHML 1HYSD 5EPAA 1I5PA 4HBNA 3FK3A 3NDYE 1N0LA 2D7NA 2HT4C 3HQRA 4KXZH 1LB2A 1J5CA 2H32B 2A75A 2AANA 2O5XH 3B9DA 3PWVA 5EOTB 3BKCH 3RWGA 5LWYH 4MX7A 2P24B 5FP3A 1SJHA 1TU2A 2BCMA 3HCVA 3VDDA 3LIUA 4LMQI 1YG9A 4I48A 4AMXA 2LHAA 2IF7A 5KS9B 4TYSA 3QQ4B 4PB0H 3N7KA 3ZSLA 1DR9A 4HCRL 3BPOB 4HIHA 1QSFD 2DQEH 2EA7A 2BVOB 2WZEA 1ERNA 2Y38A 5J3HD 1XSOA 3K2IA 5IVYA 1F31A 2F5AL 4RRPA 4OF5A 1JSYA 5HDOA 3SE4A 1E9OB 2FWUA 4I1PA 2QQIA 4W9CC 4JPKL 5L0QB 2F58L 1C28A 1CDJA 3B7RL 2B45X 1GV9A 4XCNA 1AF9A 1JPST 3AVEA 4CADA 1KV3A 4BGDA 2ZGTA 3DL3A 4QQHA 1M6UA 1TLMA 5GS0H 5DUXA 2IOOA 1CFQA 3LIZA 1T20B 2B5IB 3PUUA 3D52A 3MAWA 3TXAA 1VEPA 4PGBA 4LBLA 1URLA 1P4LA 1PD0A 2OSWA 3WD5L 3T4YA 4OI7A 1CQ9A 4G9SB 1MWAB 1SDWA 1A3LL 1BIIB 1MW2A 3RUGB 2YBPA 1LILA 1FZOB 1ZXQA 2E33A 3QDJE 5GRUL 1JGVL 3DTXB 1SFYA 4YQXH 3R8QA 3QDMB 5CIPB 5TF1H 1ET5A 3ZDZF 2JIJA 4FERA 3D2TA 4FABL 4BLJA 1CE6A 3MXVL 5DTFB 4GWNA 4FMVA 4JZNB 3M1CA 3N41F 2ZOEB 3QDGE 1TQWA 4M29A 4COUA 5JSPA 3JB8A 5BRZB 1D5ZA 3GMLB 4ANVA 3JQXA 3HI6L 2IANB 4Y1AA 1XNBA 3HG1B 4BRJA 3WSQH 5IVZB 3WFHB 4WU7B 2Z93A 4P3CL 3DX6A 3UBHA 4BLIA 3QA3B 5DHMC 2FEDC 2O6DA 2AP2A 3A6OA 3LEYH 4A2DA 1AXKA 1MEC3 4ORFA 4DUVA 5FR3A 3WMPA 2JDYA 1KUMA 2V0AA 5CEHA 3VAEA 1JWUB 4NQXA 5K0UC 5AFAA 5KAQG 4QKBA 3P4LA 3H0TB 4OUUA 4QJ4B 1WW5A 5HHOD 4G9FE 1UH2A 5LBGA 4PTUA 4V1DE 3OKKA 3DTUB 3HS0B 4U3HA 5TDOB 2QQQA 2WYIA 4BE5A 1U8KB 5EZJA 4FQ4A 2QMKA 2LQRA 1UB5B 3LHPL 5E89A 3HPLB 3W9EA 3P11H 4YK4B 4NKOB 3PAYA 4JDVA 4X9IA 2OMTA 2ZX9A 3EH5B 3QQNA 2F9BT 1NGXA 4Z7WA 3SSGA 1JPEA 4BQYA 3NT0A 1T89C 2I07B 1VHPA 5BS0A 3RWFA 5C0FA 1R0AL 2R071 4RETB 1DDTA 1XHHA 3EBRA 5FYLE 3HZ3A 4MBRA 4UM9D 4XT1C 3C60C 1RCYA 3G5VB 5JIQA 5T1JA 5FV2A 5A7WB 1PIV3 5T5PA 2EUZA 4N8VB 3VBFA 4M5YH 4PBOA 2VM9A 1VBB3 1YUHB 1HOCA 5MEND 4XH2A 4L3ED 2A74B 2AUYA 3FB8B 1BQ5A 1FYTE 1FFOB 3SMHA 4HIIA 1KXQA 5D1XA 3FL7A 3E6BA 2L04A 4ONUA 1BYNA 3DX9B 4ZS6D 2ENJA 5H4YA 4RD7A 2X0WA 1HVXA 5AOJA 1NA8A 2CK0H 3B6SA 2COVD 3VFNA 1Z9LA 3TF4A 1J8KA 2R041 3E6CC 5DS8B 3WFZA 4M0NA 2QELA 1A6WL 4LVNB 1UY4A 2F4PA 3IT8A 1ZT1A 4XE9A 2WQRA 3JWDC 4URAA 2BP8B 2P7TB 4ISVA 4YBQD 4B9YA 4HPKA 1AD0A 3GBNH 3OG4B 3VI3B 5LNGA 3DKHA 4UQ3A 2E74C 2NW2A 5EUKA 1QDOA 3UYPA 4ELDA 3KWVA 2H0FA 2B7YA 2Y8KA 3S37X 3S9DB 1KGYA 2PYTA 1ZJAA 1YHFA 4QPGB 4B7EA 5FYKE 1T3FB 3HI1B 3OKMB 3LOIA 2Z31B 1ORSB 1TG7A 3K81A 5E6ID 1FP5A 1X9PA 1F97A 2R39A 4P9HL 3ZO0B 2X5PA 1I9JL 1CF1A 3QUML 1YNTA 2ZAIA 4DN3L 1QTSA 1LU2A 1SBSL 3ZXEA 2C7FA 4ODUA 4JGZB 4UT9L 5GRWA 3VBRB 3RJRA 4JRYA 2HRLA 3H85A 3ZXDA 4N43B 4AI9A 1KDJA 2C26A 1TJXA 2WYTA 4EWAA 3CQPA 3ATEA 1B2WH 3HE6B 1T7YA 2PELA 4KJQC 2D9CA 1RZIA 2Y23A 1ADWA 3D09A 4LOVA 1L7TL 5ITFB 5CR8A 5L6YH 1U5IA 4MQ7B 3DYMA 3UGEA 4KTEH 1CT8B 2XQXA 4XFAA 1OCRB 2Z35B 1SZBA 5L19A 3S88L 4OLLA 3TVMC 3EXJA 3O6FC 3D48R 1MAML 5ICXB 4ABVA 1PMHX 3PUQA 5DDJ3 1A1MA 2E6VA 1OGAA 1ULCA 3QZPA 4ZOAA 4XIKA 1XWVA 2MTAA 3ABZA 2P1BA 4HK0B 4XF3A 2IALA 2YD7A 4RR3B 3GLAA 2WBKA 3JWNC 1U95B 5JXIA 3NJMA 4CDWC 1BOGB 3G6JF 4C1XA 1WMFA 2AC1A 3KQ4B 1PZ7A 3NJFA 4P3DA 5DVNA 4CAGA 4Y16B 1YY8B 1KBBA 1R3KB 5I82A 3GSXB 3MODH 1JXKA 3QT2A 4MWFB 1NC4A 5JXAL 5J7CC 2MPAL 2WAOA 2BOCB 4A6YB 5I8CA 4FCHA 4IRSB 2JWYA 4QPYA 4QRPB 2H9GA 3U0WH 4W93A 2DQIH 3I6GB 5CBEA 1Y18A 3STZA 2Y60A 1VEMA 2N7GA 3EDKA 1EGJH 5DJDB 3L9YA 3AY2A 1WBFA 4RNRB 4MUVA 3UKNA 4UOW1 4MZUA 2R27A 3LMJH 5GLTA 5C07D 2FH6A 3HAEG 5FEBA 2KD7A 4WJ5A 3A4FA 3OKYA 2P4EA 1XGYH 1U8PB 1T7ZA 4Y4HC 2Y4SA 1B88A 1ZKAA 3BYWA 5D71H 4Q52A 4U4IA 3VI4A 3MMEA 3RTQC 4PP1C 2VLKA 4IJ3B 4Q4X1 5TH2A 2NN8A 1ACXA 1IS4A 3RWCA 5L7OA 1VBA3 5DLML 3WENA 4X6CB 4PM1A 1K8IB 4PCRA 5FAXA 4OZOA 3FTUA 4FP8H 3CSGA 4GNKB 3KM5A 2RMU1 3L5XH 2VWEE 1KJMA 3GNEA 2OCFD 3HD8B 5CCHE 4Q0XL 2LU4A 1N2RB 2C24A 1MVUA 3MI6A 2XLAA 2D0GA 3G6JE 4N9GA 3IJSB 2QGCA 3MRNB 5L88L 1EDHA 5HPOA 4MSWA 3DYPA 3JU9A 1SVCP 2JLPA 4IRJD 4KKCD 3L48A 1CBVH 4EQVA 3CDFA 4F9LC 2EO9A 3SYCA 1Q0YL 4LSUH 3QW9A 1KJ2B 2BMKA 2UXGA 3VD4A 3GMNA 1WA4A 1X5JA 3KNBA 1G7QB 5E9DA 4B9KC 3L5WA 2C4FU 5B1JC 4C4KO 4J8RA 1QJU1 4PQQA 4QD2A 4P23C 3UTSE 3D12B 5AC92 1JGEB 1O7VA 2DV6A 4UINL 2VKWA 4TRPL 3VFGL 2IAMD 4HWEH 3L4TA 4WAFA 4IJTA 2ERJB 2PCYA 4ETQB 1G7MA 1BZ8A 4GKNA 2VLRD 4PJEB 1ZBA3 4U36A 2DQHH 4YDNA 4XVUD 1DTUA 3R0MA 3CBKB 2K46A 2VBDA 4G1MB 3BPSA 1AC6A 2WZ6A 1XF5B 1B4RA 1AQKH 4P2RB 3QDJD 1PO13 1OAKH 2ZAAA 1E8YA 1N5AA 1KBGH 2F54E 1FIGH 2C3WA 4LU5L 4RAHA 4R7LA 5GISH 1DQLH 3RU8L 4JFFD 2OZ4A 2RE9A 1U2CA 5EH1A 5FW7A 1US2A 4X7DC 3CZNA 1OK0A 2VO5A 5IUCA 2WB7A 5CF3A 4XCEA 2DTML 1XSIA 5IW6A 4L18A 2NMOA 3WBDA 1K5WA 1QJX3 3F7VA 4FQ1H 1JNLL 4IMLB 1JD7A 2NW3B 4FYRA 4X8JB 1JK9B 1TT6A 2WO3B 4N0UA 5EU5A 2I85A 4JZOB 3MNWA 4XB3A 1HESA 5IYYA 4NNXB 1QSEB 1HXS3 3I75A 4IKJA 4HKLA 5GGVL 5SV3A 3AZZA 4IU2B 4ZODA 5A16B 4WHCA 5G05L 1SM3H 1LK3L 2HFEB 2ZXGA 5IHUL 4FOWA 2PHXA 4JM2A 3C9NB 3RG1C 4V1DD 4U05A 2XKSA 4IOIA 1O7FA 2GP5A 1QR1A 3KR3H 1DZBA 4TUKL 3RZCD 4OBRA 5PAZA 2HKHL 2EEDA 5DUPH 3PXLA 1HB2A 2F6BA 3KV6A 1AGEB 2KZWA 1BVNP 2I25N 4AE0A 3LA3A 4OUEA 1OALA 4HIEB 3HC0A 3C6LB 4JRXD 3X12B 1LK2A 5F6KA 5AVAA 1QZ1A 3USSA 3MBXL 4EO5A 5L9DL 2QQWA 5FYLD 3OZ9H 1ZTXL 1MCRA 4H8WH 2J72A 2EE9A 1MJJB 3FT2B 4LQFH 4U1LA 1VKXB 4W70A 4W68A 5IFHH 4X6BB 3F95A 3OB8A 4GIQA 5EYYA 3U0ZA 4FNRA 1RVFL 4EKJA 1FYTD 1I8AA 1A6PA 3BUYA 1QPPA 3FO2A 4YDLB 4ZQTA 1V6NA 1QEWB 1A4KA 3EFOB 5GSRB 1C1EH 1UKGA 1W9YA 4KUCF 4YIQB 3LA7A 4XTRD 1A5FL 1ZSHA 3WIAA 3VXUB 1LCLA 2J1XA 5KSUB 3ULUC 2UY8A 2YUZA 3LKOA 2D97A 4N85A 2AEYA 1B0RB 1D5MB 3NJGA 2XRAH 5EF2A 1CAUB 2C9AA 1A4BA 5K9JH 3VUAA 3VZJA 3G5YB 3VWKD 1KDIA 2DQUL 4P9WA 2CKBL 2XA8L 2ITEA 3UO1H 5DD1L 4NM4L 3RB5A 1RIHL 5FYKD 1LAJA 3OTFA 3LRSA 1WT5A 5A2LH 2WA4A 3E9UA 4QOKE 2Y6SC 1ZLUK 3HEIA 2YPVL 5GGTL 3FQ1A 4PB9L 3H0OA 5BNNA 1E4WH 1EHAA 1TJGL 2BWDA 3ESPA 5BMFL 4J39A 2OK0H 1EYBA 5J6GA 3IDGA 4Z78A 7PAZA 3GKWL 1TZIA 2Q7YA 5JOFB 3LDBC 1KTKE 1UIKA 2D9QB 3N1QC 3VXQB 1UYWL 4FE9A 2E9QA 5TE7L 3LWCA 1KN4H 4XMTA 4PVNA 3MF6A 4Z1PA 1WAEA 3LDKA 1LO3L 1MZYA 4ZMWA 4RFOL 4YZ1A 1DGRN 3E8UL 2Z34A 5E8DH 3S5LG 1FAIH 4E9RA 2J6EL 2BHZA 1KXVA 2P8PA 3D3VB 3DX4A 3PWNA 4U6VH 2YUWA 3BSZL 1ND2B 1RLWA 1A14H 3AJ7A 1W9TA 4XWGL 5F97E 1TJHH 3D85A 5MEPA 3HUJF 1WBLA 2UY6B 5KTEH 3CPLA 1U93A 3BPNB 3CMOL 2EAKA 4X80H 35C8H 3CN0A 4HEPG 2ZCWA 5T1LD 4P9GA 1X5IA 5JPMB 1W0PA 4KQ7A 4MJIB 1PJWA 1N64H 2ORBH 3GIVA 15C8H 4OCYH 4G8EB 4R6UA 3UJJL 3H3PL 3BH9A 3BZ4A 3P3UA 3FJTA 3GSUB 3NPSC 3MREB 4NB7A 5TE4H 4ODHH 3RAJL 4FP2A 2MPVA 1W9SA 2QQNA 1IKOP 1FO0L 2GIXA 3TBTB 5A32B 1EVUA 5HPMB 4X6FB 3POEA 1B4JH 1CGUA 4XPBL 5B1CA 4WI6A 4RGND 5J5EA 1JU3A 2ES3A 3NFNB 1E0OB 4FKEA 5A3TA 3UV9A 4CGTA 2BGPA 1T0NB 3CK0L 3CZFB 4WZ9A 5D1ZC 4N28A 1JVOA 3W5MA 2A6VA 5FUZL 3PVNA 4Y2NA 2LAAA 3QPXL 4MDJA 2AI0H 5DU7A 3UFIA 5BQ7A 2H6CA 2ZJSH 4H1LH 2A77H 3LQCA 5CCKH 1V54B 2P5WA 4HF5H 3GJFH 5AL0A 5HTSA 4FGMA 2MNGA 1ZDQA 2W65A 4RQQA 4YOKA 1H8VA 1VLNA 1VBD1 4PGDA 2WLYA 5BUGA 1JNJA 3SEEA 3U75A 3QE5A 1TTAA 5JXHA 4BPZA 3DROA 3ZMNA 1KULA 5HBAA 4JFSA 3GYDA 1RHHA 3HUJE 3QUZB 5EO9A 3FQRB 2GJ6A 1G6NA 1ID5I 1S0GA 4B9GA 1IOAA 4GG6E 1QRKA 3BQUC 5ICUA 1PG7L 3CVIH 4WNQA 2AK4B 2HWC1 1Q1PA 4BDVA 1DJSA 4X98A 3SC7X 1AVBA 4XBMA 1WFIA 4DP4X 5DHXB 4TOYL 4WI2A 4WI7A 1HQWA 1E9PA 4KQ0A 3S4SB 2Y33A 1H6YA 5HCAA 1T4KA 3QSKB 5F89A 5JW4R 2VNVA 3OG2A 1DGRA 2IWGB 1NFAA 1G9NC 2AXGA 2FO4B 1FC2D 3BVDB 5DJ6B 4PV8A 1H2NA 2B59A 4A63A 1OAXL 1GU3A 1MQTC 1DUZB 3PJNA 4KKZA 3TZVA 1HKFA 3BAYA 3MUUA 4XMUA 5D4IA 5KW9L 4JCLA 2M83A 2NY4C 1AR1C 3E6HB 1KCUL 2XG4A 3GEWB 3MRCB 5AAWC 4NNYB 5CEYB 1FORH 3S3CB 3UTSD 1W90A 2E8ZA 1O3QA 1C3HA 5CKAA 3H1MA 2OTUB 3UABA 1H3TA 3PHQA 4B9JA 3AJYA 3O3AB 2ZYSA 4M56A 3UZEC 3LFMA 4UXAA 1R1ZA 1F58H 1T1YB 4BFEA 2DUQA 3OD0A 1MJUH 1HZHL 1I8MB 1BD2E 4HH9A 1XYNA 2JJSA 3JWNG 3ARUA 1IC4H 1I9IH 3C6SB 3Q05A 2WAQA 5JXED 1OH3A 5FA4B 3DNKA 3HJ0A 3D07A 3KS0J 4KVPA 4F5CA 3MACL 2F54D 4N68A 1F3JA 2B08A 4QKTA 3G04A 4IGBB 1V0AA 4FFWD 5I23A 4H7MA 5GZCA 3QYMA 4ANXA 5BO1L 1JN2P 1KJVA 4JUTA 3AMNA 4XXWC 5FDBA 5KBFA 1XE7A 2YD0A 3CIQA 4XN1A 4EI5B 2YGPA 3WQ7A 3OXSA 1DLHB 4XAKE 4BFIB 4ICXA 2Q4SA 4KGQA 1DIWA 3FBYA 4ZW6A 3ZKXB 2V37A 2CY6A 1E4HA 2QEJA 1QHOA 5I9QC 2MEV1 5GLWA 2W9DH 4ATEA 4BCUA 4COYA 1U58B 4MD5A 2EIJB 2C4FT 3DOSB 5ERLA 2EIGA 2RG4A 4AGVA 1LMIA 4LCUA 3HG4A 1CFTA 1D9KA 4G6KL 3BSGA 4G8FA 4X7SL 3PQYA 3SGJA 1RD6A 3MA9H 2WRAA 2R2CA 1BPVA 1DQVA 3SKOB 3QFGA 4HOOA 2ZE0A 2VZRA 3NJVA 2X4OA 3TB0A 2X4UB 4HZ1A 4NQVA 3C5ZA 3VXMA 2O1AA 4F8NA 4QT6A 3A24A 4JFVA 1H6UA 1KJRA 2VMHA 4PBDA 1DE4B 3FHIB 1DBAH 1WZMA 1U8OB 3K2MC 3GMOA 5HHNB 3H1YA 4AEHH 4YVSA 3K0YA 4P5MA 1W72A 1F6LL 2EXJA 2WFF2 5I5JA 1P7KB 2VABA 2VDMB 4GKXA 4PGZA 4PMFA 4MAYA 1XQNA 1RFDH 5BVPL 3TNPB 5C4WB 2VDLH 4FI6A 4IIQB 4XPFL 1REDA 5IVBA 1AYN2 1AANA 2KDYA 5FKPB 3NW4A 3SE6A 3TIDA 5FO9B 1RUF1 1CPNA 4TLKA 3EAKA 4M61B 5IK8A 4PLKC 2BJMH 2VXQA 4GMP3 2EIKB 1CZ8L 3ABLB 2EIBA 3MBWA 5GRVL 4Y4KD 2XX1A 3I2OA 2C6SA 4OZHF 1IIKA 4M7LH 4AVCA 2OULB 5L4MA 2BSTA 1W8ZA 1B3JA 3KPOA 4RGOH 1E9QB 2ZXAA 4TTDD 4N2IA 4NKIH 3JXAA 4JQXA 4RMTA 1ZA3B 2NY1B 3E6FB 5FKAA 3SPJA 4AQ1C 1MVQA 5C0CB 5F9JA 1M7DA 4Y5YA 3KPSE 5DN2A 1HILB 1HHIB 3D30A 3MGTB 1HE8A 4LOUD 1DBML 2LR4A 2QGEA 2F7PA 3EYFA 3IJHB 2VUKA 4JFWA 2D2CC 5DS2A 1SXCA 1INEH 5CN3A 3S8FB 3R05A 3RS6A 2IPTL 4QOKD 3VFSA 4XDQA 5A70A 3TA3C 3K8LA 3HC2A 4W4ZA 1S0DA 3ACHA 1VERA 1D2OA 3BU0A 3DI3B 3WHTA 4CUBA 5D1QC 5FYLH 2DV9A 1JERA 3RGBA 2BUKA 5HCBA 3LNDA 4I1NB 4P2YA 4PTTB 4R4FL 1EEZA 2XQBL 5D6DA 5FYJU 2VDPH 5FZDA 2MEJB 1JYTA 4GKLA 1BVLA 4LOTA 3RFRA 3POGA 4OLEA 1IS6A 2GPZA 2X1WL 2Y36L 4F57H 1QH7A 5DZJA 3HB3C 3U9PL 3U6RA 4X9FA 5EBLA 3N50A 4GRMB 3SH4A 3QEGH 1WBZA 4L92A 5C8CC 5D2NE 4KUCD 5BZDB 4OZHE 3HJRA 4JZJC 3AZWA 4R7NB 2UYAA 3DIFA 3HE7C 4ZI8A 1I1EA 4P2OD 1XL6A 3HQUA 1K6QL 5E4IA 4WM7B 3EJPA 3QNXB 1KTDB 3DGGB 3AP9A 1UQSA 5F2SA 5FS5A 1AIFB 1LU1A 2Y7QA 3C5XA 4WTXA 3HNTH 2APFA 4DO6A 2GSIA 4LCWE 1SPPB 1AMYA 3QUKA 3MV7A 5FYKH 3TJEH 1F02I 3ETSA 1NQJA 1CJDA 4GT0A 3H7LA 3RY4A 5I17A 1NAMA 3DUUB 3SNMA 3QUXA 4JKLA 4FXGA 4NUGH 4AV0A 3CFIC 1L0XA 4LHUA 3K71B 5DPNA 2C3GA 2O6CA 4ZAKC 2BYVE 1A7BA 1YECH 1VRH2 1SEBB 1XZ0B 4HJIA 2WP3O 1KCLA 4L4TD 1S2BA 2DQFA 2VYRE 1H8TA 1VCBC 1DBJL 1Z2KA 2B77A 4YGAB 3SCMB 1QXPA 1CICC 4PFEA 1S8DA 4UYQA 2YZ1A 2VQAA 5DAWA 2R1DA 1AHKA 2WWKT 1C12B 4H26B 3B9KA 3B69A 4ONGL 1FFTB 3UAAA 3TCXA 4AL8H 1E2VA 3HR9A 1NDGB 4AIZA 5D5MA 3D6GA 1SBDA 4YHYB 4WEBL 1IM9D 3EIFA 5D1IA 3SBRA 4EN7B 1KPVA 3F64A 4KHXL 1OAJA 2HJLA 1S1AA 4H8QA 3BAWA 3UG4A 1JI1A 3ARFB 2W60B 2J44A 1P5VA 3FSZA 1XGTA 5DC4B 5IT6A 1HKLH 1NGZB 5DVLA 3I9PA 4LBQA 2X5IA 3V0AA 4EBQH 1RP8A 2Z7UA 5L7XL 4AEIL 1OUSA 2BNRE 2X1PA 3AMLA 4WVMB 1L6PA 3AWEA 4BWUA 2FJHA 2J25A 3O1OA 5EXOA 3MRIA 1GUIA 1UY1A 3T4VA 2LALA 4N2GA 4AKQA 2GBVA 2W95A 1YN6B 1HSAB 2FHRA 1ETZB 3LXCA 5EPMB 3RX7A 1PPIA 3PGDA 3DXAB 4GAGH 2AKRA 3IGLA 3VZOA 3GINA 1VRBA 4PIYA 5EZLB 4NZTH 4UT6A 3VXRA 1ZK5A 3NTCH 2A9NL 5JHLL 4XMPL 5CFDA 1JXGA 2JG8B 1SNRA 3HBKA 1HB1A 1LHZA 1TIUA 1Y7VA 4LBEA 5ISZB 3H55A 3UZQA 4RX4D 4OJAA 1LP9B 1V3JA 1BVKA 1MI5B 4B9ZA 5L36A 4KTDH 3UTQA 1AR71 1IC5L 1K4DB 2O4EA 2APSA 2WZ5A 4B96A 4O7XA 2GBUA 1ZVFA 3K2KA 2RA1A 2O14A 2A73A 1I3GH 2Z4QA 1WV7T 3EHKA 3ARGC 2G75A 1DBKH 1KCRL 3BIKA 4M7ZC 2R51A 4Y2DD 5BVJB 5SX4H 1P4UA 4U4BA 4BUQA 1QW8A 1RUOA 5JHDB 3AW5A 3AG2B 4MXQC 4AVKA 2ZCKH 3B5LB 1OSPL 4XABA 3II1A 4TVSa 5I30L 1WWWX 3IS0X 2D7MA 2X2UA 2QQLL 3HOGA 4PGEB 1TMQA 1C5DB 1WLCA 2R043 4XAKD 4PRID 2A6XA 3U25A 4P9LA 2DCYA 2X53A 1K5JA 2PFWA 3WLWC 1HDKA 1ZV2A 4UTAA 4GKZA 5HCHA 2WXOA 3AS3A 4X8PA 4O51B 1EA9C 1W0OA 3GZAA 3ZYIB 4P9HC 4I77L 1NCBH 2NT1A 3FMGH 2FEDD 4P2CG 4HOMA 4CN4A 5CJBA 1ZM1A 2NY6B 4K3DH 1PNCA 4YVUA 4NLAA 3BW9B 4W4NA 3U36A 5I91A 4WUKL 2DVDA 4PJ9A 2AEZA 5CSBA 5EC2A 3A3YB 4GAYA 5F5CA 4CDXC 4Z7WF 1UB6B 4YL4A 5HGHA 1KXTB 1X4ZA 4KWUA 2ITFA 2XZZA 3QQ9D 4KQ3L 2OYPA 2Y6KA 1G6RB 1Q0XL 4FFGA 3ZFGC 4MNHB 3ROOB 1W8HA 3RRDA 4ARYA 2QKIB 5F3BA 4QT5B 3BMVA 4HJSA 4OCXL 4OCMC 1HDMB 2CUMA 5EZOL 1E5ZA 1WAAA 1VMFA 4HZFA 3WY4A 2PYFB 4R7VA 3BVNA 3VZKA 5DUVA 2VSKB 3N43B 2A3XA 3IMMA 4GZ9A 2HLAB 4NWTL 4AGLA 2HB0A 4XVSH 1JGLH 3WL9B 1BVOA 4NC1C 4FYQA 2Z4TA 2ZKHH 2VW7A 4TNWK 2OMYB 2VXUH 3P9LA 3AP6A 1YVLA 1UWEL 4KMLB 1LTEA 4IDLA 4Y9BA 3S8GB 3VFVA 5SWZA 1MCFA 1NCRA 1UKRA 1TQVA 3PL6C 2B9AA 3S37H 2DD8L 4LK4A 3GSNH 5A2AA 4PJAB 3VU2A 3JT0A 3S5AA 5FGCE 3ROUA 1AR61 4JFED 1OV8A 4GI9A 2ORXA 1YDPB 5IOPB 2JKRM 3KPSD 1DQTA 1EJOL 4LHJB 1OE2A 5LJYH 3NV2A 5C0EB 4BRVA 2HG5B 4WI8A 1ZGLM 5I1IH 1M4WA 2NYYA 2K45A 4LKXA 1A4JB 2P8MB 3IJ7A 5IEKB 2YPDA 5DEGA 1QGLA 3C6EA 4EJ1C 1XOYA 3QWQB 1Y07A 4YE4H 3JBG3 3AMHA 1JPGB 4Z7WE 4K3JH 2IV9A 3AREC 3MYJA 4CRPA 2WNWA 2IBZY 5BS0E 2BHUA 1YNTF 1B0GA 1XNKA 4RQPA 5TK2A 3L7EB 4M1DH 5BOJA 4XHJC 3ALWA 1CYWA 4XJ8A 5JMCA 4MJ5B 2PW1B 2YAEA 3M07A 1S55A 4M3CA 1O5DT 4JCMA 3QIWB 3RJ2X 3EG9A 4PJXB 4ZX4A 1RUC2 5CBLA 2XUWA 4M4RB 3FQXA 4R9AA 1QBLL 3R06B 3DRTB 1J8RA 3H2PA 3MXWH 4Q2ZA 1XF4B 3U7YH 3TAYA 3HZVB 1NOAA 2EACA 1MCBA 3RWNA 2P3KA 3MLJA 2VMFA 5D1XE 3V0WH 3UBFA 1Q9KB 4AGPA 2IQAA 5AKSA 1IKQA 1FGNL 1TPXB 5AZEH 2CO7B 3BAKA 3P4NA 3N2JA 5CSGA 3L3HA 3FF7A 4OR1A 5FO7B 4DP9X 2KL6A 4AT6A 1VBE2 4KNQA 3SDAD 2RMU3 4DK3A 3EJCA 2DEYX 3CU1A 1AGDB 2OA2A 4QXUH 3TVMD 3MJ9L 4PY8I 1HC1A 3O6FD 5ACLA 4XNXL 3D4GA 2YD3A 3PYCA 4BKLA 2ATPB 3VFUB 3GBML 5AUMA 1X7SA 4Z7UB 2JK5B 2YRPA 4LCWD 3RX5A 3BGAA 5C7XH 4JO4L 2JE9A 3Q2VA 1WKYA 2IVIB 4LJHA 1OARH 3HAEH 1BXUA 4IRZL 4NENB 4XMLH 4YR6B 4DGVL 1QJU3 3NL1A 5I8SA 1U92A 1M7XA 3SQRA 3HBPA 3SDCB 4JR9L 1WW7A 4DQAA 2FGWL 4N20A 5C0AB 4CCCA 2I5YL 2H8PB 3I9GL 3OVUB 1W6PA 4ZXBC 2CV6A 4AVBA 1AGCB 4B8EA 3CXHJ 1Q43A 1GSKA 4AG4H 1CFNA 3K0WA 4F2MA 4ZPIA 1QFWI 3IGUA 1J84A 2NY7L 1PVC3 3SOBH 3KPQA 2J8OA 3A5VA 1VAVA 3S96A 3PVEA 1G0DA 3DPRC 1WWBX 3NVCA 5BOZG 3OGSA 4W50A 3MW2A 5C8WA 4YHKH 3FRUB 4M93C 1X9TA 1JU4A 3I3BA 4L8QA 3VI4F 3A67L 3H3LA 2Y5TB 3JTSB 3IWVA 5KSBA 2F8VA 3QCVL 5B39B 1KJ2L 1OB0A 2X6BA 2FWLB 1INQA 2DTYA 2ZKNA 5A2IH 5AD0B 2D44A 1NUFA 4JMXA 3D2UD 2D4DA 4NN7B 3CPUA 5KYUB 4XPHH 5EFIB 2ZGQA 3GMRB 4OSUL 2B1OA 2XPZA 5DJAA 5DABA 4OI0A 3APCA 3EO1B 1OAQH 3PNWB 5IB3A 1FH5H 3O2DA 2JDZA 3KS0H 3SHSA 4FI7A 2XWJB 2N0MA 3U0TB 3V55A 4PGJA 3BKJL 3LCPA 2BNRD 4GUPA 5C0BD 3F12A 4AQEA 2ETWA 4IXLA 1T2JA 1FYHB 1F1GA 1Q72L 1A9EA 1TTFA 2QUOA 2PO6C 2ARJA 4XNAA 2H2SC 4R9HA 4XGZA 2ZOUA 5D93C 5FY1A 2R1XA 1U8LB 1E28A 4ZFOA 5GZOA 2WA3A 5I75C 4UNVA 3HW7A 3MJ7A 3QB7C 5DRNB 1FL5B 1UPSA 4MCZB 3IF1A 43C9B 5CNAA 5E00A 5G5DA 1OP5H 4CVUA 2ID5A 3OLEA 4IBSA 3ZTJG 2L7EA 1GCFA 1F0LA 2F7IA 4Y5VC 3C12A 1O4YA 2G9GA 1RJYA 3APBA 1UY0A 3D82A 1Z32X 4ERSH 5IUSA 3GGLA 4BQ3A 1HT6A 3WIFA 3O1TA 3G6AA 1AXTL 5C0JB 4K7JA 1UYPA 5EMYA 5HHMB 1VIWA 2R30A 2Z42A 3TN0C 4WKXA 3L95B 4LCCA 4MD0A 2XPYA 4HOZA 2EICA 3VI4E 1W8UA 3IDXH 1U3YA 3SPVB 2VLKE 3VH8B 2XWEA 3S3DB 2A1WL 4F8OA 3VBUA 2G2PA 4P05A 1T1ZA 2B1AL 1SOSA 2AABH 5AVXB 4ZTEA 2GC1A 1UJ3C 1XXNA 2K2SA 2BPA2 3E1F1 2EIZA 2APWA 1YEJL 3JYBA 5FOBB 2FNWA 1KGXA 3K2UL 1YEEL 3ULVL 5JDBA 2IXLA 4K9EH 1QAWA 4GRWE 2R0LL 4JFDD 4XCYA 5L9RA 4LSSL 4ES9A 5AOMA 1E4XI 1L9TA 3POJA 2UZYA 3IU4L 5AVTB 1TITA 1UUNA 5AOIA 4AKPA 3FBMA 1A4CA 2WQ4A 4IBLT 2DWEA 5FFOA 1R1A1 4JM2F 1ET7A 4Q7DA 5A3UA 4KKBC 4U1KA 4U3SB 1CGPA 4QD2E 4QMEA 2FQGA 5F3HA 3AC0A 2PTVA 2FX9L 4ADIA 1G7PB 3HG0A 3ZSSA 1O75A 3P0YL 1AJ7H 3L5IA 4LSTH 2EE6A 2W0KA 3NK3A 5IIEB 4G42B 4LITA 1UH3A 1Y0LA 4P46C 2OMNA 3MOAL 5J56B 1H3GA 2EVXA 4N8MA 3VBSC 3VD9A 3O2WL 4FNUA 5I8EB 2NY3D 4KJYB 4GKSB 4S11A 1I8LA 3DECA 1HW5A 3MLVL 1UENA 4PG9B 3JVFC 5F8PA 2E3VA 3LOBA 5SV4A 1E5IA 4DF9A 4FXKC 2GALA 1J5DA 4CSSA 1OSYA 1ID2A 4Q6IA 1QJY2 3OHXB 1WD3A 1LOFC 2I2SA 1H9VA 3P3NA 2EH7H 4YW1A 1DVUA 1XF3B 4GI8A 2BVBA 4LSRH 1RZPA 1BZ7A 3V4UL 1K12A 3QH3A 5IB5A 3C08L 2NT0A 3UBXA 3VXNB 1T66C 4X5PA 3QR2A 3WO4C 4LO4B 1HH6B 2E7LC 2GTQA 1HWHB 4OD1L 4U1SA 5AVRB 5J6HA 1NKOA 3PABA 1E5CA 4GSQA 2ZGKA 1NEZB 4N0UE 3PAVA 1ULVA 4EUPA 4LLYB 4BINA 3PV6A 3S7EA 2Q8AH 5T5FH 1G9AA 1R5WB 5C0DB 2E7AA 3NFPA 3EGXB 1XGQB 2JJUA 1WGOA 4U1IB 4WFGE 3OEBA 3SBWA 5CILH 3EO9H 1DCSA 1WBXB 3TH2T 2KERA 3Q6GH 4HMEA 1CMOA 3POIA 3ESOA 4NZUL 2VCAA 3BRGC 3PP4L 2VZOA 4CMHB 4HXBL 5G4NA 3U1PA 3VGIA 1JGUH 1KIQA 5T1MA 1P69B 1Q5OA 1JV5A 2V4AA 3WELA 2Z5WA 3CNAA 1T89A 4MB1A 3UYRL 3GBWA 5BS0D 3VNZA 3MRPB 1JV2B 4AYBA 4LR4A 4G43A 5KHKA 1CBJA 1W6NA 5BZXA 4X7CC 3BO8B 3P69A 4YC2B 4FBFA 2XVGA 2Y6SD 3ESNA 5LO7A 1E6JL 2NQ3A 4NP4L 5ICZB 4MBOA 3AB0C 5D8AA 2F08A 5HI4C 4GUQA 1NMCC 4N2DA 3WIIH 1BVZA 4HC1L 1G86A 3FQ2A 3TV3H 2X4QB 2EEFA 4YBHA 5D1XD 1VADB 2X9YA 1QZNA 2PR9A 1L9QA 4OF6A 4S2HA 4CSZA 2P4AB 2I32A 4GKOA 3VYPA 4JDZA 1KB3A 1XBRA 1JOPA 5FP7A 2GTZB 3NSDA 1MFAL 3KYKH 1K3IA 4U1JB 1F41A 3IE9A 2HWC3 4G2AA 4BZ2H 2V5MA 1X50A 3IT8D 2PXYA 2R15A 3V4PA 4YHLL 1GFF2 3MLZL 4L1TA 3SDXB 3MPPG 3P54A 4CXXA 1FFRA 1Q9LA 1SDAB 3DJ9A 3MU3A 1UF2C 1N68A 3QIBB 4KBBA 1U30A 2WFPA 4EWEA 5EEXA 5BZWA 1NH6A 2WUCL 1S3RA 3VHNA 3KHCA 4FNLH 4I3SH 1NBVH 1NC2A 2R56L 4ILDA 3ZYFA 4H4NA 1AS7A 5F88B 2XQRA 5A6XA 4O2CA 5I0VA 2FR4B 3IDJA 1CURA 4DPCX 3WDHA 5DHEA 3WTXA 3MRKA 4IV3A 2X4PB 1N18A 3I6KB 4D69A 3BP4B 3WJLA 3F05A 2FATH 4BFRA 4GSXA 5CJQL 1JG9A 5INDB 4DVBA 3M88A 4XFCA 4HSJA 5KXCA 3BTXA 4JW3A 1WA1X 4CL7A 1W06A 4MHUA 4HUWA 4KK8C 1SEQH 5F37A 4C56B 3MLXL 5BV7H 3WG4A 1FLRH 1ZHLA 2PHRA 2F68X 5D1ZD 4ZY9A 1OTSC 3ETTA 3RPBA 1BECA 5CFHA 2AQSA 2ZGPA 4HFUL 3QG6A 4NFDA 2WMPB 3MRLB 2MNWA 4BK5C 3AADB 5D4JA 3MA7B 4Z77B 4WV8A 1AY1L 1B9ZA 2X42A 4WW1A 4HFWB 4B50A 2PTMA 4URKA 4DEVA 3ES1A 1L3WA 1V6KA 3UESA 2E7HA 1NCQC 1E5YA 4FJYA 4EZKA 3FQNB 2WHVA 3QULA 4QGTA 2CGRH 2CAUA 1YPZE 5GGSY 4DXRA 1FZKA 4GW4A 2DQDL 2X29A 3HBGA 4I0PD 4HK9A 4CDWA 3KLLA 5FM5M 4YG3A 1OGSA 2NM1A 2WTRA 4MLOA 2VZTA 3AM8A 4KNSA 4PEEA 4X5XA 5KOMC 3RWJA 2QZQA 2FDJA 1CIYA 1SOQA 5AW7B 5DAXA 4WWOA 4AQZA 3D6EA 1BREA 1R17A 1R081 1LGVA 4HJ0D 4HMCA 2XVLA 1CQKA 1MFEH 4LGRB 1OSZB 5E1QA 5FK8A 1J5IA 3AQDA 3NRQA 2B1HH 3MYZA 1H0BA 3BJLA 2Z64C 1YY9D 1YLBB 4WUUD 5KYXB 4NNPH 5FDWB 2YD2A 4ZW8A 3T8VA 5LNDA 1GGCH 3FB5B 1FPTH 1IS3A 1MUJB 2WNUA 4WSJA 3MOBH 3MNVB 2P37A 5KN5A 1IBHA 4L29A 2EDTA 5JO5A 5FWEA 2CUAA 5HDRA 5LUMA 1QWUA 1UOKA 5A2JH 1MN4A 2P5WE 4Y4HA 5IEHB 4CCJA 1RUF3 4A2GA 5L2KA 1RYYA 1BMV1 4QRQB 4FF9A 4LAQH 3VTMA 4AGMA 2CJUL 2IADB 3MR9A 4FNQA 2J88H 3DRQA 1VB4A 1MCSA 5DD3H 2VGLM 2J3SA 3IMRA 2CRMA 2H4EA 2GJ6E 2BNNA 3QZOA 2QQVA 2GI0A 1CS6A 2RCSH 1UG9A 3WKML 3QIUA 3BPCB 4ADGA 1AIZA 4JJ5B 5HDQH 3LSOB 4OM0L 1AG6A 2B42B 1IB5A 5A6ZA 1N19A 3AS1A 2VDML 5A1AA 3GRWL 1DZ0A 2IDCA 3UX9B 3W0WB 3CHSA 3CUPA 3TOPA 2EH8H 4L1SA 4XZUB 4BQWA 5KBDA 1O5LA 1VGEH 2X28A 4UAOC 3CZLA 1BBJB 1ACCA 1G7IA 2I7SA 1V55B 5AVVB 1F8VA 3DURA 4Y24A 1H19A 1DJIA 4JX0A 3QG7L 2OX0A 1YZZA 4P23A 5C3QA 4G70B 4YWGL 1BZEA 1ZT4B 3ESMA 4GAJH 1AZNA 2LU5A 1G7HA 2VJ8A 3GALA 1W80A 8CGTA 3GI8H 4MMYB 2ZKWA 3OJVC 4TSAL 5DUML 4QHNA 5JDSA 3KYAA 3IDIB 3ZIYA 4L9DA 3RDTA 2Y7LA 5TPWL 5JPNC 5IFAL 2CWRA 2ZYHA 3V5KA 4FQLL 4BXVA 5GZFA 4LLQA 5JIHA 1L7IL 4LHUG 3II2A 5ALCL 5C09A 4OF7A 2XR4A 2J7LA 4M6MH 5C9KA 4K23H 1NANI 4N2NA 1QSZA 1F42A 4NOTA 2J73A 1R19A 1RHI1 3DX8B 3QO0B 1PHMA 4E4SA 2V4VA 3C5JA 3FTGB 1S0IA 3RPIA 1MR5A 5HHOB 1DQIA 1UZZA 1V6IA 3ZHNA 1DYPA 4LT5A 5H2BB 1WFJA 1VPOH 5T33H 1ND0A 1DEEB 2X4SB 1S7XB 2A6KB 4OKVB 4HX1A 1YYNA 3L3IB 2ZOOA 5TD4A 2ILMA 5DK0B 4XCCL 1DVSA 4FZEH 4B1MA 2BXZA 1NMAH 2IH1B 4ISQA 5CWSA 2AH2A 5AZUA 3PQYE 5ADOL 1XGZA 3Q0HA 4K5OA 4P4KB 2R063 4WFGD 1OT5A 2R1WB 2CIKB 3F84A 2OXGA 2CR0A 3NCFB 2FGZA 5DVOA 4BB3A 2E4FA 1YEIL 3LIZH 3BPOC 2JG9A 2NR6A 5T54A 2FWSA 2CL2A 1I9RL 4HIJA 4I3GA 5MENB 4JB9L 2B9VA 4L3EB 2R69A 2V72A 4JAAA 5SX5H 1ILSA 3V0HA 3B9VA 3M7FB 1NOFA 2YPKB 2B16A 4XF1A 4EWDA 2W94A 3G6DL 3US1A 1HIMH 3AMMA 5DLLA 3MNZB 2RALA 4WGKA 2HWE2 5L0QC 3CJIB 5E99L 5DMIH 4H20L 1SLXA 3WF1A 2Z8VC 1PTZA 2HLEA 2YKLH 3VRJA 2F5BL 5DGQA 1QQP2 4KK6C 1V3LA 4X9GA 4PWGA 1UYYA 4AR2A 4BISA 3MJ8B 3D06A 5TGBB 1WLWA 1IC7H 2YLHA 5HJBA 1XH3A 4F9PA 4XPGH 2B5IC 4MMXB 4F3FA 3AGVA 1H3PL 5MEOB 2JB5H 4PP2B 5JZ7C 3ESUF 4RA3A 3ZN6B 1E40A 1KPRA 2Q76A 1R093 4QGMA 5DXDA 3BN6A 5FIXA 2R0KH 3EDFA 4HG6B 4JFQB 5F5AA 2CIIA 2BOBA 1XE0A 5IK3A 1W0VA 1N6UA 4PUBH 4IUGA 4LL1A 3GJBA 4WDIB 1XMWA 5I16A 3ZKYA 1MW1A 3G5XA 5E6IB 2NXYB 2V9UA 4D9QE 5LDUA 1BJ1J 1TMCB 3JWOC 1DQ5A 1E2WA 2EUVA 4GALA 3L2LA 1G0XA 2VZSA 2YC4A 4XBPA 2Z79A 3POYA 1J8SA 2OXHB 3O0RL 3OBZA 4ASMB 1J1XH 2IFGA 5DZOA 4F7MB 4NHKA 1K4CB 3FU8A 2P47B 4YFZA 1BBDL 5JR2A 3VL8A 4CU6A 3VFTA 4Z7OE 3SJVE 5LGHL 1RUI1 1N8ZB 2G19A 4TVPE 4XPTL 5T3XE 4DOHB 1S7UA 2FCTA 4JHVA 4GWIA 5EJZB 2R9HD 1I7UA 4H1LB 1XSKA 4BJLA 1ZGLA 1BBT1 3GUFA 4IKLA 4LZKA 2HT2C 5D2LA 3VG0L 2ZBJA 3VRLF 4I0BA 5FZBA 1A3RL 3I59B 1Z7S2 1CK0L 3ZDXB 4XZ4A 3FHQA 1BLNB 3DO3A 1D5IL 4ODVL 5DRWA 4AKOA 2DFBA 2E51A 4NN0A 4LBNA 1OC1A 1AR73 4FAAB 1HCZA 3RWEB 2OQ6A 5LBSA 4JHWH 4HOXA 1E7UA 3SDDC 2GK0A 3HS0C 3IRCA 3IFLH 5JOZA 5LHDA 2BOJA 3F85A 1VLXA 4XP9L 1JHKL 2P6CA 3HC4H 4YK4C 2A3TA 1ZT7A 5FY5A 1CICD 3IJEB 2XG5B 5D5MF 2BWAA 4PD4K 3OPWA 3GSQB 2HEYF 1R47A 2ZSVB 2XBO1 4CRQA 1U42A 4LESA 5LG6A 4QXHA 3FTVA 3OJDB 4YVNA 5GZNA 1INDL 1OCWL 1RZGA 3S98A 4LB8A 1LXMA 1S7VB 4QF1B 2B0SL 5DJXB 3B3IA 3RNKA 1KFGA 3I6SA 4BZ1L 2PPFA 3KPLB 4JFHE 2A74C 4TQHA 1FNGA 4S1DC 3UMNA 5F7AA 1UFUA 1ZPLA 1MW3A 3I3DA 4R52A 4GINA 4AZ8B 4UFLA 1EMTH 4ETYA 4TUOB 1KN2L 3CFBA 4WZCA 4M43L 4PR5A 4RBPK 5CGYC 1O6UA 4E4HA 3DGDA 1AGFA 2LAGB 3VRLE 2DEXX 5DMKB 1MZFA 1J0KA 1YYLL 2EDRA 4EOWH 3DDGA 1E27B 4ELMF 5IJVB 3TP4A 3FQYA 4LVNC 4XP6L 5ANME 5HGBB 3UL4A 2LUWA 4NAQA 4AH2B 2VCBA 4Y22B 1EV12 2VB5A 1SYSB 4MA1B 1WJ3A 3DVGA 2QFPA 2CNZA 2WOYA 4FNTA 4EZJA 1PO22 1MCEA 3IDMB 1CJYA 2WPGA 4BMEA 1KGUA 4JAMA 1OK8A 4K7PX 5F1IA 5FGSA 2V17H 4QPGC 2Z31C 3CZGA 2VNRA 1IEAB 2W9EH 4L4VA 2JIXA 4TULL 5DA4A 3IZOA 4GMTH 3WEBA 5F7YC 5D5ME 5G4MA 3AKTA 4O4YL 3ISRA 3NCWA 3P9MA 4KQ4H 4MOAA 4XNZB 4W4OC 2OMVB 1ZWIB 1G1YA 4IRJB 2WCGA 4YW4A 3ZDYE 3CH1B 4JGZC 4OLZL 3RI5K 4LK7A 3VBRC 2GJ6D 3QQ3A 4AIEA 4N43C 2BZDA 4ZMTA 3BQUA 1TVHB 2K7QA 3BU7A 2JB4A 5ID1B 3HE6C 1UXLA 1JXJA 2IAMB 4KY1L 4KI5C 1AR63 2WDBA 2RACA 3AP5A 4PJCA 4UQ9A 4Y22A 3JUZA 2FJFB 3P73B 4FS0A 3DV6A 1JXDA 3A6CH 3IETB 2PXJA 2YV8A 2VDLB 1H3UA 3L8QA 3WX5A 3NN8A 3QDJB 3OMIB 1CR9L 3WLWD 2JDUA 3BWSA 2YWYA 4JY4A 3VXRE 4EAEA 4HJGA 1W6QB 3VBOB 1PS3A 4JCWA 2ENSA 4AEDA 2O61A 4WHTA 1JS4A 3OAYK 1N6QL 3GXUA 4J3UA 5JHBA 4Y1XA 2OW7A 1N0XL 1A2YA 3GMQA 3U4KA 4DNLA 1S46A 2VL5A 3QDGB 3FQ4A 3ZJAA 2CNYA 3GBDA 5DXWA 5FX3A 3DO7A 4Y16C 3V4LA 1OOPB 1YXWA 4TXWA 2HG0A 5I1AA 2DCTA 4FQZA 3SE9H 4RH4A 1PZ5A 3BDYL 3V7AG 5FZ6A 2F74B 5LAPA 1JYNA 2RMNA 1WAAF 1BMWA 1I75A 1NGYB 4AENA 1ZTMA 2BY0A 3I2JA 1OKOA 2WQVA 4IRSC 3PG2A 1AQDB 2XLLA 5T1DL 2NZ9D 4XXWA 5D21A 1EQWA 3EYUH 3OKOA 4JKNA 1ND3B 3GXNA 3ET9F 4G9FB 2GNTA 4PCYA 2I60L 5DDHB 1IGFL 4V1DB 5E1AA 4OD3L 4W9FC 3RZCB 1CU4H 1UUSA 1KDKA 4UBDC 3QBTB 1C7TA 3THCA 2PCPA 3PGFH 2OQ7A 3HI5H 4X9BA 1BF8A 4PDWB 1MHPH 4NJ4A 2HVKB 3NFSL 1QWHA 2CPUA 1AE6L 2DCKA 4X8NA 2BW5A 1X5MA 3K91A 1CR7A 2YU1A 5F1OB 4JG1L 1WZ1L 2WNVB 1E3XA 4IJ3C 3ABGA 3O3EB 4YNIA 3NRPA 1MCKA 5HY9A 5IFJB 3ARYA 3FOLB 5B3NA 3C5ZD 3AFKA 2VDPB 2ZUSA 1TENA 2X12A 1MHCA 4M8QB 2Q0AA 3V9EA 2QDNA 1QSVA 2W1UA 4UF0B 1LEGA 4FFVD 1H4HA 4XPAL 5F9OH 5JW4M 4L3AA 3GTTA 2OA9A 1S5HB 1FYTB 3N41B 3DK0A 1UA6H 2WJSA 2XJQA 2J8HA 4E42B 3PLYA 3VX1A 5IG7A 2IXKA 2ZXBA 4QQ2A 3U4EA 4OZFB 2WANA 3CDYA 4L8SA 4M3CF 5E2VH 3P3PA 2QNKA 2OQJB 4P8QA 3KF3A 3U7WH 3M70A 1TZHA 3HNYM 4HUCA 1WAAE 1JZFA 5HJGA 3C8XA 5B2GB 5EO1B 1HN1A 3P4OB 3CQOA 4IEVA 3LZFL 5CUSH 2ZPKL 1SUJA 2UY7A 1KENL