3ZNGC

Ankyrin repeat and socs-box protein 9 (asb9) in complex with elonginb and elonginc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
70
Chain Sequence
DVFLMIRRHKTTIFTDAKSTVFELKRIVEGILKRPPKDDQLFTSQTARPQAPATVEPFSSPPELPDVMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANKYRIN REPEAT AND SOCS BOX PROTEIN 9
publication title Multimeric Complexes Among Ankyrin-Repeat and Socs-Box Protein 9 (Asb9), Elonginbc, and Cullin 5: Insights Into the Structure and Assembly of Ecs-Type Cullin-Ring E3 Ubiquitin Ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 70
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zngC00
1WXVA 5C23A 3UINB 3UQBA 3QWZB 3T9LA 3L54A 1P0RA 3WAPA 3PRMB 3PZDA 1LM8B 3QQ8B 4AP4C 3BINA 2LJ5A 1E8XA 4HK2A 4DXAB 1NDDA 4MM3A 5AZGA 1V5OA 4NAWA 1EO6A 4BOSC 4CO7A 3DQVA 2DX5B 3PLVA 3OLMD 3VHTC 2KJHB 2W9NA 4WWNA 2IYDB 2PE9A 2WX1A 3QC8B 2KJRA 2AWTA 2KO3A 1X1MA 2O2VA 4NAWB 4W9KA 4JIOU 1HE8A 2GBRA 1WJNA 2M1MA 4CYEA 2MW5A 1C1YB 2ZVOA 3N32A 2O2VB 4IWOA 3WA0A 2NBWB 2RR9A 4DDID 5J18A 1WE6A 2MRPA 4FULA 5IA7A 4BKGA 4I6LB 4DHZE 4EOYA 1RFAA 2KFKA 4GN1A 2LGDA 1R4MI 2MX2A 2YLMA 5CHWA 2K1FA 2G4DB 1WX8A 2BF8B 4KIKA 2FIDA 2DZIA 1WMHA 2KFKB 2LUEA 2BGFA 3Q3JA 2FAZA 4DHZB 5CTRC 2L0FA 2N4FA 3UIOB 4ANUA 4GB9A 4IW0A 2L00B 2K8HA 2MSED 4KIKB 3W1YA 2BKFA 1WMHB 2L7RA 4HDQA 4RM8A 3CF6E 4KDLB 2IY0B 1M94A 2L0TA 3QA8A 4TKNA 4HPMB 5AEKB 1IP9A 1YX5B 2DZKA 2HD5B 4NNJB 1ZW7A 1WRDB 3W1SC 1WM2A 4MSQB 4A20A 4GIVA 1BT0A 2FCNA 2ZVNA 2KXJA 1Q5WB 2N9EB 3ML9A 3TJPA 3WIMA 2R2OA 3ZNHB 3ALBA 1UBIA 4A3PA 2LGYA 2OOBB 3DPDA 3HM6X 4M0WB 3GOEA 2XBBC 1A5RA 2IZVB 2CR5A 2GOWA 3EFUA 4G3XB 3AI5A 4IUMB 3DBRI 4LDTB 3VUWA 3WAOA 3PLUA 4HCPB 3APCA 1KM7A 2KVRA 5CHFA 1V49A 1JRUA 3M3JA 4M8MA 4ANVA 3IHPC 3ONSA 4MH0E 4WJNA 3VAWA 4OVVA 1LFDA 3AXCA 3PREA 1WH3A 3UQAA 3NS8A 3AULA 4ICVA 3QK0A 2DZMA 2OJRA 2Z59B 3QCAA 1WXSA 3EC8A 1RAXA 4IC7B 2ZNVB 2LWPA 4W9JA 1V80A 3ZRFA 2FUHB 2KDEB 3A1QA 2KNBA 4KZCA 1WGDA 2V3SA 2BWES 3T8MA 3VXWA 2KWCA 1J0GA 2KQSA 1YQBA 3U30A 2ZZPB 1UZXB 3OJ3A 3VUXA 2KX3A 3M63B 2VRRB 3A1QB 4YL8A 4URKA 3KW5B 2JWZA 2NVUI 2XEWA 2JF5A 3IFWB 2PEAA 2L05A 3HM3A 3ZNZB 4ZRKA 2C7HA 4ASWC 4BBNC 1E7VA 4II2B 4GDLA 2NR2A 2GBMA 2KDIA 2LRUA 3OAWA 4ICUA 4BKSA 2GBKA 1C3TA 4AJWA 4M8NA 1WGYA 4GDLB 2LXAA 2A5UA 3NZUA 1SE9A 3N3KB 2Z0DB 2MBQA 3ML8A 3RD2A 1H4RA 2D10A 4JQWC 5E6NA 2R2QA 2KLGA 4GOCA 2DENB 3I3TB 3B08A 1AARA 2D3GA 3ZVVA 3U7DA 1XT9B 2JT4B 1RLFA 4E71A 4ANXA 2NPTA 3IBEA 4JGHB 3KYCD 4ZRJA 4FHKA 2KZRA 3DCGA 1CMXB 1OEYJ 5HKHA 3TMPB 4MGYE 3PSEB 4FJVB 5TR5A 2PE6B 2NPTB 2M0XA 2N1VA 4AJYB 1UELA 1NBFC 2AYOB 2BYFA 3W1SA 3H9DA 2FCQA 1WX7A 4KVGB 1TBEA 2HJ8A 2KD0A 3JSVA 3DBSA 3SHQA 1YJ1A 3PHWB 1S3SG 5AZHA 5LXHA 2N7DA 4NQKE 3RULA 3AU5A 2NBVB 1UD7A 4RMAA 3DVNU 5D6JB 3V62A 5KHQA 2DYBA 2FNJB 1E5WA 4K1RB 5DPWA 2LVQA 2D2QA 3JSVB 4GU2A 3RZFA 1S1QB 4N9F4 4FA6A 1SIFA 2KWVB 3M62B 4K7SA 3O65B 3PTFC 4W9EA 3ECIA 4KDIC 3PT2B 3VVWB 4WJQA 4ZYNA 3A4RA 3MTNB 1LQBA 3KUZA 3L16A 1SGHA 1E90A 3VQIA 1PQSA 4TV3A 1WR1A 3ZUNA 4NPNA 3ZRCA 4W9GA 2K8BA 1WZ0A 2JZZA 4JLCA 4CHKA 4W9CA 2EMTA 3V6CB 1XQQA 1WFYA 4DK5A 3MJWA 5FR6A 1WJUA 2RGFA 1GJZA 3H7PA 3A9KA 2G4SA 2IO1B 1TZ1A 5E6OA 4HJKA 4PYZA 5D94A 4DHJD 2WWZA 1Y8RC 1J19A 2G45B 4GDKA 5LLIA 4HVBA 2C60A 3PV1A 3H7PB 3A9KB 2WX0A 3N30A 3DDCB 3R3MA 5C1ZA 1RRBA 2IO0B 2KANA 1U4AA 2CHWA 4X57B 3PS6A 4GDKB 1GC6A 3RZWC 4HCNB 3DBHI 1WE7A 3SD5A 1Q0WB 1OEYA 2KX0A 2IO2B 1R4NI 3C0RB 3VH3B 1ZGUB 2FIFA 3H1UA 1Q1OA 4HDOA 5D7GA 2O6VD 3MHSD 1V6EA 2J0JA 2D07B 2CHZA 3A4SC 4KSLC 3TCAA 2V1YA 2ZPNA 2C7NB 3ZIMA 1V5TA 4GSWA 2MP2A 1XD3B 1Z2MA 4FN2A 2YVCA 1IPGA 1KOTA 4MSMB 4II3B 2NS5A 1I42A 1ZKHA 1UH6A 2BWFA 1EUVB 3D32A 2KHWB 3EECA 3RCZA 4A3OA 4EZKA 1J8CA 3CMMB 2MP2B 3QIJA 4NJ6A 1E8ZA 4MJSA 1UBQA 2KN5A 4HPLB 4EKUA 1V2YA 3RT3B 2HTHA 2FCSA 2K8CA 2N9XA 2XK5A 4FLHA 2KC1A 2G3QB 1D3ZA 2V4LA 2KQ7A 4MJSB 1YIWA 3P2BA 5D2MB 2K6DB 4GMVA 3V60A 3ZTDA 4PS3A 4KZ0A 4DBGA 4WAAA 4KSKC 4IM0A 4FHJA 2PPHA 2KC2A 4I6NB 2ZPYA 4LJPB 2DAJA 2UYZB 1WF9A 2IBIB 3LJ3A 4LCDE 3ZNID 2HE7A 2KWUB 3L0WB 2Z0EB 5EDSA 3B1LX 1P9DU 4TQ0A 2CKHB 2FCMA 3AU4A 3VH4B 3R7QA 1P3QU 4IWPA 2L3ZA 3HIZA 2ASQA 2UWQA 5DPTA 1GNUA 1IYFA 3HHMA 2JVCA 3QJZA 4W9FA 4AUQC 2L76A 1WGGA 4KV2A 4LJOB 2MBEA 1T0YA 1ISNA 3SU8X 1L7YA 2EMSA 1V9JA 5G2NA 2MCNB 1V81A 3DVNV 2JZ3B 3GZNI 3VTUA 3ZLZA 2LVPA 2KTRA 4W9LA 3WANA 4WQOB 3TBLD 5JHAA 2ZNVC 5AZFA 4ZRIA 2ZJDA 2CHXA 4ZDVA 4EUTA 4B6WA 3ENEA 3QAQA 2WYQA 3ZDMC 1Z5SB 3BY4B 3PPAA 4K81A 4MELA 2N7EA 1P98A 2K6QA 4WJPA 2LXCA 2K25A 2KTRB 2MA9B 4ANWA 5DPRA 3ZW3A 1F9JA 4DDGD 2LASA 3HK0A 4W9HA 3RYTA 4FADA 3CSTA 5J2RA 1VD2A 2J7QB 2LI5A 3S2AA 3VTWA 4MEMA 3JYUA 3VUYA 4AOFA 2Y5BB 3KYDD 4HWIB 5CX3A 4BBNF 2IY1B 1FXTB 2KTFA 5IAAC 4XZ4A 2KDBA 2K39A 3KUCB 3R66C 2I1JA 2RD0A 4PYUA 2AL3A 4BVUC 5BO4B 4IM3A 1WM3A 1H8CA 4MGKE 2I1KA 2REXA 3H7SA 4BOZB 3UGBB 3KVFB 2M17A 2BYEA 1EF1A 2IO3B 1WX9A 3CSFA 3UIPB 2LGXA 4HXDA 5G55A 4W9IA 4FBJB 1WXAA 4EEWA 3L13A 3SDLC 2KDFB 3L08A 3B0AA 2GBJA 4RM9A 4GXBA 2NCNA 2AL6A 1NI2A 4IWQA 1YD8U 2J0MA 5L95C 1GG3A 2EKEC 2DAFA 2N1WA 4TUUA 3WALA 4K7UA 3V61A 2MWSB 4E3CA 2BYVE 4F7ZA 2J0KA 3PRZA 2KKCA 3KH0A 3H6NA 1GC7A 4NY0A 1L2NA 3RUIB 2GMIC 1KJTA 2LRWA 3IG3A 4LDTD 1E8WA 1WGRA 5J17A 5DCNA 2JY6A 2JUOA 4G0NB 1WXMA 2JPHA 4TQ1A 4XC2A 1WJ6A 2ZEQA 3Q3FA 1MG8A 2JRHA 3DVGX 3APFA 4E74A 2RSUA 1K8RB 1WGHA 1TTNA 2MBHA 1E7UA 4B95A 2MBBB 3VFKA 4B9KA 3NY5A 3K9OB 1WI0A 3KUDB 4J6IA 4F8CB 2GBNA 2JRIB 5E6PA 3VDZA 5DPSA 4MGZE 3L10B 4XX5A 3ZO5B 5JHBA 3QX1A 3JW0X 5L83A 2DYOA 2M4NA 3A33B 4G11A 1WIAA 2KMAA 4W9DA 3PHXB 2AEHA 4DHJB 2KOXA 4FJZA 4GGQA 1OGWA 2ZCBA 1WY8A 2MBOA 1I35A 3VTVA 3PRPB 4IM2A 4HLEA 3X23A 4WJOA 3WAMA 2DYMA 1QZEA 3IVFA 3U8ZA 2KK8A 2KMCA 2O6VA 1KLVA 5JZEB 2BPSA 3PGEA 4G50A 1YX6B 3NZSA 3A9JA 4OVUA 3ZDTA 5LXIB 2DZJA 2ZCCA 4WWPA 4JL9A 4P7IA 4AWJA 3ZKJC 2LZ6A 2O6VB 3ZTCA 2A4ZA 2LD9A 3NOBA 2KFJA 3A9JB 5GMVA 2XK5B 2RPQA 1GUAB 4BKSD 2MQJA 3LDZE 1OTRB 2LVOA 4PS8A 4NQLB 1EF5A 3R7RA 1UGMA 3TL5A 3X0WA 3ZNGC 2KLCA 2B3AA 1VCBA 1LXDA 2WDTB 4MGIE 4EFOA 4EZLA 5JH5C 4EZJA 2C9WB 1WZ3A 3QHTA 1WYWB 4BKTA 3V6EB 2CS4A 2MLBA 2QHOA 3TIXA 1P1AA 3JVZX 4MDKE 2D11A 3K9PB 2N9PC 2CU1A 4F1SA 2L8JA 1V86A 4IG7B 5CHVC 2C5LC 1WR6E 5KHOA 4K7WA 4FJYA 4I6PA 2M8SA 3M95A 3UF8A 2JXXA 3DVGY 3L17A 4PS7A 1G6JA 3NHEB 4BFRA 3EHVA 4DWFA 2PJHA 3APDA 2BKRB 4WWOA 2KJ6A 3PVLA 3OJ4B 3QARA 3DOWA 3DBLI 2NBUA 1E8YA 1OQYA 2C7MB 4NJ7A 2DHZA 1WJ4A 1TGZB
chains in the Genus database with same CATH superfamily
3UINB 3UQBA 3T9LA 1P0RA 3MC0B 3WAPA 1LM8B 2L32A 4AP4C 2VZKD 3IT4B 5H92C 4HK2A 3RNAC 4DXAB 1NDDA 4MM3A 4JPSA 4NAWA 1EO6A 3WCQA 4BOSC 2DX5B 3PLVA 3W5VB 3AMZA 3P4PB 2W9NA 2PE9A 1X1MA 4W9KA 1PFDA 4A6QA 1YNTE 2MW5A 1C1YB 1T0RC 3WA0A 1SE2A 3GZNB 5J18A 5IA7A 4BKGA 4EOYA 2VH1A 2WP9B 2BS2B 1XO3A 2MX2A 2YLMA 1L0XB 2G4DB 2W54A 1FRRA 4C7YA 2J42A 2LUEA 3Q3JA 2FAZA 3URYA 2RDBC 1SIJA 2N4FA 1QF6A 1HEZE 4IW0A 2L00B 4KIKB 3W1YA 1WMHB 1AWDA 2JZPA 3CF6E 1M94A 3QA8A 1D5XC 1NYRA 1TKGA 2HD5B 4NNJB 1WRDB 2WXKA 1TS5A 5G5HA 2KXJA 1N63A 3ALBA 1UBIA 1L0VB 3HM6X 2KQ4X 2XBBC 2IZVB 3VUWA 3PLUA 1KM7A 1V49A 3M3JA 4M8MA 3IHPC 4WJNA 3VAWA 4OVVA 2V3NA 3QCAA 1WXSA 3EC8A 4IC7B 2ZNVB 2FUHB 2KNBA 4NJCA 2V3SA 2BWES 2KWCA 1J0GA 2KQSA 3OG5A 1UZXB 3OJ3A 3VUXA 1P7EA 2VRRB 4URKA 3KW5B 1UNSA 3UI3A 3GP7A 3IFWB 2L05A 3ZNZB 4ASWC 4II2B 1KLGD 2NR2A 1NI3A 2KDIA 3NRZA 1SE3A 4M00A 4M8NA 4GDLB 2KMMA 1JMLA 1I4RA 3BIID 1H4RA 4JQWC 4P1CC 4GOCA 1CJEA 2DENB 1AARA 1XT9B 3LB8C 4JGHB 4FHKA 1WSPA 4MGYE 3PSEB 4WAFA 1I4PA 2MEKA 1SF0A 2NPTB 2M0XA 1FCLA 3AE9B 1TYGB 2L83A 1UELA 1NBFC 4CQNA 1TBEA 2PMVA 4ARCA 3SHQA 4RMAA 2NBVB 2FNJB 1E5WA 2LVQA 3RZFA 1N5XA 5BMIA 2BB6A 1SIFA 1SE4A 3PTFC 4W9EA 3ZJVA 3ECIA 2N9LA 4KDIC 3A4RA 4LLGM 4P1BC 1E90A 3VQIA 3PZ7A 4TV3A 4D2KA 1JALA 1STEA 1WR1A 4NPNA 4WURA 3RMKC 2JZZA 4CHKA 3V6CB 1XQQA 5C3JB 1WJUA 3MJ5A 5E6OA 4RGMA 4DQOC 1V97A 1J19A 2G45B 3W5UB 1FFVA 2KANA 2WGSA 1KLUD 5AUIA 4X57B 4GDKB 3RZWC 1GC6A 3DBHI 4YWGG 2INCC 4FXCA 1ZGUB 4B0EA 2WNMA 5BMHA 1QLBB 2J0JA 2CHZA 5HI1A 1XXGA 4KSLC 2TSSA 1ET6A 1R4MB 4GSWA 1ZOYB 1KOTA 3BVGA 1EUVB 1T5XD 3EECA 3RCZA 4A3OA 1WWTA 2QCZA 2MP2B 1E8ZA 4HPLB 2FCSA 2N9XA 2WS3B 2MHJA 4GMVA 4OZCA 1B1ZA 4KZ0A 4IM0A 3U52E 2Z8LA 4US9A 3AECB 1PGAA 1V8CA 5E6JA 2IBIB 3LJ3A 2HE7A 1ENFA 3GE8C 2FCMA 1QKZA 1RWSA 2ASQA 1IYFA 3HHMA 4W9FA 2AQ2B 1Y56A 2WU5B 2L76A 1WGGA 3IAM1 1MHXA 3Q6BA 2MBEA 1T0YA 4HJGE 3DVNV 1FM0D 3GZNI 2G1EA 3ZLZA 2KTRA 4W9LA 5JHAA 5AZFA 4ZRIA 4Q2JA 3FC4A 4EUTA 3O13A 4K81A 2G9HD 2N7EA 4WJPA 2HJ1A 3Q8EA 2MA9B 2WDRB 1VZ8A 3HK0A 1IBXB 4FADA 3CSTA 2J7QB 4OHJA 2LI5A 2Y5BB 5IOIA 2E3TA 1L0YB 2I1JA 4PYUA 5BO4B 4IM3A 3DHHC 1H8CA 3Q2AC 4BOZB 1F1HA 2BTEA 3UIPB 5G55A 1TS2A 4YSZB 3L13A 2GBJA 4RM9A 4IWQA 2J0MA 5L95C 5HHDG 1EWYC 2EKEC 3PRZA 3KH0A 1L2NA 2LRWA 4LDTD 2IJ0A 2JUOA 4K3CA 4XC2A 2KACA 2ZEQA 1SSNA 1K52A 2WXJA 5LNK1 2MBHA 2GRIA 4B9KA 3NY5A 3KUDB 4ARIA 4F8CB 2JRIB 2ZW1A 5DPSA 5JHBA 3QX1A 2M4NA 3A33B 2PKOA 2H88B 2KMAA 2SEBD 2RDGA 2AEHA 1QQRA 2KYWA 1ACCA 1OGWA 3AEAB 1I35A 2XNAC 1LO5D 2RMMA 3X23A 1YMHE 3WAMA 3U8ZA 2KK8A 1RM6C 2HTME 4GLSC 1KLVA 4JWSC 1E0ZA 3NZSA 4WIPA 3ZDTA 2DZJA 3NVYA 2ZCCA 4JL9A 4P7IA 4AWJA 3ZKJC 3ZTCA 2LD9A 3NOBA 2X8XX 2XK5B 4BKSD 3LDZE 3R7RA 1QILA 1TT5B 1UGMA 3ZNGC 2KLCA 2B3AA 4WWMA 1F52A 4MGIE 4EFOA 4EZJA 3B2GA 1P1AA 1VZ7A 3K9PB 2WDVB 5CHVC 5KHOA 2RPVA 1FXAA 1PDXA 4FJYA 2M8SA 3P42A 1C79A 5HG2A 4PS7A 4BFRA 3EHVA 1B9RA 1J7BA 1KFYB 1TZOA 2UU7A 1XCQL 3GE3C 1WXVA 3Q3MC 5C23A 2DLBA 4B0MA 3PRMB 1F2RC 3QQ8B 2KDMA 4KGSA 4XWTA 1N60A 2LJ5A 1E8XA 5AZGA 3AE7B 1VJKA 3DQVA 3MC8A 1ROEA 3VHTC 4LNIA 1FNUA 3QC8B 2WX1A 4RF1A 4MM3B 3I9V1 4NAWB 2W82A 5BYSA 1WJNA 2IDYA 4MH8A 2ZVOA 3N32A 1J7CA 4P6VF 4DDID 1YJJA 2WXLA 3ETRA 2KFKA 4HEA1 4GN1A 1R4MI 4EE2A 3KQ4A 2BF8B 2FIDA 1N6ZA 2FE8A 2BGFA 3UIOB 3GS2A 2IY0B 5AEKB 2K22A 3W1SC 2NTTA 2SAKA 3SFEB 4A20A 4GIVA 1BT0A 1QOAA 2FCNA 3Q3NC 4KX6B 4J3OD 3TJPA 4A3PA 2LGYA 2OOBB 3RFZB 3RNEC 2CR5A 3EFUA 5KHQA 3WAOA 2KAJA 5IKCM 4ACFA 1BUIC 3SEBA 4H2AA 5CHFA 4YXDB 2M0AA 1VRAB 2N7JA 3ONSA 4HROA 4R3DA 3PREA 3UQAA 3AULA 3FAHA 2DZMA 2V9HA 1RAXA 1UGJA 2PTLA 1YQ4B 3A1QA 1WGDA 3AB5A 3DHGC 2I2YA 2INDC 3IT6B 2CJOA 5D3DA 1AYFA 1MPEA 3HM3A 4REZA 4ZRKA 2C7HA 1E7VA 1YN5A 2CU3A 2LRUA 4BKSA 1KTKA 1N61A 2GBKA 1ZP0B 1MVKA 3AEGB 2A5UA 3H8HA 3ML8A 3RD2A 3NVWA 1ZPSA 2KLGA 3I3TB 1VLBA 3ZVVA 2PLPA 3U7DA 1IGCA 3P63A 3R2IA 5TSSA 1M4VA 1CMXB 1OEYJ 3ZQ4A 3TMPB 4FJVB 3GB1A 3H9DA 2FCQA 1WX7A 1DOYA 2HJ8A 2KD0A 1QOBA 1S3SG 4NQKE 4NZLB 3T3OA 2DYBA 4P16A 4GU2A 1C78A 5I4DA 4A55A 2VZKB 2KWVB 3M62B 2PIAA 4K7SA 1GB4A 2BYTA 5JXVA 3V05A 3PT2B 3DBLB 3VVWB 1L4ZB 4ZYNA 1LQBA 1PQSA 1MI0A 3ZUNA 1TS4A 1WZ0A 4W9CA 2EMTA 1DOIA 1WFYA 3MJWA 5FR6A 3H7PA 3A9KA 1TZ1A 1L6VA 5D94A 2WWZA 4YT0B 4HVBA 3R3MA 2C60A 3N30A 3DDCB 2IO0B 5FR3A 1ET9A 3PS6A 4QAYA 1UF0A 2IO2B 2J4XA 2FIFA 2KT7A 4LTUA 3I57A 5C2TB 2D07B 3A4SC 3Q8BA 3AEFB 1FD6A 1LGRA 4ZRPA 1YOVB 3ZIMA 1XD3B 1Z2MA 4FN2A 4MSMB 1A70A 3D32A 2MJEA 1J8CA 4XE0A 2Y3AA 1MHHE 3T3NA 1WRIA 4MJSA 2KN5A 2K8CA 4FLHA 2KC1A 5D2MB 1YIWA 3C19A 3R2TA 3RN9C 2Y5CA 4FHJA 3CWIA 4LJPB 2DAJA 3ZNID 1WF9A 3DBRB 3PZ8A 4LCDE 3MFGA 2YEPF 3L0WB 2Z0EB 4LNOA 1XLQA 2QJLA 3B1LX 1P9DU 2CKHB 3AU4A 3R7QA 1P3QU 5BYQA 2UWQA 1GNUA 2BS3B 3QJZA 1JWMD 3SU8X 1YN4A 2MCNB 3BVZA 1JWBD 4BZAA 5FKAC 4ZDVA 1YQ3B 2WYQA 1FIQA 3BY4B 4MELA 3AM9A 4ANWA 2K6QA 5MPOA 1NYQA 2K25A 2KTRB 5T8IA 5DPRA 2LASA 3RYTA 2EKIA 3TSSA 3FILA 2K9XA 3B9JA 3ZGZA 1SEBD 1VZ6A 3S2AA 4MEMA 3JYUA 1HTQA 1JW9D 4JE3B 4BBNF 2IY1B 3Q8FA 3NUHB 2KTFA 2WXFA 2H89B 5EE0A 2ON8A 4BVUC 4ITKA 4NAMA 1WM3A 2I1KA 2M17A 2BYEA 5AUKA 2IO3B 1WXQA 4HXDA 4S17A 4RGOS 1NENB 1CQVA 1JRPA 4GXBA 1YD8U 3FKYA 2DAFA 2N1WA 3WALA 4K7UA 2MWSB 2BYVE 2J0KA 1K50A 5GXGB 2KKCA 2GMIC 4TQ1A 1WJ6A 1MG8A 3DVGX 2QEJC 2XN9C 1XLPA 4E74A 2RSUA 1K8RB 1E7UA 3AE8B 1JROA 3N9YC 3K9OB 1KH0A 3VDZA 4MGZE 3L10B 2QDFA 2DYOA 1XLOA 1WIAA 2JYEA 3R8BA 2MJDA 2D3CA 2JX5A 1SJHD 2MBOA 1XLNA 2N9KA 3VTVA 4IM2A 1TY2A 3Q8CA 2BPSA 4OVUA 3A9JA 3KLSX 4IKGA 2KFJA 2PW9A 1OTRB 4NQLB 1EF5A 3TL5A 4HRSA 2DBYA 3N20C 3QHTA 4BKTA 1WYWB 3V6EB 3JVZX 2D11A 1HA5A 4ZRQA 1ZXIA 4HKQA 4YSXB 2LHDA 3NHEB 4WWOA 1E10A 3VRBB 3QARA 3DBLI 1E8YA 1WJ4A 4M01A 2Q5WD 3BK1A 1UWXA 3QWZB 1HQRD 3AEBB 3VR8B 3BINA 2QILA 3SR6A 4C80A 1PYWD 1V5OA 1PUTA 4CO7A 3OLMD 2JQRB 1JWAD 2KJHB 3ZJUA 3AE4B 4WWNA 5HFYA 2KJRA 2AWTA 2O2VA 1C4AA 2V3PA 4LNKA 4JIOU 2NMQA 1HE8A 2GBRA 5EE9A 2M1MA 4CYEA 4IWOA 2RR9A 1SXTA 1WE6A 2MRPA 2LUMA 4I6LB 1NEKB 4DHZE 2LGDA 2WXMA 1WX8A 2WXPA 1FPYA 2INNE 2KFKB 2L0FA 4ANUA 1ZDXA 2MSED 1EM7A 2D3BA 4HDQA 2PVGC 2J52A 2L0TA 4TKNA 4HPMB 3N1ZC 1F2RI 1IP9A 1YX5B 1ZW7A 3DHIC 4M0WA 4MSQB 2ZVNA 3ML9A 2R2OA 5BYRA 4N6EB 2PVOD 1A5RA 4YTNB 2GOWA 4LDTB 2WXQA 3DBRI 4HCPB 4JX1C 4DXFA 1JRUA 4MH0E 1BXTA 3AXCA 1DGJA 2K0PA 3NS8A 2AQ1B 4ICVA 3QK0A 1C76A 2LWPA 3ZRFA 1V80A 1AN8A 1TKYA 4KZCA 3VXWA 3T8MA 1YQBA 4HPPA 4PK1A 3A1QB 2N0SB 2NVUI 1FFUA 4MT5A 1SB3C 3OAWA 4YSYB 1T0SC 1WYGA 2INPE 1C3TA 4AJWA 2LXAA 2EELA 2ACZB 2WXGA 2WQYB 1C4CA 1SE9A 2Z0DB 2MBQA 2D10A 5E6NA 1KF6B 3B08A 1RLFA 2HDEA 4E71A 1FO4A 3KYCD 5HKHA 2PE6B 3N1XC 3EUB2 4AJYB 4RF0A 1C9FA 2BYFA 4KVGB 1I4GA 2D3AA 2WU2B 3JSVA 3DBSA 1YJ1A 5LXHA 2N7DA 3RULA 3BYYB 3EFCA 4KGRA 3AU5A 5D6JB 3V62A 5DPWA 3KWLA 2D2QA 3AEEB 3EA6A 1S1QB 4N9F4 2JXTA 4FA6A 1Q10A 2JSVX 4WJQA 3L16A 2QC8A 1NVID 2RDHA 2G4SA 1GOZA 2KN4A 4DHJD 1Y8RC 5C1ZA 3PV1A 3H7PB 3A9KB 2WX0A 2WXOA 3ZXVA 1U4AA 1UUPA 1WE7A 3C8YA 1OEYA 3P4RB 3C0RB 3IAS1 3H1UA 3NS1A 4HDOA 1IUEA 4DXGA 2O6VD 3MHSD 3TCAA 2ZPNA 1V5TA 3HVDA 4C4VA 4II3B 2NS5A 1I42A 2BWFA 4EZKA 2KHWB 2VH2A 2BQQA 4YTMB 3CMMB 3QIJA 3TEXA 3NVZA 3AN1A 4EKUA 1V2YA 1JWUD 2HTHA 2XK5A 1KRHA 1QOFA 2V4LA 1D3ZA 4MJSB 3ZTDA 3V60A 1AW7A 4DBGA 1HTOA 4KSKC 2L1AA 4I6NB 5H8YE 2UYZB 3LXFA 3TEYA 2KWUB 4BAXA 4TSSA 2LFIA 4TQ0A 2GI9A 3DWGC 3VH4B 4IWPA 2L3ZA 1FCCC 2FBWB 5DPTA 1FRDA 1K53A 2JVCA 3Q14C 1FXIA 4AUQC 1TIFA 4KV2A 4LJOB 2EMSA 3VTUA 5G2NA 1V81A 2JZ3B 2WHIA 5IP4D 1IGDA 4WQOB 2ZJDA 2CHXA 2Y5PA 3ZDMC 1Z5SB 1P98A 2LXCA 4W9HA 4IOIE 1RYJA 5J2RA 1E7PB 1VD2A 2BVCA 3RNGC 3VTWA 4AOFA 2KWDA 4HWIB 1FXTB 4RCOA 3FILB 5IAAC 4XZ4A 2KDBA 3R66C 2RD0A 2AL3A 3RI7C 3H7SA 2NTSA 2OEDA 3CSFA 2W3SA 4FBJB 1F0ZA 1WXAA 4EEWA 3P4QB 3ZJTA 4L1BA 3BK2A 1NI2A 1E9MA 4TUUA 2WXIA 1GC7A 4NY0A 1OQQA 4ZHOA 1KJTA 3IG3A 1E8WA 1WGRA 5DCNA 2JY6A 2WDQB 4G0NB 1WXMA 2QMTA 2JRHA 3APFA 3W9CB 4XGAB 1TTNA 2MBBB 1T6BX 4J6IA 2GBNA 3VRAB 2IGDA 1P7FA 4G11A 2K3UA 1L6UA 1I4XA 1V1OA 2BS4B 4W9DA 3PHXB 3AE1B 5EE3A 5IN7A 3OWEB 4GGQA 4FJZA 3MHZA 4ZOHC 1MFWA 1WY8A 3RNCC 4K3BA 1FMAD 2AQ3B 3ABVB 1F77A 1ESFA 4HLEA 1ZUD2 1TJEA 3IVFA 4YTPB 1D5MC 4OZBA 2O6VA 2KMCA 4G50A 4WH4A 1J7AA 2LZ6A 2A4ZA 2R61A 2GB1A 3A9JB 5GMVA 2RPQA 1GUAB 3AV8A 4WQMA 1V1PA 2D5GA 3X0WA 2LGIA 1VCBA 2IGHA 2V4IB 1CZPA 2WDTB 4OVZA 3SFDB 4EZLA 2WXRA 4M02A 1R4NB 2C9WB 2QHOA 3BVMA 2IGGA 3TIXA 2N9PC 4F1SA 1L4DB 2C5LC 2OJWA 4I6PA 1TKEA 1VDVA 3L17A 4DWFA 3APDA 4XWWA 3U7ZA 2BKRB 3PVLA 3OJ4B 1OQYA 2C7MB 1T0QC 3DCGA 1TGZB 4US8A 3AE3B 3V3XA 4C56C 1QT9A 4RGTA 3L54A 3PZDA 4OZAA 2LGSA 2IYDB 2KO3A 3CIRB 4A90A 4C7ZA 3MP9A 2O2VB 4LNFA 2NBWB 2JWUA 3MC9A 2KVZA 1QOGA 2J53A 1R7SA 4FULA 1RFAA 4L2YA 4ZYSA 3BZDB 5CHWA 1C4PA 2K1FA 1GB1A 4KIKA 2DZIA 3Q3OC 2QSDA 1WMHA 5G5GA 3BYTB 4DHZB 5CTRC 4XDCA 1FEHA 1YJIA 3E9SA 4GB9A 2K8HA 2BKFA 4RM8A 2L7RA 4KDLB 3AH7A 1TY0A 2DZKA 3BWUD 1WM2A 4USAA 2N9EB 1Q5WB 3AE2B 3WIMA 3ZNHB 4JWUC 3DPDA 4M0WB 3GOEA 1C77A 2K5PA 4IUMB 4G3XB 3AI5A 2JU6X 3APCA 2KVRA 4ANVA 1LFDA 1WH3A 1JQ4A 2OJRA 2Z59B 2ONQA 1VR9A 4LNNA 4HKZE 4W9JA 2KDEB 1K51A 2B76B 3N1YC 2OHFA 3U30A 3EGRA 2ZZPB 2KX3A 3M63B 2WXNA 4YL8A 1D4BA 2JWZA 2XEWA 2JF5A 3NZ3A 2LEKA 2PEAA 4AQ7A 2V0GA 4LK0M 4BBNC 4S0RA 4GDLA 2GBMA 5EE1A 4ICUA 4MACA 1WGYA 3I63C 3NZUA 3Q8AA 3N3KB 2ZW0A 1SJED 1I4HA 2R2QA 2LJIA 1E6EB 3HUIA 3TEWA 2D3GA 2BBCA 2JT4B 3VR9B 4ANXA 2W55A 2NPTA 3IBEA 4ZRJA 2KZRA 2L52A 2WLBA 5TR5A 2N1VA 3U4EG 1GPXA 2AYOB 3W1SA 2X38A 3DWMA 3PHWB 4KKIA 5AZHA 1UD7A 3DVNU 1JWSD 4K1RB 4KGTA 4L23A 3JSVB 4O1NA 4N59A 4RFBA 4RGNA 1D6EC 3O65B 4XDDA 1YN3A 4OW0A 1SBBB 1HXYD 3MTNB 3KUZA 1SGHA 3L4PA 2LHEA 3LYYA 3ZRCA 4W9GA 5FK9C 2K8BA 1MG4A 4JLCA 1N62A 3TEZA 4DK5A 1PGBA 2RGFA 1GJZA 2IO1B 4HJKA 4XYCA 1HZ5A 4PYZA 2M56B 3P4SB 4GDKA 5LLIA 3Q69A 3NJTA 1RRBA 1RFKA 2CHWA 3SD5A 4HCNB 1Q0WB 2KX0A 1R4NI 2MH7A 3VH3B 4ZHPA 1Q1OA 2FUG1 5D7GA 3ZXRA 1V6EA 2V1YA 2C7NB 2I38A 2W3RA 2MP2A 2YVCA 1IPGA 4C00A 1DYQA 1ZKHA 1UH6A 1WGKA 1EWCA 3P1MA 4A9AA 4NJ6A 4C4VB 1UBQA 1EU4A 3NVVA 2BT6A 3RT3B 2G3QB 2KQ7A 2WXHA 3P2BA 2K6DB 4PS3A 2ICIA 3NG0A 3RNFC 1TS3A 4WAAA 3PO0A 2PPHA 2KC2A 1CK1A 3AE6B 5IO9A 2ZPYA 4UDUC 5EDSA 4TMAB 3HVZA 1FNVA 5D3IB 3TUOA 3HIZA 1XF5L 1HZ6A 1ISNA 1L7YA 1V9JA 4RH6A 2LVPA 1FNWA 3HRDD 3WANA 3TBLD 2ZNVC 1XCTL 2JYTA 1IBXA 4B6WA 3QAQA 3ENEA 3PPAA 2IPKD 2LMCA 3ZW3A 2DNFA 1F9JA 4DDGD 1XEEA 1OQRA 3VUYA 2AX5A 1GAQB 2QIEB 3KYDD 5CX3A 2K39A 1ZXHA 3KUCB 4AS1A 1I7HA 3AE5B 2YEPB 2DWQA 4MGKE 2REXA 3ZYYX 1N5WA 1ZE3D 3UGBB 3KVFB 1EF1A 1WX9A 2LGXA 4W9IA 4PT5A 3SDLC 2KDFB 3L08A 3B0AA 3IXSA 3KWVA 1OFFA 2NCNA 2AL6A 3AEDB 1GG3A 1MJDA 4A8XC 3V61A 2M19A 1UWMA 4E3CA 4F7ZA 4N58A 3I5JC 1BMLC 4KKJA 3H6NA 2GLSA 3RUIB 5J17A 5BMGA 2JPHA 3Q3FA 1I4QA 1L5PA 1T3QA 3J9CA 4B95A 1WGHA 3VFKA 1PGXA 3U2SC 1WI0A 5E6PA 4XX5A 3ZO5B 3JW0X 5L83A 1ZDVA 4DHJB 2E6XA 1D5ZC 2KOXA 2ZCBA 3PRPB 4WJOA 2DYMA 1QZEA 4IDIA 2MJ3A 5JZEB 3PGEA 1YX6B 5LXIB 1DOXA 4WWPA 2O6VB 2BW2A 2BB5A 2MQJA 2LVOA 4PS8A 3W2DA 1LXDA 3DBHB 3B2FA 5JH5C 3E56A 1WZ3A 1V1PB 2CS4A 2MLBA 3RPFC 3RNBC 4MDKE 4RNAA 1JCKB 2CU1A 2L8JA 1V86A 4IG7B 2CJNA 1WR6E 4K7WA 3M95A 3UF8A 2JXXA 3DVGY 1G6JA 2PJHA 1EU3A 2KJ6A 3DOWA 2NBUA 4NJ7A 2DHZA
chains in the Genus database with same CATH topology
1WXVA 5C23A 3UINB 3UQBA 3QWZB 3T9LA 3L54A 1P0RA 3WAPA 3PRMB 3PZDA 1LM8B 3QQ8B 4AP4C 3BINA 2LJ5A 1E8XA 4HK2A 4DXAB 1NDDA 4MM3A 5AZGA 1V5OA 4NAWA 1EO6A 4BOSC 4CO7A 3DQVA 2DX5B 3PLVA 3OLMD 3VHTC 2KJHB 2W9NA 4WWNA 2IYDB 2PE9A 2WX1A 3QC8B 2KJRA 2AWTA 2KO3A 1X1MA 2O2VA 4NAWB 4W9KA 4JIOU 1HE8A 2GBRA 1WJNA 2M1MA 4CYEA 2MW5A 1C1YB 2ZVOA 3N32A 2O2VB 4IWOA 3WA0A 2NBWB 2RR9A 4DDID 5J18A 1WE6A 2MRPA 4FULA 5IA7A 4BKGA 4I6LB 4DHZE 4EOYA 1RFAA 2KFKA 4GN1A 2LGDA 1R4MI 2MX2A 2YLMA 5CHWA 2K1FA 2G4DB 1WX8A 2BF8B 4KIKA 2FIDA 2DZIA 1WMHA 2KFKB 2LUEA 2BGFA 3Q3JA 2FAZA 4DHZB 5CTRC 2L0FA 2N4FA 3UIOB 4ANUA 4GB9A 4IW0A 2L00B 2K8HA 2MSED 4KIKB 3W1YA 2BKFA 1WMHB 2L7RA 4HDQA 4RM8A 3CF6E 4KDLB 2IY0B 1M94A 2L0TA 3QA8A 4TKNA 4HPMB 5AEKB 1IP9A 1YX5B 2DZKA 2HD5B 4NNJB 1ZW7A 1WRDB 3W1SC 1WM2A 4MSQB 4A20A 4GIVA 1BT0A 2FCNA 2ZVNA 2KXJA 1Q5WB 2N9EB 3ML9A 3TJPA 3WIMA 2R2OA 3ZNHB 3ALBA 1UBIA 4A3PA 2LGYA 2OOBB 3DPDA 3HM6X 4M0WB 3GOEA 2XBBC 1A5RA 2IZVB 2CR5A 2GOWA 3EFUA 4G3XB 3AI5A 4IUMB 3DBRI 4LDTB 3VUWA 3WAOA 3PLUA 4HCPB 3APCA 1KM7A 2KVRA 5CHFA 1V49A 1JRUA 3M3JA 4M8MA 4ANVA 3IHPC 3ONSA 4MH0E 4WJNA 3VAWA 4OVVA 1LFDA 3AXCA 3PREA 1WH3A 3UQAA 3NS8A 3AULA 4ICVA 3QK0A 2DZMA 2OJRA 2Z59B 3QCAA 1WXSA 3EC8A 1RAXA 4IC7B 2ZNVB 2LWPA 4W9JA 1V80A 3ZRFA 2FUHB 2KDEB 3A1QA 2KNBA 4KZCA 1WGDA 2V3SA 2BWES 3T8MA 3VXWA 2KWCA 1J0GA 2KQSA 1YQBA 3U30A 2ZZPB 1UZXB 3OJ3A 3VUXA 2KX3A 3M63B 2VRRB 3A1QB 4YL8A 4URKA 3KW5B 2JWZA 2NVUI 2XEWA 2JF5A 3IFWB 2PEAA 2L05A 3HM3A 3ZNZB 4ZRKA 2C7HA 4ASWC 4BBNC 1E7VA 4II2B 4GDLA 2NR2A 2GBMA 2KDIA 2LRUA 3OAWA 4ICUA 4BKSA 2GBKA 1C3TA 4AJWA 4M8NA 1WGYA 4GDLB 2LXAA 2A5UA 3NZUA 1SE9A 3N3KB 2Z0DB 2MBQA 3ML8A 3RD2A 1H4RA 2D10A 4JQWC 5E6NA 2R2QA 2KLGA 4GOCA 2DENB 3I3TB 3B08A 1AARA 2D3GA 3ZVVA 3U7DA 1XT9B 2JT4B 1RLFA 4E71A 4ANXA 2NPTA 3IBEA 4JGHB 3KYCD 4ZRJA 4FHKA 2KZRA 3DCGA 1CMXB 1OEYJ 5HKHA 3TMPB 4MGYE 3PSEB 4FJVB 5TR5A 2PE6B 2NPTB 2M0XA 2N1VA 4AJYB 1UELA 1NBFC 2AYOB 2BYFA 3W1SA 3H9DA 2FCQA 1WX7A 4KVGB 1TBEA 2HJ8A 2KD0A 3JSVA 3DBSA 3SHQA 1YJ1A 3PHWB 1S3SG 5AZHA 5LXHA 2N7DA 4NQKE 3RULA 3AU5A 2NBVB 1UD7A 4RMAA 3DVNU 5D6JB 3V62A 5KHQA 2DYBA 2FNJB 1E5WA 4K1RB 5DPWA 2LVQA 2D2QA 3JSVB 4GU2A 3RZFA 1S1QB 4N9F4 4FA6A 1SIFA 2KWVB 3M62B 4K7SA 3O65B 3PTFC 4W9EA 3ECIA 4KDIC 3PT2B 3VVWB 4WJQA 4ZYNA 3A4RA 3MTNB 1LQBA 3KUZA 3L16A 1SGHA 1E90A 3VQIA 1PQSA 4TV3A 1WR1A 3ZUNA 4NPNA 3ZRCA 4W9GA 2K8BA 1WZ0A 2JZZA 4JLCA 4CHKA 4W9CA 2EMTA 3V6CB 1XQQA 1WFYA 4DK5A 3MJWA 5FR6A 1WJUA 2RGFA 1GJZA 3H7PA 3A9KA 2G4SA 2IO1B 1TZ1A 5E6OA 4HJKA 4PYZA 5D94A 4DHJD 2WWZA 1Y8RC 1J19A 2G45B 4GDKA 5LLIA 4HVBA 2C60A 3PV1A 3H7PB 3A9KB 2WX0A 3N30A 3DDCB 3R3MA 5C1ZA 1RRBA 2IO0B 2KANA 1U4AA 2CHWA 4X57B 3PS6A 4GDKB 1GC6A 3RZWC 4HCNB 3DBHI 1WE7A 3SD5A 1Q0WB 1OEYA 2KX0A 2IO2B 1R4NI 3C0RB 3VH3B 1ZGUB 2FIFA 3H1UA 1Q1OA 4HDOA 5D7GA 2O6VD 3MHSD 1V6EA 2J0JA 2D07B 2CHZA 3A4SC 4KSLC 3TCAA 2V1YA 2ZPNA 2C7NB 3ZIMA 1V5TA 4GSWA 2MP2A 1XD3B 1Z2MA 4FN2A 2YVCA 1IPGA 1KOTA 4MSMB 4II3B 2NS5A 1I42A 1ZKHA 1UH6A 2BWFA 1EUVB 3D32A 2KHWB 3EECA 3RCZA 4A3OA 4EZKA 1J8CA 3CMMB 2MP2B 3QIJA 4NJ6A 1E8ZA 4MJSA 1UBQA 2KN5A 4HPLB 4EKUA 1V2YA 3RT3B 2HTHA 2FCSA 2K8CA 2N9XA 2XK5A 4FLHA 2KC1A 2G3QB 1D3ZA 2V4LA 2KQ7A 4MJSB 1YIWA 3P2BA 5D2MB 2K6DB 4GMVA 3V60A 3ZTDA 4PS3A 4KZ0A 4DBGA 4WAAA 4KSKC 4IM0A 4FHJA 2PPHA 2KC2A 4I6NB 2ZPYA 4LJPB 2DAJA 2UYZB 1WF9A 2IBIB 3LJ3A 4LCDE 3ZNID 2HE7A 2KWUB 3L0WB 2Z0EB 5EDSA 3B1LX 1P9DU 4TQ0A 2CKHB 2FCMA 3AU4A 3VH4B 3R7QA 1P3QU 4IWPA 2L3ZA 3HIZA 2ASQA 2UWQA 5DPTA 1GNUA 1IYFA 3HHMA 2JVCA 3QJZA 4W9FA 4AUQC 2L76A 1WGGA 4KV2A 4LJOB 2MBEA 1T0YA 1ISNA 3SU8X 1L7YA 2EMSA 1V9JA 5G2NA 2MCNB 1V81A 3DVNV 2JZ3B 3GZNI 3VTUA 3ZLZA 2LVPA 2KTRA 4W9LA 3WANA 4WQOB 3TBLD 5JHAA 2ZNVC 5AZFA 4ZRIA 2ZJDA 2CHXA 4ZDVA 4EUTA 4B6WA 3ENEA 3QAQA 2WYQA 3ZDMC 1Z5SB 3BY4B 3PPAA 4K81A 4MELA 2N7EA 1P98A 2K6QA 4WJPA 2LXCA 2K25A 2KTRB 2MA9B 4ANWA 5DPRA 3ZW3A 1F9JA 4DDGD 2LASA 3HK0A 4W9HA 3RYTA 4FADA 3CSTA 5J2RA 1VD2A 2J7QB 2LI5A 3S2AA 3VTWA 4MEMA 3JYUA 3VUYA 4AOFA 2Y5BB 3KYDD 4HWIB 5CX3A 4BBNF 2IY1B 1FXTB 2KTFA 5IAAC 4XZ4A 2KDBA 2K39A 3KUCB 3R66C 2I1JA 2RD0A 4PYUA 2AL3A 4BVUC 5BO4B 4IM3A 1WM3A 1H8CA 4MGKE 2I1KA 2REXA 3H7SA 4BOZB 3UGBB 3KVFB 2M17A 2BYEA 1EF1A 2IO3B 1WX9A 3CSFA 3UIPB 2LGXA 4HXDA 5G55A 4W9IA 4FBJB 1WXAA 4EEWA 3L13A 3SDLC 2KDFB 3L08A 3B0AA 2GBJA 4RM9A 4GXBA 2NCNA 2AL6A 1NI2A 4IWQA 1YD8U 2J0MA 5L95C 1GG3A 2EKEC 2DAFA 2N1WA 4TUUA 3WALA 4K7UA 3V61A 2MWSB 4E3CA 2BYVE 4F7ZA 2J0KA 3PRZA 2KKCA 3KH0A 3H6NA 1GC7A 4NY0A 1L2NA 3RUIB 2GMIC 1KJTA 2LRWA 3IG3A 4LDTD 1E8WA 1WGRA 5J17A 5DCNA 2JY6A 2JUOA 4G0NB 1WXMA 2JPHA 4TQ1A 4XC2A 1WJ6A 2ZEQA 3Q3FA 1MG8A 2JRHA 3DVGX 3APFA 4E74A 2RSUA 1K8RB 1WGHA 1TTNA 2MBHA 1E7UA 4B95A 2MBBB 3VFKA 4B9KA 3NY5A 3K9OB 1WI0A 3KUDB 4J6IA 4F8CB 2GBNA 2JRIB 5E6PA 3VDZA 5DPSA 4MGZE 3L10B 4XX5A 3ZO5B 5JHBA 3QX1A 3JW0X 5L83A 2DYOA 2M4NA 3A33B 4G11A 1WIAA 2KMAA 4W9DA 3PHXB 2AEHA 4DHJB 2KOXA 4FJZA 4GGQA 1OGWA 2ZCBA 1WY8A 2MBOA 1I35A 3VTVA 3PRPB 4IM2A 4HLEA 3X23A 4WJOA 3WAMA 2DYMA 1QZEA 3IVFA 3U8ZA 2KK8A 2KMCA 2O6VA 1KLVA 5JZEB 2BPSA 3PGEA 4G50A 1YX6B 3NZSA 3A9JA 4OVUA 3ZDTA 5LXIB 2DZJA 2ZCCA 4WWPA 4JL9A 4P7IA 4AWJA 3ZKJC 2LZ6A 2O6VB 3ZTCA 2A4ZA 2LD9A 3NOBA 2KFJA 3A9JB 5GMVA 2XK5B 2RPQA 1GUAB 4BKSD 2MQJA 3LDZE 1OTRB 2LVOA 4PS8A 4NQLB 1EF5A 3R7RA 1UGMA 3TL5A 3X0WA 3ZNGC 2KLCA 2B3AA 1VCBA 1LXDA 2WDTB 4MGIE 4EFOA 4EZLA 5JH5C 4EZJA 2C9WB 1WZ3A 3QHTA 1WYWB 4BKTA 3V6EB 2CS4A 2MLBA 2QHOA 3TIXA 1P1AA 3JVZX 4MDKE 2D11A 3K9PB 2N9PC 2CU1A 4F1SA 2L8JA 1V86A 4IG7B 5CHVC 2C5LC 1WR6E 5KHOA 4K7WA 4FJYA 4I6PA 2M8SA 3M95A 3UF8A 2JXXA 3DVGY 3L17A 4PS7A 1G6JA 3NHEB 4BFRA 3EHVA 4DWFA 2PJHA 3APDA 2BKRB 4WWOA 2KJ6A 3PVLA 3OJ4B 3QARA 3DOWA 3DBLI 2NBUA 1E8YA 1OQYA 2C7MB 4NJ7A 2DHZA 1WJ4A 1TGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXV A;  5C23 A;  3UIN B;  3UQB A;  3QWZ B;  3T9L A;  3L54 A;  1P0R A;  3WAP A;  3PRM B;  3PZD A;  1LM8 B;  3QQ8 B;  4AP4 C;  3BIN A;  2LJ5 A;  1E8X A;  4HK2 A;  4DXA B;  1NDD A;  4MM3 A;  5AZG A;  1V5O A;  4NAW A;  1EO6 A;  4BOS C;  4CO7 A;  3DQV A;  2DX5 B;  3PLV A;  3OLM D;  3VHT C;  2KJH B;  2W9N A;  4WWN A;  2IYD B;  2PE9 A;  2WX1 A;  3QC8 B;  2KJR A;  2AWT A;  2KO3 A;  1X1M A;  2O2V A;  4NAW B;  4W9K A;  4JIO U;  1HE8 A;  2GBR A;  1WJN A;  2M1M A;  4CYE A;  2MW5 A;  1C1Y B;  2ZVO A;  3N32 A;  2O2V B;  4IWO A;  3WA0 A;  2NBW B;  2RR9 A;  4DDI D;  5J18 A;  1WE6 A;  2MRP A;  4FUL A;  5IA7 A;  4BKG A;  4I6L B;  4DHZ E;  4EOY A;  1RFA A;  2KFK A;  4GN1 A;  2LGD A;  1R4M I;  2MX2 A;  2YLM A;  5CHW A;  2K1F A;  2G4D B;  1WX8 A;  2BF8 B;  4KIK A;  2FID A;  2DZI A;  1WMH A;  2KFK B;  2LUE A;  2BGF A;  3Q3J A;  2FAZ A;  4DHZ B;  5CTR C;  2L0F A;  2N4F A;  3UIO B;  4ANU A;  4GB9 A;  4IW0 A;  2L00 B;  2K8H A;  2MSE D;  4KIK B;  3W1Y A;  2BKF A;  1WMH B;  2L7R A;  4HDQ A;  4RM8 A;  3CF6 E;  4KDL B;  2IY0 B;  1M94 A;  2L0T A;  3QA8 A;  4TKN A;  4HPM B;  5AEK B;  1IP9 A;  1YX5 B;  2DZK A;  2HD5 B;  4NNJ B;  1ZW7 A;  1WRD B;  3W1S C;  1WM2 A;  4MSQ B;  4A20 A;  4GIV A;  1BT0 A;  2FCN A;  2ZVN A;  2KXJ A;  1Q5W B;  2N9E B;  3ML9 A;  3TJP A;  3WIM A;  2R2O A;  3ZNH B;  3ALB A;  1UBI A;  4A3P A;  2LGY A;  2OOB B;  3DPD A;  3HM6 X;  4M0W B;  3GOE A;  2XBB C;  1A5R A;  2IZV B;  2CR5 A;  2GOW A;  3EFU A;  4G3X B;  3AI5 A;  4IUM B;  3DBR I;  4LDT B;  3VUW A;  3WAO A;  3PLU A;  4HCP B;  3APC A;  1KM7 A;  2KVR A;  5CHF A;  1V49 A;  1JRU A;  3M3J A;  4M8M A;  4ANV A;  3IHP C;  3ONS A;  4MH0 E;  4WJN A;  3VAW A;  4OVV A;  1LFD A;  3AXC A;  3PRE A;  1WH3 A;  3UQA A;  3NS8 A;  3AUL A;  4ICV A;  3QK0 A;  2DZM A;  2OJR A;  2Z59 B;  3QCA A;  1WXS A;  3EC8 A;  1RAX A;  4IC7 B;  2ZNV B;  2LWP A;  4W9J A;  1V80 A;  3ZRF A;  2FUH B;  2KDE B;  3A1Q A;  2KNB A;  4KZC A;  1WGD A;  2V3S A;  2BWE S;  3T8M A;  3VXW A;  2KWC A;  1J0G A;  2KQS A;  1YQB A;  3U30 A;  2ZZP B;  1UZX B;  3OJ3 A;  3VUX A;  2KX3 A;  3M63 B;  2VRR B;  3A1Q B;  4YL8 A;  4URK A;  3KW5 B;  2JWZ A;  2NVU I;  2XEW A;  2JF5 A;  3IFW B;  2PEA A;  2L05 A;  3HM3 A;  3ZNZ B;  4ZRK A;  2C7H A;  4ASW C;  4BBN C;  1E7V A;  4II2 B;  4GDL A;  2NR2 A;  2GBM A;  2KDI A;  2LRU A;  3OAW A;  4ICU A;  4BKS A;  2GBK A;  1C3T A;  4AJW A;  4M8N A;  1WGY A;  4GDL B;  2LXA A;  2A5U A;  3NZU A;  1SE9 A;  3N3K B;  2Z0D B;  2MBQ A;  3ML8 A;  3RD2 A;  1H4R A;  2D10 A;  4JQW C;  5E6N A;  2R2Q A;  2KLG A;  4GOC A;  2DEN B;  3I3T B;  3B08 A;  1AAR A;  2D3G A;  3ZVV A;  3U7D A;  1XT9 B;  2JT4 B;  1RLF A;  4E71 A;  4ANX A;  2NPT A;  3IBE A;  4JGH B;  3KYC D;  4ZRJ A;  4FHK A;  2KZR A;  3DCG A;  1CMX B;  1OEY J;  5HKH A;  3TMP B;  4MGY E;  3PSE B;  4FJV B;  5TR5 A;  2PE6 B;  2NPT B;  2M0X A;  2N1V A;  4AJY B;  1UEL A;  1NBF C;  2AYO B;  2BYF A;  3W1S A;  3H9D A;  2FCQ A;  1WX7 A;  4KVG B;  1TBE A;  2HJ8 A;  2KD0 A;  3JSV A;  3DBS A;  3SHQ A;  1YJ1 A;  3PHW B;  1S3S G;  5AZH A;  5LXH A;  2N7D A;  4NQK E;  3RUL A;  3AU5 A;  2NBV B;  1UD7 A;  4RMA A;  3DVN U;  5D6J B;  3V62 A;  5KHQ A;  2DYB A;  2FNJ B;  1E5W A;  4K1R B;  5DPW A;  2LVQ A;  2D2Q A;  3JSV B;  4GU2 A;  3RZF A;  1S1Q B;  4N9F 4;  4FA6 A;  1SIF A;  2KWV B;  3M62 B;  4K7S A;  3O65 B;  3PTF C;  4W9E A;  3ECI A;  4KDI C;  3PT2 B;  3VVW B;  4WJQ A;  4ZYN A;  3A4R A;  3MTN B;  1LQB A;  3KUZ A;  3L16 A;  1SGH A;  1E90 A;  3VQI A;  1PQS A;  4TV3 A;  1WR1 A;  3ZUN A;  4NPN A;  3ZRC A;  4W9G A;  2K8B A;  1WZ0 A;  2JZZ A;  4JLC A;  4CHK A;  4W9C A;  2EMT A;  3V6C B;  1XQQ A;  1WFY A;  4DK5 A;  3MJW A;  5FR6 A;  1WJU A;  2RGF A;  1GJZ A;  3H7P A;  3A9K A;  2G4S A;  2IO1 B;  1TZ1 A;  5E6O A;  4HJK A;  4PYZ A;  5D94 A;  4DHJ D;  2WWZ A;  1Y8R C;  1J19 A;  2G45 B;  4GDK A;  5LLI A;  4HVB A;  2C60 A;  3PV1 A;  3H7P B;  3A9K B;  2WX0 A;  3N30 A;  3DDC B;  3R3M A;  5C1Z A;  1RRB A;  2IO0 B;  2KAN A;  1U4A A;  2CHW A;  4X57 B;  3PS6 A;  4GDK B;  1GC6 A;  3RZW C;  4HCN B;  3DBH I;  1WE7 A;  3SD5 A;  1Q0W B;  1OEY A;  2KX0 A;  2IO2 B;  1R4N I;  3C0R B;  3VH3 B;  1ZGU B;  2FIF A;  3H1U A;  1Q1O A;  4HDO A;  5D7G A;  2O6V D;  3MHS D;  1V6E A;  2J0J A;  2D07 B;  2CHZ A;  3A4S C;  4KSL C;  3TCA A;  2V1Y A;  2ZPN A;  2C7N B;  3ZIM A;  1V5T A;  4GSW A;  2MP2 A;  1XD3 B;  1Z2M A;  4FN2 A;  2YVC A;  1IPG A;  1KOT A;  4MSM B;  4II3 B;  2NS5 A;  1I42 A;  1ZKH A;  1UH6 A;  2BWF A;  1EUV B;  3D32 A;  2KHW B;  3EEC A;  3RCZ A;  4A3O A;  4EZK A;  1J8C A;  3CMM B;  2MP2 B;  3QIJ A;  4NJ6 A;  1E8Z A;  4MJS A;  1UBQ A;  2KN5 A;  4HPL B;  4EKU A;  1V2Y A;  3RT3 B;  2HTH A;  2FCS A;  2K8C A;  2N9X A;  2XK5 A;  4FLH A;  2KC1 A;  2G3Q B;  1D3Z A;  2V4L A;  2KQ7 A;  4MJS B;  1YIW A;  3P2B A;  5D2M B;  2K6D B;  4GMV A;  3V60 A;  3ZTD A;  4PS3 A;  4KZ0 A;  4DBG A;  4WAA A;  4KSK C;  4IM0 A;  4FHJ A;  2PPH A;  2KC2 A;  4I6N B;  2ZPY A;  4LJP B;  2DAJ A;  2UYZ B;  1WF9 A;  2IBI B;  3LJ3 A;  4LCD E;  3ZNI D;  2HE7 A;  2KWU B;  3L0W B;  2Z0E B;  5EDS A;  3B1L X;  1P9D U;  4TQ0 A;  2CKH B;  2FCM A;  3AU4 A;  3VH4 B;  3R7Q A;  1P3Q U;  4IWP A;  2L3Z A;  3HIZ A;  2ASQ A;  2UWQ A;  5DPT A;  1GNU A;  1IYF A;  3HHM A;  2JVC A;  3QJZ A;  4W9F A;  4AUQ C;  2L76 A;  1WGG A;  4KV2 A;  4LJO B;  2MBE A;  1T0Y A;  1ISN A;  3SU8 X;  1L7Y A;  2EMS A;  1V9J A;  5G2N A;  2MCN B;  1V81 A;  3DVN V;  2JZ3 B;  3GZN I;  3VTU A;  3ZLZ A;  2LVP A;  2KTR A;  4W9L A;  3WAN A;  4WQO B;  3TBL D;  5JHA A;  2ZNV C;  5AZF A;  4ZRI A;  2ZJD A;  2CHX A;  4ZDV A;  4EUT A;  4B6W A;  3ENE A;  3QAQ A;  2WYQ A;  3ZDM C;  1Z5S B;  3BY4 B;  3PPA A;  4K81 A;  4MEL A;  2N7E A;  1P98 A;  2K6Q A;  4WJP A;  2LXC A;  2K25 A;  2KTR B;  2MA9 B;  4ANW A;  5DPR A;  3ZW3 A;  1F9J A;  4DDG D;  2LAS A;  3HK0 A;  4W9H A;  3RYT A;  4FAD A;  3CST A;  5J2R A;  1VD2 A;  2J7Q B;  2LI5 A;  3S2A A;  3VTW A;  4MEM A;  3JYU A;  3VUY A;  4AOF A;  2Y5B B;  3KYD D;  4HWI B;  5CX3 A;  4BBN F;  2IY1 B;  1FXT B;  2KTF A;  5IAA C;  4XZ4 A;  2KDB A;  2K39 A;  3KUC B;  3R66 C;  2I1J A;  2RD0 A;  4PYU A;  2AL3 A;  4BVU C;  5BO4 B;  4IM3 A;  1WM3 A;  1H8C A;  4MGK E;  2I1K A;  2REX A;  3H7S A;  4BOZ B;  3UGB B;  3KVF B;  2M17 A;  2BYE A;  1EF1 A;  2IO3 B;  1WX9 A;  3CSF A;  3UIP B;  2LGX A;  4HXD A;  5G55 A;  4W9I A;  4FBJ B;  1WXA A;  4EEW A;  3L13 A;  3SDL C;  2KDF B;  3L08 A;  3B0A A;  2GBJ A;  4RM9 A;  4GXB A;  2NCN A;  2AL6 A;  1NI2 A;  4IWQ A;  1YD8 U;  2J0M A;  5L95 C;  1GG3 A;  2EKE C;  2DAF A;  2N1W A;  4TUU A;  3WAL A;  4K7U A;  3V61 A;  2MWS B;  4E3C A;  2BYV E;  4F7Z A;  2J0K A;  3PRZ A;  2KKC A;  3KH0 A;  3H6N A;  1GC7 A;  4NY0 A;  1L2N A;  3RUI B;  2GMI C;  1KJT A;  2LRW A;  3IG3 A;  4LDT D;  1E8W A;  1WGR A;  5J17 A;  5DCN A;  2JY6 A;  2JUO A;  4G0N B;  1WXM A;  2JPH A;  4TQ1 A;  4XC2 A;  1WJ6 A;  2ZEQ A;  3Q3F A;  1MG8 A;  2JRH A;  3DVG X;  3APF A;  4E74 A;  2RSU A;  1K8R B;  1WGH A;  1TTN A;  2MBH A;  1E7U A;  4B95 A;  2MBB B;  3VFK A;  4B9K A;  3NY5 A;  3K9O B;  1WI0 A;  3KUD B;  4J6I A;  4F8C B;  2GBN A;  2JRI B;  5E6P A;  3VDZ A;  5DPS A;  4MGZ E;  3L10 B;  4XX5 A;  3ZO5 B;  5JHB A;  3QX1 A;  3JW0 X;  5L83 A;  2DYO A;  2M4N A;  3A33 B;  4G11 A;  1WIA A;  2KMA A;  4W9D A;  3PHX B;  2AEH A;  4DHJ B;  2KOX A;  4FJZ A;  4GGQ A;  1OGW A;  2ZCB A;  1WY8 A;  2MBO A;  1I35 A;  3VTV A;  3PRP B;  4IM2 A;  4HLE A;  3X23 A;  4WJO A;  3WAM A;  2DYM A;  1QZE A;  3IVF A;  3U8Z A;  2KK8 A;  2KMC A;  2O6V A;  1KLV A;  5JZE B;  2BPS A;  3PGE A;  4G50 A;  1YX6 B;  3NZS A;  3A9J A;  4OVU A;  3ZDT A;  5LXI B;  2DZJ A;  2ZCC A;  4WWP A;  4JL9 A;  4P7I A;  4AWJ A;  3ZKJ C;  2LZ6 A;  2O6V B;  3ZTC A;  2A4Z A;  2LD9 A;  3NOB A;  2KFJ A;  3A9J B;  5GMV A;  2XK5 B;  2RPQ A;  1GUA B;  4BKS D;  2MQJ A;  3LDZ E;  1OTR B;  2LVO A;  4PS8 A;  4NQL B;  1EF5 A;  3R7R A;  1UGM A;  3TL5 A;  3X0W A;  3ZNG C;  2KLC A;  2B3A A;  1VCB A;  1LXD A;  2WDT B;  4MGI E;  4EFO A;  4EZL A;  5JH5 C;  4EZJ A;  2C9W B;  1WZ3 A;  3QHT A;  1WYW B;  4BKT A;  3V6E B;  2CS4 A;  2MLB A;  2QHO A;  3TIX A;  1P1A A;  3JVZ X;  4MDK E;  2D11 A;  3K9P B;  2N9P C;  2CU1 A;  4F1S A;  2L8J A;  1V86 A;  4IG7 B;  5CHV C;  2C5L C;  1WR6 E;  5KHO A;  4K7W A;  4FJY A;  4I6P A;  2M8S A;  3M95 A;  3UF8 A;  2JXX A;  3DVG Y;  3L17 A;  4PS7 A;  1G6J A;  3NHE B;  4BFR A;  3EHV A;  4DWF A;  2PJH A;  3APD A;  2BKR B;  4WWO A;  2KJ6 A;  3PVL A;  3OJ4 B;  3QAR A;  3DOW A;  3DBL I;  2NBU A;  1E8Y A;  1OQY A;  2C7M B;  4NJ7 A;  2DHZ A;  1WJ4 A;  1TGZ B; 
#chains in the Genus database with same CATH topology
 3UIN B;  3UQB A;  3T9L A;  1P0R A;  3MC0 B;  3WAP A;  1LM8 B;  2L32 A;  4AP4 C;  2VZK D;  3IT4 B;  5H92 C;  4HK2 A;  3RNA C;  4DXA B;  1NDD A;  4MM3 A;  4JPS A;  4NAW A;  1EO6 A;  3WCQ A;  4BOS C;  2DX5 B;  3PLV A;  3W5V B;  3AMZ A;  3P4P B;  2W9N A;  2PE9 A;  1X1M A;  4W9K A;  1PFD A;  4A6Q A;  1YNT E;  2MW5 A;  1C1Y B;  1T0R C;  3WA0 A;  1SE2 A;  3GZN B;  5J18 A;  5IA7 A;  4BKG A;  4EOY A;  2VH1 A;  2WP9 B;  2BS2 B;  1XO3 A;  2MX2 A;  2YLM A;  1L0X B;  2G4D B;  2W54 A;  1FRR A;  4C7Y A;  2J42 A;  2LUE A;  3Q3J A;  2FAZ A;  3URY A;  2RDB C;  1SIJ A;  2N4F A;  1QF6 A;  1HEZ E;  4IW0 A;  2L00 B;  4KIK B;  3W1Y A;  1WMH B;  1AWD A;  2JZP A;  3CF6 E;  1M94 A;  3QA8 A;  1D5X C;  1NYR A;  1TKG A;  2HD5 B;  4NNJ B;  1WRD B;  2WXK A;  1TS5 A;  5G5H A;  2KXJ A;  1N63 A;  3ALB A;  1UBI A;  1L0V B;  3HM6 X;  2KQ4 X;  2XBB C;  2IZV B;  3VUW A;  3PLU A;  1KM7 A;  1V49 A;  3M3J A;  4M8M A;  3IHP C;  4WJN A;  3VAW A;  4OVV A;  2V3N A;  3QCA A;  1WXS A;  3EC8 A;  4IC7 B;  2ZNV B;  2FUH B;  2KNB A;  4NJC A;  2V3S A;  2BWE S;  2KWC A;  1J0G A;  2KQS A;  3OG5 A;  1UZX B;  3OJ3 A;  3VUX A;  1P7E A;  2VRR B;  4URK A;  3KW5 B;  1UNS A;  3UI3 A;  3GP7 A;  3IFW B;  2L05 A;  3ZNZ B;  4ASW C;  4II2 B;  1KLG D;  2NR2 A;  1NI3 A;  2KDI A;  3NRZ A;  1SE3 A;  4M00 A;  4M8N A;  4GDL B;  2KMM A;  1JML A;  1I4R A;  3BII D;  1H4R A;  4JQW C;  4P1C C;  4GOC A;  1CJE A;  2DEN B;  1AAR A;  1XT9 B;  3LB8 C;  4JGH B;  4FHK A;  1WSP A;  4MGY E;  3PSE B;  4WAF A;  1I4P A;  2MEK A;  1SF0 A;  2NPT B;  2M0X A;  1FCL A;  3AE9 B;  1TYG B;  2L83 A;  1UEL A;  1NBF C;  4CQN A;  1TBE A;  2PMV A;  4ARC A;  3SHQ A;  4RMA A;  2NBV B;  2FNJ B;  1E5W A;  2LVQ A;  3RZF A;  1N5X A;  5BMI A;  2BB6 A;  1SIF A;  1SE4 A;  3PTF C;  4W9E A;  3ZJV A;  3ECI A;  2N9L A;  4KDI C;  3A4R A;  4LLG M;  4P1B C;  1E90 A;  3VQI A;  3PZ7 A;  4TV3 A;  4D2K A;  1JAL A;  1STE A;  1WR1 A;  4NPN A;  4WUR A;  3RMK C;  2JZZ A;  4CHK A;  3V6C B;  1XQQ A;  5C3J B;  1WJU A;  3MJ5 A;  5E6O A;  4RGM A;  4DQO C;  1V97 A;  1J19 A;  2G45 B;  3W5U B;  1FFV A;  2KAN A;  2WGS A;  1KLU D;  5AUI A;  4X57 B;  4GDK B;  3RZW C;  1GC6 A;  3DBH I;  4YWG G;  2INC C;  4FXC A;  1ZGU B;  4B0E A;  2WNM A;  5BMH A;  1QLB B;  2J0J A;  2CHZ A;  5HI1 A;  1XXG A;  4KSL C;  2TSS A;  1ET6 A;  1R4M B;  4GSW A;  1ZOY B;  1KOT A;  3BVG A;  1EUV B;  1T5X D;  3EEC A;  3RCZ A;  4A3O A;  1WWT A;  2QCZ A;  2MP2 B;  1E8Z A;  4HPL B;  2FCS A;  2N9X A;  2WS3 B;  2MHJ A;  4GMV A;  4OZC A;  1B1Z A;  4KZ0 A;  4IM0 A;  3U52 E;  2Z8L A;  4US9 A;  3AEC B;  1PGA A;  1V8C A;  5E6J A;  2IBI B;  3LJ3 A;  2HE7 A;  1ENF A;  3GE8 C;  2FCM A;  1QKZ A;  1RWS A;  2ASQ A;  1IYF A;  3HHM A;  4W9F A;  2AQ2 B;  1Y56 A;  2WU5 B;  2L76 A;  1WGG A;  3IAM 1;  1MHX A;  3Q6B A;  2MBE A;  1T0Y A;  4HJG E;  3DVN V;  1FM0 D;  3GZN I;  2G1E A;  3ZLZ A;  2KTR A;  4W9L A;  5JHA A;  5AZF A;  4ZRI A;  4Q2J A;  3FC4 A;  4EUT A;  3O13 A;  4K81 A;  2G9H D;  2N7E A;  4WJP A;  2HJ1 A;  3Q8E A;  2MA9 B;  2WDR B;  1VZ8 A;  3HK0 A;  1IBX B;  4FAD A;  3CST A;  2J7Q B;  4OHJ A;  2LI5 A;  2Y5B B;  5IOI A;  2E3T A;  1L0Y B;  2I1J A;  4PYU A;  5BO4 B;  4IM3 A;  3DHH C;  1H8C A;  3Q2A C;  4BOZ B;  1F1H A;  2BTE A;  3UIP B;  5G55 A;  1TS2 A;  4YSZ B;  3L13 A;  2GBJ A;  4RM9 A;  4IWQ A;  2J0M A;  5L95 C;  5HHD G;  1EWY C;  2EKE C;  3PRZ A;  3KH0 A;  1L2N A;  2LRW A;  4LDT D;  2IJ0 A;  2JUO A;  4K3C A;  4XC2 A;  2KAC A;  2ZEQ A;  1SSN A;  1K52 A;  2WXJ A;  5LNK 1;  2MBH A;  2GRI A;  4B9K A;  3NY5 A;  3KUD B;  4ARI A;  4F8C B;  2JRI B;  2ZW1 A;  5DPS A;  5JHB A;  3QX1 A;  2M4N A;  3A33 B;  2PKO A;  2H88 B;  2KMA A;  2SEB D;  2RDG A;  2AEH A;  1QQR A;  2KYW A;  1ACC A;  1OGW A;  3AEA B;  1I35 A;  2XNA C;  1LO5 D;  2RMM A;  3X23 A;  1YMH E;  3WAM A;  3U8Z A;  2KK8 A;  1RM6 C;  2HTM E;  4GLS C;  1KLV A;  4JWS C;  1E0Z A;  3NZS A;  4WIP A;  3ZDT A;  2DZJ A;  3NVY A;  2ZCC A;  4JL9 A;  4P7I A;  4AWJ A;  3ZKJ C;  3ZTC A;  2LD9 A;  3NOB A;  2X8X X;  2XK5 B;  4BKS D;  3LDZ E;  3R7R A;  1QIL A;  1TT5 B;  1UGM A;  3ZNG C;  2KLC A;  2B3A A;  4WWM A;  1F52 A;  4MGI E;  4EFO A;  4EZJ A;  3B2G A;  1P1A A;  1VZ7 A;  3K9P B;  2WDV B;  5CHV C;  5KHO A;  2RPV A;  1FXA A;  1PDX A;  4FJY A;  2M8S A;  3P42 A;  1C79 A;  5HG2 A;  4PS7 A;  4BFR A;  3EHV A;  1B9R A;  1J7B A;  1KFY B;  1TZO A;  2UU7 A;  1XCQ L;  3GE3 C;  1WXV A;  3Q3M C;  5C23 A;  2DLB A;  4B0M A;  3PRM B;  1F2R C;  3QQ8 B;  2KDM A;  4KGS A;  4XWT A;  1N60 A;  2LJ5 A;  1E8X A;  5AZG A;  3AE7 B;  1VJK A;  3DQV A;  3MC8 A;  1ROE A;  3VHT C;  4LNI A;  1FNU A;  3QC8 B;  2WX1 A;  4RF1 A;  4MM3 B;  3I9V 1;  4NAW B;  2W82 A;  5BYS A;  1WJN A;  2IDY A;  4MH8 A;  2ZVO A;  3N32 A;  1J7C A;  4P6V F;  4DDI D;  1YJJ A;  2WXL A;  3ETR A;  2KFK A;  4HEA 1;  4GN1 A;  1R4M I;  4EE2 A;  3KQ4 A;  2BF8 B;  2FID A;  1N6Z A;  2FE8 A;  2BGF A;  3UIO B;  3GS2 A;  2IY0 B;  5AEK B;  2K22 A;  3W1S C;  2NTT A;  2SAK A;  3SFE B;  4A20 A;  4GIV A;  1BT0 A;  1QOA A;  2FCN A;  3Q3N C;  4KX6 B;  4J3O D;  3TJP A;  4A3P A;  2LGY A;  2OOB B;  3RFZ B;  3RNE C;  2CR5 A;  3EFU A;  5KHQ A;  3WAO A;  2KAJ A;  5IKC M;  4ACF A;  1BUI C;  3SEB A;  4H2A A;  5CHF A;  4YXD B;  2M0A A;  1VRA B;  2N7J A;  3ONS A;  4HRO A;  4R3D A;  3PRE A;  3UQA A;  3AUL A;  3FAH A;  2DZM A;  2V9H A;  1RAX A;  1UGJ A;  2PTL A;  1YQ4 B;  3A1Q A;  1WGD A;  3AB5 A;  3DHG C;  2I2Y A;  2IND C;  3IT6 B;  2CJO A;  5D3D A;  1AYF A;  1MPE A;  3HM3 A;  4REZ A;  4ZRK A;  2C7H A;  1E7V A;  1YN5 A;  2CU3 A;  2LRU A;  4BKS A;  1KTK A;  1N61 A;  2GBK A;  1ZP0 B;  1MVK A;  3AEG B;  2A5U A;  3H8H A;  3ML8 A;  3RD2 A;  3NVW A;  1ZPS A;  2KLG A;  3I3T B;  1VLB A;  3ZVV A;  2PLP A;  3U7D A;  1IGC A;  3P63 A;  3R2I A;  5TSS A;  1M4V A;  1CMX B;  1OEY J;  3ZQ4 A;  3TMP B;  4FJV B;  3GB1 A;  3H9D A;  2FCQ A;  1WX7 A;  1DOY A;  2HJ8 A;  2KD0 A;  1QOB A;  1S3S G;  4NQK E;  4NZL B;  3T3O A;  2DYB A;  4P16 A;  4GU2 A;  1C78 A;  5I4D A;  4A55 A;  2VZK B;  2KWV B;  3M62 B;  2PIA A;  4K7S A;  1GB4 A;  2BYT A;  5JXV A;  3V05 A;  3PT2 B;  3DBL B;  3VVW B;  1L4Z B;  4ZYN A;  1LQB A;  1PQS A;  1MI0 A;  3ZUN A;  1TS4 A;  1WZ0 A;  4W9C A;  2EMT A;  1DOI A;  1WFY A;  3MJW A;  5FR6 A;  3H7P A;  3A9K A;  1TZ1 A;  1L6V A;  5D94 A;  2WWZ A;  4YT0 B;  4HVB A;  3R3M A;  2C60 A;  3N30 A;  3DDC B;  2IO0 B;  5FR3 A;  1ET9 A;  3PS6 A;  4QAY A;  1UF0 A;  2IO2 B;  2J4X A;  2FIF A;  2KT7 A;  4LTU A;  3I57 A;  5C2T B;  2D07 B;  3A4S C;  3Q8B A;  3AEF B;  1FD6 A;  1LGR A;  4ZRP A;  1YOV B;  3ZIM A;  1XD3 B;  1Z2M A;  4FN2 A;  4MSM B;  1A70 A;  3D32 A;  2MJE A;  1J8C A;  4XE0 A;  2Y3A A;  1MHH E;  3T3N A;  1WRI A;  4MJS A;  2KN5 A;  2K8C A;  4FLH A;  2KC1 A;  5D2M B;  1YIW A;  3C19 A;  3R2T A;  3RN9 C;  2Y5C A;  4FHJ A;  3CWI A;  4LJP B;  2DAJ A;  3ZNI D;  1WF9 A;  3DBR B;  3PZ8 A;  4LCD E;  3MFG A;  2YEP F;  3L0W B;  2Z0E B;  4LNO A;  1XLQ A;  2QJL A;  3B1L X;  1P9D U;  2CKH B;  3AU4 A;  3R7Q A;  1P3Q U;  5BYQ A;  2UWQ A;  1GNU A;  2BS3 B;  3QJZ A;  1JWM D;  3SU8 X;  1YN4 A;  2MCN B;  3BVZ A;  1JWB D;  4BZA A;  5FKA C;  4ZDV A;  1YQ3 B;  2WYQ A;  1FIQ A;  3BY4 B;  4MEL A;  3AM9 A;  4ANW A;  2K6Q A;  5MPO A;  1NYQ A;  2K25 A;  2KTR B;  5T8I A;  5DPR A;  2LAS A;  3RYT A;  2EKI A;  3TSS A;  3FIL A;  2K9X A;  3B9J A;  3ZGZ A;  1SEB D;  1VZ6 A;  3S2A A;  4MEM A;  3JYU A;  1HTQ A;  1JW9 D;  4JE3 B;  4BBN F;  2IY1 B;  3Q8F A;  3NUH B;  2KTF A;  2WXF A;  2H89 B;  5EE0 A;  2ON8 A;  4BVU C;  4ITK A;  4NAM A;  1WM3 A;  2I1K A;  2M17 A;  2BYE A;  5AUK A;  2IO3 B;  1WXQ A;  4HXD A;  4S17 A;  4RGO S;  1NEN B;  1CQV A;  1JRP A;  4GXB A;  1YD8 U;  3FKY A;  2DAF A;  2N1W A;  3WAL A;  4K7U A;  2MWS B;  2BYV E;  2J0K A;  1K50 A;  5GXG B;  2KKC A;  2GMI C;  4TQ1 A;  1WJ6 A;  1MG8 A;  3DVG X;  2QEJ C;  2XN9 C;  1XLP A;  4E74 A;  2RSU A;  1K8R B;  1E7U A;  3AE8 B;  1JRO A;  3N9Y C;  3K9O B;  1KH0 A;  3VDZ A;  4MGZ E;  3L10 B;  2QDF A;  2DYO A;  1XLO A;  1WIA A;  2JYE A;  3R8B A;  2MJD A;  2D3C A;  2JX5 A;  1SJH D;  2MBO A;  1XLN A;  2N9K A;  3VTV A;  4IM2 A;  1TY2 A;  3Q8C A;  2BPS A;  4OVU A;  3A9J A;  3KLS X;  4IKG A;  2KFJ A;  2PW9 A;  1OTR B;  4NQL B;  1EF5 A;  3TL5 A;  4HRS A;  2DBY A;  3N20 C;  3QHT A;  4BKT A;  1WYW B;  3V6E B;  3JVZ X;  2D11 A;  1HA5 A;  4ZRQ A;  1ZXI A;  4HKQ A;  4YSX B;  2LHD A;  3NHE B;  4WWO A;  1E10 A;  3VRB B;  3QAR A;  3DBL I;  1E8Y A;  1WJ4 A;  4M01 A;  2Q5W D;  3BK1 A;  1UWX A;  3QWZ B;  1HQR D;  3AEB B;  3VR8 B;  3BIN A;  2QIL A;  3SR6 A;  4C80 A;  1PYW D;  1V5O A;  1PUT A;  4CO7 A;  3OLM D;  2JQR B;  1JWA D;  2KJH B;  3ZJU A;  3AE4 B;  4WWN A;  5HFY A;  2KJR A;  2AWT A;  2O2V A;  1C4A A;  2V3P A;  4LNK A;  4JIO U;  2NMQ A;  1HE8 A;  2GBR A;  5EE9 A;  2M1M A;  4CYE A;  4IWO A;  2RR9 A;  1SXT A;  1WE6 A;  2MRP A;  2LUM A;  4I6L B;  1NEK B;  4DHZ E;  2LGD A;  2WXM A;  1WX8 A;  2WXP A;  1FPY A;  2INN E;  2KFK B;  2L0F A;  4ANU A;  1ZDX A;  2MSE D;  1EM7 A;  2D3B A;  4HDQ A;  2PVG C;  2J52 A;  2L0T A;  4TKN A;  4HPM B;  3N1Z C;  1F2R I;  1IP9 A;  1YX5 B;  1ZW7 A;  3DHI C;  4M0W A;  4MSQ B;  2ZVN A;  3ML9 A;  2R2O A;  5BYR A;  4N6E B;  2PVO D;  1A5R A;  4YTN B;  2GOW A;  4LDT B;  2WXQ A;  3DBR I;  4HCP B;  4JX1 C;  4DXF A;  1JRU A;  4MH0 E;  1BXT A;  3AXC A;  1DGJ A;  2K0P A;  3NS8 A;  2AQ1 B;  4ICV A;  3QK0 A;  1C76 A;  2LWP A;  3ZRF A;  1V80 A;  1AN8 A;  1TKY A;  4KZC A;  3VXW A;  3T8M A;  1YQB A;  4HPP A;  4PK1 A;  3A1Q B;  2N0S B;  2NVU I;  1FFU A;  4MT5 A;  1SB3 C;  3OAW A;  4YSY B;  1T0S C;  1WYG A;  2INP E;  1C3T A;  4AJW A;  2LXA A;  2EEL A;  2ACZ B;  2WXG A;  2WQY B;  1C4C A;  1SE9 A;  2Z0D B;  2MBQ A;  2D10 A;  5E6N A;  1KF6 B;  3B08 A;  1RLF A;  2HDE A;  4E71 A;  1FO4 A;  3KYC D;  5HKH A;  2PE6 B;  3N1X C;  3EUB 2;  4AJY B;  4RF0 A;  1C9F A;  2BYF A;  4KVG B;  1I4G A;  2D3A A;  2WU2 B;  3JSV A;  3DBS A;  1YJ1 A;  5LXH A;  2N7D A;  3RUL A;  3BYY B;  3EFC A;  4KGR A;  3AU5 A;  5D6J B;  3V62 A;  5DPW A;  3KWL A;  2D2Q A;  3AEE B;  3EA6 A;  1S1Q B;  4N9F 4;  2JXT A;  4FA6 A;  1Q10 A;  2JSV X;  4WJQ A;  3L16 A;  2QC8 A;  1NVI D;  2RDH A;  2G4S A;  1GOZ A;  2KN4 A;  4DHJ D;  1Y8R C;  5C1Z A;  3PV1 A;  3H7P B;  3A9K B;  2WX0 A;  2WXO A;  3ZXV A;  1U4A A;  1UUP A;  1WE7 A;  3C8Y A;  1OEY A;  3P4R B;  3C0R B;  3IAS 1;  3H1U A;  3NS1 A;  4HDO A;  1IUE A;  4DXG A;  2O6V D;  3MHS D;  3TCA A;  2ZPN A;  1V5T A;  3HVD A;  4C4V A;  4II3 B;  2NS5 A;  1I42 A;  2BWF A;  4EZK A;  2KHW B;  2VH2 A;  2BQQ A;  4YTM B;  3CMM B;  3QIJ A;  3TEX A;  3NVZ A;  3AN1 A;  4EKU A;  1V2Y A;  1JWU D;  2HTH A;  2XK5 A;  1KRH A;  1QOF A;  2V4L A;  1D3Z A;  4MJS B;  3ZTD A;  3V60 A;  1AW7 A;  4DBG A;  1HTO A;  4KSK C;  2L1A A;  4I6N B;  5H8Y E;  2UYZ B;  3LXF A;  3TEY A;  2KWU B;  4BAX A;  4TSS A;  2LFI A;  4TQ0 A;  2GI9 A;  3DWG C;  3VH4 B;  4IWP A;  2L3Z A;  1FCC C;  2FBW B;  5DPT A;  1FRD A;  1K53 A;  2JVC A;  3Q14 C;  1FXI A;  4AUQ C;  1TIF A;  4KV2 A;  4LJO B;  2EMS A;  3VTU A;  5G2N A;  1V81 A;  2JZ3 B;  2WHI A;  5IP4 D;  1IGD A;  4WQO B;  2ZJD A;  2CHX A;  2Y5P A;  3ZDM C;  1Z5S B;  1P98 A;  2LXC A;  4W9H A;  4IOI E;  1RYJ A;  5J2R A;  1E7P B;  1VD2 A;  2BVC A;  3RNG C;  3VTW A;  4AOF A;  2KWD A;  4HWI B;  1FXT B;  4RCO A;  3FIL B;  5IAA C;  4XZ4 A;  2KDB A;  3R66 C;  2RD0 A;  2AL3 A;  3RI7 C;  3H7S A;  2NTS A;  2OED A;  3CSF A;  2W3S A;  4FBJ B;  1F0Z A;  1WXA A;  4EEW A;  3P4Q B;  3ZJT A;  4L1B A;  3BK2 A;  1NI2 A;  1E9M A;  4TUU A;  2WXI A;  1GC7 A;  4NY0 A;  1OQQ A;  4ZHO A;  1KJT A;  3IG3 A;  1E8W A;  1WGR A;  5DCN A;  2JY6 A;  2WDQ B;  4G0N B;  1WXM A;  2QMT A;  2JRH A;  3APF A;  3W9C B;  4XGA B;  1TTN A;  2MBB B;  1T6B X;  4J6I A;  2GBN A;  3VRA B;  2IGD A;  1P7F A;  4G11 A;  2K3U A;  1L6U A;  1I4X A;  1V1O A;  2BS4 B;  4W9D A;  3PHX B;  3AE1 B;  5EE3 A;  5IN7 A;  3OWE B;  4GGQ A;  4FJZ A;  3MHZ A;  4ZOH C;  1MFW A;  1WY8 A;  3RNC C;  4K3B A;  1FMA D;  2AQ3 B;  3ABV B;  1F77 A;  1ESF A;  4HLE A;  1ZUD 2;  1TJE A;  3IVF A;  4YTP B;  1D5M C;  4OZB A;  2O6V A;  2KMC A;  4G50 A;  4WH4 A;  1J7A A;  2LZ6 A;  2A4Z A;  2R61 A;  2GB1 A;  3A9J B;  5GMV A;  2RPQ A;  1GUA B;  3AV8 A;  4WQM A;  1V1P A;  2D5G A;  3X0W A;  2LGI A;  1VCB A;  2IGH A;  2V4I B;  1CZP A;  2WDT B;  4OVZ A;  3SFD B;  4EZL A;  2WXR A;  4M02 A;  1R4N B;  2C9W B;  2QHO A;  3BVM A;  2IGG A;  3TIX A;  2N9P C;  4F1S A;  1L4D B;  2C5L C;  2OJW A;  4I6P A;  1TKE A;  1VDV A;  3L17 A;  4DWF A;  3APD A;  4XWW A;  3U7Z A;  2BKR B;  3PVL A;  3OJ4 B;  1OQY A;  2C7M B;  1T0Q C;  3DCG A;  1TGZ B;  4US8 A;  3AE3 B;  3V3X A;  4C56 C;  1QT9 A;  4RGT A;  3L54 A;  3PZD A;  4OZA A;  2LGS A;  2IYD B;  2KO3 A;  3CIR B;  4A90 A;  4C7Z A;  3MP9 A;  2O2V B;  4LNF A;  2NBW B;  2JWU A;  3MC9 A;  2KVZ A;  1QOG A;  2J53 A;  1R7S A;  4FUL A;  1RFA A;  4L2Y A;  4ZYS A;  3BZD B;  5CHW A;  1C4P A;  2K1F A;  1GB1 A;  4KIK A;  2DZI A;  3Q3O C;  2QSD A;  1WMH A;  5G5G A;  3BYT B;  4DHZ B;  5CTR C;  4XDC A;  1FEH A;  1YJI A;  3E9S A;  4GB9 A;  2K8H A;  2BKF A;  4RM8 A;  2L7R A;  4KDL B;  3AH7 A;  1TY0 A;  2DZK A;  3BWU D;  1WM2 A;  4USA A;  2N9E B;  1Q5W B;  3AE2 B;  3WIM A;  3ZNH B;  4JWU C;  3DPD A;  4M0W B;  3GOE A;  1C77 A;  2K5P A;  4IUM B;  4G3X B;  3AI5 A;  2JU6 X;  3APC A;  2KVR A;  4ANV A;  1LFD A;  1WH3 A;  1JQ4 A;  2OJR A;  2Z59 B;  2ONQ A;  1VR9 A;  4LNN A;  4HKZ E;  4W9J A;  2KDE B;  1K51 A;  2B76 B;  3N1Y C;  2OHF A;  3U30 A;  3EGR A;  2ZZP B;  2KX3 A;  3M63 B;  2WXN A;  4YL8 A;  1D4B A;  2JWZ A;  2XEW A;  2JF5 A;  3NZ3 A;  2LEK A;  2PEA A;  4AQ7 A;  2V0G A;  4LK0 M;  4BBN C;  4S0R A;  4GDL A;  2GBM A;  5EE1 A;  4ICU A;  4MAC A;  1WGY A;  3I63 C;  3NZU A;  3Q8A A;  3N3K B;  2ZW0 A;  1SJE D;  1I4H A;  2R2Q A;  2LJI A;  1E6E B;  3HUI A;  3TEW A;  2D3G A;  2BBC A;  2JT4 B;  3VR9 B;  4ANX A;  2W55 A;  2NPT A;  3IBE A;  4ZRJ A;  2KZR A;  2L52 A;  2WLB A;  5TR5 A;  2N1V A;  3U4E G;  1GPX A;  2AYO B;  3W1S A;  2X38 A;  3DWM A;  3PHW B;  4KKI A;  5AZH A;  1UD7 A;  3DVN U;  1JWS D;  4K1R B;  4KGT A;  4L23 A;  3JSV B;  4O1N A;  4N59 A;  4RFB A;  4RGN A;  1D6E C;  3O65 B;  4XDD A;  1YN3 A;  4OW0 A;  1SBB B;  1HXY D;  3MTN B;  3KUZ A;  1SGH A;  3L4P A;  2LHE A;  3LYY A;  3ZRC A;  4W9G A;  5FK9 C;  2K8B A;  1MG4 A;  4JLC A;  1N62 A;  3TEZ A;  4DK5 A;  1PGB A;  2RGF A;  1GJZ A;  2IO1 B;  4HJK A;  4XYC A;  1HZ5 A;  4PYZ A;  2M56 B;  3P4S B;  4GDK A;  5LLI A;  3Q69 A;  3NJT A;  1RRB A;  1RFK A;  2CHW A;  3SD5 A;  4HCN B;  1Q0W B;  2KX0 A;  1R4N I;  2MH7 A;  3VH3 B;  4ZHP A;  1Q1O A;  2FUG 1;  5D7G A;  3ZXR A;  1V6E A;  2V1Y A;  2C7N B;  2I38 A;  2W3R A;  2MP2 A;  2YVC A;  1IPG A;  4C00 A;  1DYQ A;  1ZKH A;  1UH6 A;  1WGK A;  1EWC A;  3P1M A;  4A9A A;  4NJ6 A;  4C4V B;  1UBQ A;  1EU4 A;  3NVV A;  2BT6 A;  3RT3 B;  2G3Q B;  2KQ7 A;  2WXH A;  3P2B A;  2K6D B;  4PS3 A;  2ICI A;  3NG0 A;  3RNF C;  1TS3 A;  4WAA A;  3PO0 A;  2PPH A;  2KC2 A;  1CK1 A;  3AE6 B;  5IO9 A;  2ZPY A;  4UDU C;  5EDS A;  4TMA B;  3HVZ A;  1FNV A;  5D3I B;  3TUO A;  3HIZ A;  1XF5 L;  1HZ6 A;  1ISN A;  1L7Y A;  1V9J A;  4RH6 A;  2LVP A;  1FNW A;  3HRD D;  3WAN A;  3TBL D;  2ZNV C;  1XCT L;  2JYT A;  1IBX A;  4B6W A;  3QAQ A;  3ENE A;  3PPA A;  2IPK D;  2LMC A;  3ZW3 A;  2DNF A;  1F9J A;  4DDG D;  1XEE A;  1OQR A;  3VUY A;  2AX5 A;  1GAQ B;  2QIE B;  3KYD D;  5CX3 A;  2K39 A;  1ZXH A;  3KUC B;  4AS1 A;  1I7H A;  3AE5 B;  2YEP B;  2DWQ A;  4MGK E;  2REX A;  3ZYY X;  1N5W A;  1ZE3 D;  3UGB B;  3KVF B;  1EF1 A;  1WX9 A;  2LGX A;  4W9I A;  4PT5 A;  3SDL C;  2KDF B;  3L08 A;  3B0A A;  3IXS A;  3KWV A;  1OFF A;  2NCN A;  2AL6 A;  3AED B;  1GG3 A;  1MJD A;  4A8X C;  3V61 A;  2M19 A;  1UWM A;  4E3C A;  4F7Z A;  4N58 A;  3I5J C;  1BML C;  4KKJ A;  3H6N A;  2GLS A;  3RUI B;  5J17 A;  5BMG A;  2JPH A;  3Q3F A;  1I4Q A;  1L5P A;  1T3Q A;  3J9C A;  4B95 A;  1WGH A;  3VFK A;  1PGX A;  3U2S C;  1WI0 A;  5E6P A;  4XX5 A;  3ZO5 B;  3JW0 X;  5L83 A;  1ZDV A;  4DHJ B;  2E6X A;  1D5Z C;  2KOX A;  2ZCB A;  3PRP B;  4WJO A;  2DYM A;  1QZE A;  4IDI A;  2MJ3 A;  5JZE B;  3PGE A;  1YX6 B;  5LXI B;  1DOX A;  4WWP A;  2O6V B;  2BW2 A;  2BB5 A;  2MQJ A;  2LVO A;  4PS8 A;  3W2D A;  1LXD A;  3DBH B;  3B2F A;  5JH5 C;  3E56 A;  1WZ3 A;  1V1P B;  2CS4 A;  2MLB A;  3RPF C;  3RNB C;  4MDK E;  4RNA A;  1JCK B;  2CU1 A;  2L8J A;  1V86 A;  4IG7 B;  2CJN A;  1WR6 E;  4K7W A;  3M95 A;  3UF8 A;  2JXX A;  3DVG Y;  1G6J A;  2PJH A;  1EU3 A;  2KJ6 A;  3DOW A;  2NBU A;  4NJ7 A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 1WXV A;  5C23 A;  3UIN B;  3UQB A;  3QWZ B;  3T9L A;  3L54 A;  1P0R A;  3WAP A;  3PRM B;  3PZD A;  1LM8 B;  3QQ8 B;  4AP4 C;  3BIN A;  2LJ5 A;  1E8X A;  4HK2 A;  4DXA B;  1NDD A;  4MM3 A;  5AZG A;  1V5O A;  4NAW A;  1EO6 A;  4BOS C;  4CO7 A;  3DQV A;  2DX5 B;  3PLV A;  3OLM D;  3VHT C;  2KJH B;  2W9N A;  4WWN A;  2IYD B;  2PE9 A;  2WX1 A;  3QC8 B;  2KJR A;  2AWT A;  2KO3 A;  1X1M A;  2O2V A;  4NAW B;  4W9K A;  4JIO U;  1HE8 A;  2GBR A;  1WJN A;  2M1M A;  4CYE A;  2MW5 A;  1C1Y B;  2ZVO A;  3N32 A;  2O2V B;  4IWO A;  3WA0 A;  2NBW B;  2RR9 A;  4DDI D;  5J18 A;  1WE6 A;  2MRP A;  4FUL A;  5IA7 A;  4BKG A;  4I6L B;  4DHZ E;  4EOY A;  1RFA A;  2KFK A;  4GN1 A;  2LGD A;  1R4M I;  2MX2 A;  2YLM A;  5CHW A;  2K1F A;  2G4D B;  1WX8 A;  2BF8 B;  4KIK A;  2FID A;  2DZI A;  1WMH A;  2KFK B;  2LUE A;  2BGF A;  3Q3J A;  2FAZ A;  4DHZ B;  5CTR C;  2L0F A;  2N4F A;  3UIO B;  4ANU A;  4GB9 A;  4IW0 A;  2L00 B;  2K8H A;  2MSE D;  4KIK B;  3W1Y A;  2BKF A;  1WMH B;  2L7R A;  4HDQ A;  4RM8 A;  3CF6 E;  4KDL B;  2IY0 B;  1M94 A;  2L0T A;  3QA8 A;  4TKN A;  4HPM B;  5AEK B;  1IP9 A;  1YX5 B;  2DZK A;  2HD5 B;  4NNJ B;  1ZW7 A;  1WRD B;  3W1S C;  1WM2 A;  4MSQ B;  4A20 A;  4GIV A;  1BT0 A;  2FCN A;  2ZVN A;  2KXJ A;  1Q5W B;  2N9E B;  3ML9 A;  3TJP A;  3WIM A;  2R2O A;  3ZNH B;  3ALB A;  1UBI A;  4A3P A;  2LGY A;  2OOB B;  3DPD A;  3HM6 X;  4M0W B;  3GOE A;  2XBB C;  1A5R A;  2IZV B;  2CR5 A;  2GOW A;  3EFU A;  4G3X B;  3AI5 A;  4IUM B;  3DBR I;  4LDT B;  3VUW A;  3WAO A;  3PLU A;  4HCP B;  3APC A;  1KM7 A;  2KVR A;  5CHF A;  1V49 A;  1JRU A;  3M3J A;  4M8M A;  4ANV A;  3IHP C;  3ONS A;  4MH0 E;  4WJN A;  3VAW A;  4OVV A;  1LFD A;  3AXC A;  3PRE A;  1WH3 A;  3UQA A;  3NS8 A;  3AUL A;  4ICV A;  3QK0 A;  2DZM A;  2OJR A;  2Z59 B;  3QCA A;  1WXS A;  3EC8 A;  1RAX A;  4IC7 B;  2ZNV B;  2LWP A;  4W9J A;  1V80 A;  3ZRF A;  2FUH B;  2KDE B;  3A1Q A;  2KNB A;  4KZC A;  1WGD A;  2V3S A;  2BWE S;  3T8M A;  3VXW A;  2KWC A;  1J0G A;  2KQS A;  1YQB A;  3U30 A;  2ZZP B;  1UZX B;  3OJ3 A;  3VUX A;  2KX3 A;  3M63 B;  2VRR B;  3A1Q B;  4YL8 A;  4URK A;  3KW5 B;  2JWZ A;  2NVU I;  2XEW A;  2JF5 A;  3IFW B;  2PEA A;  2L05 A;  3HM3 A;  3ZNZ B;  4ZRK A;  2C7H A;  4ASW C;  4BBN C;  1E7V A;  4II2 B;  4GDL A;  2NR2 A;  2GBM A;  2KDI A;  2LRU A;  3OAW A;  4ICU A;  4BKS A;  2GBK A;  1C3T A;  4AJW A;  4M8N A;  1WGY A;  4GDL B;  2LXA A;  2A5U A;  3NZU A;  1SE9 A;  3N3K B;  2Z0D B;  2MBQ A;  3ML8 A;  3RD2 A;  1H4R A;  2D10 A;  4JQW C;  5E6N A;  2R2Q A;  2KLG A;  4GOC A;  2DEN B;  3I3T B;  3B08 A;  1AAR A;  2D3G A;  3ZVV A;  3U7D A;  1XT9 B;  2JT4 B;  1RLF A;  4E71 A;  4ANX A;  2NPT A;  3IBE A;  4JGH B;  3KYC D;  4ZRJ A;  4FHK A;  2KZR A;  3DCG A;  1CMX B;  1OEY J;  5HKH A;  3TMP B;  4MGY E;  3PSE B;  4FJV B;  5TR5 A;  2PE6 B;  2NPT B;  2M0X A;  2N1V A;  4AJY B;  1UEL A;  1NBF C;  2AYO B;  2BYF A;  3W1S A;  3H9D A;  2FCQ A;  1WX7 A;  4KVG B;  1TBE A;  2HJ8 A;  2KD0 A;  3JSV A;  3DBS A;  3SHQ A;  1YJ1 A;  3PHW B;  1S3S G;  5AZH A;  5LXH A;  2N7D A;  4NQK E;  3RUL A;  3AU5 A;  2NBV B;  1UD7 A;  4RMA A;  3DVN U;  5D6J B;  3V62 A;  5KHQ A;  2DYB A;  2FNJ B;  1E5W A;  4K1R B;  5DPW A;  2LVQ A;  2D2Q A;  3JSV B;  4GU2 A;  3RZF A;  1S1Q B;  4N9F 4;  4FA6 A;  1SIF A;  2KWV B;  3M62 B;  4K7S A;  3O65 B;  3PTF C;  4W9E A;  3ECI A;  4KDI C;  3PT2 B;  3VVW B;  4WJQ A;  4ZYN A;  3A4R A;  3MTN B;  1LQB A;  3KUZ A;  3L16 A;  1SGH A;  1E90 A;  3VQI A;  1PQS A;  4TV3 A;  1WR1 A;  3ZUN A;  4NPN A;  3ZRC A;  4W9G A;  2K8B A;  1WZ0 A;  2JZZ A;  4JLC A;  4CHK A;  4W9C A;  2EMT A;  3V6C B;  1XQQ A;  1WFY A;  4DK5 A;  3MJW A;  5FR6 A;  1WJU A;  2RGF A;  1GJZ A;  3H7P A;  3A9K A;  2G4S A;  2IO1 B;  1TZ1 A;  5E6O A;  4HJK A;  4PYZ A;  5D94 A;  4DHJ D;  2WWZ A;  1Y8R C;  1J19 A;  2G45 B;  4GDK A;  5LLI A;  4HVB A;  2C60 A;  3PV1 A;  3H7P B;  3A9K B;  2WX0 A;  3N30 A;  3DDC B;  3R3M A;  5C1Z A;  1RRB A;  2IO0 B;  2KAN A;  1U4A A;  2CHW A;  4X57 B;  3PS6 A;  4GDK B;  1GC6 A;  3RZW C;  4HCN B;  3DBH I;  1WE7 A;  3SD5 A;  1Q0W B;  1OEY A;  2KX0 A;  2IO2 B;  1R4N I;  3C0R B;  3VH3 B;  1ZGU B;  2FIF A;  3H1U A;  1Q1O A;  4HDO A;  5D7G A;  2O6V D;  3MHS D;  1V6E A;  2J0J A;  2D07 B;  2CHZ A;  3A4S C;  4KSL C;  3TCA A;  2V1Y A;  2ZPN A;  2C7N B;  3ZIM A;  1V5T A;  4GSW A;  2MP2 A;  1XD3 B;  1Z2M A;  4FN2 A;  2YVC A;  1IPG A;  1KOT A;  4MSM B;  4II3 B;  2NS5 A;  1I42 A;  1ZKH A;  1UH6 A;  2BWF A;  1EUV B;  3D32 A;  2KHW B;  3EEC A;  3RCZ A;  4A3O A;  4EZK A;  1J8C A;  3CMM B;  2MP2 B;  3QIJ A;  4NJ6 A;  1E8Z A;  4MJS A;  1UBQ A;  2KN5 A;  4HPL B;  4EKU A;  1V2Y A;  3RT3 B;  2HTH A;  2FCS A;  2K8C A;  2N9X A;  2XK5 A;  4FLH A;  2KC1 A;  2G3Q B;  1D3Z A;  2V4L A;  2KQ7 A;  4MJS B;  1YIW A;  3P2B A;  5D2M B;  2K6D B;  4GMV A;  3V60 A;  3ZTD A;  4PS3 A;  4KZ0 A;  4DBG A;  4WAA A;  4KSK C;  4IM0 A;  4FHJ A;  2PPH A;  2KC2 A;  4I6N B;  2ZPY A;  4LJP B;  2DAJ A;  2UYZ B;  1WF9 A;  2IBI B;  3LJ3 A;  4LCD E;  3ZNI D;  2HE7 A;  2KWU B;  3L0W B;  2Z0E B;  5EDS A;  3B1L X;  1P9D U;  4TQ0 A;  2CKH B;  2FCM A;  3AU4 A;  3VH4 B;  3R7Q A;  1P3Q U;  4IWP A;  2L3Z A;  3HIZ A;  2ASQ A;  2UWQ A;  5DPT A;  1GNU A;  1IYF A;  3HHM A;  2JVC A;  3QJZ A;  4W9F A;  4AUQ C;  2L76 A;  1WGG A;  4KV2 A;  4LJO B;  2MBE A;  1T0Y A;  1ISN A;  3SU8 X;  1L7Y A;  2EMS A;  1V9J A;  5G2N A;  2MCN B;  1V81 A;  3DVN V;  2JZ3 B;  3GZN I;  3VTU A;  3ZLZ A;  2LVP A;  2KTR A;  4W9L A;  3WAN A;  4WQO B;  3TBL D;  5JHA A;  2ZNV C;  5AZF A;  4ZRI A;  2ZJD A;  2CHX A;  4ZDV A;  4EUT A;  4B6W A;  3ENE A;  3QAQ A;  2WYQ A;  3ZDM C;  1Z5S B;  3BY4 B;  3PPA A;  4K81 A;  4MEL A;  2N7E A;  1P98 A;  2K6Q A;  4WJP A;  2LXC A;  2K25 A;  2KTR B;  2MA9 B;  4ANW A;  5DPR A;  3ZW3 A;  1F9J A;  4DDG D;  2LAS A;  3HK0 A;  4W9H A;  3RYT A;  4FAD A;  3CST A;  5J2R A;  1VD2 A;  2J7Q B;  2LI5 A;  3S2A A;  3VTW A;  4MEM A;  3JYU A;  3VUY A;  4AOF A;  2Y5B B;  3KYD D;  4HWI B;  5CX3 A;  4BBN F;  2IY1 B;  1FXT B;  2KTF A;  5IAA C;  4XZ4 A;  2KDB A;  2K39 A;  3KUC B;  3R66 C;  2I1J A;  2RD0 A;  4PYU A;  2AL3 A;  4BVU C;  5BO4 B;  4IM3 A;  1WM3 A;  1H8C A;  4MGK E;  2I1K A;  2REX A;  3H7S A;  4BOZ B;  3UGB B;  3KVF B;  2M17 A;  2BYE A;  1EF1 A;  2IO3 B;  1WX9 A;  3CSF A;  3UIP B;  2LGX A;  4HXD A;  5G55 A;  4W9I A;  4FBJ B;  1WXA A;  4EEW A;  3L13 A;  3SDL C;  2KDF B;  3L08 A;  3B0A A;  2GBJ A;  4RM9 A;  4GXB A;  2NCN A;  2AL6 A;  1NI2 A;  4IWQ A;  1YD8 U;  2J0M A;  5L95 C;  1GG3 A;  2EKE C;  2DAF A;  2N1W A;  4TUU A;  3WAL A;  4K7U A;  3V61 A;  2MWS B;  4E3C A;  2BYV E;  4F7Z A;  2J0K A;  3PRZ A;  2KKC A;  3KH0 A;  3H6N A;  1GC7 A;  4NY0 A;  1L2N A;  3RUI B;  2GMI C;  1KJT A;  2LRW A;  3IG3 A;  4LDT D;  1E8W A;  1WGR A;  5J17 A;  5DCN A;  2JY6 A;  2JUO A;  4G0N B;  1WXM A;  2JPH A;  4TQ1 A;  4XC2 A;  1WJ6 A;  2ZEQ A;  3Q3F A;  1MG8 A;  2JRH A;  3DVG X;  3APF A;  4E74 A;  2RSU A;  1K8R B;  1WGH A;  1TTN A;  2MBH A;  1E7U A;  4B95 A;  2MBB B;  3VFK A;  4B9K A;  3NY5 A;  3K9O B;  1WI0 A;  3KUD B;  4J6I A;  4F8C B;  2GBN A;  2JRI B;  5E6P A;  3VDZ A;  5DPS A;  4MGZ E;  3L10 B;  4XX5 A;  3ZO5 B;  5JHB A;  3QX1 A;  3JW0 X;  5L83 A;  2DYO A;  2M4N A;  3A33 B;  4G11 A;  1WIA A;  2KMA A;  4W9D A;  3PHX B;  2AEH A;  4DHJ B;  2KOX A;  4FJZ A;  4GGQ A;  1OGW A;  2ZCB A;  1WY8 A;  2MBO A;  1I35 A;  3VTV A;  3PRP B;  4IM2 A;  4HLE A;  3X23 A;  4WJO A;  3WAM A;  2DYM A;  1QZE A;  3IVF A;  3U8Z A;  2KK8 A;  2KMC A;  2O6V A;  1KLV A;  5JZE B;  2BPS A;  3PGE A;  4G50 A;  1YX6 B;  3NZS A;  3A9J A;  4OVU A;  3ZDT A;  5LXI B;  2DZJ A;  2ZCC A;  4WWP A;  4JL9 A;  4P7I A;  4AWJ A;  3ZKJ C;  2LZ6 A;  2O6V B;  3ZTC A;  2A4Z A;  2LD9 A;  3NOB A;  2KFJ A;  3A9J B;  5GMV A;  2XK5 B;  2RPQ A;  1GUA B;  4BKS D;  2MQJ A;  3LDZ E;  1OTR B;  2LVO A;  4PS8 A;  4NQL B;  1EF5 A;  3R7R A;  1UGM A;  3TL5 A;  3X0W A;  3ZNG C;  2KLC A;  2B3A A;  1VCB A;  1LXD A;  2WDT B;  4MGI E;  4EFO A;  4EZL A;  5JH5 C;  4EZJ A;  2C9W B;  1WZ3 A;  3QHT A;  1WYW B;  4BKT A;  3V6E B;  2CS4 A;  2MLB A;  2QHO A;  3TIX A;  1P1A A;  3JVZ X;  4MDK E;  2D11 A;  3K9P B;  2N9P C;  2CU1 A;  4F1S A;  2L8J A;  1V86 A;  4IG7 B;  5CHV C;  2C5L C;  1WR6 E;  5KHO A;  4K7W A;  4FJY A;  4I6P A;  2M8S A;  3M95 A;  3UF8 A;  2JXX A;  3DVG Y;  3L17 A;  4PS7 A;  1G6J A;  3NHE B;  4BFR A;  3EHV A;  4DWF A;  2PJH A;  3APD A;  2BKR B;  4WWO A;  2KJ6 A;  3PVL A;  3OJ4 B;  3QAR A;  3DOW A;  3DBL I;  2NBU A;  1E8Y A;  1OQY A;  2C7M B;  4NJ7 A;  2DHZ A;  1WJ4 A;  1TGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...