3ZNJ1

Crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
MLYLVRMTVNLPRNLDPREEERLKASEKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp.
pubmed doi rcsb
source organism Rhodococcus opacus
molecule tags Lyase
molecule keywords 5-CHLOROMUCONOLACTONE DEHALOGENASE
total genus 25
structure length 94
sequence length 94
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, 9, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF02426 MIase Muconolactone delta-isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Dimeric alpha+beta barrel 3znj100
4LBPA 1MWQA 1S7IA 4LBIA 3ZNJ1 4FPIA 3ZO7A 4LBHA 3ZNUA
chains in the Genus database with same CATH superfamily
2V8DA 1S7IA 3K89A 4YHHF 4F50A 1B0PA 2AWZA 4MKVA 5DGAA 2UXBF 3MM6A 3DOLB 3MWBA 2YWFA 4ZJLA 4CT8A 1EP4B 1KQSR 4DJBA 3RRGA 4B3TF 1QVGR 1WDDA 3CDBA 3F41A 5AT1B 1VQNS 2NQPA 4V1Ak 1U0HA 3UD4P 3I55S 3PEJA 4CLZA 4ECZA 4IR1A 1ZAXA 2IC3A 2FHOB 4DZDA 5KT6A 2JEJA 3U27A 5ETSA 1GT8A 4OYZA 3T9NA 1RDRA 2I38A 3KXDA 2XMTA 3OTCA 4CTAB 1S99A 3EE3A 3J7YU 2FUG9 4Q2MA 3PKMA 3DLGA 5CXTA 1RWNB 1X5SA 3L95X 4IH6A 3RUBL 3MUVP 1KNZA 5HMZA 3T5JA 3R5DA 4P74A 5K8NA 1V3ZA 1IBMF 4AD6A 2CQ1A 2HFNA 3JSMB 4OJ1A 4QWAA 4WFXA 4YHHJ 3SI8A 3D9BA 2KI2A 3LGMA 3TUIC 3DOKA 3R1LA 4TY8B 3AQOA 1OYEA 3ET6B 2H4WB 1GTHA 1TR0A 1O8BA 1RTZA 4G3IA 1NPRA 1TELA 2JRSA 1BY9A 1X4GA 1WEZA 2KXFA 2N3LA 1TKZB 3VGUA 3DN9A 4N47A 1SJ4P 2MLXA 4B9LA 2H3EB 1D1UA 3MMJA 3W8GA 1BQNB 1HNVA 1TL1B 4Z2XA 3G2XA 4ICLA 4LT6A 2KN4A 3SSRA 4DFJA 1TL3A 1HBNB 3P8BB 4BS2A 1N88A 2PT0A 2Q43A 2IMOA 4DZ6A 1RTJA 4OIXA 3MEGA 1Q86T 2HQCA 5D3GA 4WXWA 3CJ3A 1RHKB 1TL7B 1U8SA 1UWBA 1X8DA 3QT8A 5DZ7A 1RWWB 1RWPB 3EDQB 3TZYA 2HSEB 4RBTA 1WSVA 4BCAA 1QAJA 2HQ3A 1QJHA 3ILIA 1X5OA 5LXRA 2DRBA 1NBEB 1QE1A 3CMAS 2GFFA 3HDSA 4QWCA 3MOJB 2F63A 1FRMA 3MGJA 4TNOA 2V4QA 4DI6A 3WIVA 1NK8A 2I0XA 4Q8FA 4X84A 3OR1B 2DB1A 3GZ7A 2BX6A 2EFVA 4OLPA 4MMOA 1KHVA 2UXBJ 1H73A 2I2YA 1HWLA 4WP9A 1CJVA 1TK5A 2JSXA 1RZMA 2U1AA 5B0BA 2VJVA 2UXCF 1VQ9S 3W64A 3DRPA 5A8KA 4RJVA 1WG4A 2IY5B 1B0VA 4ZHRA 4ECWA 1U1PA 3IWXA 2BW7A 2M5YA 2RSQA 3Q0AA 2DCUB 3TJ8A 4JI1F 4C3KA 2CNNB 1XR6A 1YJVA 4AFFA 2D3OR 1VC0A 2AJQA 4ECQA 4K4VA 3CNQP 2MY7A 2Q6BA 2EC2A 4LSLB 3WC0A 3DRPB 2OPQB 3R3TA 1QDUB 2C3PA 1AT1B 3RBZA 4YQWA 1IBMJ 4A47A 1WOPA 3CIMA 2JX2A 2JEFA 2ZH8A 1N34F 4Q7AA 5CZXA 2HBYB 5E5NA 1K44A 2RF2B 4CO0A 3G71S 1VK8A 3I32A 3HF5A 2E44A 1IQZA 3GYGA 5AE2A 3US5A 4NLOA 3T1AA 3IP0A 1WC6A 2VDIA 2RD5C 4TLQA 5L38A 1TK8A 4NYZA 1KVJA 2F9DA 4QWBA 4UZBA 3QAUA 2H48B 3JSRA 1P27B 2GS8A 2JLEA 1XMBA 3Q89A 4OHVA 2ATCB 1T9UA 2DNPA 4F0HA 3QIDA 5CCLA 3K57A 4ZKAA 2WVDA 4LQ3A 2HBZB 2HHUA 3C6UA 4ECYA 4ZITA 4LF4J 3ILJA 4UQTA 3G9CA 1GXTA 2AU0A 4L75A 1FEEA 1S0NA 5MAOA 2UUBF 2HNZB 4ICLB 3SXLA 3HVTB 3H90A 2RRBA 2HNDA 4F3MA 5HVGA 3MDFA 4ED1A 2FHKA 3QGIA 4RW6B 2W9BB 1S1XB 4PAAA 2W1BA 5E3QA 1U26A 2W7OA 3RW6A 3N5FA 1ULRA 1Y3KA 2YNFA 4WF9Q 3NL0A 1SKSA 4DG1A 1VOMA 2ZBCA 3CCES 2FIUA 2OSQA 4I2PA 3C14B 1SXLA 2QA4S 1JLEA 1GNKA 2HFUA 2M0GB 2BJ9A 4OI4A 3VQSA 5HLFB 1M1KT 1FKAF 2BANB 5L1LA 4ZVEA 2J9DA 3ZTRA 2DGXA 3PRVA 2RNEA 1NK9A 3LUYA 3DLEB 2XTJP 1HQUA 2DGSA 1R6YA 4F36A 4RU9A 4J9NA 4KRWA 1FK9B 3BBBA 1YIJS 4N5SA 4LF8F 1T02A 2XY6A 3W9JA 2DGVA 1IKWB 2VDHA 4M5KA 4Z7CA 3BYRA 2VQEJ 3CJ2A 3OR2A 1U47A 3M32A 1FJCA 2B9WA 2GHPA 3WX8A 4WU2A 1P9YA 3D4JA 4DX7A 3K5OA 5F9LA 4X4SA 1DQAA 4V19X 4Y00A 4CLYA 1A6LA 4WYWA 4NZ6A 1S6UA 4BC9A 2CPIA 1BGXT 1KD1T 1MMDA 2OPRB 4J90A 1PBUA 3PCOB 2G0CA 1SH2A 3PNIA 5GAHU 5K20B 5HROA 2YKQA 1QVFR 3HHLD 5KG6A 2VC1A 1KVIA 2H54B 4NCAA 4J9SA 2WVEA 2NSBA 2NUUG 5DDPC 2AYBA 2GX8A 3H2LA 1UEVA 4EWTA 2FLNA 1SUQA 1TZ0A 5F3ZA 5A2QU 3ADAC 1KQGB 5B0FA 1T9WA 3DLBA 2ZC4A 2MGZB 1S9EB 2H65B 3IBFB 3TEHB 4XTTA 1MSWD 4B3OB 3J7AN 5L1JA 1JJHA 4LFBJ 2AYMA 3EVWA 3M30B 3CJKB 4MFBA 4CO4A 3I5CA 1BQXA 2LDIA 1UPMB 5DO2A 4LREA 4QR0A 3PIPQ 1HQEB 2G2YA 3NAHA 2A1BA 5A8KB 1OSDA 1NKBA 4FBTA 4ZPWR 3UO0A 2XQCA 2IVYA 2RS8A 3FK4A 4OHWA 3DGPB 3PACA 1CJKB 1NK5A 2YX1A 2VU5A 2KJVA 2VJUA 1RAHB 4OYOA 1S10A 4B3MJ 3DLJA 4AE5A 1YJWS 5DRKA 2JVRA 1ZPVA 3OFFA 2IM0A 2WB1D 3NOCA 3QAEA 2IBKA 2F4VF 2ZD1B 1XBWA 3KDOA 3OXFA 3LPEA 1IKXB 2CQGA 1HL6A 3CCWA 3K8VA 3EM1A 3M6VA 3I56S 3GQCA 4EZ6A 1E6YA 4FPIA 2J6UA 1KEKA 4YFUA 1CJTA 4WPAA 4J9UE 5C25B 1EIYB 2BKNA 2GVZB 1B64A 2XHWA 4OI6A 1I94J 3ELHA 2BANA 3IGVA 4HI2A 1KLMB 1S1TB 4HLBA 5DQGA 4GC7A 4LSZB 5G0RA 1OQ6A 4LF9J 2HKEA 2AHOB 4L73A 2QV6A 1Q8BA 1XMQJ 7FD1A 1QTMA 2YWGA 4DQIA 1WNEA 2KU7A 3CB4A 4PUOB 1SJ1A 3DRRA 4DR3F 1TQLA 3LH2S 4TU9A 1L5UA 3G6VA 2MZQA 2PDAA 3R5GA 2OPSB 4PXCA 3DFEA 3HHLA 4H4KA 4YUDA 4DV4F 3PR4A 4DSLA 3HK2A 2A10A 1NZ8A 5I3UB 1O51A 1OYDA 3ET6A 5SZTA 3E51A 3C19A 1IR1A 4DSKA 1APSA 3U1MA 4EYIB 3V4IA 4DLGA 2AX1A 4YY3J 3R27A 3KLEA 2XHCA 1OY8A 3GWCA 5E7OB 1MWQA 2VFSA 5KFSA 1RT6B 2VIHA 3OVSA 3M8SA 1FJGF 3BN7A 1HYSA 2BEFA 1NJYA 1S76D 3RBEA 4G1IA 2KFYA 4FF1A 2NYHA 2K7KA 3OT9A 3CMES 2IDEA 3FBEA 3LANA 3RR8A 5CYJA 4LF6J 1PYTA 3CC7S 3N6NA 2HHPA 4DV6F 3O2IA 2ALZA 4PQUB 3WZ0A 4DU7A 3CCMS 1S0OA 2NSCA 3NWRA 2X1AA 4ANDA 3SFGA 2IHR1 3G8QA 3WX4A 2MQOA 3LALA 3R9LA 2VOOA 4YY3F 1RUSA 3G6XA 5KTQA 1O5JA 2IFXA 2KHDA 2Z57B 5AXLA 3S6EA 2DNKA 3S1TA 2W9CA 2DEJA 2QTWA 5E41A 1HNXF 4LQ9A 4ZVFA 4C2MA 2BJ3A 2GGPA 2QLBB 2IYIA 3IRWP 4ZPAA 4M5GA 3ZTQA 4M5DB 1S77D 5B0CA 1S59A 2F40A 2W7AA 5LMNF 4QBUA 1K8AT 3NMAA 4OYBA 2CQDA 2A2CA 2VFTA 5HVFA 1JLFB 1SUQB 1UFKA 1WC4A 2E29A 5E2QA 3MFIA 4ALZA 1QAYA 4A48A 4K4SA 2HWIA 4FZVA 3MR2A 1XEZA 3JYTB 4QYZJ 3MMCA 4HTJA 2VKZG 3V4IB 1HIYA 1M5OC 5IWAJ 1IXKA 4W92B 3A4TA 4MKBA 1LXJA 1FDAA 2DH7A 4ZVOB 3H8YA 5E3PA 4B3SF 3TVZA 4IUFA 2O67A 1AZSA 4G1QA 4QCLA 5AJ3F 2GGPB 2XMJA 4B3SJ 1QD1A 1PC5A 2FVSA 2XULA 1AUSL 2F4VJ 2ATLA 3CSKA 3AOCA 1B4SA 4NOHA 4O3SA 1WI6A 2LDYA 1FF2A 3U7JA 1XNQJ 1BD6A 2XCPA 2QFJA 3OUYA 3ZXWA 3GV7B 1YDLA 5KFUA 3H5YA 4ECUA 2FHJA 1FK9A 4O3OA 1YJTA 2GAGC 4I6AA 4MIWA 3SEOA 5A0YA 4DX5A 4DV0F 5C25A 3PX6A 5I42A 2XLKA 2ASYA 4ECTA 1T03B 3BSOA 2P9EA 1N6QB 3F56A 3DRYA 2V8HA 1RT5A 4X2BA 5A6WA 4F8RA 1RHQB 1E6YB 2X7IA 3HULA 3NXZA 4N77A 3T6BA 3VVUA 2XZDB 3M05A 4CLPA 5DETA 5KFEA 2WOMB 2KZZA 1MG7A 1YJNS 2Y8YA 2YPYA 3HVRA 1TMJA 4DQPA 4WZMA 4URSA 2W9BA 3A8KA 4HI1A 2XC9A 2C2OB 3FCVA 2B56A 3GR1A 3JTPA 1REVA 1JLBB 2GHVC 3T6JA 5DLGA 2VFVA 3DLGB 2C3MA 4B02A 1RBLA 4UUXA 2KT2A 5K8MA 1X60A 2FD2A 4NI2A 1WACA 5KFLA 1MW7A 5ETNA 2M88A 3PRBA 2P6SA 1HA1A 2PGCA 5KFVA 4FDFA 3P5BP 4JBCA 3G96A 2UXCJ 4OZ0A 1UA1A 2WK4A 3VALA 4A8XA 2ZJRQ 4CH0S 1RHMB 3DLLQ 1Y00A 3GILA 2PFFB 1VBYA 1X0FA 1UVIA 4F7VA 5BR8J 1VQKS 2HVHA 3PRDA 1NB7A 2G0JA 3NWGA 1U8WA 2DYAA 3THPA 2ADCA 4GKKF 2ZZMA 3ENAA 2E1AA 5AE3A 2V8VA 1NDPA 1NHVA 2HVDA 2XYHB 3CJ8A 2JVOA 3QT7A 4BLGA 4Y2AA 2E9RX 1ZA1B 2KRBA 3AJDA 3AB4B 2QN6B 4DPTA 3TANA 4FS1A 3P5TL 2ZD1A 2QT7A 1UAWA 4DR1F 4HL9A 5D77A 2HHTA 5IV4A 2OH2A 3GLJA 3RB4A 3HJFA 2OO4A 2IVMA 3FKBA 4ZLJA 3TW0A 3PJWA 5DDOC 2C2RA 2ZITA 2FGCA 1WHVA 3LP2B 3KLGB 1JXVA 1QY7A 1UTAA 4KKOA 4NZ7A 3SCLE 1HBUB 5C5JA 2ZHBA 2YBVA 2GVDB 3AT1B 5HO4A 2BMBA 1J2VA 5BYRA 1X4HA 1FVQA 2ROPA 3GIJA 4FNHA 4JV0A 2W9AA 2J0QD 2VA2A 1TUGB 2VG5A 1YKWA 2XS5A 2BKOA 5HMYA 1QUVA 1Y3JA 2H5JB 1KONA 1F6TA 1HW9A 2I5JA 4PG5A 3EDRB 3TZXA 2QFIA 2ADBA 2AV5A 3O5TB 4NLQA 2F65A 3BH6B 2C42A 1RP5A 2FJAB 4NEZA 1TK0A 1NAQA 1FA0A 3AA9A 3P49B 4AQYJ 3HVTA 1WTBA 2APOA 1XQIA 1V3SA 4WE1B 2W2OP 1KWMA 1Q7LB 2IIHA 4KGZB 4CM0A 1CVJA 2ZM6F 2V50A 1RT1B 1ZZNA 3I4PA 1YJ9S 7FDRA 3GE9A 3MPYA 3QWUA 2DHSA 2ROEA 4IG0B 4IYQA 1CC8A 4O44A 1NJZA 2ZH7A 3MR6A 4QIWD 2G1DA 1HWUA 3D7SB 4U7UK 2FZKB 2FJBB 2FJEB 1R27B 4AL6A 3NCQA 1B99A 3TO8A 5D0EA 3G6YA 3CEDA 3POTB 1R43A 1DFDA 4YB7A 5EGYA 1GXLA 2VHGA 4NCGB 1VLYA 2E5JA 2RDJA 1YG0A 2OUGA 4DV6J 4IQXA 1U1NA 2LQ5A 2VB6A 2HRUA 5IZHA 1CC7A 1S57A 1G7CB 3IMQJ 1PIEA 2HGNA 4QW8A 1IQTA 1NNDA 3FQLA 3I4HX 3K59A 2R7RA 2CA9A 2BKPA 1R3NA 2CFXA 2K1RA 3LO3A 3N9UC 2E66A 4A8KA 4KGXB 3RAMA 4ED7A 1RJJA 1Y7PA 4I56A 1C1CA 3CCJS 1URNA 2AZ3A 1FJGJ 2QG9B 2HWTA 3H0PA 4K5RA 5B08A 2B4UA 3GV5B 1Q81T 1YJ7A 1H98A 3J81j 3BGRB 3KK3B 2Q3PA 3SSQA 4EEYA 2MHEA 1XC9A 2D9OA 1S49A 2VQEF 1M5KC 3M8ZA 2AQ4A 4YOEA 2CQBA 3DRSB 3GJTB 1GMVA 2E1RA 2MB0B 2RQ4A 3DGPA 1TAUA 2DRAA 4MIAA 3OL6A 3CCVS 1CJVB 1RWOB 1SL1A 2DY9A 3GONA 5KT5A 1S4FA 3LGNA 4LSNA 1NJWA 1MROA 4EBEA 2QLJB 2EK6A 3DLEA 4LRDA 4DF8A 3IG1B 2BE7D 3AXMA 3H20A 4HH0A 3BBFA 3BGFA 2VPWB 4FVCA 2VG6A 4C3LA 1X4FA 3IBWA 3GFYA 4RL1A 4DFMA 3KG4A 4R0JA 1RXOB 4Y2KA 3SSSA 5HQLA 1FXRA 2R7QA 3FNNA 2QMUB 1X0PA 3D28A 1MU2A 2K1RB 4KYZA 3EPGA 1Q82T 4OI1A 4DV1F 3M6XA 1FDNA 5CYMB 1T9VA 4CLUA 4KV8B 1I3OB 3N6LA 1WF1A 2N82B 3W7BA 4NLXA 5GAHI 5EHHA 4EFAC 1RQ0A 5L1KA 2L9WA 2ASLA 1GTEA 4LF7J 1SJRA 1UVLA 2V5HG 2DJWA 2J0XA 3QGHA 4JYAF 3QSYB 1QSYA 1GAOA 2ZM6J 2FY1A 3BR9A 1RT4B 4PZVA 3D67A 2CPHA 2YQ1A 3POTA 4QR2A 4ZS6A 4DBQA 4ILRA 1ZS6A 1SQEA 2HQIA 4C48A 2QL7B 4TLRA 1YZ6A 4S0MA 3HCXA 2FVRA 3A8IA 3KJVA 2HURA 3WHIA 1IKWA 2E9ZA 4AL5A 4BWMA 1ZPWX 3G87A 2H5IB 3FGVA 2VFUA 4LRFA 4NASA 2UVVA 1N34J 4OI0A 3T1YJ 1NK0A 4KQZA 2HBQB 3M8WA 4F4YA 2IMWP 4NZ0A 2ZVIA 2Y0SD 3Q8RB 1EHWA 2KYZA 1Z4UA 3NNCA 5GADU 5DLFA 4KB7A 4DV1J 4Y2MA 2D3ZA 1KLNA 2O3DA 4M5IA 3C46A 2BJ1A 5EWGA 4NLPA 5F0UA 2FC9A 1RAAB 1T03A 4TQRA 1K9MT 4KGMA 3I9V9 5LL6d 1N5YB 1S7HA 3LAMA 5J1NA 5T41A 3KLHA 3C2PA 5D3GB 2RU9A 2QA1A 4YMEA 3PIOQ 2HRTA 5J2PB 3RTVA 1VRTB 2EW9A 3OFGA 4CT9A 5LOQA 2R2SA 2R9LA 4C4WA 3QPIA 3AH6A 1R0CB 2RUSA 5LM7E 1CLFA 2F8EX 3DU5A 2HHSA 3TI0A 2Z2ZA 2BRKA 4G1PA 3TUZC 5ETMA 2C28A 5KFZA 4J9QA 1LW2B 4FF2A 1TKZA 3KHGA 3TJ9A 5A8WB 4H4OB 1N5TA 3AB2B 3QO9A 3HLUA 4M5HA 4UW2A 5KG3A 2MKHA 3OV7A 4F3OA 1LWFB 2XS2A 5IC6B 4USHA 3TWZA 2PN6A 3TX8A 3G8TA 3SCKE 3DHWC 1I51B 1C2PA 4FKXA 3BKUA 4FNIA 1FNOA 2JC0A 3JSMA 1R6VA 4J91A 2AJ0A 1HR0J 2PEHA 2R7WA 3HO1A 4NLTA 1HBOB 1F60B 2RDIA 4LRCA 1CQMA 4YDXA 2XO7A 5IT4A 3SFUA 2H9ZA 2X1BA 3J7YI 1OO0B 4R8UA 2KFNA 5EN1A 2OPRA 3D3BJ 1R0AA 3KLHB 2HK3A 2UUTA 1FO1A 2ZJQQ 3IS9A 5B0EA 4QQBA 4RLEA 3HHKA 3V2UC 5KFMA 1RT7A 1KC8T 2XG8A 3IAM9 3NBPA 1N5QA 2K06A 2HHXA 3VAIA 2WSFC 1IBLJ 2OIHA 1S12A 3EICA 2DNZA 1F2HA 2QMXA 3MM5A 3VAMA 4CI0B 3CDWA 4TN2A 4TQSA 2J8SA 2V94A 2AJFE 3B78A 3GPAA 2RKIA 5LSLA 2J6SA 3NNAA 4NMXA 3CD0A 4JI7F 1SVDA 4Y28C 1RISA 3H98A 2BQ3A 2HMIA 3BO3A 1UETA 5C7PA 1RWVB 5LXYA 2AF6A 1S4EA 3NGRA 2BXJA 4FYXB 3IO1A 2HBRB 3OTEA 1RT7B 3TAMB 2XLJA 2GIRA 3PW0A 2VBXA 3M9MB 4NRUA 4K59A 5D4PA 4ZCLA 2IVFB 9RUBA 3TQEA 3PXGa 1G4CA 1EQMA 1RU2A 2V6AA 2DNHA 1C1BA 1UFLA 4ED6A 4DL7A 1AFJA 1LFWA 2L41A 3DLKA 3FEYB 2ZVSA 1DTQB 4JI2F 3GIMA 2F3JA 4JI6F 2BV3A 2HS4A 5KG5A 3SV4A 3C16A 1G6BA 1X9SA 2E5GA 3D0HE 4XPEA 3DRRB 1M0SA 2D74B 5D4LA 3QJLA 1WKKA 4C98A 5ETRA 3WQPA 1WORA 2GQQA 4RNOA 3VAFA 5KT7A 1JJ4A 2DR8A 4B3OA 3CVKA 4DV5J 3A3PB 5LMNJ 2CPYA 1T0TV 4ES3A 1F9HA 3QO9B 1W26A 4BHQA 1IM6A 1ZTWA 1R8HA 4I68A 4NMLA 4ZK7M 3LWMA 3IG1A 4EZ9A 1W2BR 2I9SA 3KK1B 5IT9Y 4Z37A 4FBUA 3M8PB 3Q8PB 1Q5VA 3LP0B 4HDGA 4JI8F 1Y4ZB 5C2GA 1VBXA 2HGLA 4KGKA 5HROB 4EBDA 2G1HA 4J9LA 1IJFB 1NJIT 2FLOA 1OY9A 1IKVA 2V34A 3JQKA 1VIXA 1CULB 1RKIA 2WW4A 3IM8A 1S1VB 5MLCV 5E33A 1F5CA 2W2QP 4HACB 3AFGA 4L76A 3FDSA 2QGFB 2OSRA 1NEEA 4LJMA 4OV1A 4ZVSB 3P3DA 5THWA 3W8PA 2HW3A 1IKVB 2YQ3A 5GMDA 3V6DA 1K1QA 4K0KJ 1S79A 3ZNJ1 2YKMB 5DDRC 1ZAWA 3FJ2A 2V4JA 5ETKA 2FQQB 1SPBP 2AX0A 1S48A 2FHJD 3FSXA 2BRLA 3U1LA 2N7CA 2W4PA 3H25A 4EBCA 4ID5A 2ZC3A 5H9EK 1N36F 4R25A 1VS3A 2PMWA 1UW4A 3D0IE 1EKSA 2OAUA 3ISNC 3P96A 5CAAA 4OYIA 3OJUA 3RRHA 2UU9F 3GYXB 1A9NB 4DS5A 1P6TA 2R7VA 3JTOA 4NCGA 3ISND 2CVIA 4MT1A 1R89A 4OX6A 1OPZA 2JDJA 4NE9C 3NRBA 5EX3A 1SI9A 4K4YA 4H4MB 3T1YF 2E5IA 2DNNA 2HZCA 4KFBB 4WWSA 2QL5B 3J80Y 2ZH5A 4DV4J 3RB3A 2LCWA 4J5OA 1VC6A 4QU7A 1TL7A 1UWBB 2Z4PA 3OTOF 2UUWA 3TR5A 3FBBA 4JV1A 3GSDA 5IT9U 1RT1A 3I6PA 5HN0A 1U48A 3FEXB 3FVYA 2CYYA 1FD8A 1GX5A 2B4VA 2FDNA 2C3UA 1VQOS 3NGUA 2EI5A 2NPFA 4CLKA 3CC4S 2XNRA 3P6YC 3D2WA 2MQ8A 2FVQA 5J2QB 1WDTA 2LXIA 3OD2A 1LQ9A 1FWKA 3CJTA 1FRIA 3IA0A 4KV8A 4I6YA 4DN9A 5B7WA 5BYSA 1T05B 3ZO7A 3AOAA 1IBKF 1H7WA 4J9OA 1KTVA 2LP4A 3E8OA 4C8ZA 2JJ4D 2JFDA 2MEWA 2X3DA 2EG2A 2ZH3A 2MQMA 2HIYA 2QJ3A 2UVWA 4C3MA 3CPWR 1GX6A 5FLXU 1RAJA 3BN4A 3I5AA 4DR4F 3SDEA 4IDKA 3E3XA 3KFWX 4X64F 3M8QA 2DPIA 2F5GA 4NCBA 3LPYA 4K2JA 5HAOA 3R7BB 3QT6A 3GIKA 5I3PA 1JLEB 3O44A 1R8CA 3KLGA 1L3TA 5D4OA 4DUYF 4O0IA 2EFQA 1RK8A 5J2MB 1IKXA 2A0FB 5IXUA 4MJKA 2DY1A 3QT5A 4X4TA 4NLGA 4C11A 1Q8IA 1J27A 4DS4A 3TX0A 2CJYB 2IPOB 4I69A 5KFIA 4CH7A 2V9WA 4GVBB 2HNYB 1C0UA 1WHWA 3HSJA 3RJMB 3A8EA 2DNRA 1FTRA 1REGX 2GQCA 3KLFB 1UJ6A 2MLYA 1R0AB 1RT2B 2P2CB 3PZPA 2D3UA 1T11A 4USKA 3GSIA 4C8YA 3DU6A 3FFIB 1HBOA 2HG4A 2HAIA 5BR8F 2G4BA 1N33F 1CQNA 2ZBIA 2YKPA 3JS9A 4GO5X 4RNNA 2DO4A 5J1EB 3Q2TC 1KR4A 1JMTA 3AJ2A 3D6HB 4OZ2A 3RG6A 3CCUS 1FI4A 1C0TA 4Y34A 4WCEQ 4DUZJ 3DDKA 3ZZYA 3QSIA 3T1HJ 2H4YB 4KO0A 4DV7J 3Q22A 4DUZF 4ER8A 5L46A 1FNXH 3G86A 1VQ4S 4RW9B 4WP8A 4IFYB 1F9FA 4HH1A 1MROB 2QA2A 2WSCC 3O1LA 3GFZA 3DLKB 1FFSB 2GMLA 4J9MA 2R8GA 2FZGB 2D41A 4Y65A 1VQLS 4HT5A 1ZBTA 3F44A 3G8SA 1DTTA 1NZAA 1U6FA 1JK9B 4U7CA 2W2MP 4LIWA 4GRSA 5HP1A 1RHUB 3TZWA 2UUBJ 4K4TA 5CABA 1PSDA 2LXUA 2EBGA 1F3VA 4YEAA 5K14B 2K2PA 5KG1A 4HT7A 2M8DB 1UVMA 4HKQA 3HHLC 4H4KC 4UUWA 1BMQB 2SXLA 2M9KA 3JB9k 1EETB 2O66A 4QWDA 2QLWA 2V8PA 2YNHB 2UUCF 2DIVA 5LSRA 2HHQA 3S7RA 3UR0A 1IN0A 3CJ0A 5LSOA 2XYPB 5EUHA 2GAHC 5CA5A 2FVCA 4IFVB 3PW5A 3SDEB 1NO8A 1FFWB 4JI6J 1ZM2A 3J7A1 4UZCA 4NLYA 4USJC 4YR0A 2A6OA 5SUHA 3H40A 2YX4A 2DHXA 3UWTA 2AGPA 1V3RA 4GMKA 5AJ3J 3UE2A 4W4MA 2Z2YB 2WVBA 4QIFA 2DPJA 1RABB 1S1XA 1M1HA 3H2VE 2FY8A 2ROGA 3EJMA 4XDDA 4CIOA 3CIZA 1RI7A 3LAKA 1KSPA 4NLUA 4QJVA 1IUJA 3HZGA 4F0MA 4IG0A 2OELA 1H72C 2HQDA 4WP3A 2MQPA 1HBNA 4PXDA 1ZAVA 4J9PA 1C1BB 1OS5A 2VBWA 3OW2R 3VGTA 2MMYA 2PC6A 1FRLA 2RMLA 1U2FA 2FC8A 1E6VB 3LA0A 2ZH9A 1S1WB 2J7KA 4DR1J 4ED5A 3QIPA 2OPPA 2YVSA 2EBEA 3BDPA 4X65F 2B4OA 3IGNA 5KAKA 2AZ1A 1SH0A 1I6JA 1NHUA 1SJQA 4WXOA 2E7XA 3VZHA 4RW4B 4P2FA 1Q95G 5KFFA 1P1TA 2D1CA 1BWVA 5J2NA 1G1XA 3BSAA 3KLIA 2HMIB 2B6AB 4RUBA 4KIAA 1HI0P 4ZPVR 3S01A 3UDEA 1OIAA 4CQ1A 5KFCA 4OX8A 1VR6A 3V6HA 2X3GA 2B51A 3LQVA 1G3OA 3RRKA 4ZLNA 1LWCA 1WHXA 2DNQA 3ZFVA 3KUGA 4XIUA 1N36J 1RT2A 5D15A 3RAXA 3O6QA 2KJWA 1Y0HA 1MN7A 4UOGA 4OYMA 4M1KA 1LW0B 2ZOGA 4OJ3A 4ES1A 1N4LA 2OEKA 3C66A 3L7OA 3PTWA 4IG3B 2IJRA 3TEGA 4P6QA 1UWAA 2Y9HA 2C2MB 3EGZA 5H9FJ 1HWJA 1FRHA 2XI3A 5LJ3Y 4O4RA 4KY3A 1HNZF 1X31C 4I2QA 3MM6B 1RT6A 1HD1A 4JI3F 3I96A 3Q24A 2VODA 2CJAA 1N48A 2JEIA 4Q2LA 5C42A 4U9RA 2DK2A 3TZZA 1Z1ZA 1W25A 1NCLA 2XMVA 4ETXA 4DQRA 5ITHA 3T3FA 4F0KA 1NM2A 3M6WA 2MKSA 4YS2A 5HQ8A 1XMOF 2R2RA 1WEXA 4P2XA 5DM6Q 2EWHA 1X5PA 1OY6A 2Z2LA 2M52A 1OMSA 3FCWA 3M1VB 5I4MA 3EPIA 3GCXP 1Y5IB 1S9FA 3AODA 1BQMB 4DPWA 5D8HB 4DR4J 3VAJA 4DL2A 2VD3A 2UP1A 1HPZB 2C3YA 4JP8A 4P71A 2AGQA 2X51A 3MPVA 3N01A 5B0AA 1EZZB 5IV3A 1ZOTA 5IQQA 4ENOA 3OPKA 2X1FA 1RBOB 3M1VA 3MAHA 2DITA 5C24A 5BXIA 3HM9A 2DNLA 4WTYA 1Y5NB 4X64J 2AEJA 1N0UA 3BDEA 3M4XA 2LEBA 2FJXA 4Q8EA 1HNVB 1TL1A 3B4MA 3JYTA 1H3DA 2JNJA 1FRJA 4F4KA 3UFCX 3VQTA 1HQUB 1N5SA 3BO4A 1FXLA 1WUUA 4ZJQA 2L3MA 4ZDNA 4ZIVA 4W90B 2GJIA 4OZ3A 3UCUP 1Q78A 1G2EA 2AJ4A 2HS3A 3GR0A 4USMA 4JUZA 4I2PB 3DOKB 3AAWB 1H7XA 2ZUAA 2HPUA 3OSPA 1TTHB 2CJBA 2D7SA 3MM7B 3RW7A 1ROFA 2CNKB 3EYZA 5G4DA 2WB4A 2LU2A 3R7NB 1RHRB 4C0OC 8ATCB 1NK6A 1L3SA 3H4BA 4ED3A 1S1UA 2AP6A 2BDPA 1RU1A 2EFPA 3GJSB 2ALYB 1XK8A 3KJFB 4RO0A 5ETOA 4CDIA 3PJXA 2LMIA 3A3OB 3MUTP 4NL5A 3KJVB 4DL6A 4BC7A 3VF0B 5DQHA 4ZP6A 2ABYA 2FPHX 1VBKA 3MUMP 2DXEA 3N6MA 1M1GA 3PR5B 1RAFB 3L7PA 3L09A 1HD0A 1CS4A 1HW8A 2KVQE 3DYAA 1U0HB 1JQGA 4USIA 5K8OA 2ZE2B 4OQJA 4WIIA 4R8UB 2J0WA 3DDIA 3FUYA 4BDPA 3DOLA 4LF6F 3PDNA 3MEKA 4CM2A 1QUPA 3GCWP 4CO3A 2Y3YA 1PJ6A 1R0BG 2YKNB 3HSDA 5C42B 2EG1A 2DGQA 1TFYA 3NG8A 4USWA 3I5BA 3SMZA 2XM3A 1RB0A 3M2UA 2CKWA 1CS4B 1HNIB 2DISA 2WAQD 3SQOP 4RUCA 4ZJOA 3C16B 1LWXA 4ECSA 1ZTTA 3SQGB 4URQU 2N3OA 1YRXA 5HSPA 3BPDA 4Q44A 4LF8J 4OMFG 5IOLA 2Y8WA 1EKRA 2VG7B 5KFGA 2CQCA 2OTJS 2B9YA 4E8UA 5J2PA 4ZPDA 1SKWA 1Q5YA 4CYUA 4LF2A 1JNZB 2C2ZB 4ATNA 3QFHA 2MXYA 2JLFA 3W62A 1HBMA 1S6QB 3OL7A 1CJTB 3QGGA 3TA0A 2KRRA 3NOGA 2XBPA 1U4BA 4X4QA 2P9GA 2ZNYA 5F8MA 3BSNA 5D6GA 3J81Y 3TQ1A 2VF3A 5F8HA 3PVXA 1RHJB 2MY8A 1PCAA 1QM9A 1O0PA 3PG9A 3Q86A 4JOUA 5HANA 2WHOA 5I42B 4C0BA 3QRPA 3N28A 5J2QA 2BZ2A 1RSCA 1VQMS 1HBUA 2KT3A 1NH7A 2W01A 3IR7B 3PYEA 4UOFA 2GO8A 3H5SA 1WTFA 4PG7A 5CQGA 5C24B 3OUYB 2BQRA 4FYYB 5F8GA 1JKHA 4CO5A 3K0JA 4MK7A 1W2IA 3OTDA 1X9WA 3DXSX 1FESA 2ILZA 3GP9A 1HPZA 2W4DA 5EWFA 4ELTA 4CLWA 1VGYA 2Y1JA 3OQ2A 4J9VA 2N7YA 2CQ3A 1UJ5A 5KFAA 2DXFA 2OHDA 4FPRA 5KOWA 3M2UB 3HVAA 3MM9A 1LXNA 3K2YA 3NP5A 4TY8A 3V4MA 1IWAA 4I1TA 3NGKA 3MEDA 2LA4A 1UEKA 3W60A 2J8AA 2RQMA 5D0GA 1XJWB 1NSKL 2GCFA 1FWLA 4DSIA 3C3LA 1CSJA 3BGLA 1GMWA 1WF0A 1IBLF 1T3NA 3D3CJ 3GV8B 3MM9B 2ZBRA 3NEKA 4IKAA 1Z2ZA 4LF1A 2VA3A 3V81B 4ECRA 2DTJA 3KHLA 1SV5B 4P2MA 3P4UB 3D6MB 2C22A 5DG7A 2W9CB 2L9NA 1VC5A 2MJNA 3K58A 5KOXA 1PO6A 2QLFB 3W3SA 1SBRA 2I6WA 4OX7A 3UNGC 3TAQA 1Q79A 4K0KF 4CYUB 5IM0A 3BF4A 2HFZA 1UVNA 1FJ7A 1BLUA 3GJQB 3N4WA 4K7QA 1LWCB 3KG1A 4WKRA 5HMXA 2YNIB 2VG7A 2DO0A 3NGTA 5FDLA 1HQEA 2KM8C 1F1BB 1SL2A 3BSCA 1IR2A 1KKHA 3M8QB 4OV6A 3FMWA 1EX8A 1X4AA 3CCZA 2RU3A 4C8NA 5CYQB 3CJKA 1FX2A 3E01A 4NYPA 3ISZA 3NLCA 4MAKA 3V81A 5HLFA 1WELA 5KFOA 5AE1A 4UY8T 3HT3A 1RT5B 2RRNA 1NXIA 2VICA 1H6KX 5H9EJ 5ETLA 1HNZJ 1KQKA 2EKNA 2UXDJ 1PBAA 2COLA 4X4NA 2I8EA 4UY85 4K4UA 4DV2J 1T94A 4KSEB 3MEGB 1W7WA 1RADB 2C3OA 4HHUA 4UOHA 3UDVA 2PI4A 1AXQA 1MWYA 2AIRB 3EGNA 3ITHA 4ZVPB 2KXHA 1AROP 1LKZA 3KKFA 3MAQA 2ZH2A 3KTQA 2W2PP 4CCHA 1EQ0A 4GKJF 5D0RA 4DPXA 4UTGA 2LA6A 2ZKUA 2WTFA 3I87A 4R0EA 1VRUA 3G82A 1UFWA 4O3RA 2FHMA 1VK3A 1FD2A 2XGQA 1WG5A 4X4RA 4OFZA 2BW2A 5J2MA 4LF4F 1KLMA 2V67A 4O3NA 4B08A 2ASJA 4FXWA 3CJQA 4HHJA 1S1UB 4USVA 1U45A 4RR5A 2BM0A 1NSQA 2VPXB 2RH3A 3DGVA 3ENQA 2HHHJ 5E3AA 1BE4A 2QE5A 3KG0A 1TP7A 3DLHA 3K5PA 2MLZA 5IS2A 4QU6A 1KQFB 2WCXA 3IRXB 5KT3A 3HPOA 3JTNA 1NJXA 2IA6A 3DOMB 3FRYA 4M5NA 4IO9Q 1MWZA 1D09B 1OPIA 1YBUA 3MMAB 3PY8A 3X3UA 4DWIA 3M8YA 1BC6A 2MZTA 3PYFA 3R5AA 2R7SA 1S6QA 5CYQA 3V6KA 4JI4J 2GZOA 3PYDA 2LQJA 2RVJA 3BKTA 4IOCQ 1M90T 1RA7A 1N6QA 4L3KA 2LFVA 3G4SS 2YNIA 2B43A 5FDLB 4KHRA 4DF4A 4LF7F 2IRXA 3KNGA 2X1GA 4C7QA 4WKYA 2IBOA 1XNQF 2V4RA 1PKUA 2B7CB 2C2KB 2DGOA 2FYXA 5M2UA 2XMWA 4YDDB 2DR9A 1TKTB 1FNMA 1H2TZ 1TAQA 2CPEA 3KLIB 2ACYA 2VPZB 2FJDB 3I9ZA 4MFBB 4M5JA 4EI2A 5RUBA 3FSYA 1D9AA 3BQ0A 2GQ2A 4YB6A 3OVBA 2VQFJ 3TP2A 1HYSB 3GIIA 5AXNA 2ZHAA 4I7FA 1X7VA 2NXNA 3DNCA 2KG1A 1UCNA 3ENVA 4DL4A 1XMOJ 4PXEA 3RBDA 3F0NA 2UXDF 2GO9A 3UCGA 4QYZK 2Y1IA 4F25A 2H1YA 1HWKA 1SB6A 2QIFA 5U47A 3MM8A 2WSEC 4RBUA 3SV3A 4ED0A 3D0GE 1WC3A 2P5VA 2DNGA 4DXLA 1QSLA 4KPCA 1CJUB 1N32J 4DL3A 4FKYA 5CZVA 3VVTA 4LR8A 2BABA 3ZZ0A 4B9SA 2V63A 2EFGA 1TMMA 2R2TA 2XSJA 1Q8KA 3SYZA 2KB2A 3T5HA 1H38A 2BYCA 4RBVA 1VHIA 2LU1A 1HHSA 1H2UX 1U6ZA 2W25A 2P6TA 4P10A 3D1QA 5KG0A 4NYOA 4N56A 2V2QA 4YR2A 4NXMF 3OR2B 3PO4A 2BOPA 3T1HF 4KT0C 1LK5A 1QSSA 1S1TA 3FZBA 5HVHA 4O23A 1WHYA 2GA7A 2GC8A 5LMUJ 4FF3A 2QYCA 2NS1B 2J0SD 3L4BC 3LP1A 3K17A 3IWLA 1LFPA 2GV1A 3DCAA 1F0XA 1YX2A 2NZ4A 2GIQA 2L9DA 4LFCF 3MURP 2W24A 1RAIB 3K5MA 3R1HA 5K5MA 3D1HA 4OX9F 2R7XA 2CRLA 2VC0A 4QOTA 4N8NA 4J9KA 1DHMA 3D54A 3MECA 4Y6IA 5KFPA 2PEBA 2YKAA 1I1GA 3FSIA 4EK2A 3HJVA 4ZOSA 4X66F 3IAS9 4NA1A 3KLEB 2ZKTA 2HNZA 5HI7A 3EMTA 2XEXA 4LR9A 4KKOB 3IR6B 3ILOA 1RTJB 4HTIA 4UT4A 2KZMA 1FHTA 5DDQC 1R8AA 4D3GA 4AQYF 2MKCA 3PHTA 1L3VA 4FVMA 2BE9B 2W8LA 3HHLB 4ZP7A 2DRDA 4R5PB 4ZCKA 1FEHA 2QRRA 1XNRF 1HLWA 3JQJA 4DSJA 1ICEB 3HHDA 1YRUA 3SQGA 5L39A 4JV5F 4KFBA 2YNGB 2D69A 1FVSA 2OKQA 3R97A 2W7PA 2ZOFA 3MAAB 3BBCA 5DGBA 2CJKA 4ZLLA 1RWUA 4JYAJ 4LFAF 1GK8A 4NLRA 3UD5A 1GMUA 1HHQA 1S5ZA 4L3NA 3PW2A 1RBAA 1BHNA 2I1RA 2LYVA 3CJ5A 1U09A 1V5VA 1DY3A 2NYIA 3MMCB 3SCIE 5B09A 1RKJA 4V19J 2LQ9A 1YJRA 1U2RA 5A2QY 4KTQA 5EX0A 3D66A 3R7SB 5KFBA 3H42A 5KG7A 3PO5A 2QA4G 2HHWA 2AMCB 4OZ5A 4O4GB 3MR3A 2HVZA 2DBBA 2DVIA 2ZE2A 1NLKL 4NX9A 3VAKA 1RTIA 3OVAA 4ZVTB 3P45B 3HD2A 3KYLA 2LECA 3OTOJ 2EEYA 2HWHA 3J80U 5JXSA 4C11B 1FFGB 1O6XA 2F1FA 4RWWA 3W9HA 2YXLA 5F9NA 3W65A 4ZHRB 3M2RB 1C1CB 2M70A 4UF4A 4XDCA 3OLAA 4LFBF 3RB0A 3W2VA 2BR0A 3BR8A 2ZHOA 2G2ZA 3M8PA 5GVQA 1VFJA 2F4FA 2NZCA 2Z2MA 1HKAA 2IM3A 1FX4A 4LUBA 4ZVHA 1U49A 5E3CA 2OTLS 3ICLA 4ED4A 4NLVA 1PJ5A 1FKPB 3C14A 3ILLA 3PM9A 2M3DA 3MMAA 4RKUC 3PFEA 3CJRA 4Q0BB 2ZBPA 3IM9A 4PYDA 2PA3A 2ZJPQ 1GMWD 1P8GA 1QE1B 1S9EA 4ZMMA 2NR0A 3NNHA 5IT0A 4K50A 1U25A 3JQMA 1K47A 4H4OA 4FXDA 1U0SA 4ITSA 1M5PC 1RTHB 5DZ6A 3UCZP 4TVAB 2VUGA 5I3UA 3OL9A 1PJ7A 4GC6A 2CPZA 1IWGA 3CO9A 4CRJA 2FLPA 1SC6A 1JKHB 4DU8A 4FYVB 5KFJA 4QWEA 4WJBA 2E5LJ 4KJIA 3JAMU 1GFWB 3U02A 1FRKA 3FCHA 4WBFA 1OSCA 4IOBA 3EVOA 2BJDA 4ZP8A 4WIQA 1RTDA 1VHFA 1N0VC 2N4DA 2RJZA 2JHEA 2HNYA 3BKFA 3CJSA 1PYSB 2XNQA 4QPTA 3RAQA 4A8YA 3M7VA 1AZSB 2PA8D 4G1QB 4HR2A 1Z2LA 1ZZFA 2DGWA 4I4BA 2RIJA 2C2EA 3TA2A 4QIEA 3TAPA 2O1PA 1KBRA 4ZA1A 7AT1B 4PUOA 4PCQA 1I5OB 4CO2A 1B7YB 1S6OA 4CNYA 2XY7A 1ZH5A 4IFVA 1HI1A 1V6HA 1VISA 3CWJA 3OFHA 3U1NA 3UPFA 2MKIA 3CW2C 3ENWA 3ZZUA 4O3QA 2ZH1A 1K0VA 3NGDA 1FDDA 2VBYA 3OFEA 3TNVA 1Q7YT 1SKRA 2YNHA 4B9TA 4B9UA 4LSNB 3HP6A 1SCJB 5ETPA 4O3PA 2J7UA 2OGUA 1NDLA 3V6DB 2HQGA 3A1YG 1IR0A 5FIIA 3CCSS 1YZ7A 1AB8A 2BUNA 2QLXA 3BGUA 4PEOA 3VAGA 3GTYX 2YNFB 3NS7B 2HRYA 2IYGA 4IG3A 4TYBA 3HFVA 4WFNQ 2B8PA 1WD6A 1X9MA 4A46A 2F9JA 3CDAA 4TXSA 2IC3B 5IWAF 4WZQA 4DOZA 3NMRA 2ZZNA 2XWYA 2M4MA 3VV2B 5HL7Q 1OQ3A 5CD4A 3ZZPA 2XMKA 1JLGA 1VDHA 4NPOA 3UDCA 2YQ0A 2ZDOA 2KFZA 5A8RA 2UUCJ 1NU4A 1T7PA 2XSFA 3BH7B 1R8PA 3CCTA 2XO6A 2DR6A 4CLTA 2QYGA 4OYXA 4C8KA 1URRA 5CYMA 3CULA 2HVIA 1B7FA 1UMJA 2A3JA 3NAIA 1LK7A 4IR9A 2DCLA 3M2VB 3HHEA 2E7WA 4EMDA 4BBYA 2BM1A 3BPSP 3Q8YA 4Q0BA 5E3RA 4ID8A 4OX9J 4DCPB 4F4XA 4A8QA 4USUA 4JI3J 1E6VA 5BYQA 3MD1A 1X4CA 1RAOA 4MK9A 4JI0J 1PG5B 2QO3A 3CGIA 3MHYA 3OXLA 1VRTA 4O44B 5KFNA 3RR7A 1HMVB 4GKJJ 1NPKA 4WFYA 3MCSA 3IWNC 3BB5A 1IKYA 4OZ1A 4DCJB 4L72B 1D9DA 4KHPF 2F8HA 3QLHA 2CDRB 2YH0A 3HFZB 4M5MA 3ZZZA 3KLFA 1IVZA 1J5OB 1B3TA 1DJ0A 4LMZA 1ZA2B 4LBHA 3K7RA 1FT8A 5T7LB 4TKTA 2DHAA 3W5XA 3HI9A 3NKYA 4BWJA 2KXNB 2MSTA 2R4FA 5ADZA 5D0HA 3BM7A 3QBCA 3HKWA 3CCLS 5GAEU 4AL7A 2NCKL 3DM2A 5D4NA 1YHQS 3JSBA 2XS7A 1JWWA 1DBDA 2HZVA 2GVZA 3HKZD 3I0RA 4Y2CA 2W4CA 3BJYA 1NSAA 3RB6A 2PFDA 3C6TA 3LP1B 1HFEL 4DX6A 1XR7A 2GJ2A 2MKJA 3CE8A 3PEHA 4JI8J 4WK1A 2CPFA 3DM2B 1F5BA 4Q43A 3UVJA 4PPZA 3QNWB 3RZAA 4IRCA 3PX0A 3B54A 4DUTA 5EDWA 1NRKA 1NDKA 1XIQA 2DHHA 3MAAA 4DDFA 4YP3A 3MF5A 4A8WA 1P9QC 2QSFA 1JLQA 2ZUGA 3CCRS 2DNMA 1CULA 2K3KA 4M8LA 2MZJA 4LVOP 4EO8A 1IJEB 2D9PA 3CDEA 3M6UA 4WTOB 1BQMA 1UZDA 2GNKA 3QLHB 1R7IA 3HX9A 4PQAA 2RILA 2VOPA 4KH0B 2RQKA 3D6TB 2DHGA 4NLDA 4OJHA 2M2BA 4KHMA 3VR1A 4L74A 2HHHF 1V9OA 3ZTSA 1ZM4A 2B9EA 1AW0A 3KK1A 1OWXA 1UPPA 2O01C 4NEYA 2FVPA 1PYOB 4PWUA 1RT3B 1MN9A 4LFAJ 2CIMA 4DMZA 2CZ4A 1YITS 1DZ5A 2FJWA 2J9EA 4NA2A 1JLAB 2DNYA 2UV8G 4XAKA 1A7GE 3AOBA 1YGYA 3B82A 3DDNA 1UA0A 4Z7YA 1LWFA 2HLTA 1AYEA 4B3RJ 3KJQB 1BWEA 3Q8VA 5FJ4A 5HATA 5A8WA 2ACMA 3BZQA 4F04B 4KE5A 3KK2A 2DD8S 1MNEA 2CPXA 2VG5B 1SIWB 2Y1RI 1X5TA 2EFOA 2HIQA 3GMGA 4GVLA 1TKDA 1TV6A 2GVDA 1YBAA 2QL9B 3LF0A 1Q53A 3H5UA 2OEJA 4JI7J 3BQ2A 1RA6A 2FGOA 2V4JB 2YX7A 2CJQA 1FWPA 2PE8A 3L9ZA 1JLBA 4ZVRB 1HNXJ 3DYAB 1VCTA 2LXFA 4GVBA 3CJ4A 5F3TA 1GEHA 1RTIB 1SV5A 4DHVA 4IOAQ 5DJBA 1XERA 4L6V3 4ZCMA 4CNZA 1XR5A 4JI1J 4P73A 2EFNA 5GMKa 2HHVA 1F2GA 4ELVA 3H7HB 5T14A 2WONA 4DSEA 2CDQA 2B0GA 2OD6A 3UD3P 2CG4A 4J9RA 3V5RA 1OJ4A 5GADI 4ZLPA 4DR2J 3GYNA 3M8RA 2WBRA 3QWPA 4RX6A 3G6ES 3KMQA 4X4OA 1UVJA 4F3QA 2IM2A 4JV2A 3HFKA 4FYWB 4RU2A 1BUXA 4ZVGA 3PKYA 3EXYA 2KYXA 2QEXS 4IH5A 2KHCA 2R8IA 4EU0A 3EGWB 1VIOA 3MTKA 1N33J 4X4VA 1AFIA 2R42A 1J5OA 1FXDA 1T05A 3IS9B 4ZPBA 2ZNZA 1HARA 2LEPA 5F0WA 5HBMA 4U8YA 1RYRA 3ITHB 3KNAA 1RT4A 1YWXA 1N32F 3GFHA 1CPZA 4ZVQB 1IKYB 3UDLA 2XGPA 4DPYA 1CJUA 5G0RB 4N41A 1Q1KA 2V8GA 1EJ7L 1SH3A 2Z58B 4OI2A 5B0GA 3W2WA 2KH9A 2LQBA 1NSPA 1RTHA 4MTPA 2ZH6A 3CD6S 3PW7A 2UVRA 1BXNA 1Y5LB 2HFOA 1RWMB 2IM1A 3PYGA 3VWSA 3CO0P 3M2VA 2UV8A 1DQ8A 1EETA 1B70B 2NXUA 3QATA 4IO1A 4ZCIA 3J7Z5 3CCQS 4IRDA 2DR5A 3RYLA 4WFBQ 1WC5A 3FBCA 3OHAA 1RYSA 2PI5A 1SKUB 2WZ1A 4G6VB 4DR5J 1TKTA 2OMLA 4ZN1A 1UP1A 3GJRB 4AYBD 1T95A 4KAIA 1GXUA 3KLVA 2LVWA 3KHHA 4F4WA 1NUEA 2WONB 3WBZA 5L9NA 2AGOA 1F5AA 3EWGA 4LF5F 1JLCB 4I6WA 3AY0A 1S9GA 2VASA 2HVEA 4LSLA 2HGMA 5GMEA 5KG4A 2E1CA 3DRSA 2ERRA 4CTAA 2AEFA 4NWBA 4LRBA 1XNRJ 3NBPB 3WIUA 3MEEB 4PQUA 1KFDA 4XK8C 3MCOA 1Y9OA 2V2ZA 4MYUA 2G13A 4OZNA 4RNFA 1N5VA 5KFDA 1WJ9A 4TU8A 2IAJA 4QZVB 3CTRA 2IRYA 3JAMY 2NLWA 1UW9A 2CVEA 1C0TB 2MJUA 4DPOA 2UZAA 4I64A 3IRXA 1PILA 2RHQB 3Q8UA 3QZ8A 1EP4A 3EZ5A 4B3RF 4J7CA 4O4GA 3J7ZT 5KT2A 5D78A 4LF5J 5JUMA 1RWKB 2V2KA 4B3TJ 4DR7F 3LW5C 4ERDA 2JH3A 2NPIA 2E9TA 4MIBA 4DFPA 1KTQA 3VGVA 2OMOA 2A2DA 3KUHA 4XO0A 2ZEJA 3KJNB 2HS0A 1VJWA 4PYAA 4DR5F 1AA1B 3N79A 4P7VA 2H51B 2V69A 4M5DA 4QIGA 1DLOB 1IBCB 1F3FA 2C2NA 5GAEI 4LVNP 2ZWPA 3W5YA 4E2FB 2IAJB 4PG8A 1C0UB 2YNGA 2HK2A 1FKOA 3PJ9A 4J37A 5HK4A 4QW9A 4K2XA 5E0OA 5KG2A 3OXGA 4X62J 2FB0A 2HFVA 2Z8QA 2DXDA 3ETMA 1JLGB 1HR0F 5KFYA 3QRQA 5F8NA 8RUCA 3IFEA 5A76A 5JJBA 4ZIWA 4DSFA 1S0MA 5ETVA 1BQNA 2EKYA 3DI6B 2NXJA 3OTBA 5IM0B 2JC1A 1KN6A 2HLUA 1N5YA 3MM7A 2CADA 2CQPA 4OYAA 4IDKB 5CD4H 3TAMA 3DMJB 1HNWF 4CO1A 4JI5F 4GKKJ 1C4AA 1F9EB 2XZTB 4I0WA 4KBIA 3Q83A 4C8MA 2N4CA 4K4WA 3PV8A 1K73T 1DRZA 4A8MP 3V6JA 1FKPA 3ZNUA 2L48A 4RW7B 4NXNF 2OFGX 3E01B 3AXKA 2BQUA 1YLXA 1HBMB 2K7JA 2VKRA 2RE1A 3IBCB 3MOZA 4B9NA 4F02A 2YWEA 1QAIA 4P75A 3TYTA 5F8IA 1RGVA 2ZZTA 2CNLB 3GFXA 3MFHA 2VQFF 2JEGA 3DKDA 1RAGB 1JXEA 1ACMB 2CPJA 3D6FB 4HEA9 2EC0A 4YB1P 3NY0A 2C2DA 2BJ8A 2CUYA 2E5HA 3GG0A 4LR7A 2IJNA 4U6PA 4RUAA 2DR7A 4RPFA 4KPYA 2XZWA 4KHPJ 4QPXA 5BJRA 2O5DA 3UR3C 5HBMB 1Q4RA 4RW8B 4EGLA 3R2CJ 2RAQA 1PAEX 4WK3A 3FQKA 3I82A 1RTDB 4ED2A 3M30A 3W63A 1WC1A 1SL0A 2C1EB 3O8WA 3TVYA 4ED8A 3H2UB 4ZPTR 1M5HA 2ZDPA 5IC4B 2MZRA 2PMHA 4WE1A 2R7TA 3EGVA 2MQNA 1SC3B 2P9CA 4P2SA 1VQSA 3FZ2A 1R8BA 4PXBA 1JLFA 4X65J 1MMNA 2AJ2A 2EXUA 2F7VA 3AD9C 3EXCX 1IM4A 2G9OA 3QYYA 5IQ6A 1XWLA 1YJUA 2D3O1 4A8SA 2VONA 4U67Q 4DV0J 2KKHA 4RWXA 3TVKA 5JVHQ 4OZLA 4U8VA 2CNOB 2OEMA 2ZH4A 4XPCA 1T3OA 3LTOA 3R6LB 1ZETA 1KHWA 5LMUF 4OHYA 3F73A 1D8YA 1UKUA 3MEEA 1MMLA 1SC1B 4R5PA 3GG1A 3OSNA 5A8RB 2LEAA 3THVA 2J9DE 4N8OA 2RHSB 1S9GB 3ZZRA 1WEYA 2MZ1A 1XTZA 2Z0GA 4ZPCA 3CF5Q 4K4XA 1D3WA 1KOOA 1VYAA 5L8RC 3W5ZA 2XB2D 5AXKA 1J5EF 5KFHA 1WSRA 2B5JA 5F8JA 1VI7A 3SIPB 3OLBA 2RQCA 2B9XA 2DIUA 3BGRA 1TUWA 3KK3A 3KWMA 4RW4A 1HHTP 1NPPA 4KH1B 1HWIA 4EO6A 4N7TA 1P1LA 1QTNB 3NS6A 4DV2F 4F4ZA 2B7BB 1S97A 2GIFA 4OHXA 3ONQA 3R8YA 2DKOB 4C6AA 4ELUA 2V0NA 1SQFA 2YKNA 3MPDA 4DL5A 2IA0A 2CZ9A 3K8WA 2XLIA 1S6PB 4USTA 4P7TA 1DTQA 2HZAA 4M95A 1S72S 4CLFA 2CQIA 1SC4B 1PAUB 2CZVC 4JI5J 4U7UD 3TRGA 2MQQA 4ILLA 3MMBA 3BEGB 1CEZA 3MZIA 3VZIA 1FKOB 1WI8A 5GAGU 5DS7A 1KRPA 2XMAA 1WC0A 4K4ZA 1N54B 1V5IB 2WVCA 5DM7Q 4DQQA 3VAHA 4C9DA 1WOSA 1KS2A 3AD8C 1CG2A 2V9KA 3BYPA 4K8RA 4QIVA 4URGA 3NCPA 2J5AA 2GHWA 3HHNB 2JOQA 1S6PA 1D0EA 4X4UA 1QAXA 3H59A 1QLNA 2RT3A 2CQ4A 3KOAA 2IRUA 3IXQA 3EX7B 1UJ4A 2RKIB 3B4DA 2RB7A 3O3LA 4JI0F 3MECB 3VHQA 1PC4A 3M9NB 4P9SA 4TY9A 4U95A 2M8HA 2UUAF 2CWXA 2RUGA 1VJQA 2K3IA 2RRAA 2ZBQA 1LV5A 1M5VC 4PWDA 3CD7A 4TU7A 1TKXB 4DR7J 2VL1A 1YSJA 1UZHA 3DMJA 2CPDA 2MDAA 1ZM9A 5A6PA 3AHPA 1LW0A 4PPDA 4A8OA 5KFQA 3QZ7A 1TFWA 2PD1A 1R31A 1K0TA 3PW4A 1DQ9A 3AA8A 1X4BA 3M2RA 4EYHB 2DGUA 1GQEA 2OLWA 4DUYJ 3R5JB 2NREA 3N0VA 3EZOA 1UEUA 2RDDA 3C6UB 1RLDA 5L1IA 4RNHA 4WU3A 3FMBA 3E2EA 3BS9A 4DX8H 2PO4A 2XSJB 2B6AA 1UVKA 2BBEA 4G65A 4PWDB 1H2VZ 4HYKA 4MK8A 2KG0A 2FZCB 5J1PA 2G0IA 5EWEA 1FE0A 2BJ7A 2MTLA 3QMQA 3CD5A 3Q2SC 2EVZA 3LP0A 3SBMA 2BA9A 4PABA 1LW2A 1S1WA 2HAFA 3HSZA 4RZRA 3W2WB 3QIPB 5H9FK 1Q8LA 1S0VA 2Q1LA 2YH1A 4JV5J 3FFIA 1WG1A 3D68A 2JL9A 3MR5A 1DAXA 3R5BA 2HYIB 4E0DA 3IC1A 3ZZOA 1VRQC 1KFSA 1YBTA 2EK1A 3FRZA 1AUDA 3AJ1A 1YVFA 3RBXA 2KDOA 2OPSA 4DPUA 4DR6J 1RE1B 2Z56B 4RW8A 3HT0A 3EZUA 6AT1B 1ZM3A 2QZ8A 5DG9A 4IH7A 2AKWB 4NI2B 1T9XA 2NXCA 4OZJA 3UVJB 2M7SA 5M2RA 2BE2A 5KFKA 3KHRA 1PGZA 4F4AA 1JLCA 2CQ0A 1REVB 2KTQA 1JIHA 1MLAA 2F8MA 3CT9A 2AD9A 2AEMA 2OJ3A 1X4EA 2E5LF 2LQ8A 2WVFA 1KOHA 3MD3A 4F2SA 4LFCJ 2MZSA 2CXEA 4LBPA 1VQ8S 5FD1A 1JB0C 1TKXA 3MPUB 4MKYA 4Y3CA 2YWKA 1EARA 2J76E 5HMWA 5H1SV 4DV7F 4DR2F 4CWBA 1U1LA 5K14A 3PFOA 3HSGA 1JNRB 1YQHA 2B5JB 2PSZA 3T19A 2OD4A 4TYAA 2UVUA 3QRRA 5JMNA 1U1MA 1VBZA 2E1MC 4DV3J 1Y10A 1WKJA 5KFWA 4K5SA 4ZVUB 1VQYA 5C2CA 3CXCR 1TUVA 3L7UA 3VCDA 1HMVA 3ZTPA 3OHBA 2NUHA 3EVMA 2Q79A 4PG4A 4MYTA 3W9IA 1N56A 3GB0A 3HD1A 4NLWA 4NLSA 1TL3B 5M2PA 3IN5A 4WFZA 3K5LA 2R8KA 4RW9A 4W98A 1RCXB 3R2DJ 1VRUB 3G82B 1ITPA 2CQHA 1TU0B 2Y0BB 2FTRA 4OJGA 4QYRA 4ILMA 3Q8SB 4ECXA 5CH7B 2DT9A 1JJ2R 1HNIA 1SIZA 4KO0B 3MMBB 5KFTA 3VTIA 3D5MA 5K9FA 4RNMA 1VQ5S 1FERA 2R8JA 4M94A 1A0OB 4DR3J 2HFSA 3QFWA 1RAEB 5J1EA 4RUHA 3DXBA 4Q5VA 2WW8A 3LGHA 2POKA 2VBZA 1XMQF 3QJPA 1VQ6S 1NMEB 1U1QA 3AQPA 4PWWA 2JFKA 1DARA 1XN9A 5IFMA 4A8FA 4ES2A 2MQLA 8AT1B 1H74A 1TVRB 4C97A 1I94F 4N76A 2XMUA 3EUNA 2ZFHA 4ZN3A 4Q45A 2QX0A 3A12A 1RCOB 3FEZA 2OFHX 3BREA 4D3HA 4ETZA 2ASDA 4B9VA 1L3UA 1B0TA 4YN3B 2B4PA 1N52B 1YI2S 2KL8A 5F41A 1Q0NA 2JWNA 2VZ9A 2QSWA 1VMBA 3AD7C 3R6GB 2V68A 4F26A 1SJ3P 4CLSA 3Q23A 1KVKA 4YR3A 3IR5B 3NGSA 4DQSA 4JI4F 2ILYA 5DQIA 1IBKJ 2YPZA 1NK4A 3N5BA 4B3MF 2Q66A 2DH9A 2A6MA 3WDOA 1D8ZA 1TL5A 1TV6B 1LEOA 3VGSA 4AT1B 1N8RT 3C6TB 2W8KA 3TUJC 3KDNA 3R5CA 3I0RB 3MXHP 4AXIA 1CBKA 2VV5A 2ZWOA 3I31A 4GO7X 4QR1A 3W61A 3KK2B 3HXMA 2HEKA 1KDNA 4RW7A 2HQFA 3OBIA 4X66J 3BO2A 5KFXA 4B17A 5K8PA 3THTA 2DH8A 3NCRA 5HP1B 2E1PA 2XMMA 2J9CA 2P8IA 3BGOP 2OPPB 5T7LA 3RGIA 1C4CA 2VFRA 5B0DA 5DG8A 1ZYQA 1FTCA 4UOCA 1EAYC 1HI8A 2BACA 2BVZA 4LIRA 5A0YB 3DI6A 2BJEA 2YWWA 3MEDB 1NB2A 4PKDB 3S8SA 3Q8QB 4DFKA 4EUVA 1LWEA 3GU0A 1EB0A 4E98A 4DV3F 4PRFA 1U02A 2BE2B 1Q16B 4DN0A 4Y0FA 5HJXA 1U1RA 1TL4A 3TA1A 4FS2A 2CQ2A 2LLZA 1D9FA 4KR0B 2A18A 3DRXA 3H5XA 6FD1A 3OL8A 3LWLA 1NK7A 3A3NB 1M5SA 4NXMJ 3C8YA 2KT5A 3C15A 4H54A 2B8QA 2OP5A 3ULHA 9ATCB 2MKKA 1JXLA 5LJ5Y 4F2RA 5F8LA 4M5LA 5FLXY 4FXVA 3GIRA 4OI3A 5KFRA 3M32B 4CZCA 4LBIA 2JLGA 3MR7A 4IRKA 4U96A 1NKEA 1WOOA 2I5JB 2Z30B 2UUAJ 2QMWA 1LNQA 5HQMA 4B9MA 4M63A 3X1LB 5L9XA 1RACB 2XYGB 2R7OA 3UN3A 5ETQA 3UI3A 4KC5A 4CLLA 4ECVA 1HNWJ 5JVGQ 1JJCB 4HVZA 4ID5B 2GMHA 5CCMA 1WWHA 4Y2IA 3TOQA 3CC2S 2KVIA 1WF2A 4I2QB 3UQSA 3SZ2A 2IJFA 2KO1A 2OI2A 2YKMA 4OLOA 1NHKL 3SCJE 4FYDA 2VG6B 4ANEA 2AJ1A 2AW0A 5KT4A 4DLEA 1S1VA 3NS5A 4DV5F 4HACA 1DTTB 3T41A 3HZEA 3HMJG 4LF9F 3UW1A 3FBFA 1YRTA 2VPYB 1U1OA 4OL8A 2XY5A 1J5EJ 1CJKA 3LOUA 1FJEB 2MPUA 4I67A 2FLLA 2J7WA 4JI2J 2EPIA 3DHXA 4IFYA 4LRAA 3UN5A 5AXMA 3BV8A 2DEIA 2DNOA 3OR1A 3I0SB 4OYWA 3UNYA 3CMQA 3MCNA 2DGTA 3MTJA 2AT1B 2XI2A 5J2NB 3W1YC 3OJSA 2Y1LB 3CDUA 1VQPS 2CAJA 4C8OA 5ETTA 3ZTOA 4DG1B 1RWXB 4P52A 3ZC4A 2MHNA 2MGZA 1HQ2A 3B6BA 2WRMA 4NRTA 1SQGA 1JLAA 2BOAA 2GJFA 2YKOA 3RU0A 2XCAA 3TARA 1JX4A 3I0SA 2MKYA 2CJ9A 3BQ1A 2KM8B 4O0NA 2AYGA 1X4DA 2PMZD 3T5KA 4HDHA 2IDLA 5GAGI 2R7UA 4WFAQ 2GMJA 2AYEA 3PHEA 2MYFA 3KMSA 3TJAA 4DEZA 1H0HB 2XWXA 2OPQA 1LWEB 5I3QA 1U6BA 2YY3A 3HVWA 1JLQB 3CUNA 2JZ5A 3T9ZA 3QJJA 1K1SA 3ETOA 2Q6CA 1U1KA 2E7VA 1T9TA 1YK9A 2L08A 3D1OA 1KP6A 3QQCD 5CHCB 4F67A 4MH8A 3T5LA 2R3VA 2WOMA 1FCAA 2UU9J 2CWKA 1NDCA 3B8HA 1FE4A 3J81U 1ELOA 4HHHA 3DOMA 4YB5A 3WC2A 3TUPA 1DURA 2LKZA 3JXOA 4C8LA 4DCOB 1GH8A 1U24A 1L3KA 1FRXA 2RF2A 3ZZTA 4FF4A 3KUEA 2ZOMA 1VLOA 4A4JA 1SJFA 2H5EA 4C0HA 3MPWA 3JSYA 4IQMA 3W2VB 4UQGA 5LT5A 3A13A 4PG6A 3H4DA 2U2FA 2GW8A 4DL0C 2RS2A 3MM5B 4X4PA 3L3CA 2NXEA 4ZP9A 4P72A 3K5NA 4NXNJ 2W2NP 4JB8B 3PX4A 2MSSA 2VH7A 3MCMA 3C15B 2HNDB 2G2OA 3MI7X 1T9YA 4MKAA 4RW6A 2R2UA 4AUKA 4CP5A 1VQ7S 2B3TB 6FDRA 3DC2A 3UN2A 1T8EA 1NKCA 1YTYA 3LP2A 1LOUA 2QC3A 4ANCA 2WBMA 2K8GA 3MM8B 4WYLA 4CH1A 3A8JA 1TVRA 1RLCL 1FDBA 4OHZA 4KGVB 4FN5A 4DR6F 2V2VA 4I7FB 2CJXB 3FC9A 4FP9A 4H4MA 4X62F 3M9OB 1MU2B 1U2CA 2YTCA 3W66A 1DLOA 1NH8A 1U7LA 2PIIA 1WKLA 1Y11A 5HJYA 2FJVA 2J6TA 4PR6A 2R8HA 1UL3A 4NA3A 2YWHA 1RT3A 4OYPA 2CG8A 3QGPA 4AXJA
chains in the Genus database with same CATH topology
4LBPA 1MWQA 1S7IA 4LBIA 3ZNJ1 4FPIA 3ZO7A 4LBHA 3ZNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LBP A;  1MWQ A;  1S7I A;  4LBI A;  3ZNJ 1;  4FPI A;  3ZO7 A;  4LBH A;  3ZNU A; 
#chains in the Genus database with same CATH topology
 2V8D A;  1S7I A;  3K89 A;  4YHH F;  4F50 A;  1B0P A;  2AWZ A;  4MKV A;  5DGA A;  2UXB F;  3MM6 A;  3DOL B;  3MWB A;  2YWF A;  4ZJL A;  4CT8 A;  1EP4 B;  1KQS R;  4DJB A;  3RRG A;  4B3T F;  1QVG R;  1WDD A;  3CDB A;  3F41 A;  5AT1 B;  1VQN S;  2NQP A;  4V1A k;  1U0H A;  3UD4 P;  3I55 S;  3PEJ A;  4CLZ A;  4ECZ A;  4IR1 A;  1ZAX A;  2IC3 A;  2FHO B;  4DZD A;  5KT6 A;  2JEJ A;  3U27 A;  5ETS A;  1GT8 A;  4OYZ A;  3T9N A;  1RDR A;  2I38 A;  3KXD A;  2XMT A;  3OTC A;  4CTA B;  1S99 A;  3EE3 A;  3J7Y U;  2FUG 9;  4Q2M A;  3PKM A;  3DLG A;  5CXT A;  1RWN B;  1X5S A;  3L95 X;  4IH6 A;  3RUB L;  3MUV P;  1KNZ A;  5HMZ A;  3T5J A;  3R5D A;  4P74 A;  5K8N A;  1V3Z A;  1IBM F;  4AD6 A;  2CQ1 A;  2HFN A;  3JSM B;  4OJ1 A;  4QWA A;  4WFX A;  4YHH J;  3SI8 A;  3D9B A;  2KI2 A;  3LGM A;  3TUI C;  3DOK A;  3R1L A;  4TY8 B;  3AQO A;  1OYE A;  3ET6 B;  2H4W B;  1GTH A;  1TR0 A;  1O8B A;  1RTZ A;  4G3I A;  1NPR A;  1TEL A;  2JRS A;  1BY9 A;  1X4G A;  1WEZ A;  2KXF A;  2N3L A;  1TKZ B;  3VGU A;  3DN9 A;  4N47 A;  1SJ4 P;  2MLX A;  4B9L A;  2H3E B;  1D1U A;  3MMJ A;  3W8G A;  1BQN B;  1HNV A;  1TL1 B;  4Z2X A;  3G2X A;  4ICL A;  4LT6 A;  2KN4 A;  3SSR A;  4DFJ A;  1TL3 A;  1HBN B;  3P8B B;  4BS2 A;  1N88 A;  2PT0 A;  2Q43 A;  2IMO A;  4DZ6 A;  1RTJ A;  4OIX A;  3MEG A;  1Q86 T;  2HQC A;  5D3G A;  4WXW A;  3CJ3 A;  1RHK B;  1TL7 B;  1U8S A;  1UWB A;  1X8D A;  3QT8 A;  5DZ7 A;  1RWW B;  1RWP B;  3EDQ B;  3TZY A;  2HSE B;  4RBT A;  1WSV A;  4BCA A;  1QAJ A;  2HQ3 A;  1QJH A;  3ILI A;  1X5O A;  5LXR A;  2DRB A;  1NBE B;  1QE1 A;  3CMA S;  2GFF A;  3HDS A;  4QWC A;  3MOJ B;  2F63 A;  1FRM A;  3MGJ A;  4TNO A;  2V4Q A;  4DI6 A;  3WIV A;  1NK8 A;  2I0X A;  4Q8F A;  4X84 A;  3OR1 B;  2DB1 A;  3GZ7 A;  2BX6 A;  2EFV A;  4OLP A;  4MMO A;  1KHV A;  2UXB J;  1H73 A;  2I2Y A;  1HWL A;  4WP9 A;  1CJV A;  1TK5 A;  2JSX A;  1RZM A;  2U1A A;  5B0B A;  2VJV A;  2UXC F;  1VQ9 S;  3W64 A;  3DRP A;  5A8K A;  4RJV A;  1WG4 A;  2IY5 B;  1B0V A;  4ZHR A;  4ECW A;  1U1P A;  3IWX A;  2BW7 A;  2M5Y A;  2RSQ A;  3Q0A A;  2DCU B;  3TJ8 A;  4JI1 F;  4C3K A;  2CNN B;  1XR6 A;  1YJV A;  4AFF A;  2D3O R;  1VC0 A;  2AJQ A;  4ECQ A;  4K4V A;  3CNQ P;  2MY7 A;  2Q6B A;  2EC2 A;  4LSL B;  3WC0 A;  3DRP B;  2OPQ B;  3R3T A;  1QDU B;  2C3P A;  1AT1 B;  3RBZ A;  4YQW A;  1IBM J;  4A47 A;  1WOP A;  3CIM A;  2JX2 A;  2JEF A;  2ZH8 A;  1N34 F;  4Q7A A;  5CZX A;  2HBY B;  5E5N A;  1K44 A;  2RF2 B;  4CO0 A;  3G71 S;  1VK8 A;  3I32 A;  3HF5 A;  2E44 A;  1IQZ A;  3GYG A;  5AE2 A;  3US5 A;  4NLO A;  3T1A A;  3IP0 A;  1WC6 A;  2VDI A;  2RD5 C;  4TLQ A;  5L38 A;  1TK8 A;  4NYZ A;  1KVJ A;  2F9D A;  4QWB A;  4UZB A;  3QAU A;  2H48 B;  3JSR A;  1P27 B;  2GS8 A;  2JLE A;  1XMB A;  3Q89 A;  4OHV A;  2ATC B;  1T9U A;  2DNP A;  4F0H A;  3QID A;  5CCL A;  3K57 A;  4ZKA A;  2WVD A;  4LQ3 A;  2HBZ B;  2HHU A;  3C6U A;  4ECY A;  4ZIT A;  4LF4 J;  3ILJ A;  4UQT A;  3G9C A;  1GXT A;  2AU0 A;  4L75 A;  1FEE A;  1S0N A;  5MAO A;  2UUB F;  2HNZ B;  4ICL B;  3SXL A;  3HVT B;  3H90 A;  2RRB A;  2HND A;  4F3M A;  5HVG A;  3MDF A;  4ED1 A;  2FHK A;  3QGI A;  4RW6 B;  2W9B B;  1S1X B;  4PAA A;  2W1B A;  5E3Q A;  1U26 A;  2W7O A;  3RW6 A;  3N5F A;  1ULR A;  1Y3K A;  2YNF A;  4WF9 Q;  3NL0 A;  1SKS A;  4DG1 A;  1VOM A;  2ZBC A;  3CCE S;  2FIU A;  2OSQ A;  4I2P A;  3C14 B;  1SXL A;  2QA4 S;  1JLE A;  1GNK A;  2HFU A;  2M0G B;  2BJ9 A;  4OI4 A;  3VQS A;  5HLF B;  1M1K T;  1FKA F;  2BAN B;  5L1L A;  4ZVE A;  2J9D A;  3ZTR A;  2DGX A;  3PRV A;  2RNE A;  1NK9 A;  3LUY A;  3DLE B;  2XTJ P;  1HQU A;  2DGS A;  1R6Y A;  4F36 A;  4RU9 A;  4J9N A;  4KRW A;  1FK9 B;  3BBB A;  1YIJ S;  4N5S A;  4LF8 F;  1T02 A;  2XY6 A;  3W9J A;  2DGV A;  1IKW B;  2VDH A;  4M5K A;  4Z7C A;  3BYR A;  2VQE J;  3CJ2 A;  3OR2 A;  1U47 A;  3M32 A;  1FJC A;  2B9W A;  2GHP A;  3WX8 A;  4WU2 A;  1P9Y A;  3D4J A;  4DX7 A;  3K5O A;  5F9L A;  4X4S A;  1DQA A;  4V19 X;  4Y00 A;  4CLY A;  1A6L A;  4WYW A;  4NZ6 A;  1S6U A;  4BC9 A;  2CPI A;  1BGX T;  1KD1 T;  1MMD A;  2OPR B;  4J90 A;  1PBU A;  3PCO B;  2G0C A;  1SH2 A;  3PNI A;  5GAH U;  5K20 B;  5HRO A;  2YKQ A;  1QVF R;  3HHL D;  5KG6 A;  2VC1 A;  1KVI A;  2H54 B;  4NCA A;  4J9S A;  2WVE A;  2NSB A;  2NUU G;  5DDP C;  2AYB A;  2GX8 A;  3H2L A;  1UEV A;  4EWT A;  2FLN A;  1SUQ A;  1TZ0 A;  5F3Z A;  5A2Q U;  3ADA C;  1KQG B;  5B0F A;  1T9W A;  3DLB A;  2ZC4 A;  2MGZ B;  1S9E B;  2H65 B;  3IBF B;  3TEH B;  4XTT A;  1MSW D;  4B3O B;  3J7A N;  5L1J A;  1JJH A;  4LFB J;  2AYM A;  3EVW A;  3M30 B;  3CJK B;  4MFB A;  4CO4 A;  3I5C A;  1BQX A;  2LDI A;  1UPM B;  5DO2 A;  4LRE A;  4QR0 A;  3PIP Q;  1HQE B;  2G2Y A;  3NAH A;  2A1B A;  5A8K B;  1OSD A;  1NKB A;  4FBT A;  4ZPW R;  3UO0 A;  2XQC A;  2IVY A;  2RS8 A;  3FK4 A;  4OHW A;  3DGP B;  3PAC A;  1CJK B;  1NK5 A;  2YX1 A;  2VU5 A;  2KJV A;  2VJU A;  1RAH B;  4OYO A;  1S10 A;  4B3M J;  3DLJ A;  4AE5 A;  1YJW S;  5DRK A;  2JVR A;  1ZPV A;  3OFF A;  2IM0 A;  2WB1 D;  3NOC A;  3QAE A;  2IBK A;  2F4V F;  2ZD1 B;  1XBW A;  3KDO A;  3OXF A;  3LPE A;  1IKX B;  2CQG A;  1HL6 A;  3CCW A;  3K8V A;  3EM1 A;  3M6V A;  3I56 S;  3GQC A;  4EZ6 A;  1E6Y A;  4FPI A;  2J6U A;  1KEK A;  4YFU A;  1CJT A;  4WPA A;  4J9U E;  5C25 B;  1EIY B;  2BKN A;  2GVZ B;  1B64 A;  2XHW A;  4OI6 A;  1I94 J;  3ELH A;  2BAN A;  3IGV A;  4HI2 A;  1KLM B;  1S1T B;  4HLB A;  5DQG A;  4GC7 A;  4LSZ B;  5G0R A;  1OQ6 A;  4LF9 J;  2HKE A;  2AHO B;  4L73 A;  2QV6 A;  1Q8B A;  1XMQ J;  7FD1 A;  1QTM A;  2YWG A;  4DQI A;  1WNE A;  2KU7 A;  3CB4 A;  4PUO B;  1SJ1 A;  3DRR A;  4DR3 F;  1TQL A;  3LH2 S;  4TU9 A;  1L5U A;  3G6V A;  2MZQ A;  2PDA A;  3R5G A;  2OPS B;  4PXC A;  3DFE A;  3HHL A;  4H4K A;  4YUD A;  4DV4 F;  3PR4 A;  4DSL A;  3HK2 A;  2A10 A;  1NZ8 A;  5I3U B;  1O51 A;  1OYD A;  3ET6 A;  5SZT A;  3E51 A;  3C19 A;  1IR1 A;  4DSK A;  1APS A;  3U1M A;  4EYI B;  3V4I A;  4DLG A;  2AX1 A;  4YY3 J;  3R27 A;  3KLE A;  2XHC A;  1OY8 A;  3GWC A;  5E7O B;  1MWQ A;  2VFS A;  5KFS A;  1RT6 B;  2VIH A;  3OVS A;  3M8S A;  1FJG F;  3BN7 A;  1HYS A;  2BEF A;  1NJY A;  1S76 D;  3RBE A;  4G1I A;  2KFY A;  4FF1 A;  2NYH A;  2K7K A;  3OT9 A;  3CME S;  2IDE A;  3FBE A;  3LAN A;  3RR8 A;  5CYJ A;  4LF6 J;  1PYT A;  3CC7 S;  3N6N A;  2HHP A;  4DV6 F;  3O2I A;  2ALZ A;  4PQU B;  3WZ0 A;  4DU7 A;  3CCM S;  1S0O A;  2NSC A;  3NWR A;  2X1A A;  4AND A;  3SFG A;  2IHR 1;  3G8Q A;  3WX4 A;  2MQO A;  3LAL A;  3R9L A;  2VOO A;  4YY3 F;  1RUS A;  3G6X A;  5KTQ A;  1O5J A;  2IFX A;  2KHD A;  2Z57 B;  5AXL A;  3S6E A;  2DNK A;  3S1T A;  2W9C A;  2DEJ A;  2QTW A;  5E41 A;  1HNX F;  4LQ9 A;  4ZVF A;  4C2M A;  2BJ3 A;  2GGP A;  2QLB B;  2IYI A;  3IRW P;  4ZPA A;  4M5G A;  3ZTQ A;  4M5D B;  1S77 D;  5B0C A;  1S59 A;  2F40 A;  2W7A A;  5LMN F;  4QBU A;  1K8A T;  3NMA A;  4OYB A;  2CQD A;  2A2C A;  2VFT A;  5HVF A;  1JLF B;  1SUQ B;  1UFK A;  1WC4 A;  2E29 A;  5E2Q A;  3MFI A;  4ALZ A;  1QAY A;  4A48 A;  4K4S A;  2HWI A;  4FZV A;  3MR2 A;  1XEZ A;  3JYT B;  4QYZ J;  3MMC A;  4HTJ A;  2VKZ G;  3V4I B;  1HIY A;  1M5O C;  5IWA J;  1IXK A;  4W92 B;  3A4T A;  4MKB A;  1LXJ A;  1FDA A;  2DH7 A;  4ZVO B;  3H8Y A;  5E3P A;  4B3S F;  3TVZ A;  4IUF A;  2O67 A;  1AZS A;  4G1Q A;  4QCL A;  5AJ3 F;  2GGP B;  2XMJ A;  4B3S J;  1QD1 A;  1PC5 A;  2FVS A;  2XUL A;  1AUS L;  2F4V J;  2ATL A;  3CSK A;  3AOC A;  1B4S A;  4NOH A;  4O3S A;  1WI6 A;  2LDY A;  1FF2 A;  3U7J A;  1XNQ J;  1BD6 A;  2XCP A;  2QFJ A;  3OUY A;  3ZXW A;  3GV7 B;  1YDL A;  5KFU A;  3H5Y A;  4ECU A;  2FHJ A;  1FK9 A;  4O3O A;  1YJT A;  2GAG C;  4I6A A;  4MIW A;  3SEO A;  5A0Y A;  4DX5 A;  4DV0 F;  5C25 A;  3PX6 A;  5I42 A;  2XLK A;  2ASY A;  4ECT A;  1T03 B;  3BSO A;  2P9E A;  1N6Q B;  3F56 A;  3DRY A;  2V8H A;  1RT5 A;  4X2B A;  5A6W A;  4F8R A;  1RHQ B;  1E6Y B;  2X7I A;  3HUL A;  3NXZ A;  4N77 A;  3T6B A;  3VVU A;  2XZD B;  3M05 A;  4CLP A;  5DET A;  5KFE A;  2WOM B;  2KZZ A;  1MG7 A;  1YJN S;  2Y8Y A;  2YPY A;  3HVR A;  1TMJ A;  4DQP A;  4WZM A;  4URS A;  2W9B A;  3A8K A;  4HI1 A;  2XC9 A;  2C2O B;  3FCV A;  2B56 A;  3GR1 A;  3JTP A;  1REV A;  1JLB B;  2GHV C;  3T6J A;  5DLG A;  2VFV A;  3DLG B;  2C3M A;  4B02 A;  1RBL A;  4UUX A;  2KT2 A;  5K8M A;  1X60 A;  2FD2 A;  4NI2 A;  1WAC A;  5KFL A;  1MW7 A;  5ETN A;  2M88 A;  3PRB A;  2P6S A;  1HA1 A;  2PGC A;  5KFV A;  4FDF A;  3P5B P;  4JBC A;  3G96 A;  2UXC J;  4OZ0 A;  1UA1 A;  2WK4 A;  3VAL A;  4A8X A;  2ZJR Q;  4CH0 S;  1RHM B;  3DLL Q;  1Y00 A;  3GIL A;  2PFF B;  1VBY A;  1X0F A;  1UVI A;  4F7V A;  5BR8 J;  1VQK S;  2HVH A;  3PRD A;  1NB7 A;  2G0J A;  3NWG A;  1U8W A;  2DYA A;  3THP A;  2ADC A;  4GKK F;  2ZZM A;  3ENA A;  2E1A A;  5AE3 A;  2V8V A;  1NDP A;  1NHV A;  2HVD A;  2XYH B;  3CJ8 A;  2JVO A;  3QT7 A;  4BLG A;  4Y2A A;  2E9R X;  1ZA1 B;  2KRB A;  3AJD A;  3AB4 B;  2QN6 B;  4DPT A;  3TAN A;  4FS1 A;  3P5T L;  2ZD1 A;  2QT7 A;  1UAW A;  4DR1 F;  4HL9 A;  5D77 A;  2HHT A;  5IV4 A;  2OH2 A;  3GLJ A;  3RB4 A;  3HJF A;  2OO4 A;  2IVM A;  3FKB A;  4ZLJ A;  3TW0 A;  3PJW A;  5DDO C;  2C2R A;  2ZIT A;  2FGC A;  1WHV A;  3LP2 B;  3KLG B;  1JXV A;  1QY7 A;  1UTA A;  4KKO A;  4NZ7 A;  3SCL E;  1HBU B;  5C5J A;  2ZHB A;  2YBV A;  2GVD B;  3AT1 B;  5HO4 A;  2BMB A;  1J2V A;  5BYR A;  1X4H A;  1FVQ A;  2ROP A;  3GIJ A;  4FNH A;  4JV0 A;  2W9A A;  2J0Q D;  2VA2 A;  1TUG B;  2VG5 A;  1YKW A;  2XS5 A;  2BKO A;  5HMY A;  1QUV A;  1Y3J A;  2H5J B;  1KON A;  1F6T A;  1HW9 A;  2I5J A;  4PG5 A;  3EDR B;  3TZX A;  2QFI A;  2ADB A;  2AV5 A;  3O5T B;  4NLQ A;  2F65 A;  3BH6 B;  2C42 A;  1RP5 A;  2FJA B;  4NEZ A;  1TK0 A;  1NAQ A;  1FA0 A;  3AA9 A;  3P49 B;  4AQY J;  3HVT A;  1WTB A;  2APO A;  1XQI A;  1V3S A;  4WE1 B;  2W2O P;  1KWM A;  1Q7L B;  2IIH A;  4KGZ B;  4CM0 A;  1CVJ A;  2ZM6 F;  2V50 A;  1RT1 B;  1ZZN A;  3I4P A;  1YJ9 S;  7FDR A;  3GE9 A;  3MPY A;  3QWU A;  2DHS A;  2ROE A;  4IG0 B;  4IYQ A;  1CC8 A;  4O44 A;  1NJZ A;  2ZH7 A;  3MR6 A;  4QIW D;  2G1D A;  1HWU A;  3D7S B;  4U7U K;  2FZK B;  2FJB B;  2FJE B;  1R27 B;  4AL6 A;  3NCQ A;  1B99 A;  3TO8 A;  5D0E A;  3G6Y A;  3CED A;  3POT B;  1R43 A;  1DFD A;  4YB7 A;  5EGY A;  1GXL A;  2VHG A;  4NCG B;  1VLY A;  2E5J A;  2RDJ A;  1YG0 A;  2OUG A;  4DV6 J;  4IQX A;  1U1N A;  2LQ5 A;  2VB6 A;  2HRU A;  5IZH A;  1CC7 A;  1S57 A;  1G7C B;  3IMQ J;  1PIE A;  2HGN A;  4QW8 A;  1IQT A;  1NND A;  3FQL A;  3I4H X;  3K59 A;  2R7R A;  2CA9 A;  2BKP A;  1R3N A;  2CFX A;  2K1R A;  3LO3 A;  3N9U C;  2E66 A;  4A8K A;  4KGX B;  3RAM A;  4ED7 A;  1RJJ A;  1Y7P A;  4I56 A;  1C1C A;  3CCJ S;  1URN A;  2AZ3 A;  1FJG J;  2QG9 B;  2HWT A;  3H0P A;  4K5R A;  5B08 A;  2B4U A;  3GV5 B;  1Q81 T;  1YJ7 A;  1H98 A;  3J81 j;  3BGR B;  3KK3 B;  2Q3P A;  3SSQ A;  4EEY A;  2MHE A;  1XC9 A;  2D9O A;  1S49 A;  2VQE F;  1M5K C;  3M8Z A;  2AQ4 A;  4YOE A;  2CQB A;  3DRS B;  3GJT B;  1GMV A;  2E1R A;  2MB0 B;  2RQ4 A;  3DGP A;  1TAU A;  2DRA A;  4MIA A;  3OL6 A;  3CCV S;  1CJV B;  1RWO B;  1SL1 A;  2DY9 A;  3GON A;  5KT5 A;  1S4F A;  3LGN A;  4LSN A;  1NJW A;  1MRO A;  4EBE A;  2QLJ B;  2EK6 A;  3DLE A;  4LRD A;  4DF8 A;  3IG1 B;  2BE7 D;  3AXM A;  3H20 A;  4HH0 A;  3BBF A;  3BGF A;  2VPW B;  4FVC A;  2VG6 A;  4C3L A;  1X4F A;  3IBW A;  3GFY A;  4RL1 A;  4DFM A;  3KG4 A;  4R0J A;  1RXO B;  4Y2K A;  3SSS A;  5HQL A;  1FXR A;  2R7Q A;  3FNN A;  2QMU B;  1X0P A;  3D28 A;  1MU2 A;  2K1R B;  4KYZ A;  3EPG A;  1Q82 T;  4OI1 A;  4DV1 F;  3M6X A;  1FDN A;  5CYM B;  1T9V A;  4CLU A;  4KV8 B;  1I3O B;  3N6L A;  1WF1 A;  2N82 B;  3W7B A;  4NLX A;  5GAH I;  5EHH A;  4EFA C;  1RQ0 A;  5L1K A;  2L9W A;  2ASL A;  1GTE A;  4LF7 J;  1SJR A;  1UVL A;  2V5H G;  2DJW A;  2J0X A;  3QGH A;  4JYA F;  3QSY B;  1QSY A;  1GAO A;  2ZM6 J;  2FY1 A;  3BR9 A;  1RT4 B;  4PZV A;  3D67 A;  2CPH A;  2YQ1 A;  3POT A;  4QR2 A;  4ZS6 A;  4DBQ A;  4ILR A;  1ZS6 A;  1SQE A;  2HQI A;  4C48 A;  2QL7 B;  4TLR A;  1YZ6 A;  4S0M A;  3HCX A;  2FVR A;  3A8I A;  3KJV A;  2HUR A;  3WHI A;  1IKW A;  2E9Z A;  4AL5 A;  4BWM A;  1ZPW X;  3G87 A;  2H5I B;  3FGV A;  2VFU A;  4LRF A;  4NAS A;  2UVV A;  1N34 J;  4OI0 A;  3T1Y J;  1NK0 A;  4KQZ A;  2HBQ B;  3M8W A;  4F4Y A;  2IMW P;  4NZ0 A;  2ZVI A;  2Y0S D;  3Q8R B;  1EHW A;  2KYZ A;  1Z4U A;  3NNC A;  5GAD U;  5DLF A;  4KB7 A;  4DV1 J;  4Y2M A;  2D3Z A;  1KLN A;  2O3D A;  4M5I A;  3C46 A;  2BJ1 A;  5EWG A;  4NLP A;  5F0U A;  2FC9 A;  1RAA B;  1T03 A;  4TQR A;  1K9M T;  4KGM A;  3I9V 9;  5LL6 d;  1N5Y B;  1S7H A;  3LAM A;  5J1N A;  5T41 A;  3KLH A;  3C2P A;  5D3G B;  2RU9 A;  2QA1 A;  4YME A;  3PIO Q;  2HRT A;  5J2P B;  3RTV A;  1VRT B;  2EW9 A;  3OFG A;  4CT9 A;  5LOQ A;  2R2S A;  2R9L A;  4C4W A;  3QPI A;  3AH6 A;  1R0C B;  2RUS A;  5LM7 E;  1CLF A;  2F8E X;  3DU5 A;  2HHS A;  3TI0 A;  2Z2Z A;  2BRK A;  4G1P A;  3TUZ C;  5ETM A;  2C28 A;  5KFZ A;  4J9Q A;  1LW2 B;  4FF2 A;  1TKZ A;  3KHG A;  3TJ9 A;  5A8W B;  4H4O B;  1N5T A;  3AB2 B;  3QO9 A;  3HLU A;  4M5H A;  4UW2 A;  5KG3 A;  2MKH A;  3OV7 A;  4F3O A;  1LWF B;  2XS2 A;  5IC6 B;  4USH A;  3TWZ A;  2PN6 A;  3TX8 A;  3G8T A;  3SCK E;  3DHW C;  1I51 B;  1C2P A;  4FKX A;  3BKU A;  4FNI A;  1FNO A;  2JC0 A;  3JSM A;  1R6V A;  4J91 A;  2AJ0 A;  1HR0 J;  2PEH A;  2R7W A;  3HO1 A;  4NLT A;  1HBO B;  1F60 B;  2RDI A;  4LRC A;  1CQM A;  4YDX A;  2XO7 A;  5IT4 A;  3SFU A;  2H9Z A;  2X1B A;  3J7Y I;  1OO0 B;  4R8U A;  2KFN A;  5EN1 A;  2OPR A;  3D3B J;  1R0A A;  3KLH B;  2HK3 A;  2UUT A;  1FO1 A;  2ZJQ Q;  3IS9 A;  5B0E A;  4QQB A;  4RLE A;  3HHK A;  3V2U C;  5KFM A;  1RT7 A;  1KC8 T;  2XG8 A;  3IAM 9;  3NBP A;  1N5Q A;  2K06 A;  2HHX A;  3VAI A;  2WSF C;  1IBL J;  2OIH A;  1S12 A;  3EIC A;  2DNZ A;  1F2H A;  2QMX A;  3MM5 A;  3VAM A;  4CI0 B;  3CDW A;  4TN2 A;  4TQS A;  2J8S A;  2V94 A;  2AJF E;  3B78 A;  3GPA A;  2RKI A;  5LSL A;  2J6S A;  3NNA A;  4NMX A;  3CD0 A;  4JI7 F;  1SVD A;  4Y28 C;  1RIS A;  3H98 A;  2BQ3 A;  2HMI A;  3BO3 A;  1UET A;  5C7P A;  1RWV B;  5LXY A;  2AF6 A;  1S4E A;  3NGR A;  2BXJ A;  4FYX B;  3IO1 A;  2HBR B;  3OTE A;  1RT7 B;  3TAM B;  2XLJ A;  2GIR A;  3PW0 A;  2VBX A;  3M9M B;  4NRU A;  4K59 A;  5D4P A;  4ZCL A;  2IVF B;  9RUB A;  3TQE A;  3PXG a;  1G4C A;  1EQM A;  1RU2 A;  2V6A A;  2DNH A;  1C1B A;  1UFL A;  4ED6 A;  4DL7 A;  1AFJ A;  1LFW A;  2L41 A;  3DLK A;  3FEY B;  2ZVS A;  1DTQ B;  4JI2 F;  3GIM A;  2F3J A;  4JI6 F;  2BV3 A;  2HS4 A;  5KG5 A;  3SV4 A;  3C16 A;  1G6B A;  1X9S A;  2E5G A;  3D0H E;  4XPE A;  3DRR B;  1M0S A;  2D74 B;  5D4L A;  3QJL A;  1WKK A;  4C98 A;  5ETR A;  3WQP A;  1WOR A;  2GQQ A;  4RNO A;  3VAF A;  5KT7 A;  1JJ4 A;  2DR8 A;  4B3O A;  3CVK A;  4DV5 J;  3A3P B;  5LMN J;  2CPY A;  1T0T V;  4ES3 A;  1F9H A;  3QO9 B;  1W26 A;  4BHQ A;  1IM6 A;  1ZTW A;  1R8H A;  4I68 A;  4NML A;  4ZK7 M;  3LWM A;  3IG1 A;  4EZ9 A;  1W2B R;  2I9S A;  3KK1 B;  5IT9 Y;  4Z37 A;  4FBU A;  3M8P B;  3Q8P B;  1Q5V A;  3LP0 B;  4HDG A;  4JI8 F;  1Y4Z B;  5C2G A;  1VBX A;  2HGL A;  4KGK A;  5HRO B;  4EBD A;  2G1H A;  4J9L A;  1IJF B;  1NJI T;  2FLO A;  1OY9 A;  1IKV A;  2V34 A;  3JQK A;  1VIX A;  1CUL B;  1RKI A;  2WW4 A;  3IM8 A;  1S1V B;  5MLC V;  5E33 A;  1F5C A;  2W2Q P;  4HAC B;  3AFG A;  4L76 A;  3FDS A;  2QGF B;  2OSR A;  1NEE A;  4LJM A;  4OV1 A;  4ZVS B;  3P3D A;  5THW A;  3W8P A;  2HW3 A;  1IKV B;  2YQ3 A;  5GMD A;  3V6D A;  1K1Q A;  4K0K J;  1S79 A;  3ZNJ 1;  2YKM B;  5DDR C;  1ZAW A;  3FJ2 A;  2V4J A;  5ETK A;  2FQQ B;  1SPB P;  2AX0 A;  1S48 A;  2FHJ D;  3FSX A;  2BRL A;  3U1L A;  2N7C A;  2W4P A;  3H25 A;  4EBC A;  4ID5 A;  2ZC3 A;  5H9E K;  1N36 F;  4R25 A;  1VS3 A;  2PMW A;  1UW4 A;  3D0I E;  1EKS A;  2OAU A;  3ISN C;  3P96 A;  5CAA A;  4OYI A;  3OJU A;  3RRH A;  2UU9 F;  3GYX B;  1A9N B;  4DS5 A;  1P6T A;  2R7V A;  3JTO A;  4NCG A;  3ISN D;  2CVI A;  4MT1 A;  1R89 A;  4OX6 A;  1OPZ A;  2JDJ A;  4NE9 C;  3NRB A;  5EX3 A;  1SI9 A;  4K4Y A;  4H4M B;  3T1Y F;  2E5I A;  2DNN A;  2HZC A;  4KFB B;  4WWS A;  2QL5 B;  3J80 Y;  2ZH5 A;  4DV4 J;  3RB3 A;  2LCW A;  4J5O A;  1VC6 A;  4QU7 A;  1TL7 A;  1UWB B;  2Z4P A;  3OTO F;  2UUW A;  3TR5 A;  3FBB A;  4JV1 A;  3GSD A;  5IT9 U;  1RT1 A;  3I6P A;  5HN0 A;  1U48 A;  3FEX B;  3FVY A;  2CYY A;  1FD8 A;  1GX5 A;  2B4V A;  2FDN A;  2C3U A;  1VQO S;  3NGU A;  2EI5 A;  2NPF A;  4CLK A;  3CC4 S;  2XNR A;  3P6Y C;  3D2W A;  2MQ8 A;  2FVQ A;  5J2Q B;  1WDT A;  2LXI A;  3OD2 A;  1LQ9 A;  1FWK A;  3CJT A;  1FRI A;  3IA0 A;  4KV8 A;  4I6Y A;  4DN9 A;  5B7W A;  5BYS A;  1T05 B;  3ZO7 A;  3AOA A;  1IBK F;  1H7W A;  4J9O A;  1KTV A;  2LP4 A;  3E8O A;  4C8Z A;  2JJ4 D;  2JFD A;  2MEW A;  2X3D A;  2EG2 A;  2ZH3 A;  2MQM A;  2HIY A;  2QJ3 A;  2UVW A;  4C3M A;  3CPW R;  1GX6 A;  5FLX U;  1RAJ A;  3BN4 A;  3I5A A;  4DR4 F;  3SDE A;  4IDK A;  3E3X A;  3KFW X;  4X64 F;  3M8Q A;  2DPI A;  2F5G A;  4NCB A;  3LPY A;  4K2J A;  5HAO A;  3R7B B;  3QT6 A;  3GIK A;  5I3P A;  1JLE B;  3O44 A;  1R8C A;  3KLG A;  1L3T A;  5D4O A;  4DUY F;  4O0I A;  2EFQ A;  1RK8 A;  5J2M B;  1IKX A;  2A0F B;  5IXU A;  4MJK A;  2DY1 A;  3QT5 A;  4X4T A;  4NLG A;  4C11 A;  1Q8I A;  1J27 A;  4DS4 A;  3TX0 A;  2CJY B;  2IPO B;  4I69 A;  5KFI A;  4CH7 A;  2V9W A;  4GVB B;  2HNY B;  1C0U A;  1WHW A;  3HSJ A;  3RJM B;  3A8E A;  2DNR A;  1FTR A;  1REG X;  2GQC A;  3KLF B;  1UJ6 A;  2MLY A;  1R0A B;  1RT2 B;  2P2C B;  3PZP A;  2D3U A;  1T11 A;  4USK A;  3GSI A;  4C8Y A;  3DU6 A;  3FFI B;  1HBO A;  2HG4 A;  2HAI A;  5BR8 F;  2G4B A;  1N33 F;  1CQN A;  2ZBI A;  2YKP A;  3JS9 A;  4GO5 X;  4RNN A;  2DO4 A;  5J1E B;  3Q2T C;  1KR4 A;  1JMT A;  3AJ2 A;  3D6H B;  4OZ2 A;  3RG6 A;  3CCU S;  1FI4 A;  1C0T A;  4Y34 A;  4WCE Q;  4DUZ J;  3DDK A;  3ZZY A;  3QSI A;  3T1H J;  2H4Y B;  4KO0 A;  4DV7 J;  3Q22 A;  4DUZ F;  4ER8 A;  5L46 A;  1FNX H;  3G86 A;  1VQ4 S;  4RW9 B;  4WP8 A;  4IFY B;  1F9F A;  4HH1 A;  1MRO B;  2QA2 A;  2WSC C;  3O1L A;  3GFZ A;  3DLK B;  1FFS B;  2GML A;  4J9M A;  2R8G A;  2FZG B;  2D41 A;  4Y65 A;  1VQL S;  4HT5 A;  1ZBT A;  3F44 A;  3G8S A;  1DTT A;  1NZA A;  1U6F A;  1JK9 B;  4U7C A;  2W2M P;  4LIW A;  4GRS A;  5HP1 A;  1RHU B;  3TZW A;  2UUB J;  4K4T A;  5CAB A;  1PSD A;  2LXU A;  2EBG A;  1F3V A;  4YEA A;  5K14 B;  2K2P A;  5KG1 A;  4HT7 A;  2M8D B;  1UVM A;  4HKQ A;  3HHL C;  4H4K C;  4UUW A;  1BMQ B;  2SXL A;  2M9K A;  3JB9 k;  1EET B;  2O66 A;  4QWD A;  2QLW A;  2V8P A;  2YNH B;  2UUC F;  2DIV A;  5LSR A;  2HHQ A;  3S7R A;  3UR0 A;  1IN0 A;  3CJ0 A;  5LSO A;  2XYP B;  5EUH A;  2GAH C;  5CA5 A;  2FVC A;  4IFV B;  3PW5 A;  3SDE B;  1NO8 A;  1FFW B;  4JI6 J;  1ZM2 A;  3J7A 1;  4UZC A;  4NLY A;  4USJ C;  4YR0 A;  2A6O A;  5SUH A;  3H40 A;  2YX4 A;  2DHX A;  3UWT A;  2AGP A;  1V3R A;  4GMK A;  5AJ3 J;  3UE2 A;  4W4M A;  2Z2Y B;  2WVB A;  4QIF A;  2DPJ A;  1RAB B;  1S1X A;  1M1H A;  3H2V E;  2FY8 A;  2ROG A;  3EJM A;  4XDD A;  4CIO A;  3CIZ A;  1RI7 A;  3LAK A;  1KSP A;  4NLU A;  4QJV A;  1IUJ A;  3HZG A;  4F0M A;  4IG0 A;  2OEL A;  1H72 C;  2HQD A;  4WP3 A;  2MQP A;  1HBN A;  4PXD A;  1ZAV A;  4J9P A;  1C1B B;  1OS5 A;  2VBW A;  3OW2 R;  3VGT A;  2MMY A;  2PC6 A;  1FRL A;  2RML A;  1U2F A;  2FC8 A;  1E6V B;  3LA0 A;  2ZH9 A;  1S1W B;  2J7K A;  4DR1 J;  4ED5 A;  3QIP A;  2OPP A;  2YVS A;  2EBE A;  3BDP A;  4X65 F;  2B4O A;  3IGN A;  5KAK A;  2AZ1 A;  1SH0 A;  1I6J A;  1NHU A;  1SJQ A;  4WXO A;  2E7X A;  3VZH A;  4RW4 B;  4P2F A;  1Q95 G;  5KFF A;  1P1T A;  2D1C A;  1BWV A;  5J2N A;  1G1X A;  3BSA A;  3KLI A;  2HMI B;  2B6A B;  4RUB A;  4KIA A;  1HI0 P;  4ZPV R;  3S01 A;  3UDE A;  1OIA A;  4CQ1 A;  5KFC A;  4OX8 A;  1VR6 A;  3V6H A;  2X3G A;  2B51 A;  3LQV A;  1G3O A;  3RRK A;  4ZLN A;  1LWC A;  1WHX A;  2DNQ A;  3ZFV A;  3KUG A;  4XIU A;  1N36 J;  1RT2 A;  5D15 A;  3RAX A;  3O6Q A;  2KJW A;  1Y0H A;  1MN7 A;  4UOG A;  4OYM A;  4M1K A;  1LW0 B;  2ZOG A;  4OJ3 A;  4ES1 A;  1N4L A;  2OEK A;  3C66 A;  3L7O A;  3PTW A;  4IG3 B;  2IJR A;  3TEG A;  4P6Q A;  1UWA A;  2Y9H A;  2C2M B;  3EGZ A;  5H9F J;  1HWJ A;  1FRH A;  2XI3 A;  5LJ3 Y;  4O4R A;  4KY3 A;  1HNZ F;  1X31 C;  4I2Q A;  3MM6 B;  1RT6 A;  1HD1 A;  4JI3 F;  3I96 A;  3Q24 A;  2VOD A;  2CJA A;  1N48 A;  2JEI A;  4Q2L A;  5C42 A;  4U9R A;  2DK2 A;  3TZZ A;  1Z1Z A;  1W25 A;  1NCL A;  2XMV A;  4ETX A;  4DQR A;  5ITH A;  3T3F A;  4F0K A;  1NM2 A;  3M6W A;  2MKS A;  4YS2 A;  5HQ8 A;  1XMO F;  2R2R A;  1WEX A;  4P2X A;  5DM6 Q;  2EWH A;  1X5P A;  1OY6 A;  2Z2L A;  2M52 A;  1OMS A;  3FCW A;  3M1V B;  5I4M A;  3EPI A;  3GCX P;  1Y5I B;  1S9F A;  3AOD A;  1BQM B;  4DPW A;  5D8H B;  4DR4 J;  3VAJ A;  4DL2 A;  2VD3 A;  2UP1 A;  1HPZ B;  2C3Y A;  4JP8 A;  4P71 A;  2AGQ A;  2X51 A;  3MPV A;  3N01 A;  5B0A A;  1EZZ B;  5IV3 A;  1ZOT A;  5IQQ A;  4ENO A;  3OPK A;  2X1F A;  1RBO B;  3M1V A;  3MAH A;  2DIT A;  5C24 A;  5BXI A;  3HM9 A;  2DNL A;  4WTY A;  1Y5N B;  4X64 J;  2AEJ A;  1N0U A;  3BDE A;  3M4X A;  2LEB A;  2FJX A;  4Q8E A;  1HNV B;  1TL1 A;  3B4M A;  3JYT A;  1H3D A;  2JNJ A;  1FRJ A;  4F4K A;  3UFC X;  3VQT A;  1HQU B;  1N5S A;  3BO4 A;  1FXL A;  1WUU A;  4ZJQ A;  2L3M A;  4ZDN A;  4ZIV A;  4W90 B;  2GJI A;  4OZ3 A;  3UCU P;  1Q78 A;  1G2E A;  2AJ4 A;  2HS3 A;  3GR0 A;  4USM A;  4JUZ A;  4I2P B;  3DOK B;  3AAW B;  1H7X A;  2ZUA A;  2HPU A;  3OSP A;  1TTH B;  2CJB A;  2D7S A;  3MM7 B;  3RW7 A;  1ROF A;  2CNK B;  3EYZ A;  5G4D A;  2WB4 A;  2LU2 A;  3R7N B;  1RHR B;  4C0O C;  8ATC B;  1NK6 A;  1L3S A;  3H4B A;  4ED3 A;  1S1U A;  2AP6 A;  2BDP A;  1RU1 A;  2EFP A;  3GJS B;  2ALY B;  1XK8 A;  3KJF B;  4RO0 A;  5ETO A;  4CDI A;  3PJX A;  2LMI A;  3A3O B;  3MUT P;  4NL5 A;  3KJV B;  4DL6 A;  4BC7 A;  3VF0 B;  5DQH A;  4ZP6 A;  2ABY A;  2FPH X;  1VBK A;  3MUM P;  2DXE A;  3N6M A;  1M1G A;  3PR5 B;  1RAF B;  3L7P A;  3L09 A;  1HD0 A;  1CS4 A;  1HW8 A;  2KVQ E;  3DYA A;  1U0H B;  1JQG A;  4USI A;  5K8O A;  2ZE2 B;  4OQJ A;  4WII A;  4R8U B;  2J0W A;  3DDI A;  3FUY A;  4BDP A;  3DOL A;  4LF6 F;  3PDN A;  3MEK A;  4CM2 A;  1QUP A;  3GCW P;  4CO3 A;  2Y3Y A;  1PJ6 A;  1R0B G;  2YKN B;  3HSD A;  5C42 B;  2EG1 A;  2DGQ A;  1TFY A;  3NG8 A;  4USW A;  3I5B A;  3SMZ A;  2XM3 A;  1RB0 A;  3M2U A;  2CKW A;  1CS4 B;  1HNI B;  2DIS A;  2WAQ D;  3SQO P;  4RUC A;  4ZJO A;  3C16 B;  1LWX A;  4ECS A;  1ZTT A;  3SQG B;  4URQ U;  2N3O A;  1YRX A;  5HSP A;  3BPD A;  4Q44 A;  4LF8 J;  4OMF G;  5IOL A;  2Y8W A;  1EKR A;  2VG7 B;  5KFG A;  2CQC A;  2OTJ S;  2B9Y A;  4E8U A;  5J2P A;  4ZPD A;  1SKW A;  1Q5Y A;  4CYU A;  4LF2 A;  1JNZ B;  2C2Z B;  4ATN A;  3QFH A;  2MXY A;  2JLF A;  3W62 A;  1HBM A;  1S6Q B;  3OL7 A;  1CJT B;  3QGG A;  3TA0 A;  2KRR A;  3NOG A;  2XBP A;  1U4B A;  4X4Q A;  2P9G A;  2ZNY A;  5F8M A;  3BSN A;  5D6G A;  3J81 Y;  3TQ1 A;  2VF3 A;  5F8H A;  3PVX A;  1RHJ B;  2MY8 A;  1PCA A;  1QM9 A;  1O0P A;  3PG9 A;  3Q86 A;  4JOU A;  5HAN A;  2WHO A;  5I42 B;  4C0B A;  3QRP A;  3N28 A;  5J2Q A;  2BZ2 A;  1RSC A;  1VQM S;  1HBU A;  2KT3 A;  1NH7 A;  2W01 A;  3IR7 B;  3PYE A;  4UOF A;  2GO8 A;  3H5S A;  1WTF A;  4PG7 A;  5CQG A;  5C24 B;  3OUY B;  2BQR A;  4FYY B;  5F8G A;  1JKH A;  4CO5 A;  3K0J A;  4MK7 A;  1W2I A;  3OTD A;  1X9W A;  3DXS X;  1FES A;  2ILZ A;  3GP9 A;  1HPZ A;  2W4D A;  5EWF A;  4ELT A;  4CLW A;  1VGY A;  2Y1J A;  3OQ2 A;  4J9V A;  2N7Y A;  2CQ3 A;  1UJ5 A;  5KFA A;  2DXF A;  2OHD A;  4FPR A;  5KOW A;  3M2U B;  3HVA A;  3MM9 A;  1LXN A;  3K2Y A;  3NP5 A;  4TY8 A;  3V4M A;  1IWA A;  4I1T A;  3NGK A;  3MED A;  2LA4 A;  1UEK A;  3W60 A;  2J8A A;  2RQM A;  5D0G A;  1XJW B;  1NSK L;  2GCF A;  1FWL A;  4DSI A;  3C3L A;  1CSJ A;  3BGL A;  1GMW A;  1WF0 A;  1IBL F;  1T3N A;  3D3C J;  3GV8 B;  3MM9 B;  2ZBR A;  3NEK A;  4IKA A;  1Z2Z A;  4LF1 A;  2VA3 A;  3V81 B;  4ECR A;  2DTJ A;  3KHL A;  1SV5 B;  4P2M A;  3P4U B;  3D6M B;  2C22 A;  5DG7 A;  2W9C B;  2L9N A;  1VC5 A;  2MJN A;  3K58 A;  5KOX A;  1PO6 A;  2QLF B;  3W3S A;  1SBR A;  2I6W A;  4OX7 A;  3UNG C;  3TAQ A;  1Q79 A;  4K0K F;  4CYU B;  5IM0 A;  3BF4 A;  2HFZ A;  1UVN A;  1FJ7 A;  1BLU A;  3GJQ B;  3N4W A;  4K7Q A;  1LWC B;  3KG1 A;  4WKR A;  5HMX A;  2YNI B;  2VG7 A;  2DO0 A;  3NGT A;  5FDL A;  1HQE A;  2KM8 C;  1F1B B;  1SL2 A;  3BSC A;  1IR2 A;  1KKH A;  3M8Q B;  4OV6 A;  3FMW A;  1EX8 A;  1X4A A;  3CCZ A;  2RU3 A;  4C8N A;  5CYQ B;  3CJK A;  1FX2 A;  3E01 A;  4NYP A;  3ISZ A;  3NLC A;  4MAK A;  3V81 A;  5HLF A;  1WEL A;  5KFO A;  5AE1 A;  4UY8 T;  3HT3 A;  1RT5 B;  2RRN A;  1NXI A;  2VIC A;  1H6K X;  5H9E J;  5ETL A;  1HNZ J;  1KQK A;  2EKN A;  2UXD J;  1PBA A;  2COL A;  4X4N A;  2I8E A;  4UY8 5;  4K4U A;  4DV2 J;  1T94 A;  4KSE B;  3MEG B;  1W7W A;  1RAD B;  2C3O A;  4HHU A;  4UOH A;  3UDV A;  2PI4 A;  1AXQ A;  1MWY A;  2AIR B;  3EGN A;  3ITH A;  4ZVP B;  2KXH A;  1ARO P;  1LKZ A;  3KKF A;  3MAQ A;  2ZH2 A;  3KTQ A;  2W2P P;  4CCH A;  1EQ0 A;  4GKJ F;  5D0R A;  4DPX A;  4UTG A;  2LA6 A;  2ZKU A;  2WTF A;  3I87 A;  4R0E A;  1VRU A;  3G82 A;  1UFW A;  4O3R A;  2FHM A;  1VK3 A;  1FD2 A;  2XGQ A;  1WG5 A;  4X4R A;  4OFZ A;  2BW2 A;  5J2M A;  4LF4 F;  1KLM A;  2V67 A;  4O3N A;  4B08 A;  2ASJ A;  4FXW A;  3CJQ A;  4HHJ A;  1S1U B;  4USV A;  1U45 A;  4RR5 A;  2BM0 A;  1NSQ A;  2VPX B;  2RH3 A;  3DGV A;  3ENQ A;  2HHH J;  5E3A A;  1BE4 A;  2QE5 A;  3KG0 A;  1TP7 A;  3DLH A;  3K5P A;  2MLZ A;  5IS2 A;  4QU6 A;  1KQF B;  2WCX A;  3IRX B;  5KT3 A;  3HPO A;  3JTN A;  1NJX A;  2IA6 A;  3DOM B;  3FRY A;  4M5N A;  4IO9 Q;  1MWZ A;  1D09 B;  1OPI A;  1YBU A;  3MMA B;  3PY8 A;  3X3U A;  4DWI A;  3M8Y A;  1BC6 A;  2MZT A;  3PYF A;  3R5A A;  2R7S A;  1S6Q A;  5CYQ A;  3V6K A;  4JI4 J;  2GZO A;  3PYD A;  2LQJ A;  2RVJ A;  3BKT A;  4IOC Q;  1M90 T;  1RA7 A;  1N6Q A;  4L3K A;  2LFV A;  3G4S S;  2YNI A;  2B43 A;  5FDL B;  4KHR A;  4DF4 A;  4LF7 F;  2IRX A;  3KNG A;  2X1G A;  4C7Q A;  4WKY A;  2IBO A;  1XNQ F;  2V4R A;  1PKU A;  2B7C B;  2C2K B;  2DGO A;  2FYX A;  5M2U A;  2XMW A;  4YDD B;  2DR9 A;  1TKT B;  1FNM A;  1H2T Z;  1TAQ A;  2CPE A;  3KLI B;  2ACY A;  2VPZ B;  2FJD B;  3I9Z A;  4MFB B;  4M5J A;  4EI2 A;  5RUB A;  3FSY A;  1D9A A;  3BQ0 A;  2GQ2 A;  4YB6 A;  3OVB A;  2VQF J;  3TP2 A;  1HYS B;  3GII A;  5AXN A;  2ZHA A;  4I7F A;  1X7V A;  2NXN A;  3DNC A;  2KG1 A;  1UCN A;  3ENV A;  4DL4 A;  1XMO J;  4PXE A;  3RBD A;  3F0N A;  2UXD F;  2GO9 A;  3UCG A;  4QYZ K;  2Y1I A;  4F25 A;  2H1Y A;  1HWK A;  1SB6 A;  2QIF A;  5U47 A;  3MM8 A;  2WSE C;  4RBU A;  3SV3 A;  4ED0 A;  3D0G E;  1WC3 A;  2P5V A;  2DNG A;  4DXL A;  1QSL A;  4KPC A;  1CJU B;  1N32 J;  4DL3 A;  4FKY A;  5CZV A;  3VVT A;  4LR8 A;  2BAB A;  3ZZ0 A;  4B9S A;  2V63 A;  2EFG A;  1TMM A;  2R2T A;  2XSJ A;  1Q8K A;  3SYZ A;  2KB2 A;  3T5H A;  1H38 A;  2BYC A;  4RBV A;  1VHI A;  2LU1 A;  1HHS A;  1H2U X;  1U6Z A;  2W25 A;  2P6T A;  4P10 A;  3D1Q A;  5KG0 A;  4NYO A;  4N56 A;  2V2Q A;  4YR2 A;  4NXM F;  3OR2 B;  3PO4 A;  2BOP A;  3T1H F;  4KT0 C;  1LK5 A;  1QSS A;  1S1T A;  3FZB A;  5HVH A;  4O23 A;  1WHY A;  2GA7 A;  2GC8 A;  5LMU J;  4FF3 A;  2QYC A;  2NS1 B;  2J0S D;  3L4B C;  3LP1 A;  3K17 A;  3IWL A;  1LFP A;  2GV1 A;  3DCA A;  1F0X A;  1YX2 A;  2NZ4 A;  2GIQ A;  2L9D A;  4LFC F;  3MUR P;  2W24 A;  1RAI B;  3K5M A;  3R1H A;  5K5M A;  3D1H A;  4OX9 F;  2R7X A;  2CRL A;  2VC0 A;  4QOT A;  4N8N A;  4J9K A;  1DHM A;  3D54 A;  3MEC A;  4Y6I A;  5KFP A;  2PEB A;  2YKA A;  1I1G A;  3FSI A;  4EK2 A;  3HJV A;  4ZOS A;  4X66 F;  3IAS 9;  4NA1 A;  3KLE B;  2ZKT A;  2HNZ A;  5HI7 A;  3EMT A;  2XEX A;  4LR9 A;  4KKO B;  3IR6 B;  3ILO A;  1RTJ B;  4HTI A;  4UT4 A;  2KZM A;  1FHT A;  5DDQ C;  1R8A A;  4D3G A;  4AQY F;  2MKC A;  3PHT A;  1L3V A;  4FVM A;  2BE9 B;  2W8L A;  3HHL B;  4ZP7 A;  2DRD A;  4R5P B;  4ZCK A;  1FEH A;  2QRR A;  1XNR F;  1HLW A;  3JQJ A;  4DSJ A;  1ICE B;  3HHD A;  1YRU A;  3SQG A;  5L39 A;  4JV5 F;  4KFB A;  2YNG B;  2D69 A;  1FVS A;  2OKQ A;  3R97 A;  2W7P A;  2ZOF A;  3MAA B;  3BBC A;  5DGB A;  2CJK A;  4ZLL A;  1RWU A;  4JYA J;  4LFA F;  1GK8 A;  4NLR A;  3UD5 A;  1GMU A;  1HHQ A;  1S5Z A;  4L3N A;  3PW2 A;  1RBA A;  1BHN A;  2I1R A;  2LYV A;  3CJ5 A;  1U09 A;  1V5V A;  1DY3 A;  2NYI A;  3MMC B;  3SCI E;  5B09 A;  1RKJ A;  4V19 J;  2LQ9 A;  1YJR A;  1U2R A;  5A2Q Y;  4KTQ A;  5EX0 A;  3D66 A;  3R7S B;  5KFB A;  3H42 A;  5KG7 A;  3PO5 A;  2QA4 G;  2HHW A;  2AMC B;  4OZ5 A;  4O4G B;  3MR3 A;  2HVZ A;  2DBB A;  2DVI A;  2ZE2 A;  1NLK L;  4NX9 A;  3VAK A;  1RTI A;  3OVA A;  4ZVT B;  3P45 B;  3HD2 A;  3KYL A;  2LEC A;  3OTO J;  2EEY A;  2HWH A;  3J80 U;  5JXS A;  4C11 B;  1FFG B;  1O6X A;  2F1F A;  4RWW A;  3W9H A;  2YXL A;  5F9N A;  3W65 A;  4ZHR B;  3M2R B;  1C1C B;  2M70 A;  4UF4 A;  4XDC A;  3OLA A;  4LFB F;  3RB0 A;  3W2V A;  2BR0 A;  3BR8 A;  2ZHO A;  2G2Z A;  3M8P A;  5GVQ A;  1VFJ A;  2F4F A;  2NZC A;  2Z2M A;  1HKA A;  2IM3 A;  1FX4 A;  4LUB A;  4ZVH A;  1U49 A;  5E3C A;  2OTL S;  3ICL A;  4ED4 A;  4NLV A;  1PJ5 A;  1FKP B;  3C14 A;  3ILL A;  3PM9 A;  2M3D A;  3MMA A;  4RKU C;  3PFE A;  3CJR A;  4Q0B B;  2ZBP A;  3IM9 A;  4PYD A;  2PA3 A;  2ZJP Q;  1GMW D;  1P8G A;  1QE1 B;  1S9E A;  4ZMM A;  2NR0 A;  3NNH A;  5IT0 A;  4K50 A;  1U25 A;  3JQM A;  1K47 A;  4H4O A;  4FXD A;  1U0S A;  4ITS A;  1M5P C;  1RTH B;  5DZ6 A;  3UCZ P;  4TVA B;  2VUG A;  5I3U A;  3OL9 A;  1PJ7 A;  4GC6 A;  2CPZ A;  1IWG A;  3CO9 A;  4CRJ A;  2FLP A;  1SC6 A;  1JKH B;  4DU8 A;  4FYV B;  5KFJ A;  4QWE A;  4WJB A;  2E5L J;  4KJI A;  3JAM U;  1GFW B;  3U02 A;  1FRK A;  3FCH A;  4WBF A;  1OSC A;  4IOB A;  3EVO A;  2BJD A;  4ZP8 A;  4WIQ A;  1RTD A;  1VHF A;  1N0V C;  2N4D A;  2RJZ A;  2JHE A;  2HNY A;  3BKF A;  3CJS A;  1PYS B;  2XNQ A;  4QPT A;  3RAQ A;  4A8Y A;  3M7V A;  1AZS B;  2PA8 D;  4G1Q B;  4HR2 A;  1Z2L A;  1ZZF A;  2DGW A;  4I4B A;  2RIJ A;  2C2E A;  3TA2 A;  4QIE A;  3TAP A;  2O1P A;  1KBR A;  4ZA1 A;  7AT1 B;  4PUO A;  4PCQ A;  1I5O B;  4CO2 A;  1B7Y B;  1S6O A;  4CNY A;  2XY7 A;  1ZH5 A;  4IFV A;  1HI1 A;  1V6H A;  1VIS A;  3CWJ A;  3OFH A;  3U1N A;  3UPF A;  2MKI A;  3CW2 C;  3ENW A;  3ZZU A;  4O3Q A;  2ZH1 A;  1K0V A;  3NGD A;  1FDD A;  2VBY A;  3OFE A;  3TNV A;  1Q7Y T;  1SKR A;  2YNH A;  4B9T A;  4B9U A;  4LSN B;  3HP6 A;  1SCJ B;  5ETP A;  4O3P A;  2J7U A;  2OGU A;  1NDL A;  3V6D B;  2HQG A;  3A1Y G;  1IR0 A;  5FII A;  3CCS S;  1YZ7 A;  1AB8 A;  2BUN A;  2QLX A;  3BGU A;  4PEO A;  3VAG A;  3GTY X;  2YNF B;  3NS7 B;  2HRY A;  2IYG A;  4IG3 A;  4TYB A;  3HFV A;  4WFN Q;  2B8P A;  1WD6 A;  1X9M A;  4A46 A;  2F9J A;  3CDA A;  4TXS A;  2IC3 B;  5IWA F;  4WZQ A;  4DOZ A;  3NMR A;  2ZZN A;  2XWY A;  2M4M A;  3VV2 B;  5HL7 Q;  1OQ3 A;  5CD4 A;  3ZZP A;  2XMK A;  1JLG A;  1VDH A;  4NPO A;  3UDC A;  2YQ0 A;  2ZDO A;  2KFZ A;  5A8R A;  2UUC J;  1NU4 A;  1T7P A;  2XSF A;  3BH7 B;  1R8P A;  3CCT A;  2XO6 A;  2DR6 A;  4CLT A;  2QYG A;  4OYX A;  4C8K A;  1URR A;  5CYM A;  3CUL A;  2HVI A;  1B7F A;  1UMJ A;  2A3J A;  3NAI A;  1LK7 A;  4IR9 A;  2DCL A;  3M2V B;  3HHE A;  2E7W A;  4EMD A;  4BBY A;  2BM1 A;  3BPS P;  3Q8Y A;  4Q0B A;  5E3R A;  4ID8 A;  4OX9 J;  4DCP B;  4F4X A;  4A8Q A;  4USU A;  4JI3 J;  1E6V A;  5BYQ A;  3MD1 A;  1X4C A;  1RAO A;  4MK9 A;  4JI0 J;  1PG5 B;  2QO3 A;  3CGI A;  3MHY A;  3OXL A;  1VRT A;  4O44 B;  5KFN A;  3RR7 A;  1HMV B;  4GKJ J;  1NPK A;  4WFY A;  3MCS A;  3IWN C;  3BB5 A;  1IKY A;  4OZ1 A;  4DCJ B;  4L72 B;  1D9D A;  4KHP F;  2F8H A;  3QLH A;  2CDR B;  2YH0 A;  3HFZ B;  4M5M A;  3ZZZ A;  3KLF A;  1IVZ A;  1J5O B;  1B3T A;  1DJ0 A;  4LMZ A;  1ZA2 B;  4LBH A;  3K7R A;  1FT8 A;  5T7L B;  4TKT A;  2DHA A;  3W5X A;  3HI9 A;  3NKY A;  4BWJ A;  2KXN B;  2MST A;  2R4F A;  5ADZ A;  5D0H A;  3BM7 A;  3QBC A;  3HKW A;  3CCL S;  5GAE U;  4AL7 A;  2NCK L;  3DM2 A;  5D4N A;  1YHQ S;  3JSB A;  2XS7 A;  1JWW A;  1DBD A;  2HZV A;  2GVZ A;  3HKZ D;  3I0R A;  4Y2C A;  2W4C A;  3BJY A;  1NSA A;  3RB6 A;  2PFD A;  3C6T A;  3LP1 B;  1HFE L;  4DX6 A;  1XR7 A;  2GJ2 A;  2MKJ A;  3CE8 A;  3PEH A;  4JI8 J;  4WK1 A;  2CPF A;  3DM2 B;  1F5B A;  4Q43 A;  3UVJ A;  4PPZ A;  3QNW B;  3RZA A;  4IRC A;  3PX0 A;  3B54 A;  4DUT A;  5EDW A;  1NRK A;  1NDK A;  1XIQ A;  2DHH A;  3MAA A;  4DDF A;  4YP3 A;  3MF5 A;  4A8W A;  1P9Q C;  2QSF A;  1JLQ A;  2ZUG A;  3CCR S;  2DNM A;  1CUL A;  2K3K A;  4M8L A;  2MZJ A;  4LVO P;  4EO8 A;  1IJE B;  2D9P A;  3CDE A;  3M6U A;  4WTO B;  1BQM A;  1UZD A;  2GNK A;  3QLH B;  1R7I A;  3HX9 A;  4PQA A;  2RIL A;  2VOP A;  4KH0 B;  2RQK A;  3D6T B;  2DHG A;  4NLD A;  4OJH A;  2M2B A;  4KHM A;  3VR1 A;  4L74 A;  2HHH F;  1V9O A;  3ZTS A;  1ZM4 A;  2B9E A;  1AW0 A;  3KK1 A;  1OWX A;  1UPP A;  2O01 C;  4NEY A;  2FVP A;  1PYO B;  4PWU A;  1RT3 B;  1MN9 A;  4LFA J;  2CIM A;  4DMZ A;  2CZ4 A;  1YIT S;  1DZ5 A;  2FJW A;  2J9E A;  4NA2 A;  1JLA B;  2DNY A;  2UV8 G;  4XAK A;  1A7G E;  3AOB A;  1YGY A;  3B82 A;  3DDN A;  1UA0 A;  4Z7Y A;  1LWF A;  2HLT A;  1AYE A;  4B3R J;  3KJQ B;  1BWE A;  3Q8V A;  5FJ4 A;  5HAT A;  5A8W A;  2ACM A;  3BZQ A;  4F04 B;  4KE5 A;  3KK2 A;  2DD8 S;  1MNE A;  2CPX A;  2VG5 B;  1SIW B;  2Y1R I;  1X5T A;  2EFO A;  2HIQ A;  3GMG A;  4GVL A;  1TKD A;  1TV6 A;  2GVD A;  1YBA A;  2QL9 B;  3LF0 A;  1Q53 A;  3H5U A;  2OEJ A;  4JI7 J;  3BQ2 A;  1RA6 A;  2FGO A;  2V4J B;  2YX7 A;  2CJQ A;  1FWP A;  2PE8 A;  3L9Z A;  1JLB A;  4ZVR B;  1HNX J;  3DYA B;  1VCT A;  2LXF A;  4GVB A;  3CJ4 A;  5F3T A;  1GEH A;  1RTI B;  1SV5 A;  4DHV A;  4IOA Q;  5DJB A;  1XER A;  4L6V 3;  4ZCM A;  4CNZ A;  1XR5 A;  4JI1 J;  4P73 A;  2EFN A;  5GMK a;  2HHV A;  1F2G A;  4ELV A;  3H7H B;  5T14 A;  2WON A;  4DSE A;  2CDQ A;  2B0G A;  2OD6 A;  3UD3 P;  2CG4 A;  4J9R A;  3V5R A;  1OJ4 A;  5GAD I;  4ZLP A;  4DR2 J;  3GYN A;  3M8R A;  2WBR A;  3QWP A;  4RX6 A;  3G6E S;  3KMQ A;  4X4O A;  1UVJ A;  4F3Q A;  2IM2 A;  4JV2 A;  3HFK A;  4FYW B;  4RU2 A;  1BUX A;  4ZVG A;  3PKY A;  3EXY A;  2KYX A;  2QEX S;  4IH5 A;  2KHC A;  2R8I A;  4EU0 A;  3EGW B;  1VIO A;  3MTK A;  1N33 J;  4X4V A;  1AFI A;  2R42 A;  1J5O A;  1FXD A;  1T05 A;  3IS9 B;  4ZPB A;  2ZNZ A;  1HAR A;  2LEP A;  5F0W A;  5HBM A;  4U8Y A;  1RYR A;  3ITH B;  3KNA A;  1RT4 A;  1YWX A;  1N32 F;  3GFH A;  1CPZ A;  4ZVQ B;  1IKY B;  3UDL A;  2XGP A;  4DPY A;  1CJU A;  5G0R B;  4N41 A;  1Q1K A;  2V8G A;  1EJ7 L;  1SH3 A;  2Z58 B;  4OI2 A;  5B0G A;  3W2W A;  2KH9 A;  2LQB A;  1NSP A;  1RTH A;  4MTP A;  2ZH6 A;  3CD6 S;  3PW7 A;  2UVR A;  1BXN A;  1Y5L B;  2HFO A;  1RWM B;  2IM1 A;  3PYG A;  3VWS A;  3CO0 P;  3M2V A;  2UV8 A;  1DQ8 A;  1EET A;  1B70 B;  2NXU A;  3QAT A;  4IO1 A;  4ZCI A;  3J7Z 5;  3CCQ S;  4IRD A;  2DR5 A;  3RYL A;  4WFB Q;  1WC5 A;  3FBC A;  3OHA A;  1RYS A;  2PI5 A;  1SKU B;  2WZ1 A;  4G6V B;  4DR5 J;  1TKT A;  2OML A;  4ZN1 A;  1UP1 A;  3GJR B;  4AYB D;  1T95 A;  4KAI A;  1GXU A;  3KLV A;  2LVW A;  3KHH A;  4F4W A;  1NUE A;  2WON B;  3WBZ A;  5L9N A;  2AGO A;  1F5A A;  3EWG A;  4LF5 F;  1JLC B;  4I6W A;  3AY0 A;  1S9G A;  2VAS A;  2HVE A;  4LSL A;  2HGM A;  5GME A;  5KG4 A;  2E1C A;  3DRS A;  2ERR A;  4CTA A;  2AEF A;  4NWB A;  4LRB A;  1XNR J;  3NBP B;  3WIU A;  3MEE B;  4PQU A;  1KFD A;  4XK8 C;  3MCO A;  1Y9O A;  2V2Z A;  4MYU A;  2G13 A;  4OZN A;  4RNF A;  1N5V A;  5KFD A;  1WJ9 A;  4TU8 A;  2IAJ A;  4QZV B;  3CTR A;  2IRY A;  3JAM Y;  2NLW A;  1UW9 A;  2CVE A;  1C0T B;  2MJU A;  4DPO A;  2UZA A;  4I64 A;  3IRX A;  1PIL A;  2RHQ B;  3Q8U A;  3QZ8 A;  1EP4 A;  3EZ5 A;  4B3R F;  4J7C A;  4O4G A;  3J7Z T;  5KT2 A;  5D78 A;  4LF5 J;  5JUM A;  1RWK B;  2V2K A;  4B3T J;  4DR7 F;  3LW5 C;  4ERD A;  2JH3 A;  2NPI A;  2E9T A;  4MIB A;  4DFP A;  1KTQ A;  3VGV A;  2OMO A;  2A2D A;  3KUH A;  4XO0 A;  2ZEJ A;  3KJN B;  2HS0 A;  1VJW A;  4PYA A;  4DR5 F;  1AA1 B;  3N79 A;  4P7V A;  2H51 B;  2V69 A;  4M5D A;  4QIG A;  1DLO B;  1IBC B;  1F3F A;  2C2N A;  5GAE I;  4LVN P;  2ZWP A;  3W5Y A;  4E2F B;  2IAJ B;  4PG8 A;  1C0U B;  2YNG A;  2HK2 A;  1FKO A;  3PJ9 A;  4J37 A;  5HK4 A;  4QW9 A;  4K2X A;  5E0O A;  5KG2 A;  3OXG A;  4X62 J;  2FB0 A;  2HFV A;  2Z8Q A;  2DXD A;  3ETM A;  1JLG B;  1HR0 F;  5KFY A;  3QRQ A;  5F8N A;  8RUC A;  3IFE A;  5A76 A;  5JJB A;  4ZIW A;  4DSF A;  1S0M A;  5ETV A;  1BQN A;  2EKY A;  3DI6 B;  2NXJ A;  3OTB A;  5IM0 B;  2JC1 A;  1KN6 A;  2HLU A;  1N5Y A;  3MM7 A;  2CAD A;  2CQP A;  4OYA A;  4IDK B;  5CD4 H;  3TAM A;  3DMJ B;  1HNW F;  4CO1 A;  4JI5 F;  4GKK J;  1C4A A;  1F9E B;  2XZT B;  4I0W A;  4KBI A;  3Q83 A;  4C8M A;  2N4C A;  4K4W A;  3PV8 A;  1K73 T;  1DRZ A;  4A8M P;  3V6J A;  1FKP A;  3ZNU A;  2L48 A;  4RW7 B;  4NXN F;  2OFG X;  3E01 B;  3AXK A;  2BQU A;  1YLX A;  1HBM B;  2K7J A;  2VKR A;  2RE1 A;  3IBC B;  3MOZ A;  4B9N A;  4F02 A;  2YWE A;  1QAI A;  4P75 A;  3TYT A;  5F8I A;  1RGV A;  2ZZT A;  2CNL B;  3GFX A;  3MFH A;  2VQF F;  2JEG A;  3DKD A;  1RAG B;  1JXE A;  1ACM B;  2CPJ A;  3D6F B;  4HEA 9;  2EC0 A;  4YB1 P;  3NY0 A;  2C2D A;  2BJ8 A;  2CUY A;  2E5H A;  3GG0 A;  4LR7 A;  2IJN A;  4U6P A;  4RUA A;  2DR7 A;  4RPF A;  4KPY A;  2XZW A;  4KHP J;  4QPX A;  5BJR A;  2O5D A;  3UR3 C;  5HBM B;  1Q4R A;  4RW8 B;  4EGL A;  3R2C J;  2RAQ A;  1PAE X;  4WK3 A;  3FQK A;  3I82 A;  1RTD B;  4ED2 A;  3M30 A;  3W63 A;  1WC1 A;  1SL0 A;  2C1E B;  3O8W A;  3TVY A;  4ED8 A;  3H2U B;  4ZPT R;  1M5H A;  2ZDP A;  5IC4 B;  2MZR A;  2PMH A;  4WE1 A;  2R7T A;  3EGV A;  2MQN A;  1SC3 B;  2P9C A;  4P2S A;  1VQS A;  3FZ2 A;  1R8B A;  4PXB A;  1JLF A;  4X65 J;  1MMN A;  2AJ2 A;  2EXU A;  2F7V A;  3AD9 C;  3EXC X;  1IM4 A;  2G9O A;  3QYY A;  5IQ6 A;  1XWL A;  1YJU A;  2D3O 1;  4A8S A;  2VON A;  4U67 Q;  4DV0 J;  2KKH A;  4RWX A;  3TVK A;  5JVH Q;  4OZL A;  4U8V A;  2CNO B;  2OEM A;  2ZH4 A;  4XPC A;  1T3O A;  3LTO A;  3R6L B;  1ZET A;  1KHW A;  5LMU F;  4OHY A;  3F73 A;  1D8Y A;  1UKU A;  3MEE A;  1MML A;  1SC1 B;  4R5P A;  3GG1 A;  3OSN A;  5A8R B;  2LEA A;  3THV A;  2J9D E;  4N8O A;  2RHS B;  1S9G B;  3ZZR A;  1WEY A;  2MZ1 A;  1XTZ A;  2Z0G A;  4ZPC A;  3CF5 Q;  4K4X A;  1D3W A;  1KOO A;  1VYA A;  5L8R C;  3W5Z A;  2XB2 D;  5AXK A;  1J5E F;  5KFH A;  1WSR A;  2B5J A;  5F8J A;  1VI7 A;  3SIP B;  3OLB A;  2RQC A;  2B9X A;  2DIU A;  3BGR A;  1TUW A;  3KK3 A;  3KWM A;  4RW4 A;  1HHT P;  1NPP A;  4KH1 B;  1HWI A;  4EO6 A;  4N7T A;  1P1L A;  1QTN B;  3NS6 A;  4DV2 F;  4F4Z A;  2B7B B;  1S97 A;  2GIF A;  4OHX A;  3ONQ A;  3R8Y A;  2DKO B;  4C6A A;  4ELU A;  2V0N A;  1SQF A;  2YKN A;  3MPD A;  4DL5 A;  2IA0 A;  2CZ9 A;  3K8W A;  2XLI A;  1S6P B;  4UST A;  4P7T A;  1DTQ A;  2HZA A;  4M95 A;  1S72 S;  4CLF A;  2CQI A;  1SC4 B;  1PAU B;  2CZV C;  4JI5 J;  4U7U D;  3TRG A;  2MQQ A;  4ILL A;  3MMB A;  3BEG B;  1CEZ A;  3MZI A;  3VZI A;  1FKO B;  1WI8 A;  5GAG U;  5DS7 A;  1KRP A;  2XMA A;  1WC0 A;  4K4Z A;  1N54 B;  1V5I B;  2WVC A;  5DM7 Q;  4DQQ A;  3VAH A;  4C9D A;  1WOS A;  1KS2 A;  3AD8 C;  1CG2 A;  2V9K A;  3BYP A;  4K8R A;  4QIV A;  4URG A;  3NCP A;  2J5A A;  2GHW A;  3HHN B;  2JOQ A;  1S6P A;  1D0E A;  4X4U A;  1QAX A;  3H59 A;  1QLN A;  2RT3 A;  2CQ4 A;  3KOA A;  2IRU A;  3IXQ A;  3EX7 B;  1UJ4 A;  2RKI B;  3B4D A;  2RB7 A;  3O3L A;  4JI0 F;  3MEC B;  3VHQ A;  1PC4 A;  3M9N B;  4P9S A;  4TY9 A;  4U95 A;  2M8H A;  2UUA F;  2CWX A;  2RUG A;  1VJQ A;  2K3I A;  2RRA A;  2ZBQ A;  1LV5 A;  1M5V C;  4PWD A;  3CD7 A;  4TU7 A;  1TKX B;  4DR7 J;  2VL1 A;  1YSJ A;  1UZH A;  3DMJ A;  2CPD A;  2MDA A;  1ZM9 A;  5A6P A;  3AHP A;  1LW0 A;  4PPD A;  4A8O A;  5KFQ A;  3QZ7 A;  1TFW A;  2PD1 A;  1R31 A;  1K0T A;  3PW4 A;  1DQ9 A;  3AA8 A;  1X4B A;  3M2R A;  4EYH B;  2DGU A;  1GQE A;  2OLW A;  4DUY J;  3R5J B;  2NRE A;  3N0V A;  3EZO A;  1UEU A;  2RDD A;  3C6U B;  1RLD A;  5L1I A;  4RNH A;  4WU3 A;  3FMB A;  3E2E A;  3BS9 A;  4DX8 H;  2PO4 A;  2XSJ B;  2B6A A;  1UVK A;  2BBE A;  4G65 A;  4PWD B;  1H2V Z;  4HYK A;  4MK8 A;  2KG0 A;  2FZC B;  5J1P A;  2G0I A;  5EWE A;  1FE0 A;  2BJ7 A;  2MTL A;  3QMQ A;  3CD5 A;  3Q2S C;  2EVZ A;  3LP0 A;  3SBM A;  2BA9 A;  4PAB A;  1LW2 A;  1S1W A;  2HAF A;  3HSZ A;  4RZR A;  3W2W B;  3QIP B;  5H9F K;  1Q8L A;  1S0V A;  2Q1L A;  2YH1 A;  4JV5 J;  3FFI A;  1WG1 A;  3D68 A;  2JL9 A;  3MR5 A;  1DAX A;  3R5B A;  2HYI B;  4E0D A;  3IC1 A;  3ZZO A;  1VRQ C;  1KFS A;  1YBT A;  2EK1 A;  3FRZ A;  1AUD A;  3AJ1 A;  1YVF A;  3RBX A;  2KDO A;  2OPS A;  4DPU A;  4DR6 J;  1RE1 B;  2Z56 B;  4RW8 A;  3HT0 A;  3EZU A;  6AT1 B;  1ZM3 A;  2QZ8 A;  5DG9 A;  4IH7 A;  2AKW B;  4NI2 B;  1T9X A;  2NXC A;  4OZJ A;  3UVJ B;  2M7S A;  5M2R A;  2BE2 A;  5KFK A;  3KHR A;  1PGZ A;  4F4A A;  1JLC A;  2CQ0 A;  1REV B;  2KTQ A;  1JIH A;  1MLA A;  2F8M A;  3CT9 A;  2AD9 A;  2AEM A;  2OJ3 A;  1X4E A;  2E5L F;  2LQ8 A;  2WVF A;  1KOH A;  3MD3 A;  4F2S A;  4LFC J;  2MZS A;  2CXE A;  4LBP A;  1VQ8 S;  5FD1 A;  1JB0 C;  1TKX A;  3MPU B;  4MKY A;  4Y3C A;  2YWK A;  1EAR A;  2J76 E;  5HMW A;  5H1S V;  4DV7 F;  4DR2 F;  4CWB A;  1U1L A;  5K14 A;  3PFO A;  3HSG A;  1JNR B;  1YQH A;  2B5J B;  2PSZ A;  3T19 A;  2OD4 A;  4TYA A;  2UVU A;  3QRR A;  5JMN A;  1U1M A;  1VBZ A;  2E1M C;  4DV3 J;  1Y10 A;  1WKJ A;  5KFW A;  4K5S A;  4ZVU B;  1VQY A;  5C2C A;  3CXC R;  1TUV A;  3L7U A;  3VCD A;  1HMV A;  3ZTP A;  3OHB A;  2NUH A;  3EVM A;  2Q79 A;  4PG4 A;  4MYT A;  3W9I A;  1N56 A;  3GB0 A;  3HD1 A;  4NLW A;  4NLS A;  1TL3 B;  5M2P A;  3IN5 A;  4WFZ A;  3K5L A;  2R8K A;  4RW9 A;  4W98 A;  1RCX B;  3R2D J;  1VRU B;  3G82 B;  1ITP A;  2CQH A;  1TU0 B;  2Y0B B;  2FTR A;  4OJG A;  4QYR A;  4ILM A;  3Q8S B;  4ECX A;  5CH7 B;  2DT9 A;  1JJ2 R;  1HNI A;  1SIZ A;  4KO0 B;  3MMB B;  5KFT A;  3VTI A;  3D5M A;  5K9F A;  4RNM A;  1VQ5 S;  1FER A;  2R8J A;  4M94 A;  1A0O B;  4DR3 J;  2HFS A;  3QFW A;  1RAE B;  5J1E A;  4RUH A;  3DXB A;  4Q5V A;  2WW8 A;  3LGH A;  2POK A;  2VBZ A;  1XMQ F;  3QJP A;  1VQ6 S;  1NME B;  1U1Q A;  3AQP A;  4PWW A;  2JFK A;  1DAR A;  1XN9 A;  5IFM A;  4A8F A;  4ES2 A;  2MQL A;  8AT1 B;  1H74 A;  1TVR B;  4C97 A;  1I94 F;  4N76 A;  2XMU A;  3EUN A;  2ZFH A;  4ZN3 A;  4Q45 A;  2QX0 A;  3A12 A;  1RCO B;  3FEZ A;  2OFH X;  3BRE A;  4D3H A;  4ETZ A;  2ASD A;  4B9V A;  1L3U A;  1B0T A;  4YN3 B;  2B4P A;  1N52 B;  1YI2 S;  2KL8 A;  5F41 A;  1Q0N A;  2JWN A;  2VZ9 A;  2QSW A;  1VMB A;  3AD7 C;  3R6G B;  2V68 A;  4F26 A;  1SJ3 P;  4CLS A;  3Q23 A;  1KVK A;  4YR3 A;  3IR5 B;  3NGS A;  4DQS A;  4JI4 F;  2ILY A;  5DQI A;  1IBK J;  2YPZ A;  1NK4 A;  3N5B A;  4B3M F;  2Q66 A;  2DH9 A;  2A6M A;  3WDO A;  1D8Z A;  1TL5 A;  1TV6 B;  1LEO A;  3VGS A;  4AT1 B;  1N8R T;  3C6T B;  2W8K A;  3TUJ C;  3KDN A;  3R5C A;  3I0R B;  3MXH P;  4AXI A;  1CBK A;  2VV5 A;  2ZWO A;  3I31 A;  4GO7 X;  4QR1 A;  3W61 A;  3KK2 B;  3HXM A;  2HEK A;  1KDN A;  4RW7 A;  2HQF A;  3OBI A;  4X66 J;  3BO2 A;  5KFX A;  4B17 A;  5K8P A;  3THT A;  2DH8 A;  3NCR A;  5HP1 B;  2E1P A;  2XMM A;  2J9C A;  2P8I A;  3BGO P;  2OPP B;  5T7L A;  3RGI A;  1C4C A;  2VFR A;  5B0D A;  5DG8 A;  1ZYQ A;  1FTC A;  4UOC A;  1EAY C;  1HI8 A;  2BAC A;  2BVZ A;  4LIR A;  5A0Y B;  3DI6 A;  2BJE A;  2YWW A;  3MED B;  1NB2 A;  4PKD B;  3S8S A;  3Q8Q B;  4DFK A;  4EUV A;  1LWE A;  3GU0 A;  1EB0 A;  4E98 A;  4DV3 F;  4PRF A;  1U02 A;  2BE2 B;  1Q16 B;  4DN0 A;  4Y0F A;  5HJX A;  1U1R A;  1TL4 A;  3TA1 A;  4FS2 A;  2CQ2 A;  2LLZ A;  1D9F A;  4KR0 B;  2A18 A;  3DRX A;  3H5X A;  6FD1 A;  3OL8 A;  3LWL A;  1NK7 A;  3A3N B;  1M5S A;  4NXM J;  3C8Y A;  2KT5 A;  3C15 A;  4H54 A;  2B8Q A;  2OP5 A;  3ULH A;  9ATC B;  2MKK A;  1JXL A;  5LJ5 Y;  4F2R A;  5F8L A;  4M5L A;  5FLX Y;  4FXV A;  3GIR A;  4OI3 A;  5KFR A;  3M32 B;  4CZC A;  4LBI A;  2JLG A;  3MR7 A;  4IRK A;  4U96 A;  1NKE A;  1WOO A;  2I5J B;  2Z30 B;  2UUA J;  2QMW A;  1LNQ A;  5HQM A;  4B9M A;  4M63 A;  3X1L B;  5L9X A;  1RAC B;  2XYG B;  2R7O A;  3UN3 A;  5ETQ A;  3UI3 A;  4KC5 A;  4CLL A;  4ECV A;  1HNW J;  5JVG Q;  1JJC B;  4HVZ A;  4ID5 B;  2GMH A;  5CCM A;  1WWH A;  4Y2I A;  3TOQ A;  3CC2 S;  2KVI A;  1WF2 A;  4I2Q B;  3UQS A;  3SZ2 A;  2IJF A;  2KO1 A;  2OI2 A;  2YKM A;  4OLO A;  1NHK L;  3SCJ E;  4FYD A;  2VG6 B;  4ANE A;  2AJ1 A;  2AW0 A;  5KT4 A;  4DLE A;  1S1V A;  3NS5 A;  4DV5 F;  4HAC A;  1DTT B;  3T41 A;  3HZE A;  3HMJ G;  4LF9 F;  3UW1 A;  3FBF A;  1YRT A;  2VPY B;  1U1O A;  4OL8 A;  2XY5 A;  1J5E J;  1CJK A;  3LOU A;  1FJE B;  2MPU A;  4I67 A;  2FLL A;  2J7W A;  4JI2 J;  2EPI A;  3DHX A;  4IFY A;  4LRA A;  3UN5 A;  5AXM A;  3BV8 A;  2DEI A;  2DNO A;  3OR1 A;  3I0S B;  4OYW A;  3UNY A;  3CMQ A;  3MCN A;  2DGT A;  3MTJ A;  2AT1 B;  2XI2 A;  5J2N B;  3W1Y C;  3OJS A;  2Y1L B;  3CDU A;  1VQP S;  2CAJ A;  4C8O A;  5ETT A;  3ZTO A;  4DG1 B;  1RWX B;  4P52 A;  3ZC4 A;  2MHN A;  2MGZ A;  1HQ2 A;  3B6B A;  2WRM A;  4NRT A;  1SQG A;  1JLA A;  2BOA A;  2GJF A;  2YKO A;  3RU0 A;  2XCA A;  3TAR A;  1JX4 A;  3I0S A;  2MKY A;  2CJ9 A;  3BQ1 A;  2KM8 B;  4O0N A;  2AYG A;  1X4D A;  2PMZ D;  3T5K A;  4HDH A;  2IDL A;  5GAG I;  2R7U A;  4WFA Q;  2GMJ A;  2AYE A;  3PHE A;  2MYF A;  3KMS A;  3TJA A;  4DEZ A;  1H0H B;  2XWX A;  2OPQ A;  1LWE B;  5I3Q A;  1U6B A;  2YY3 A;  3HVW A;  1JLQ B;  3CUN A;  2JZ5 A;  3T9Z A;  3QJJ A;  1K1S A;  3ETO A;  2Q6C A;  1U1K A;  2E7V A;  1T9T A;  1YK9 A;  2L08 A;  3D1O A;  1KP6 A;  3QQC D;  5CHC B;  4F67 A;  4MH8 A;  3T5L A;  2R3V A;  2WOM A;  1FCA A;  2UU9 J;  2CWK A;  1NDC A;  3B8H A;  1FE4 A;  3J81 U;  1ELO A;  4HHH A;  3DOM A;  4YB5 A;  3WC2 A;  3TUP A;  1DUR A;  2LKZ A;  3JXO A;  4C8L A;  4DCO B;  1GH8 A;  1U24 A;  1L3K A;  1FRX A;  2RF2 A;  3ZZT A;  4FF4 A;  3KUE A;  2ZOM A;  1VLO A;  4A4J A;  1SJF A;  2H5E A;  4C0H A;  3MPW A;  3JSY A;  4IQM A;  3W2V B;  4UQG A;  5LT5 A;  3A13 A;  4PG6 A;  3H4D A;  2U2F A;  2GW8 A;  4DL0 C;  2RS2 A;  3MM5 B;  4X4P A;  3L3C A;  2NXE A;  4ZP9 A;  4P72 A;  3K5N A;  4NXN J;  2W2N P;  4JB8 B;  3PX4 A;  2MSS A;  2VH7 A;  3MCM A;  3C15 B;  2HND B;  2G2O A;  3MI7 X;  1T9Y A;  4MKA A;  4RW6 A;  2R2U A;  4AUK A;  4CP5 A;  1VQ7 S;  2B3T B;  6FDR A;  3DC2 A;  3UN2 A;  1T8E A;  1NKC A;  1YTY A;  3LP2 A;  1LOU A;  2QC3 A;  4ANC A;  2WBM A;  2K8G A;  3MM8 B;  4WYL A;  4CH1 A;  3A8J A;  1TVR A;  1RLC L;  1FDB A;  4OHZ A;  4KGV B;  4FN5 A;  4DR6 F;  2V2V A;  4I7F B;  2CJX B;  3FC9 A;  4FP9 A;  4H4M A;  4X62 F;  3M9O B;  1MU2 B;  1U2C A;  2YTC A;  3W66 A;  1DLO A;  1NH8 A;  1U7L A;  2PII A;  1WKL A;  1Y11 A;  5HJY A;  2FJV A;  2J6T A;  4PR6 A;  2R8H A;  1UL3 A;  4NA3 A;  2YWH A;  1RT3 A;  4OYP A;  2CG8 A;  3QGP A;  4AXJ A; 
#chains in the Genus database with same CATH homology
 4LBP A;  1MWQ A;  1S7I A;  4LBI A;  3ZNJ 1;  4FPI A;  3ZO7 A;  4LBH A;  3ZNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...