3ZNUA

Crystal structure of clcf in crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
b'MLYLVRMTVNLPRNLDPREEERLKASEKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-CHLOROMUCONOLACTONE DEHALOGENASE
publication title Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp.
pubmed doi rcsb
source organism Rhodococcus opacus
molecule tags Lyase
total genus 26
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02426 MIase Muconolactone delta-isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Dimeric alpha+beta barrel 3znuA00
4LBIA 3ZO7A 1S7IA 1MWQA 3ZNJ1 4LBPA 4LBHA 3ZNUA 4FPIA
chains in the Genus database with same CATH superfamily
2ADBA 3VGTA 3CXCR 2PFDA 1IBKF 3FQLA 2CFXA 3G6YA 4I64A 4YR2A 2V8GA 3OVAA 4HI1A 2WAQD 1Y00A 4ETXA 1YGYA 2DH9A 3Q8YA 4DR4F 4KPCA 4V19X 2YXLA 2HHVA 2CJYB 3THPA 2MKHA 2DTJA 4LR8A 4YY3F 4RJVA 3I4PA 5CABA 3R7SB 3NCRA 5HMXA 4TVAB 5ETSA 2GVDA 4K0KJ 1R0BG 4KR0B 1N36F 3ZFVA 3H42A 2H51B 1UTAA 2HFNA 2C3PA 4AXJA 3FQKA 4BWMA 3R5DA 3MM7B 1HNZJ 1NM2A 4NLQA 3VGVA 1H3DA 3FJ2A 2ASYA 3K8VA 1UVNA 4GRSA 5IT9Y 4DL5A 5D3GB 1XEZA 1BQMA 2PMWA 3QO9A 1PKUA 2V2KA 1SH3A 3C19A 1HBMB 2YX1A 3W60A 4DMZA 2WVEA 2DR7A 5CZXA 5C42A 3ENWA 1TL7B 4NOHA 1XNRJ 1QAJA 2Y9HA 4HYKA 5J2NB 2IFXA 5KT5A 4DV5J 1F3VA 1IM6A 3AD8C 3J7Z5 4RW8B 1RHUB 5DO2A 2E1MC 5KG1A 5H9EJ 1RTJB 1YJ9S 4BS2A 5F8NA 3ISND 3S6EA 5C24A 4IOCQ 2Z8QA 5K20B 3IRXA 1HWLA 3VHQA 3TOQA 2E5IA 4DUYF 2OI2A 2BZ2A 5ETRA 3DLEB 4DZ6A 2NYHA 4DG1A 4WYWA 4NLSA 5HAOA 3M32B 2B0GA 1R6YA 4I67A 4B3RJ 1DZ5A 4F25A 4DV7J 2KFZA 2PFFB 3PJWA 3POTB 4N8NA 2NXJA 3GYGA 4LIWA 2UXDJ 2MQLA 1X4FA 5LXYA 2KYZA 1AUDA 2A1BA 3UWTA 4IR1A 1N5QA 2LXUA 1G7CB 1FX2A 4ZVOB 4LRFA 4DUTA 4OZJA 2HAIA 4ECXA 1Q5VA 1RA7A 1HD1A 4PXBA 1FEEA 1X4DA 1SUQA 3KDOA 2YNHB 2PA3A 1U1MA 3U1MA 3KJVB 1WSRA 3BGLA 2KXHA 4CT8A 2CPEA 3M9OB 3NS6A 2WB1D 4CO0A 2MQ8A 4IKAA 3CD5A 1MN9A 3HJFA 2OMLA 3F44A 1PJ5A 1ZAWA 2W2MP 1TUVA 1Q8BA 2JX2A 2D69A 3BQ0A 2HFVA 1T9XA 3BQ2A 1QVGR 4K50A 3G8QA 4LF7J 2LU2A 4NI2B 3MR5A 2VIHA 2FZKB 4WIQA 5DLGA 3N5FA 3CO9A 2MZJA 4R0EA 4K4WA 2FHMA 2YKQA 2HPUA 2RS8A 5CYQA 1N52B 3E3XA 1I3OB 2MKSA 4F0HA 1JLGA 3MXHP 1XMOJ 2GIQA 1CC7A 4RR5A 3DOKA 3N01A 3GR1A 1TAUA 2E5LJ 2YKPA 4KPYA 1NMEB 3OR2A 2ZHAA 2BQRA 1PAEX 3UI3A 4TKTA 3AJ1A 2MHNA 4BCAA 3ISZA 3A3NB 4BC9A 2G1DA 4JI1F 1EB0A 1X5PA 2H3EB 4PWUA 1UVKA 1V9OA 2LVWA 1O51A 2V8HA 3DC2A 4ZP8A 1K0VA 1JLEB 3H59A 3CJKA 1QVFR 2W2QP 3MECA 1QJHA 1AW0A 4KKOB 1IKWA 1UFWA 4M5GA 1PC5A 4U67Q 1CEZA 2DH8A 1S6UA 3DFEA 4M5NA 2K3KA 4DR1J 4I7FA 3Q8SB 1Y9OA 4WZQA 3OJUA 3PIPQ 2VPWB 5HO4A 1YQHA 2M5YA 3P8BB 4JOUA 4DV2F 1HQUA 1E6VB 3O3LA 2Q66A 3OTOF 3NAIA 3ET6A 1JK9B 2HSEB 2HZAA 2HHTA 5IM0A 1YJTA 4KE5A 1YVFA 1XNQF 3FBEA 5FLXU 4Q7AA 1B64A 1TL5A 1UEVA 4IH5A 2DGOA 1FTRA 2FHJA 1U6BA 3HK2A 4KV8A 3HXMA 3QT6A 2MTLA 3MPDA 4L76A 1RT4A 3I56S 2CQHA 2G0IA 4WK3A 4ITSA 3DHXA 5IT4A 1WKKA 2PO4A 2MQPA 2RQCA 1K47A 1FKPA 5F9LA 2RQMA 2F4VJ 3UNYA 1CSJA 3AJ2A 2AW0A 1K44A 2K7JA 4DU7A 4ZHRA 1N54B 4QIEA 4CO5A 2AGQA 2U2FA 1WELA 3K58A 3PYDA 1CULA 2HVZA 3VAJA 1J2VA 4C9DA 4CLTA 2DO0A 2MQNA 2CQ4A 3J80Y 1HHQA 3TRGA 3SCIE 1X4GA 3MD1A 2N7YA 3VV2B 3KK1A 3UQSA 4OYIA 1WTBA 4L75A 3GFZA 4IG0B 1YJRA 3OLAA 4Y3CA 2WSEC 4OX9J 3HULA 2DNRA 2HBZB 3QGPA 2E7VA 3HVTA 2EK6A 4DI6A 4HLBA 2F9JA 4ZVUB 1T11A 1S72S 1FDNA 3KK3B 2ZOMA 4EYIB 4OX8A 3H98A 3G82B 2BM1A 4XPCA 2DPIA 4GKKF 2RU3A 1P6TA 2K1RB 4KGZB 2KZZA 1I94F 2HYIB 4I68A 4MKAA 4PWDB 2UU9J 4CYUB 5BYQA 3CCSS 1RAEB 3OW2R 1GEHA 3MAHA 2KM8B 4FYXB 2QA2A 1WD6A 1NPKA 2P9EA 4HDGA 4ED3A 3MM5A 2P2CB 4FKXA 2CNOB 2VDHA 4QIGA 3GFHA 1KOOA 5J2MA 2G2YA 4OI2A 2NXEA 1BY9A 3CW2C 2FGOA 4YS2A 2VG6B 3CDAA 5KOXA 1DBDA 2PD1A 2MKYA 5E3PA 4J90A 3LPEA 2Q43A 1REGX 1TV6A 1HIYA 1Z1ZA 1DFDA 1C4CA 4DOZA 4ECYA 1RSCA 1S9GA 2JWNA 3MCNA 3HF5A 4DR6J 3JYTA 1BQNB 1RHRB 4NLRA 1RTZA 2DR9A 3I0SA 4LQ9A 4M5MA 2CZ4A 2DNMA 1JQGA 2RRNA 3TAQA 2YKNA 3H0PA 1RBAA 4WZMA 2R2TA 1FWKA 2UUBJ 3AA9A 4XAKA 4C97A 3RBDA 1A6LA 1RHKB 4RZRA 2M9KA 1RWKB 3V5RA 2W4DA 2LLZA 1W2IA 3EZOA 2YNIB 4WBFA 2GA7A 5AXLA 4A4JA 1NXIA 2OHDA 1U6ZA 3EZUA 4KKOA 3R97A 5E3RA 3H2UB 2GHVC 2M8DB 1RB0A 3FCVA 2IVYA 1S1VA 3NGUA 1RT5B 3M2RA 4DQIA 3DLGB 1EX8A 1JLCA 5LMUJ 4ANCA 3BGFA 2Y3YA 4NEZA 4X64J 2O01C 2DHHA 4Y0FA 4DX7A 4DU8A 1ZAVA 2JFKA 2V69A 4MFBB 2HHUA 4Y6IA 3LAKA 1R0CB 2XO6A 4WYLA 1SCJB 2EFVA 2YKMB 2YNFA 2WCXA 4LSLA 5BXIA 2LCWA 4J91A 3AA8A 2DISA 3Q86A 4L74A 2BRKA 3HO1A 1QAYA 1ZM9A 2BYCA 1R6VA 3PEJA 2C2OB 1NDCA 3GIKA 2JZ5A 2OLWA 3GB0A 3W9JA 3PW5A 4FKYA 4B3TJ 1S79A 3Q8UA 3IXQA 3H5SA 1FX4A 4WTOB 1BLUA 3AY0A 2MYFA 3TWZA 1FVSA 1LW0A 4FP9A 4B3SJ 4ALZA 4H4MB 4NMXA 4WKYA 2B4OA 2QSFA 2UVWA 1V3RA 4QWEA 2V68A 4DPOA 1P9YA 1FJEB 2DNOA 1X5OA 5B0FA 2L9WA 4G1PA 5LJ3Y 3A8IA 2VQEJ 2ASDA 3KFWX 2IYGA 4JI3J 2Y8YA 3TA0A 1BE4A 1NH8A 4MKVA 4WFNQ 4PEOA 1SL0A 3RAMA 1RLDA 2FZCB 1RQ0A 2YH1A 1GX5A 1Q81T 3OR1A 4FF1A 2WBRA 4KRWA 1RWXB 4AL7A 1WKJA 2IY5B 1IBKJ 4RLEA 3OL6A 3ZZTA 1Z2LA 3MMBA 3R5AA 4USWA 1RCOB 4DR4J 4EU0A 1IUJA 3M30B 5G0RA 2GMHA 1C0UB 3FUYA 4ZLNA 4NEYA 4B9MA 2XLIA 1T9YA 4CLPA 4YY3J 5IV4A 3D1HA 5LM7E 2C22A 1M1KT 2JHEA 4FF4A 1N36J 1R8PA 4N41A 4K5RA 2DVIA 2JLEA 3DYAA 4USUA 2EC0A 2VB6A 4OZ0A 4WFZA 3SYZA 4WTYA 1JJHA 1WUUA 4ZPDA 3GJSB 1NSPA 5K14B 3KLIB 3HVAA 1SIWB 1RAOA 3O5TB 1CG2A 4FVMA 2V63A 3QWUA 2E44A 5KFPA 1EARA 2DCUB 3L7OA 3SXLA 4ZJLA 2G0CA 4FBTA 5DJBA 3E2EA 1X4AA 1J5OB 4CH0S 4ZCLA 3KXDA 1Q53A 4OLPA 1RTIB 5CYMA 1N48A 2M2BA 4KGKA 1N5YB 3LAMA 1FJCA 1BGXT 1ZA1B 3I32A 3HVWA 5IXUA 3M2UA 5T7LB 3D1QA 5K8NA 4NCAA 4LRAA 5F41A 1UP1A 3V6HA 1WOSA 3JSMA 5I3UB 2GJIA 4DUYJ 2AJ1A 2V67A 2B3TB 2NSBA 2M88A 8ATCB 4P52A 2B9WA 3RB6A 2XM3A 2V6AA 4OHZA 4W90B 1VQ6S 3W9HA 3CIZA 3ZO7A 2YKAA 2RAQA 2GNKA 4LR7A 2V34A 5AE2A 2QTWA 4ECZA 2Q6BA 2ZC3A 1YI2S 1Q7LB 4YDDB 2ZVIA 3D6MB 5CHCB 2ALZA 3ZZYA 3P4UB 2ZM6F 4NYPA 2V8DA 1FCAA 1JXEA 4K4XA 3DLGA 1WF2A 4S0MA 3KNGA 2KI2A 4RUBA 2M52A 2YWEA 4KY3A 1UJ5A 2WK4A 1FRHA 2BKOA 5LJ5Y 3RTVA 1U7LA 2C42A 1PCAA 2OTJS 3NBPA 5C25A 3E01B 1VC0A 4CO3A 1HI0P 1ZYQA 1FI4A 3KYLA 2DHXA 5LL6d 3TJAA 4C6AA 1U48A 4DQQA 3L09A 1N88A 3BQ1A 1S6QB 3DLKA 1CJUB 5KFNA 1HW9A 3KLFA 2BE7D 1RU2A 1P1TA 2PA8D 1S76D 2QFJA 4CTAA 4CLLA 1VISA 3PM9A 3R7NB 1FK9A 4W4MA 2IDLA 2GV1A 2A10A 3GCXP 2FQQB 4JI1J 3TZXA 4PPDA 4H54A 1LKZA 2Z2ZA 4Y2KA 4F02A 1EAYC 1HWJA 2BJ3A 5CQGA 2YWHA 2DH7A 2RT3A 1DQAA 2Z2MA 3DGPB 5KT2A 4TY9A 2JEFA 3BGRA 2BA9A 2GMLA 2JL9A 4PRFA 2Y1IA 2R4FA 2BXJA 1F2HA 3CJ0A 5D6GA 2HFSA 3CJQA 3HZEA 2BKPA 4EO8A 4HHUA 2VASA 2AX0A 3X3UA 2OP5A 2XSFA 2G4BA 1RCXB 2DGWA 1MROB 1VRTA 3U1NA 3TEGA 3C6TB 1WHWA 3H20A 3ZTPA 1N5SA 4X62F 1R7IA 4CH7A 3RB4A 4DV2J 1S6OA 4ED6A 3OTOJ 1JLFB 1IKVA 3K8WA 3AOBA 1U2CA 1WF0A 2ROEA 1ZA2B 2QA4S 3SV3A 4UW2A 1XNQJ 3Q89A 3CNQP 2NR0A 4FYVB 4NRTA 2FLPA 1RHJB 5C2GA 1WEZA 2CIMA 1OQ3A 2XYPB 5KFQA 2DNPA 1HNIB 1X9WA 3QIPA 1NK5A 2ZZMA 2NXNA 1FXLA 3M8QA 1G3OA 1U2FA 4X4UA 1RWNB 2DNLA 3CDWA 2RIJA 1WC1A 2D9PA 4YFUA 1MLAA 1K73T 4IRKA 1HA1A 5SUHA 2VBZA 3MUMP 3R8YA 2CQPA 3DXSX 3GIJA 4I1TA 2GJ2A 5HBMB 3MMCB 2DRAA 4G1IA 2VPYB 1J5OA 3F0NA 2MGZB 1TTHB 1OO0B 3CWJA 2B56A 3U1LA 1SJRA 3R3TA 3HSJA 3US5A 1DTTB 3WZ0A 2OO4A 2GQQA 2DITA 2BE2B 4V1Ak 3BBFA 4PABA 3NCQA 1JLQA 4F2RA 4PQAA 4KAIA 3F73A 2CPJA 5KFVA 1YJWS 1CC8A 1FEHA 3BEGB 2VQFJ 2CQ0A 1CJKB 3NS7B 3FNNA 1VBYA 1S0MA 2XI2A 4UUXA 4X4OA 5J1EB 4ZDNA 1F2GA 1QUPA 2DJWA 2XO7A 4P7TA 4EUVA 5L46A 2B6AA 2AF6A 4NL5A 2RSQA 2VU5A 4GKKJ 2DGUA 2V2ZA 2VA2A 4YN3B 2R7TA 2F1FA 3CJ2A 3MCSA 1I94J 1PSDA 1HQ2A 2YVSA 4PYAA 2XGQA 2OH2A 1I5OB 1ZM3A 2RUSA 2FJWA 4P9SA 1QM9A 2HGNA 4J37A 2FVRA 3EVMA 1BC6A 3LWLA 2IJFA 2K3IA 2UUTA 3IG1B 2PC6A 3MEEA 4J9NA 5E2QA 2KM8C 1B7FA 3KK2A 1IWGA 4ZPTR 2HZCA 5H9FK 3E01A 3MEDB 5DDQC 1HMVA 1CQMA 4JP8A 1TL1A 2VFVA 2IJRA 1T94A 1YSJA 1VQOS 1GMWD 4XPEA 2DR8A 1WKLA 4K7QA 5KG3A 5IWAF 3X1LB 1R0AB 2JDJA 3KNAA 3DDKA 2EG1A 3FEXB 4ELUA 4IFVB 5GADU 3T9ZA 4V19J 3EVOA 2BUNA 3ADAC 2MEWA 3IA0A 2WVBA 3A8KA 4DL4A 5HROB 4CWBA 2AJQA 4N47A 1PAUB 4Y34A 4ZVQB 3SSQA 3ZTQA 2G0JA 1G1XA 4ZN1A 2AD9A 3TW0A 4DFKA 3VAMA 1CJTA 1FRMA 3IBCB 2QRRA 4H4KC 4K2XA 3BR9A 2W9BB 1UZHA 2RRBA 3THVA 4OZ2A 1X4CA 3EM1A 2LEBA 4FS2A 3G6VA 4IQXA 5T14A 1YIJS 3NP5A 4M63A 1EHWA 2CQBA 2DGSA 2XZTB 2WVDA 3QWPA 3OXGA 5KFXA 4DCOB 1KNZA 1FJGF 1YDLA 1HKAA 1NHVA 2ZBRA 5H9EK 2IA6A 3QNWB 3IO1A 4ZLJA 3I6PA 3HD1A 3MFIA 1XR6A 4IG3B 1UWBA 2NPFA 3TR5A 4DV0F 5GAHI 4QWBA 4K4VA 1M90T 3QJPA 3MMAB 2K8GA 3NGRA 3IWNC 2IA0A 5IQQA 4W98A 2VKRA 2DIVA 4QOTA 3J7YU 2HFZA 1N56A 4N76A 4DPWA 2KTQA 3NAHA 4JV5F 2J0WA 2I1RA 2JVOA 5I3PA 4CLYA 2J9DA 5D15A 3TYTA 4ID8A 3N6LA 3IWXA 3I96A 1UW4A 5ETKA 3GG0A 4IH7A 3RR8A 4I2PA 4IRDA 3GIIA 3BYPA 4DN9A 5HP1B 1SKUB 4OHXA 4KQZA 4QYZJ 3WQPA 1WSVA 5HLFA 2BW2A 1QSYA 3B82A 5JUMA 1WHVA 1L3TA 3L95X 2VJUA 4RW7A 1WC3A 4ENOA 5KFTA 3T9NA 4Z37A 1BWEA 2FUG9 1URRA 2LQBA 2R8HA 1TKXB 4DV4F 5KT7A 3I0RB 4UT4A 3OFEA 3R27A 1S9FA 3OQ2A 3D9BA 1FKAF 1C1CB 4LBIA 2R42A 2AZ1A 2ZEJA 1LXJA 3GR0A 2ZHOA 2CNKB 2A2DA 1UVLA 4ES3A 2ZBIA 1QE1B 5HI7A 2APOA 1RHMB 1NB7A 4Q2LA 1O6XA 1VHIA 1URNA 3NY0A 1OSDA 1MU2A 1RWWB 2QT7A 3PW2A 4B9UA 4DPYA 5F3ZA 2MPUA 1U1LA 2P6TA 4UQTA 2HHSA 2L48A 1RWUA 4EZ9A 4DPTA 4X65F 1TKZA 3CCRS 1RT7A 1Z2ZA 1BWVA 1U4BA 1VQMS 4NLUA 2OGUA 2MXYA 2ZBQA 3NOGA 3AJDA 4J7CA 4N5SA 3M6XA 4LF2A 1SV5A 3BN4A 4RWWA 1HI1A 4OI0A 3PX0A 4ES2A 5J2PA 3ILOA 2ZVSA 3OL9A 1VRUA 2LQ9A 2COLA 5EX0A 4NA2A 3IR7B 3C6UA 2ZJPQ 1KP6A 1VK8A 2IMWP 2IC3A 3TZYA 2C3YA 5GADI 3OFHA 3KG1A 1LW2B 3QYYA 2HHPA 3EPGA 2MSTA 1NAQA 3E51A 3BJYA 1VGYA 5AT1B 5JXSA 4RU2A 3JSRA 3RG6A 5KFZA 2PE8A 4HHHA 4TYBA 2GCFA 5GAGI 2H4YB 4C3KA 4YB5A 4OZNA 2C2ZB 1CQNA 3CC4S 1K1QA 2CPDA 4F0KA 4O3RA 1C0TA 4P2FA 2FTRA 3HSGA 4KFBA 2DGQA 1LFWA 3MWBA 2WSCC 5DETA 4U95A 4M5IA 3PY8A 3MTKA 3I9ZA 1KOHA 3MAAB 4IFYA 4B17A 5HJXA 3T6JA 3C14A 3KHGA 1WEXA 4ZS6A 6FD1A 4B9NA 1S49A 2YPZA 3IC1A 2BOPA 2ZJRQ 1VBXA 1X0PA 2HKEA 1HNVB 2D41A 4JB8B 3FCHA 5I42A 2DY1A 1NDKA 1W2BR 3T1YF 4OZ5A 3H7HB 3DMJA 1YX2A 3CT9A 3KLGA 4CNZA 3NMRA 2AYMA 3M4XA 3CB4A 2ZM6J 1EP4A 2BOAA 1HPZB 2ASLA 3A8EA 4GVBA 4Y28C 4FDFA 3K2YA 1ITPA 2OD6A 4ERDA 1H0HB 2ZUGA 1S1XA 1H2TZ 2HMIA 3OHBA 1RBOB 3OUYB 3MR6A 3SCLE 1SJ1A 2VKZG 2M8HA 3UW1A 1D9FA 3NWGA 2X51A 1IBMF 2J6SA 1U6FA 2RD5C 2RH3A 1S1TB 2I9SA 3ZC4A 5LSRA 1ZAXA 1TZ0A 3GJRB 2EW9A 4ZVEA 2KVIA 3W1YC 1U1RA 1L3SA 3LP2A 2DGXA 2J5AA 1NJZA 1M1HA 4KGXB 1UFKA 3TP2A 5B09A 3I82A 5HP1A 5KFIA 1KN6A 3IS9A 1VQSA 3SV4A 5A8WB 3M1VA 3G6ES 3BKTA 1KTQA 4RO0A 1AXQA 2I5JB 2WSFC 2C3MA 7FDRA 4HHJA 2ILZA 2QMWA 1S4FA 4YQWA 4PUOA 1FWPA 4ZPWR 2IAJA 4BBYA 4LF9F 4EZ6A 1V3SA 1FDAA 4HH0A 3RYLA 1I1GA 2DHAA 5FIIA 1U45A 5J2QA 3CCMS 4WFBQ 4OHYA 3FBCA 5M2UA 3K59A 2WW4A 1IWAA 1TKTB 5D4PA 4I0WA 3V4IB 2W2NP 2GX8A 5E7OB 1HARA 3OTCA 2AYGA 4USMA 4ZK7M 3TAMA 5KT6A 4ECUA 3N5BA 2HVIA 1HNXF 2DBBA 1U1PA 2Z2YB 3IMQJ 2XNRA 1JXVA 4MK7A 3PKMA 4M5DB 2ZH7A 3IAM9 3A4TA 3CULA 2VONA 2OPQA 1VHFA 2OPPB 3G86A 1SVDA 4FS1A 4JYAF 4X62J 3FFIA 3J81U 1X0FA 3GFXA 2YQ1A 1P1LA 3AXMA 2I6WA 3TUJC 3U27A 4UTGA 1TQLA 4G1QA 1NCLA 3W2WA 5D4LA 5A8KA 5D78A 2I2YA 3D3BJ 5B0DA 3OTDA 3P3DA 4ZJQA 5U47A 2BV3A 2C2RA 1GMWA 1Y5NB 4K4SA 3FMWA 4URSA 3QAEA 4DQRA 4ANEA 2FYXA 2RUGA 4CO1A 3MTJA 1ZPWX 2VD3A 5HMYA 1RKIA 3LANA 4NXMF 4UZCA 4C7QA 1VLOA 3DOLB 2A2CA 2KYXA 1R3NA 3WDOA 1P8GA 4CM2A 4M8LA 1OMSA 1FTCA 2EBEA 1E6YB 5DRKA 2HBRB 3G2XA 3HFVA 3PHTA 2HGMA 1SKWA 2J8AA 4UQGA 3VF0B 1UCNA 3TI0A 1U0HB 5L1JA 1U8WA 2QA4G 3MAAA 3P5BP 2EFOA 3H8YA 1S9EB 4ZPCA 3T1HJ 2DCLA 2BBEA 1MWYA 1RWVB 5AE1A 4RU9A 4EBDA 2AEFA 2I8EA 3RAXA 2YKOA 2IMOA 1NKBA 3ENQA 3A1YG 1SC1B 3OT9A 3EZ5A 3EDRB 1RE1B 4GVLA 4P2MA 2ZH4A 4U8YA 3E8OA 2OPRB 2WBMA 1KRPA 5A8RB 2EFNA 4ED8A 4MIWA 4H4OA 4B9LA 3JTPA 2DRBA 4MKYA 1FKOB 2XMAA 3CF5Q 2D7SA 4RW9B 3VWSA 4B9TA 2ZZNA 3BSNA 3BPSP 3EVWA 1KVKA 3CCVS 3T5JA 3DOMB 4LF1A 3NGSA 3OUYA 1SKSA 2EEYA 4EO6A 3DRPA 1N6QB 3LA0A 3UD4P 3MMJA 2OTLS 1NU4A 5HANA 1KVJA 3UFCX 2DO4A 3K5NA 4OJ1A 1VQLS 4BC7A 3PZPA 2FJDB 2FDNA 5F0WA 2EKYA 4ZPVR 2NCKL 2R8GA 4OX7A 5KFSA 3JXOA 2KRBA 5IWAJ 1YWXA 1S5ZA 5KT3A 3OV7A 3BSOA 3UDCA 1SH0A 1VDHA 2UXBF 5HMZA 2H65B 1Y7PA 2AGPA 3LP1B 3SZ2A 1S1UB 1RTDB 5GMDA 4M5LA 4ICLB 1X31C 2E1PA 1S0NA 2RS2A 1S0VA 2LKZA 1UA0A 3NMAA 4JBCA 4CLUA 4RX6A 3EE3A 4CRJA 2DGVA 1KLMA 4DPXA 2UUWA 1YLXA 1H73A 4PYDA 4NCGB 4WJBA 2W9CA 3VQTA 1FO1A 1DAXA 1RTHB 3IM9A 3HT0A 1TKTA 1SKRA 3LO3A 4ID5A 3P96A 3DI6B 3BR8A 1FJGJ 4DV3F 1JLBB 2EI5A 4Q0BA 2LYVA 4J9KA 2ZZTA 2VICA 4E98A 1RISA 3L9ZA 3D68A 2LDYA 5HATA 2B51A 4ZPAA 2NYIA 1YBAA 1REVA 2MSSA 2K2PA 3VAFA 3G87A 4DV0J 2DR6A 5KG4A 3HHNB 4FBUA 2HNZB 2AZ3A 3HFZB 1RT1A 4DFMA 1JNZB 1KQFB 2CG8A 4ZVPB 1VC6A 1X4BA 4DL3A 3D2WA 4JV5J 3RRGA 2IM0A 2ACMA 5ETNA 1IM4A 5DM6Q 1U1NA 1DLOB 4R5PB 2C2DA 4FYWB 1GMUA 1PBAA 1R27B 2FJVA 3UN3A 4Y2CA 4QIFA 1YRUA 3QFWA 4ECSA 3HHKA 4BHQA 1F5CA 4IQMA 5I3QA 5HQMA 2W2PP 3Q2TC 2GQ2A 3SCKE 4UOCA 3KLHB 4J5OA 1TVRA 1T03B 3BS9A 2HIQA 4R8UB 4X84A 1JMTA 3VTIA 1VQPS 4LIRA 1BXNA 2E7WA 2CQIA 1XIQA 1YBTA 1C1BB 2HNDA 1FVQA 1RT3A 2KVQE 3PDNA 4LRBA 3H4BA 1L3VA 2XULA 5EDWA 1RWOB 4DV4J 2UVRA 4RW6A 3CJ4A 5F8IA 1WF1A 3FBFA 3EMTA 3IR5B 1FFSB 2HK3A 4WK1A 3PFEA 1N5VA 2ZWPA 2CPYA 3W9IA 3CCJS 4WP3A 3BGOP 4CO2A 4DQSA 4O4GA 1Z4UA 4OHVA 2YWKA 3V81A 4KIAA 1AA1B 2H5IB 1LWFB 3BB5A 4TU7A 3QRPA 3AOCA 5A0YB 1HR0F 3SI8A 4YR3A 4X65J 4HTIA 3J7AN 3CSKA 4C98A 2PDAA 2BANA 4QIWD 4L73A 4NLVA 4DUZF 5D0HA 3CD6S 4U96A 4IO1A 3PFOA 4O44B 1F3FA 1VK3A 1OYDA 1J5EF 1AZSA 2HRTA 1K1SA 4C8KA 2XSJB 4I6AA 4IOBA 2QL7B 4AE5A 3J7ZT 5B7WA 1EKSA 4RBVA 5K9FA 1NJIT 4X4QA 3KLEB 4QR1A 2YQ0A 3AD7C 4MMOA 2GVZB 4PAAA 3ZZ0A 3SDEA 3JAMU 2YWFA 4WF9Q 5HL7Q 2AYEA 4IOAQ 5IT0A 4X4TA 3V6DB 4J9LA 3ILIA 5E41A 2G2ZA 2FJEB 3NOCA 4RW4A 5EX3A 1U47A 1CS4A 2KHCA 2WONB 1PYSB 4HKQA 2QYCA 1P9QC 1JJ4A 1OJ4A 4GO5X 1MMLA 2MQMA 4WU2A 5D4NA 3N4WA 3PXGa 3MF5A 1GTEA 5CD4A 4ED5A 4HDHA 3GG1A 1LWEA 2WB4A 3KJNB 4I2QB 1FDBA 1PYTA 1KR4A 1HYSB 3PX4A 3NNAA 4OL8A 4JI0F 3IWLA 3JQKA 1FXRA 3B78A 2BX6A 2HLTA 1N33F 2RNEA 4QJVA 4U6PA 3NG8A 4DQPA 2MZRA 3T1YJ 1Y5LB 2VPXB 3OL7A 3DRSB 2KXNB 1U02A 4F0MA 2FPHX 3QSIA 3RU0A 3P6YC 2HWHA 3AAWB 4TQRA 2DK2A 2F3JA 3W62A 1EQ0A 2YNGB 3EGZA 3TO8A 2BQ3A 4CIOA 4U9RA 3AB4B 2ZWOA 4GKJF 2CA9A 4ETZA 4KBIA 1ZOTA 1IBMJ 4HI2A 1H2UX 5HK4A 1FESA 2HNYB 2GFFA 5DQIA 2VFSA 5KFLA 3TARA 4LRDA 4EI2A 3TUIC 3NKYA 3QZ7A 3VAHA 1T05B 2QLJB 3TX8A 4F3MA 1U0SA 2GMJA 2W24A 4NLYA 1OQ6A 4WU3A 3GV8B 5KG2A 3M8PB 1IKXA 5F8MA 2FD2A 4KT0C 2QLWA 1KWMA 1FF2A 3AD9C 2CJAA 4U8VA 4AYBD 4QBUA 3HHLB 1NK4A 1Q16B 4OYZA 4DR5F 4LF9J 4O0NA 1GXUA 1HWKA 1GNKA 4K4TA 2CNLB 5ETMA 2UZAA 3GJQB 3QPIA 2Z57B 1RT6B 1YJVA 4U7CA 3GYXB 1X5SA 1CJVB 3ZNUA 3BO4A 5KFCA 5D0EA 4E2FB 4A8SA 3LH2S 2XS2A 3GV7B 1HNXJ 1IQZA 2OELA 3O2IA 4P72A 4WP9A 4LSZB 1B3TA 4FF2A 1LWFA 1WC4A 3BKUA 4Q43A 4MAKA 3VALA 1L3UA 3EXCX 4J9VA 4JYAJ 5CXTA 4FZVA 3PYEA 2AHOB 3KTQA 3MPUB 5DS7A 2CUYA 1IQTA 2LQJA 4F4XA 4LFBF 4DFJA 5L1KA 3HT3A 1SC3B 4DL6A 2D3OR 3MM6B 3OSPA 2DHSA 2E9ZA 2CQDA 4C8ZA 2JLGA 3MEGA 2RKIB 2KL8A 3C16B 4GO7X 4I6WA 4G3IA 4C8YA 1GMVA 4C11B 2D3O1 1HNWF 2W7OA 1NHKL 4TXSA 5J1NA 2XMWA 3V4MA 5F8LA 2ZE2B 3T5HA 3AFGA 3I9V9 3MEKA 3QJLA 2CPHA 1T9TA 3NNHA 3PJXA 1LV5A 4NXMJ 2C2KB 4EGLA 4IYQA 2Q3PA 2QN6B 2E66A 2VG5B 2NZ4A 2MJUA 5FDLA 5E3AA 4NLDA 4ATNA 5KFUA 1DRZA 1R31A 3RW7A 4KGVB 4HACA 1JLAB 4QWAA 3LP0A 1NDPA 4PXEA 1S6PA 3DM2A 4I56A 1Q82T 3FRZA 2BW7A 1HQEB 1VQNS 3PX6A 4NA1A 1M5VC 4ZA1A 4AUKA 4QQBA 1GXLA 2OEMA 3PEHA 4ZVRB 1R8CA 3JS9A 1WORA 1PILA 1YRTA 2VODA 4ZVHA 5DDOC 1UKUA 4QYZK 4OQJA 2O1PA 1O8BA 3M6VA 4A8QA 4Q44A 1HWUA 4ZP6A 5C2CA 2JEGA 1DTQB 4OZ1A 3I5AA 1NJWA 3WX8A 2KN4A 5MAOA 2NPIA 1W25A 4XDCA 2MZTA 3LW5C 5IT9U 2QA1A 3T19A 4M94A 3I55S 2NUUG 3K5MA 3C15B 3CEDA 5ETOA 2FC8A 4DSFA 1LNQA 1UVIA 2PGCA 1U1OA 3BO2A 2Y1RI 4TLRA 2YY3A 2XYGB 2W1BA 2QC3A 2SXLA 1NH7A 2HK2A 3VGSA 3MM7A 2N7CA 1JKHB 3CJ8A 2HNYA 4FYYB 4DR2F 1SXLA 5D0RA 4B3OB 5CH7B 4PQUB 4PPZA 5D3GA 2BRLA 2FJAB 2GHPA 1HBMA 1HBUB 3RBXA 2ZD1B 2R7UA 2MKJA 4DJBA 1Q8LA 1TL7A 4WE1B 3D66A 2UXBJ 2F5GA 5J2NA 1S48A 1WG5A 4RW8A 3N0VA 2CQ1A 1OS5A 1TAQA 1RTJA 1RAGB 2CDRB 1KD1T 4WP8A 2RHQB 3CVKA 3L3CA 1JJ2R 4XO0A 1TKDA 1OY8A 5EGYA 3F56A 2E29A 1YJUA 2VBYA 4Q5VA 4UY85 1U8SA 5F9NA 3FVYA 2CQ3A 5LOQA 4NCBA 5CCLA 3DLEA 4LREA 2FLLA 2PSZA 3M32A 2RDIA 2HGLA 2X7IA 1CJVA 4I4BA 4A8OA 2GZOA 5KFJA 4DV3J 3POTA 1Q0NA 3ULHA 1VR6A 4EBEA 1LXNA 3SQGB 4LMZA 4LJMA 3EICA 3EPIA 4NPOA 1U25A 4KB7A 4U7UK 5DG8A 3SEOA 1YK9A 4P73A 1XQIA 3O6QA 4B3MF 2OD4A 1UVJA 1FDDA 1K0TA 2E9TA 4KH0B 3OBIA 1HBNB 2YNHA 3MPWA 3UE2A 3KJVA 2GO8A 1FFWB 4RUHA 2M0GB 3CCES 5KFEA 3O8WA 5AJ3F 2LECA 3UDLA 5IC4B 3DU6A 5AXKA 3SMZA 4ZCIA 3R2DJ 3EUNA 2RKIA 2ZHBA 4USKA 3M2VB 4DZDA 3IGVA 5A2QU 2KKHA 1ZBTA 4ZCMA 4O23A 2F9DA 1PGZA 4DL2A 2CPIA 4USVA 3VZHA 4P2SA 2ZBPA 2XBPA 1VMBA 1FJ7A 4NI2A 1KEKA 1YJ7A 3RBZA 2IRXA 2J0XA 3CDEA 3ELHA 2XNQA 3FZBA 1TFYA 3VVUA 4CDIA 4CLFA 2HWTA 2VG7B 3GU0A 1VBZA 1WHYA 2CRLA 2AJFE 3D6HB 2J0SD 4DEZA 3B4DA 1HQEA 3I5BA 2J7WA 2NUHA 5LMNF 1GT8A 1A0OB 4WXWA 3TUPA 4F4AA 3PYFA 1F5BA 5DG7A 1Q4RA 1S1WB 3G6XA 4KHPF 4LF5F 2F4VF 2N3LA 4USTA 4KYZA 2JC0A 4UOHA 1JLEA 4ZCKA 5B0BA 1IKYB 4DF4A 4EWTA 4LVOP 3M9NB 3GLJA 4TY8B 3M9MB 1KQKA 4DL7A 1HR0J 4Y65A 3DGVA 5GVQA 1CBKA 4NLGA 1JJCB 3JAMY 3M8YA 1SJ3P 4ZLPA 3TUZC 2FVPA 4OZLA 1HD0A 4EBCA 4OX9F 4DSKA 4WPAA 3W8PA 3MM8B 2RILA 3GCWP 1LQ9A 3GE9A 3UCGA 4DUZJ 2M7SA 2AYBA 4PG5A 1E6VA 4PWWA 5DGAA 1G4CA 1VQ8S 2R8JA 1S4EA 2IRUA 4EMDA 2MZQA 5CD4H 2Q79A 4NLXA 4ZMMA 2FY1A 2IM2A 4Q8EA 4WKRA 2OSQA 3TVYA 4TU8A 2AU0A 2GVDB 1X8DA 3QMQA 4OI6A 3R1LA 2Y0BB 4UOFA 4L3KA 4DX6A 1GAOA 1KS2A 1WG1A 5LT5A 1KHVA 2OFGX 2DKOB 5DZ7A 3MGJA 1A7GE 2X1AA 2WRMA 1ULRA 2ZH8A 1BQMB 3QO9B 1T95A 3PCOB 1FRXA 2R7RA 4QZVB 4N56A 4ELVA 2PMZD 2ZITA 5C42B 3R2CJ 5ETLA 3LGNA 1RAFB 5DGBA 2HQFA 2LQ5A 5EWGA 3PKYA 2CPFA 4IG0A 2F8MA 1X5TA 4JI0J 4CLZA 5DG9A 2XLJA 5C24B 4MH8A 3QQCD 4HEA9 4Y00A 1N33J 1LOUA 3M05A 3IRXB 1FA0A 1HHTP 4AL6A 4G6VB 3L7PA 5L38A 1FRIA 2VL1A 1G2EA 4C3MA 5L39A 3KK3A 3D7SB 2O67A 3QZ8A 2DEJA 3SQGA 4DG1B 3RAQA 3G82A 4O3SA 1UMJA 2IIHA 3A3OB 4MK8A 2K1RA 2GJFA 1VOMA 4IRCA 2HAFA 4NZ7A 1LWCB 2AJ0A 2Q1LA 3B4MA 4PWDA 3ZZZA 2HS4A 4CYUA 2YWWA 4GKJJ 5CYJA 4DXLA 1KONA 2HHWA 2E7XA 2F65A 4J9RA 1KTVA 3LGMA 2V8VA 3ETOA 3BREA 4X4NA 2PI5A 1HI8A 3HJVA 4K8RA 4OV1A 2N4CA 1SUQB 1DHMA 4U7UD 2VG6A 4C48A 2ERRA 5F8GA 2B43A 1T0TV 1EZZB 2FVCA 5KG7A 3SFUA 3TANA 2VH7A 2BJ7A 1N34F 1V5IB 3BN7A 4CP5A 4CCHA 2XMMA 3KUHA 3I5CA 3QJJA 5KFKA 2RDDA 3CDUA 2LQ8A 5DDRC 1BQNA 4PG8A 4A46A 2KO1A 3ZXWA 1U49A 4AD6A 1SC4B 3JSBA 3R5GA 4Z7YA 1MG7A 3HHLC 6AT1B 1UL3A 3JTNA 5CYQB 1MWZA 4QIVA 1XWLA 4M1KA 4H4KA 2HHXA 2J9CA 1JLGB 4QR2A 4C0HA 2AEJA 3DOKB 4MYUA 2UUCF 3OR2B 3RR7A 2YNIA 1X4HA 4ED4A 2F8EX 2W9AA 2HFUA 3PW4A 3HD2A 2L9NA 2OEJA 4WCEQ 4RNOA 3IAS9 5LSLA 3BDEA 1MNEA 3H2VE 3T5LA 2VQEF 3VZIA 1S0OA 4FXDA 2JH3A 1RT5A 1TP7A 1T8EA 2ZDOA 2QSWA 2KT2A 3MECB 3RGIA 2YBVA 4LBHA 4LFBJ 3O44A 2X3GA 1IKWB 1AUSL 5JVHQ 3KUEA 4DV1F 4MFBA 3QGIA 1TFWA 2HBQB 3HLUA 3EDQB 4DSIA 2MZSA 5IFMA 2YKMA 4O3PA 4B9SA 4I7FB 1HNWJ 1XTZA 3C66A 2FVSA 2AIRB 2LXIA 1HQUB 4I6YA 1VI7A 2RQ4A 2G13A 1NDLA 3ET6B 2VPZB 4D3HA 3CD0A 2L08A 3LWMA 1GX6A 2DPJA 4L6V3 2CQGA 3AQPA 1HWIA 1RXOB 5IM0B 3LGHA 4OLOA 1QUVA 4OX6A 3D4JA 2L3MA 2H9ZA 4OI3A 2KRRA 4KV8B 4H4MA 1B0PA 4KTQA 1RT4B 2V2QA 1C2PA 2XZWA 3MPVA 3KHRA 1J27A 1YZ6A 4HT7A 1YHQS 1CVJA 1O5JA 4J9QA 1R43A 1FKPB 5L9XA 3A3PB 3CD7A 2C3UA 2ZH2A 4ZHRB 4X66F 3PR5B 2KG0A 5ADZA 4BLGA 1CULB 3CO0P 2XQCA 2PN6A 1RAAB 2MKCA 2EBGA 1C4AA 2UUAF 2NS1B 2XMJA 3TVZA 5FLXY 3FSYA 3KK1B 2AGOA 2QJ3A 3ZZUA 1NPRA 3KHLA 4CM0A 3B6BA 1KQSR 1HW8A 2OEKA 2E5JA 4A8XA 1NJYA 1HL6A 4KHRA 3M30A 3HVTB 5EWFA 3NL0A 1C0UA 3TNVA 3NNCA 3MR2A 3GPAA 1LWCA 4O3QA 2BDPA 1B70B 4IH6A 3BZQA 3MOZA 3FEZA 4AL5A 5ITHA 1NSAA 1S7IA 2MZ1A 1DQ8A 4C8OA 5GAHU 3AHPA 2DNKA 2CZ9A 4KHMA 3PVXA 1BD6A 5K14A 3KLIA 4DR2J 2DNNA 2QV6A 1OYEA 1JIHA 5J1PA 1N32F 1H6KX 2QE5A 3O1LA 1RKJA 3KG0A 4ZPBA 2HS3A 1VLYA 3MM5B 1T3OA 4PXDA 2H1YA 5CA5A 5J2MB 2FHOB 1BUXA 1NSQA 3M8RA 2V4JB 2HEKA 3CCWA 1RTIA 6FDRA 5F0UA 4ZIVA 3MURP 2HQGA 1N5YA 2VDIA 2KT5A 2KZMA 4J9MA 1TV6B 4X2BA 5T7LA 3R6LB 2HLUA 2QLXA 5E5NA 1RJJA 5I3UA 2BE9B 1S9GB 5THWA 5G4DA 3D54A 1RYSA 1FNOA 1B0VA 2FJBB 2IYIA 3JYTB 1S12A 1PYOB 2NZCA 4KO0B 1QSSA 2HURA 2V9WA 3CJTA 2B7BB 1VIOA 3HMJG 3I0SB 4USJC 3KWMA 1A9NB 3RB3A 3PJ9A 3W64A 2HQCA 5LSOA 4PZVA 2NXCA 4ER8A 2YKNB 3MCOA 2G9OA 2WVFA 1Q1KA 3J7A1 5A2QY 3AOAA 3G71S 4ZN3A 2W01A 2QZ8A 3U7JA 2DXEA 4F4WA 3KLVA 5KG6A 4B3MJ 5L9NA 1UJ4A 1Y3JA 4OYOA 4OYBA 2P5VA 1RT2B 1QDUB 4RNFA 3MR3A 2VOPA 2CVIA 2GC8A 1D9AA 4YR0A 1W7WA 1V5VA 3P45B 5CAAA 5AJ3J 3S01A 4DV6F 1S1VB 2VBWA 4MIAA 3CPWR 2VHGA 2AKWB 3W63A 3M2RB 3MR7A 3UN2A 1JLCB 1DURA 2BJEA 1F5AA 3HPOA 2GS8A 4TU9A 5L8RC 2F8HA 2J76E 2DIUA 2XCPA 2I0XA 4ECWA 3QT5A 4Z7CA 5HVGA 1S6QA 1CJUA 4RPFA 3FZ2A 1U24A 5IV3A 4NRUA 4K4UA 2YNFB 2KT3A 4LSLB 2LEPA 1VRQC 3K0JA 3T6BA 3HI9A 3AXKA 2R7XA 5KFHA 4FN5A 2ALYB 2W8LA 3WX4A 2J6UA 1RAHB 4B9VA 2EXUA 3SFGA 2CJQA 4OV6A 2C28A 5GAGU 3D67A 2ATCB 2M3DA 5LMNJ 4XDDA 1RBLA 1ZH5A 3D5MA 4KHPJ 4LF5J 1FFGB 1LW0B 1JNRB 2AV5A 2AJ2A 3EGVA 3UVJB 3DGPA 3H40A 2ADCA 3GTYX 4NXNF 5KFOA 3CGIA 2HS0A 3EX7B 2W2OP 2OMOA 5AXMA 3MI7X 4OJGA 3L7UA 4F50A 4DDFA 4C4WA 1UEKA 1I6JA 2XMUA 2EG2A 1YJNS 3M8ZA 2OKQA 1MROA 1WDDA 2BJ9A 2RVJA 3C6TA 4TLQA 1LWXA 3C46A 3OR1B 2VQFF 1H2VZ 1JLFA 1F0XA 4CLKA 1NKCA 4F4KA 5M2PA 1VQ4S 3DLHA 1H38A 4FXVA 3MMBB 4JI4F 2G2OA 2CVEA 2NREA 5G0RB 4WXOA 4URQU 1IJFB 4QU6A 3FC9A 1KHWA 4FNHA 3W3SA 3BH6B 4A8WA 2Z0GA 1EKRA 1HNIA 1SH2A 4QW9A 2E1AA 4OIXA 2A6MA 3RZAA 3DYAB 2PI4A 1QTMA 3Q2SC 1R8HA 3BBCA 1G6BA 3LQVA 4I69A 3BH7B 1D9DA 2ZDPA 3CIMA 2K7KA 3VCDA 2DXFA 5HBMA 2B4UA 3OL8A 1H98A 3FKBA 3MMCA 4ANDA 2MGZA 3MUTP 1B7YB 2V4JA 2YWGA 1MW7A 3ZZPA 3Q23A 4NA3A 3EGNA 5CCMA 1WOPA 1DTTA 3ZTOA 2QLBB 2BE2A 1ZM2A 1L3KA 1ELOA 1Y4ZB 2DEIA 3PR4A 3DHWC 2A18A 5CYMB 4EK2A 2BACA 3UN5A 1XC9A 2BM0A 3TA2A 4ILRA 3M2UB 1NHUA 4KO0A 1UAWA 2Y0SD 1WNEA 2BKNA 2JSXA 1CJKA 1F9HA 4RUCA 1M5HA 4OI1A 5J1EA 1Y3KA 3JSMB 3FK4A 3N6MA 5GAEU 3A12A 2LDIA 3MM9B 5JJBA 1WEYA 4F3QA 4C8MA 3ZZRA 3KHHA 2ROPA 4OYMA 3KJFB 3HM9A 1NZAA 3R1HA 2DHGA 4DX8H 5K8MA 2OSRA 3LF0A 2VFUA 1RT2A 3NWRA 5CZVA 2DGTA 3ENVA 4ZJOA 1YG0A 2BABA 2U1AA 3IG1A 1KBRA 4CO4A 2XS7A 4NZ0A 2CZVC 1WC0A 4Q2MA 2RB7A 4M95A 4DR7F 4X4SA 3MEDA 3OD2A 2HRYA 4Q45A 2D3UA 2XYHB 1BMQB 4TQSA 4NYOA 2IRYA 3QLHB 5C5JA 3CMAS 1F9EB 4E0DA 1ZETA 1RADB 3W5XA 2CPXA 2CXEA 2MY8A 1N34J 5ETQA 1R0AA 4RWXA 3NBPB 5C25B 3GJTB 5KTQA 2ZH1A 4LFAF 2O3DA 1OY9A 1TK0A 2ZJQQ 4IFVA 1N0VC 2MKKA 3K7RA 1DARA 1FD8A 2CJBA 3DLKB 4P74A 5GMKa 5HROA 4BWJA 1RHQB 3KLFB 4HTJA 2XLKA 2E9RX 2VUGA 5DLFA 4J9UE 1IBLF 1KLNA 4ED2A 3DKDA 4CTAB 3Q0AA 2W9BA 1WACA 1FK9B 3OTEA 3UVJA 2UUCJ 3HP6A 8RUCA 3MDFA 3FMBA 2PEBA 4JI2F 2R7OA 2H5EA 4DX5A 2YQ3A 3GIRA 2XEXA 3EXYA 2CNNB 5KFFA 2LU1A 2X1GA 1SL2A 1XMQF 3LOUA 1ZPVA 3BGRB 4IG3A 3R9LA 3LALA 5BYSA 3MMAA 3R6GB 1FXDA 3U02A 4DV1J 1FD2A 2JJ4D 2Z30B 2HQDA 1T9UA 4QR0A 4DCPB 4IO9Q 4A8KA 2AJ4A 2ZUAA 3MHYA 1SL1A 4J9SA 1VRTB 1VJWA 4A8MP 2AEMA 5H1SV 2RU9A 2ZH6A 4O3OA 3KMSA 4NLWA 5ETPA 1T9VA 2E1CA 4UOGA 2ZH3A 4A48A 1AB8A 3QRRA 3DRXA 1IKVB 3FEYB 3GWCA 4QCLA 4DFPA 1XN9A 4LF6F 3I87A 4F2SA 2DT9A 3VVTA 3R5CA 3BSCA 1KDNA 3GIMA 4AQYF 1Q78A 2ATLA 2V0NA 4WWSA 1JX4A 4B02A 3HHDA 2RQKA 3W5YA 2QO3A 5HN0A 3EGWB 3QIPB 3M8QB 1IN0A 4LFCF 3RRKA 1TKXA 2FB0A 2FGCA 3SCJE 3I0RA 4PKDB 4Q8FA 5GAEI 4MTPA 2NXUA 1C1CA 3HFKA 4X66J 2MMYA 3OXFA 2JLFA 3M7VA 1RK8A 5EHHA 3IM8A 2N4DA 2WOMB 1UFLA 1QE1A 2UUAJ 4ZOSA 4QU7A 1FE0A 3OSNA 2EFGA 2B4VA 2VZ9A 1QTNB 2QL5B 3CCTA 4FNIA 1P27B 1JLQB 3MM9A 2XG8A 1RA6A 4DCJB 2V5HG 3OVSA 1YZ7A 5KFRA 3GONA 3SSSA 2B5JB 4ED1A 1MWQA 4FYDA 3IGNA 2CKWA 3R5BA 2B6AB 2CAJA 3BF4A 4QWCA 4BDPA 4P2XA 4ZVTB 2J7KA 4LBPA 4ILLA 2YPYA 4WIIA 4X4PA 2LP4A 1H72C 2KB2A 1KVIA 1M5OC 2HHHF 2FJXA 3DN9A 2PT0A 2AX1A 4QWDA 2KJWA 1Q5YA 1X7VA 2B9YA 2VOOA 4PR6A 2ZOFA 3R7BB 3UDEA 4DL0C 1LW2A 3IN5A 5BR8F 2QX0A 1N32J 2GW8A 5HVFA 2D3ZA 1SJ4P 2HFOA 1YITS 2V94A 2VC1A 2OPSB 4C3LA 2VJVA 2KDOA 3MEEB 3QLHA 1ICEB 3HDSA 1RU1A 3KK2B 3W2VB 1GQEA 2JEJA 2Q6CA 2BJ1A 4ZVSB 2WTFA 1HMVB 2V8PA 2HVHA 2OIHA 4XK8C 1KFDA 2C2NA 1TL1B 1UPPA 2CYYA 2MHEA 4RNHA 1ZZFA 3T1AA 5T41A 1K8AT 1WJ9A 5EWEA 1EQMA 5K8PA 3G8TA 1V6HA 4KH1B 4C0OC 1NK0A 3HVRA 3TQ1A 1D8ZA 1SI9A 2GAGC 1FE4A 4MYTA 4KSEB 2OAUA 2ABYA 4CLSA 4NMLA 4OI4A 3KOAA 4M5HA 3THTA 4A47A 3CTRA 3N6NA 4XIUA 3W66A 4ZKAA 2BJDA 2HIYA 1Q8IA 1HNVA 1HBOB 3AQOA 3RJMB 3CJSA 3OTBA 5D0GA 3LTOA 3TZZA 2QG9B 1D0EA 1CJTB 3W8GA 5K8OA 3DDNA 7FD1A 3FCWA 2H5JB 1HPZA 2W4PA 3TJ8A 2WW8A 4NE9C 1FRJA 1PJ6A 3NGKA 3S1TA 1ZM4A 2HQ3A 3PRDA 1RDRA 4EFAC 3K17A 2Z58B 4DV6J 3P49B 1SBRA 3DLJA 1UVMA 4MJKA 4LF4F 3BDPA 3PIOQ 1UWBB 4FPIA 1GFWB 3D0GE 2KG1A 4JI6F 1S1TA 5KFDA 9ATCB 4DR3F 2ZOGA 4K59A 1NZ8A 3WBZA 3IBWA 4W92B 3IBFB 1DY3A 3VR1A 2FLNA 4LF8F 1BQXA 2D1CA 4AXIA 4DSJA 3TAPA 2IBKA 3H5UA 1LK7A 2KXFA 5A8WA 4MIBA 4LUBA 1N4LA 2N3OA 4C2MA 2FVQA 2HQIA 2I5JA 2C1EB 4I2PB 3MUVP 4RKUC 4D3GA 2OUGA 3TVKA 1F9FA 1EIYB 2J0QD 3FDSA 3ITHB 2DB1A 1X9MA 5HLFB 4RNNA 1GK8A 3ISNC 4RW7B 2EVZA 3K89A 2KJVA 5D4OA 2R7WA 3WIVA 2RDJA 4OHWA 3OJSA 2B8QA 2B7CB 1ZTWA 4NXNJ 4UZBA 2XMTA 4Y2IA 4HH1A 1NJXA 2WOMA 3TQEA 3HSZA 5C7PA 3V4IA 5B08A 4QPXA 2LA6A 2AMCB 4YUDA 1RAIB 5F8JA 3PO4A 3BGUA 3ILLA 4RNMA 4M5DA 2WHOA 1UWAA 1T7PA 2NQPA 1X4EA 3QFHA 2L9DA 3T1HF 2OPPA 1ACMB 1QD1A 4P10A 2CQCA 1MU2B 3UCUP 3EYZA 1B99A 1GTHA 3T5KA 2B5JA 2VFTA 4ZP9A 4DS5A 5RUBA 4YB1P 1H7WA 3TEHB 4JI4J 1Q79A 2NSCA 1RLCL 2R3VA 1TKZB 1RT7B 3SQOP 4MKBA 2IM3A 3JSYA 2IBOA 2IM1A 2HG4A 2ZKTA 2O66A 3MCMA 4N77A 4Y2AA 4LR9A 1SV5B 1WI8A 1KKHA 2MLYA 4X4VA 1R8BA 4USIA 2YX7A 5J2PB 4YHHF 3VQSA 1VRUB 2OPSA 3AT1B 3PV8A 1VS3A 3DOLA 2Y8WA 1PJ7A 5EN1A 3C6UB 2CWXA 2IC3B 2PEHA 1TK8A 3W2VA 3HCXA 2EFQA 1RUSA 1E6YA 4OZ3A 3VAKA 2UVUA 3CCLS 2JC1A 2WZ1A 2XY7A 1FRKA 3I4HX 3FRYA 5KT4A 3UO0A 4DBQA 3WHIA 1U0HA 3HHLD 2W7AA 5MLCV 1D09B 2XGPA 3W61A 1FNMA 2AQ4A 3ONQA 1S9EA 1TELA 2M4MA 3ETMA 1C0TB 1OPIA 5DM7Q 5FD1A 1ZS6A 4KFBB 5IOLA 5E33A 3IFEA 1APSA 1FWLA 1U2RA 4ED7A 2QMXA 3PHEA 1TL3B 3IR6B 1F6TA 1IBCB 4IFYB 5DQGA 1RACB 4AT1B 1HBOA 4F04B 3C14B 3CJRA 1Y11A 3DDIA 5D8HB 4TYAA 3GP9A 3GZ7A 2OPRA 3DRRB 5A8RA 5A6PA 1VBKA 1VFJA 2FC9A 3OHAA 1S59A 1M0SA 3NLCA 2XY6A 1LK5A 1EETB 1FKOA 3ICLA 3BKFA 5I42B 2HW3A 2XWXA 1NO8A 3K57A 1TUGB 3Q8RB 2W7PA 4CQ1A 4RW9A 4UUWA 2PMHA 3DMJB 3G4SS 2FZGB 3KLGB 3DOMA 1PC4A 1IR2A 3OVBA 1RWPB 1N6QA 4IUFA 1EP4B 2GIRA 4MT1A 4DR7J 1I51B 4GVBB 3OFGA 4ZIWA 1S1XB 3H5YA 2HMIB 3CDBA 2A6OA 3TJ9A 4P6QA 2X1FA 1L5UA 2C3OA 2MB0B 2CADA 2R2UA 4F67A 3M8SA 3RRHA 5L1LA 4LFAJ 1Y0HA 2P9GA 1FNXH 3LP1A 2ZFHA 2HWIA 1NLKL 2QEXS 1M5SA 2R8IA 1S1UA 1RTDA 3LP2B 4IDKB 3L4BC 4ICLA 4OFZA 4KJIA 4G65A 4J9OA 4O4RA 3QSYB 4YMEA 3KMQA 1VYAA 1PG5B 1NK9A 4JI7F 3CCQS 3CE8A 1NKEA 5HMWA 3K5LA 3IS9B 1JWWA 1IBLJ 3ITHA 4OMFG 2KFYA 3M1VB 1IJEB 5ETTA 4DN0A 1NK6A 1RI7A 3SSRA 3BYRA 1TMJA 2XMKA 3DRYA 1KQGB 1T9WA 4NCGA 2VFRA 5KG0A 4PUOB 2HZVA 4JI2J 2R9LA 4K4ZA 1RTHA 3HKZD 1X60A 2IAJB 3VAIA 1VC5A 3DI6A 1JLBA 2DRDA 3PNIA 2X3DA 3N79A 1RYRA 5J2QB 3FGVA 1XMQJ 5ETVA 2C2MB 2XI3A 2E5GA 1H7XA 2YX4A 3GYNA 2W4CA 4OYXA 2BMBA 2B4PA 3D0IE 1WI6A 4ZITA 4CNYA 5L1IA 2UV8G 2A3JA 2HNZA 3T41A 3EJMA 3PW0A 3TAMB 2EC2A 4LT6A 4JI8F 4P7VA 1FT8A 1UZDA 2ZC4A 4EYHB 2OFHX 2EK1A 3CCZA 1PBUA 2DR5A 2OPQB 3C2PA 1RABB 1DLOA 4R5PA 1VCTA 4NX9A 3Q8VA 4RL1A 1D8YA 2M70A 4CZCA 3FFIB 1PIEA 1WHXA 2KH9A 4CH1A 4QW8A 2AP6A 2CDQA 4G1QB 4LF6J 3W2WB 5A8KB 2G1HA 1IR0A 1F1BB 2UXCF 4LQ3A 3PRVA 4F26A 4WFXA 4URGA 4HR2A 2JRSA 4ELTA 3KLHA 4AQYJ 1GH8A 3MD3A 1T03A 2VBXA 2DY9A 5IZHA 2F40A 1AFJA 4R8UA 4YB7A 2GAHC 3AH6A 3GQCA 3H4DA 1MMDA 4K2JA 1C1BA 4JI5F 1NPPA 1OWXA 1NEEA 3B8HA 2MY7A 1MSWD 2J9DE 4LFCJ 1VQ9S 4ZVGA 2FHKA 2RF2B 3HX9A 3MFHA 5HQ8A 4A8FA 1RP5A 3J81Y 1OPZA 4FF3A 3UNGC 3DNCA 4OYAA 4OYPA 1XBWA 4DSLA 3SBMA 3OPKA 4ECVA 4EEYA 2AWZA 2H4WB 2A0FB 3VGUA 5M2RA 3PW7A 1TL3A 4KGMA 4OYWA 5K5MA 4DPUA 3HZGA 5A0YA 1U26A 2LA4A 1S77D 2H54B 1N0UA 1OY6A 1ZTTA 3DRRA 4JUZA 1M5PC 1T02A 5B0AA 2ASJA 2F7VA 2IVFB 1EETA 3Q83A 1IR1A 2LMIA 2JVRA 4O44A 2Z2LA 1S57A 4R25A 3J7YI 2R2SA 2HHHJ 2XSJA 2MQOA 1TR0A 2DD8S 3W7BA 4TNOA 3PRBA 2D9OA 4H4OB 3J81j 1UW9A 5KFMA 3KLEA 3CMES 3UD3P 3H5XA 2MDAA 5KFYA 2QL9B 2GVZA 2VA3A 5BR8J 2D74B 1NRKA 2FIUA 4K0KF 2BQUA 1ROFA 3V6DA 2CG4A 4DLEA 4UY8T 3MZIA 3DRPB 2L41A 1QSLA 2MJNA 2WONA 2X1BA 4LSNB 4Z2XA 2NLWA 1GXTA 1HNZF 3A13A 4O0IA 1UPMB 3WC2A 2LFVA 3ILJA 3KG4A 5DDPC 2MLXA 2XZDB 1YKWA 4PG6A 4IDKA 1D1UA 2QYGA 3Q22A 1WTFA 4AFFA 4C8LA 1XNRF 5KFBA 2IHR1 4I2QA 1S99A 4DV5F 1UETA 1HYSA 3KUGA 3JTOA 3KJQB 1ZZNA 3N28A 2V4QA 1PO6A 1TMMA 1R89A 4C8NA 3W5ZA 3S8SA 2KU7A 2N82B 3HSDA 4F3OA 5AXNA 1KLMB 1T3NA 1KSPA 3DRSA 2F63A 3TX0A 5EUHA 4DWIA 2DNGA 2W9CB 2ZNZA 3DLBA 5E3CA 1DQ9A 3DCAA 2GGPB 4B3RF 3S7RA 4RBUA 1SPBP 2Y1LB 2YNGA 5B0GA 4DV7F 3NEKA 4ID5B 1QAIA 3FSIA 4Q0BB 2QGFB 2XB2D 3HHEA 1UEUA 2UXDF 4N7TA 5BJRA 3PTWA 1NUEA 1SIZA 7AT1B 2BJ8A 2CWKA 4LF4J 1REVB 2RHSB 3H2LA 5HVHA 4IR9A 1CLFA 5E0OA 2J9EA 4JI6J 3UCZP 5AE3A 4ZLLA 2RE1A 4DR3J 1V3ZA 1N5TA 5JVGQ 1KFSA 1YBUA 3BBBA 1RT1B 3FBBA 4WFYA 5KFAA 4X4RA 1IVZA 4F4ZA 2LEAA 4F8RA 1TK5A 4F4YA 1HHSA 1T05A 4LF8J 2MKIA 3RUBL 5F3TA 3D6TB 3SIPB 4LVNP 5KOWA 3LUYA 2VC0A 2ACYA 1Q7YT 3JB9k 2KFNA 3ZTSA 3M8PA 1H74A 1RZMA 3R5JB 2XTJP 2R7VA 4JV1A 1BHNA 2EFPA 3CMQA 2E5HA 3H90A 3HHLA 4LF7F 2EPIA 3GSDA 2FY8A 1SB6A 1TVRB 2RF2A 2R2RA 4XTTA 3D6FB 3D1OA 4MK9A 5DZ6A 1RWMB 3LPYA 3CCUS 5IQ6A 2B9XA 1RT6A 4YOEA 4DS4A 2HNDB 4NLOA 1RT3B 1XMOF 2RJZA 4FVCA 1JXLA 4ILMA 4RW6B 2E5LF 2XMVA 3GILA 1VQ5S 3PYGA 4F36A 5IS2A 4HL9A 2BVZA 2DNQA 2XHCA 5LXRA 2YH0A 4GC6A 5FJ4A 1AYEA 2V4RA 3CJ3A 3FSXA 2DNHA 3K5OA 4QYRA 4F7VA 4ECRA 1U1KA 1NBEB 3JQJA 2AT1B 4K5SA 4YEAA 3W65A 4O4GB 1VIXA 3V81B 5BYRA 4E8UA 3HKWA 1W26A 2W25A 2Z56B 2IVMA 2B9EA 2GHWA 3CC2S 2P9CA 3UR0A 4C0BA 5B0EA 3PG9A 3MM6A 4OJHA 3I31A 1YRXA 3C16A 3PO5A 9RUBA 1VQKS 2HHQA 3QT7A 1Q95G 4DR1F 4C11A 2BANB 1VJQA 2ZE2A 3UR3C 1Q86T 2BEFA 1SQEA 1HLWA 1K9MT 2BR0A 2CJXB 3ZTRA 1CPZA 3NS5A 3G96A 2J8SA 4YHHJ 2IDEA 1AZSB 1TUWA 1DJ0A 3OLBA 1XR7A 5A76A 2R7QA 2VG5A 4YDXA 1SQGA 3QT8A 4M5KA 4PCQA 3C8YA 4HVZA 3DU5A 2P8IA 4DHVA 3AB2B 4N8OA 2JOQA 2RMLA 2ROGA 5KG5A 1AFIA 1B4SA 1SJFA 3IP0A 1Y10A 4LSNA 1WWHA 4ECTA 1JLAA 3PACA 3SDEB 3QAUA 1U09A 1NSKL 3V2UC 1RAJA 2CPZA 1MN7A 3NXZA 1NK7A 2PIIA 2QFIA 1M5KC 4RW4B 5GMEA 4B08A 1CS4B 4NWBA 1O0PA 2P6SA 2HRUA 2ZNYA 3N9UC 4DLGA 2O5DA 1UJ6A 1M1GA 1FERA 4KC5A 1EJ7L 3T3FA 5F8HA 2XS5A 4P71A 1LWEB 1DTQA 4GC7A 3VAGA 2POKA 4L3NA 2UP1A 1S7HA 4YP3A 4FXWA 1OSCA 4JV0A 3Q24A 1NK8A 2IPOB 2CJKA 3MAQA 1KC8T 1NB2A 2CQ2A 3QBCA 3UDVA 5DQHA 5JMNA 2Y1JA 3C15A 2GGPA 1UA1A 1J5EJ 1F60B 2UVVA 2V9KA 3MOJB 5A6WA 2XWYA 2DNYA 4PG7A 4LRCA 3J80U 2CJ9A 5E3QA 5I4MA 4OJ3A 4RBTA 2J6TA 2J7UA 1S97A 4QPTA 1LEOA 2R8KA 1JKHA 3CJ5A 3ENAA 5HJYA 4CLWA 2UU9F 4B3OA 4ZVFA 4YB6A 4PQUA 3QIDA 2FLOA 2GIFA 1U1QA 2UV8A 3V6JA 3UPFA 2JFDA 2R7SA 1HBUA 3QRQA 2ZD1A 1AROP 3DLLQ 4WE1A 2K06A 2MLZA 1SC6A 1Y5IB 3CC7S 3CUNA 1B0TA 2QIFA 2XHWA 3BM7A 4R0JA 2MQQA 1IXKA 3GFYA 3AODA 4CT9A 4USHA 1WOOA 2LXFA 1FHTA 4JI7J 2B8PA 2FHJD 3QGHA 1XK8A 3D3CJ 4K4YA 1XMBA 3KKFA 1S10A 1VQYA 3DXBA 1IKXB 3BO3A 2V2VA 4DR6F 2WVCA 1X9SA 3M6UA 3A8JA 3M6WA 3B54A 8AT1B 3M8WA 3NRBA 5IC6B 3ZZOA 3GV5B 5KFWA 1R8AA 5KFGA 2I38A 1SQFA 2VV5A 2ILYA 1WC5A 1LFPA 4NASA 2V50A 2RRAA 2UUBF 2ZH9A 1SJQA 1OIAA 2HBYB 2XY5A 2VF3A 3TZWA 2KHDA 5SZTA 2EWHA 1FRLA 3NGTA 2GO9A 1WC6A 4L72B 3D0HE 2EKNA 5HQLA 1TL4A 4NZ6A 1MMNA 3BPDA 3RB0A 1HBNA 4JI8J 2H48B 4J9PA 4ED0A 4HT5A 1YTYA 4CI0B 2XC9A 4DF8A 2HVEA 3UD5A 1TU0B 2QLFB 1QAXA 4JV2A 1QY7A 4NLTA 5LMUF 3K5PA 3M2VA 3QATA 2F4FA 2HVDA 4X64F 4PXCA 3TA1A 1Q8KA 2UXCJ 4Y2MA 3BV8A 4NLPA 1JB0C 3MEGB 1WG4A 1AT1B 4TN2A 2XCAA 3IRWP 5KAKA 3NGDA 1XJWB 2ZBCA 3QGGA 2Z4PA 2E1RA 3OFFA 4PG4A 2OJ3A 4JI5J 3D28A 3RW6A 4P75A 2VG7A 3G8SA 3H25A 3GMGA 4DR5J 2DNZA 2YTCA 3P5TL 3ZNJ1 3Q8PB 5HSPA 4DSEA 1XR5A 4B3TF 5FDLB 4UF4A 1XERA 4O3NA 4ZP7A 3WC0A 2JEIA 4ECQA 1S1WA 4HACB 3WIUA 2ZKUA 3KDNA 3NCPA 3LP0B 4B3SF 1N8RT 4A8YA 1S6PB 3DM2B 2IJNA 3BSAA 2JNJA 2DYAA 1IKYA 1QLNA 3OXLA 5B0CA 2QMUB 2W8KA 3V6KA 2DXDA 4TY8A 1VQ7S 3Q8QB 4WFAQ 3C3LA 2C2EA 4JI3F 3GSIA 3EWGA 3CJKB 1WDTA 1NNDA 2GQCA 1RGVA 4NYZA 4M5JA 4ES1A 1HFEL 3MPYA 5H9FJ 3MM8A 3G9CA 3RBEA 3JQMA 2ZH5A 4FPRA 5D77A 4GMKA 4RUAA 3F41A 1D3WA
chains in the Genus database with same CATH topology
4LBIA 3ZO7A 1S7IA 1MWQA 3ZNJ1 4LBPA 4LBHA 3ZNUA 4FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LBI A;  3ZO7 A;  1S7I A;  1MWQ A;  3ZNJ 1;  4LBP A;  4LBH A;  3ZNU A;  4FPI A; 
#chains in the Genus database with same CATH topology
 2ADB A;  3VGT A;  3CXC R;  2PFD A;  1IBK F;  3FQL A;  2CFX A;  3G6Y A;  4I64 A;  4YR2 A;  2V8G A;  3OVA A;  4HI1 A;  2WAQ D;  1Y00 A;  4ETX A;  1YGY A;  2DH9 A;  3Q8Y A;  4DR4 F;  4KPC A;  4V19 X;  2YXL A;  2HHV A;  2CJY B;  3THP A;  2MKH A;  2DTJ A;  4LR8 A;  4YY3 F;  4RJV A;  3I4P A;  5CAB A;  3R7S B;  3NCR A;  5HMX A;  4TVA B;  5ETS A;  2GVD A;  4K0K J;  1R0B G;  4KR0 B;  1N36 F;  3ZFV A;  3H42 A;  2H51 B;  1UTA A;  2HFN A;  2C3P A;  4AXJ A;  3FQK A;  4BWM A;  3R5D A;  3MM7 B;  1HNZ J;  1NM2 A;  4NLQ A;  3VGV A;  1H3D A;  3FJ2 A;  2ASY A;  3K8V A;  1UVN A;  4GRS A;  5IT9 Y;  4DL5 A;  5D3G B;  1XEZ A;  1BQM A;  2PMW A;  3QO9 A;  1PKU A;  2V2K A;  1SH3 A;  3C19 A;  1HBM B;  2YX1 A;  3W60 A;  4DMZ A;  2WVE A;  2DR7 A;  5CZX A;  5C42 A;  3ENW A;  1TL7 B;  4NOH A;  1XNR J;  1QAJ A;  2Y9H A;  4HYK A;  5J2N B;  2IFX A;  5KT5 A;  4DV5 J;  1F3V A;  1IM6 A;  3AD8 C;  3J7Z 5;  4RW8 B;  1RHU B;  5DO2 A;  2E1M C;  5KG1 A;  5H9E J;  1RTJ B;  1YJ9 S;  4BS2 A;  5F8N A;  3ISN D;  3S6E A;  5C24 A;  4IOC Q;  2Z8Q A;  5K20 B;  3IRX A;  1HWL A;  3VHQ A;  3TOQ A;  2E5I A;  4DUY F;  2OI2 A;  2BZ2 A;  5ETR A;  3DLE B;  4DZ6 A;  2NYH A;  4DG1 A;  4WYW A;  4NLS A;  5HAO A;  3M32 B;  2B0G A;  1R6Y A;  4I67 A;  4B3R J;  1DZ5 A;  4F25 A;  4DV7 J;  2KFZ A;  2PFF B;  3PJW A;  3POT B;  4N8N A;  2NXJ A;  3GYG A;  4LIW A;  2UXD J;  2MQL A;  1X4F A;  5LXY A;  2KYZ A;  1AUD A;  2A1B A;  3UWT A;  4IR1 A;  1N5Q A;  2LXU A;  1G7C B;  1FX2 A;  4ZVO B;  4LRF A;  4DUT A;  4OZJ A;  2HAI A;  4ECX A;  1Q5V A;  1RA7 A;  1HD1 A;  4PXB A;  1FEE A;  1X4D A;  1SUQ A;  3KDO A;  2YNH B;  2PA3 A;  1U1M A;  3U1M A;  3KJV B;  1WSR A;  3BGL A;  2KXH A;  4CT8 A;  2CPE A;  3M9O B;  3NS6 A;  2WB1 D;  4CO0 A;  2MQ8 A;  4IKA A;  3CD5 A;  1MN9 A;  3HJF A;  2OML A;  3F44 A;  1PJ5 A;  1ZAW A;  2W2M P;  1TUV A;  1Q8B A;  2JX2 A;  2D69 A;  3BQ0 A;  2HFV A;  1T9X A;  3BQ2 A;  1QVG R;  4K50 A;  3G8Q A;  4LF7 J;  2LU2 A;  4NI2 B;  3MR5 A;  2VIH A;  2FZK B;  4WIQ A;  5DLG A;  3N5F A;  3CO9 A;  2MZJ A;  4R0E A;  4K4W A;  2FHM A;  2YKQ A;  2HPU A;  2RS8 A;  5CYQ A;  1N52 B;  3E3X A;  1I3O B;  2MKS A;  4F0H A;  1JLG A;  3MXH P;  1XMO J;  2GIQ A;  1CC7 A;  4RR5 A;  3DOK A;  3N01 A;  3GR1 A;  1TAU A;  2E5L J;  2YKP A;  4KPY A;  1NME B;  3OR2 A;  2ZHA A;  2BQR A;  1PAE X;  3UI3 A;  4TKT A;  3AJ1 A;  2MHN A;  4BCA A;  3ISZ A;  3A3N B;  4BC9 A;  2G1D A;  4JI1 F;  1EB0 A;  1X5P A;  2H3E B;  4PWU A;  1UVK A;  1V9O A;  2LVW A;  1O51 A;  2V8H A;  3DC2 A;  4ZP8 A;  1K0V A;  1JLE B;  3H59 A;  3CJK A;  1QVF R;  2W2Q P;  3MEC A;  1QJH A;  1AW0 A;  4KKO B;  1IKW A;  1UFW A;  4M5G A;  1PC5 A;  4U67 Q;  1CEZ A;  2DH8 A;  1S6U A;  3DFE A;  4M5N A;  2K3K A;  4DR1 J;  4I7F A;  3Q8S B;  1Y9O A;  4WZQ A;  3OJU A;  3PIP Q;  2VPW B;  5HO4 A;  1YQH A;  2M5Y A;  3P8B B;  4JOU A;  4DV2 F;  1HQU A;  1E6V B;  3O3L A;  2Q66 A;  3OTO F;  3NAI A;  3ET6 A;  1JK9 B;  2HSE B;  2HZA A;  2HHT A;  5IM0 A;  1YJT A;  4KE5 A;  1YVF A;  1XNQ F;  3FBE A;  5FLX U;  4Q7A A;  1B64 A;  1TL5 A;  1UEV A;  4IH5 A;  2DGO A;  1FTR A;  2FHJ A;  1U6B A;  3HK2 A;  4KV8 A;  3HXM A;  3QT6 A;  2MTL A;  3MPD A;  4L76 A;  1RT4 A;  3I56 S;  2CQH A;  2G0I A;  4WK3 A;  4ITS A;  3DHX A;  5IT4 A;  1WKK A;  2PO4 A;  2MQP A;  2RQC A;  1K47 A;  1FKP A;  5F9L A;  2RQM A;  2F4V J;  3UNY A;  1CSJ A;  3AJ2 A;  2AW0 A;  1K44 A;  2K7J A;  4DU7 A;  4ZHR A;  1N54 B;  4QIE A;  4CO5 A;  2AGQ A;  2U2F A;  1WEL A;  3K58 A;  3PYD A;  1CUL A;  2HVZ A;  3VAJ A;  1J2V A;  4C9D A;  4CLT A;  2DO0 A;  2MQN A;  2CQ4 A;  3J80 Y;  1HHQ A;  3TRG A;  3SCI E;  1X4G A;  3MD1 A;  2N7Y A;  3VV2 B;  3KK1 A;  3UQS A;  4OYI A;  1WTB A;  4L75 A;  3GFZ A;  4IG0 B;  1YJR A;  3OLA A;  4Y3C A;  2WSE C;  4OX9 J;  3HUL A;  2DNR A;  2HBZ B;  3QGP A;  2E7V A;  3HVT A;  2EK6 A;  4DI6 A;  4HLB A;  2F9J A;  4ZVU B;  1T11 A;  1S72 S;  1FDN A;  3KK3 B;  2ZOM A;  4EYI B;  4OX8 A;  3H98 A;  3G82 B;  2BM1 A;  4XPC A;  2DPI A;  4GKK F;  2RU3 A;  1P6T A;  2K1R B;  4KGZ B;  2KZZ A;  1I94 F;  2HYI B;  4I68 A;  4MKA A;  4PWD B;  2UU9 J;  4CYU B;  5BYQ A;  3CCS S;  1RAE B;  3OW2 R;  1GEH A;  3MAH A;  2KM8 B;  4FYX B;  2QA2 A;  1WD6 A;  1NPK A;  2P9E A;  4HDG A;  4ED3 A;  3MM5 A;  2P2C B;  4FKX A;  2CNO B;  2VDH A;  4QIG A;  3GFH A;  1KOO A;  5J2M A;  2G2Y A;  4OI2 A;  2NXE A;  1BY9 A;  3CW2 C;  2FGO A;  4YS2 A;  2VG6 B;  3CDA A;  5KOX A;  1DBD A;  2PD1 A;  2MKY A;  5E3P A;  4J90 A;  3LPE A;  2Q43 A;  1REG X;  1TV6 A;  1HIY A;  1Z1Z A;  1DFD A;  1C4C A;  4DOZ A;  4ECY A;  1RSC A;  1S9G A;  2JWN A;  3MCN A;  3HF5 A;  4DR6 J;  3JYT A;  1BQN B;  1RHR B;  4NLR A;  1RTZ A;  2DR9 A;  3I0S A;  4LQ9 A;  4M5M A;  2CZ4 A;  2DNM A;  1JQG A;  2RRN A;  3TAQ A;  2YKN A;  3H0P A;  1RBA A;  4WZM A;  2R2T A;  1FWK A;  2UUB J;  3AA9 A;  4XAK A;  4C97 A;  3RBD A;  1A6L A;  1RHK B;  4RZR A;  2M9K A;  1RWK B;  3V5R A;  2W4D A;  2LLZ A;  1W2I A;  3EZO A;  2YNI B;  4WBF A;  2GA7 A;  5AXL A;  4A4J A;  1NXI A;  2OHD A;  1U6Z A;  3EZU A;  4KKO A;  3R97 A;  5E3R A;  3H2U B;  2GHV C;  2M8D B;  1RB0 A;  3FCV A;  2IVY A;  1S1V A;  3NGU A;  1RT5 B;  3M2R A;  4DQI A;  3DLG B;  1EX8 A;  1JLC A;  5LMU J;  4ANC A;  3BGF A;  2Y3Y A;  4NEZ A;  4X64 J;  2O01 C;  2DHH A;  4Y0F A;  4DX7 A;  4DU8 A;  1ZAV A;  2JFK A;  2V69 A;  4MFB B;  2HHU A;  4Y6I A;  3LAK A;  1R0C B;  2XO6 A;  4WYL A;  1SCJ B;  2EFV A;  2YKM B;  2YNF A;  2WCX A;  4LSL A;  5BXI A;  2LCW A;  4J91 A;  3AA8 A;  2DIS A;  3Q86 A;  4L74 A;  2BRK A;  3HO1 A;  1QAY A;  1ZM9 A;  2BYC A;  1R6V A;  3PEJ A;  2C2O B;  1NDC A;  3GIK A;  2JZ5 A;  2OLW A;  3GB0 A;  3W9J A;  3PW5 A;  4FKY A;  4B3T J;  1S79 A;  3Q8U A;  3IXQ A;  3H5S A;  1FX4 A;  4WTO B;  1BLU A;  3AY0 A;  2MYF A;  3TWZ A;  1FVS A;  1LW0 A;  4FP9 A;  4B3S J;  4ALZ A;  4H4M B;  4NMX A;  4WKY A;  2B4O A;  2QSF A;  2UVW A;  1V3R A;  4QWE A;  2V68 A;  4DPO A;  1P9Y A;  1FJE B;  2DNO A;  1X5O A;  5B0F A;  2L9W A;  4G1P A;  5LJ3 Y;  3A8I A;  2VQE J;  2ASD A;  3KFW X;  2IYG A;  4JI3 J;  2Y8Y A;  3TA0 A;  1BE4 A;  1NH8 A;  4MKV A;  4WFN Q;  4PEO A;  1SL0 A;  3RAM A;  1RLD A;  2FZC B;  1RQ0 A;  2YH1 A;  1GX5 A;  1Q81 T;  3OR1 A;  4FF1 A;  2WBR A;  4KRW A;  1RWX B;  4AL7 A;  1WKJ A;  2IY5 B;  1IBK J;  4RLE A;  3OL6 A;  3ZZT A;  1Z2L A;  3MMB A;  3R5A A;  4USW A;  1RCO B;  4DR4 J;  4EU0 A;  1IUJ A;  3M30 B;  5G0R A;  2GMH A;  1C0U B;  3FUY A;  4ZLN A;  4NEY A;  4B9M A;  2XLI A;  1T9Y A;  4CLP A;  4YY3 J;  5IV4 A;  3D1H A;  5LM7 E;  2C22 A;  1M1K T;  2JHE A;  4FF4 A;  1N36 J;  1R8P A;  4N41 A;  4K5R A;  2DVI A;  2JLE A;  3DYA A;  4USU A;  2EC0 A;  2VB6 A;  4OZ0 A;  4WFZ A;  3SYZ A;  4WTY A;  1JJH A;  1WUU A;  4ZPD A;  3GJS B;  1NSP A;  5K14 B;  3KLI B;  3HVA A;  1SIW B;  1RAO A;  3O5T B;  1CG2 A;  4FVM A;  2V63 A;  3QWU A;  2E44 A;  5KFP A;  1EAR A;  2DCU B;  3L7O A;  3SXL A;  4ZJL A;  2G0C A;  4FBT A;  5DJB A;  3E2E A;  1X4A A;  1J5O B;  4CH0 S;  4ZCL A;  3KXD A;  1Q53 A;  4OLP A;  1RTI B;  5CYM A;  1N48 A;  2M2B A;  4KGK A;  1N5Y B;  3LAM A;  1FJC A;  1BGX T;  1ZA1 B;  3I32 A;  3HVW A;  5IXU A;  3M2U A;  5T7L B;  3D1Q A;  5K8N A;  4NCA A;  4LRA A;  5F41 A;  1UP1 A;  3V6H A;  1WOS A;  3JSM A;  5I3U B;  2GJI A;  4DUY J;  2AJ1 A;  2V67 A;  2B3T B;  2NSB A;  2M88 A;  8ATC B;  4P52 A;  2B9W A;  3RB6 A;  2XM3 A;  2V6A A;  4OHZ A;  4W90 B;  1VQ6 S;  3W9H A;  3CIZ A;  3ZO7 A;  2YKA A;  2RAQ A;  2GNK A;  4LR7 A;  2V34 A;  5AE2 A;  2QTW A;  4ECZ A;  2Q6B A;  2ZC3 A;  1YI2 S;  1Q7L B;  4YDD B;  2ZVI A;  3D6M B;  5CHC B;  2ALZ A;  3ZZY A;  3P4U B;  2ZM6 F;  4NYP A;  2V8D A;  1FCA A;  1JXE A;  4K4X A;  3DLG A;  1WF2 A;  4S0M A;  3KNG A;  2KI2 A;  4RUB A;  2M52 A;  2YWE A;  4KY3 A;  1UJ5 A;  2WK4 A;  1FRH A;  2BKO A;  5LJ5 Y;  3RTV A;  1U7L A;  2C42 A;  1PCA A;  2OTJ S;  3NBP A;  5C25 A;  3E01 B;  1VC0 A;  4CO3 A;  1HI0 P;  1ZYQ A;  1FI4 A;  3KYL A;  2DHX A;  5LL6 d;  3TJA A;  4C6A A;  1U48 A;  4DQQ A;  3L09 A;  1N88 A;  3BQ1 A;  1S6Q B;  3DLK A;  1CJU B;  5KFN A;  1HW9 A;  3KLF A;  2BE7 D;  1RU2 A;  1P1T A;  2PA8 D;  1S76 D;  2QFJ A;  4CTA A;  4CLL A;  1VIS A;  3PM9 A;  3R7N B;  1FK9 A;  4W4M A;  2IDL A;  2GV1 A;  2A10 A;  3GCX P;  2FQQ B;  4JI1 J;  3TZX A;  4PPD A;  4H54 A;  1LKZ A;  2Z2Z A;  4Y2K A;  4F02 A;  1EAY C;  1HWJ A;  2BJ3 A;  5CQG A;  2YWH A;  2DH7 A;  2RT3 A;  1DQA A;  2Z2M A;  3DGP B;  5KT2 A;  4TY9 A;  2JEF A;  3BGR A;  2BA9 A;  2GML A;  2JL9 A;  4PRF A;  2Y1I A;  2R4F A;  2BXJ A;  1F2H A;  3CJ0 A;  5D6G A;  2HFS A;  3CJQ A;  3HZE A;  2BKP A;  4EO8 A;  4HHU A;  2VAS A;  2AX0 A;  3X3U A;  2OP5 A;  2XSF A;  2G4B A;  1RCX B;  2DGW A;  1MRO B;  1VRT A;  3U1N A;  3TEG A;  3C6T B;  1WHW A;  3H20 A;  3ZTP A;  1N5S A;  4X62 F;  1R7I A;  4CH7 A;  3RB4 A;  4DV2 J;  1S6O A;  4ED6 A;  3OTO J;  1JLF B;  1IKV A;  3K8W A;  3AOB A;  1U2C A;  1WF0 A;  2ROE A;  1ZA2 B;  2QA4 S;  3SV3 A;  4UW2 A;  1XNQ J;  3Q89 A;  3CNQ P;  2NR0 A;  4FYV B;  4NRT A;  2FLP A;  1RHJ B;  5C2G A;  1WEZ A;  2CIM A;  1OQ3 A;  2XYP B;  5KFQ A;  2DNP A;  1HNI B;  1X9W A;  3QIP A;  1NK5 A;  2ZZM A;  2NXN A;  1FXL A;  3M8Q A;  1G3O A;  1U2F A;  4X4U A;  1RWN B;  2DNL A;  3CDW A;  2RIJ A;  1WC1 A;  2D9P A;  4YFU A;  1MLA A;  1K73 T;  4IRK A;  1HA1 A;  5SUH A;  2VBZ A;  3MUM P;  3R8Y A;  2CQP A;  3DXS X;  3GIJ A;  4I1T A;  2GJ2 A;  5HBM B;  3MMC B;  2DRA A;  4G1I A;  2VPY B;  1J5O A;  3F0N A;  2MGZ B;  1TTH B;  1OO0 B;  3CWJ A;  2B56 A;  3U1L A;  1SJR A;  3R3T A;  3HSJ A;  3US5 A;  1DTT B;  3WZ0 A;  2OO4 A;  2GQQ A;  2DIT A;  2BE2 B;  4V1A k;  3BBF A;  4PAB A;  3NCQ A;  1JLQ A;  4F2R A;  4PQA A;  4KAI A;  3F73 A;  2CPJ A;  5KFV A;  1YJW S;  1CC8 A;  1FEH A;  3BEG B;  2VQF J;  2CQ0 A;  1CJK B;  3NS7 B;  3FNN A;  1VBY A;  1S0M A;  2XI2 A;  4UUX A;  4X4O A;  5J1E B;  4ZDN A;  1F2G A;  1QUP A;  2DJW A;  2XO7 A;  4P7T A;  4EUV A;  5L46 A;  2B6A A;  2AF6 A;  4NL5 A;  2RSQ A;  2VU5 A;  4GKK J;  2DGU A;  2V2Z A;  2VA2 A;  4YN3 B;  2R7T A;  2F1F A;  3CJ2 A;  3MCS A;  1I94 J;  1PSD A;  1HQ2 A;  2YVS A;  4PYA A;  2XGQ A;  2OH2 A;  1I5O B;  1ZM3 A;  2RUS A;  2FJW A;  4P9S A;  1QM9 A;  2HGN A;  4J37 A;  2FVR A;  3EVM A;  1BC6 A;  3LWL A;  2IJF A;  2K3I A;  2UUT A;  3IG1 B;  2PC6 A;  3MEE A;  4J9N A;  5E2Q A;  2KM8 C;  1B7F A;  3KK2 A;  1IWG A;  4ZPT R;  2HZC A;  5H9F K;  3E01 A;  3MED B;  5DDQ C;  1HMV A;  1CQM A;  4JP8 A;  1TL1 A;  2VFV A;  2IJR A;  1T94 A;  1YSJ A;  1VQO S;  1GMW D;  4XPE A;  2DR8 A;  1WKL A;  4K7Q A;  5KG3 A;  5IWA F;  3X1L B;  1R0A B;  2JDJ A;  3KNA A;  3DDK A;  2EG1 A;  3FEX B;  4ELU A;  4IFV B;  5GAD U;  3T9Z A;  4V19 J;  3EVO A;  2BUN A;  3ADA C;  2MEW A;  3IA0 A;  2WVB A;  3A8K A;  4DL4 A;  5HRO B;  4CWB A;  2AJQ A;  4N47 A;  1PAU B;  4Y34 A;  4ZVQ B;  3SSQ A;  3ZTQ A;  2G0J A;  1G1X A;  4ZN1 A;  2AD9 A;  3TW0 A;  4DFK A;  3VAM A;  1CJT A;  1FRM A;  3IBC B;  2QRR A;  4H4K C;  4K2X A;  3BR9 A;  2W9B B;  1UZH A;  2RRB A;  3THV A;  4OZ2 A;  1X4C A;  3EM1 A;  2LEB A;  4FS2 A;  3G6V A;  4IQX A;  5T14 A;  1YIJ S;  3NP5 A;  4M63 A;  1EHW A;  2CQB A;  2DGS A;  2XZT B;  2WVD A;  3QWP A;  3OXG A;  5KFX A;  4DCO B;  1KNZ A;  1FJG F;  1YDL A;  1HKA A;  1NHV A;  2ZBR A;  5H9E K;  2IA6 A;  3QNW B;  3IO1 A;  4ZLJ A;  3I6P A;  3HD1 A;  3MFI A;  1XR6 A;  4IG3 B;  1UWB A;  2NPF A;  3TR5 A;  4DV0 F;  5GAH I;  4QWB A;  4K4V A;  1M90 T;  3QJP A;  3MMA B;  2K8G A;  3NGR A;  3IWN C;  2IA0 A;  5IQQ A;  4W98 A;  2VKR A;  2DIV A;  4QOT A;  3J7Y U;  2HFZ A;  1N56 A;  4N76 A;  4DPW A;  2KTQ A;  3NAH A;  4JV5 F;  2J0W A;  2I1R A;  2JVO A;  5I3P A;  4CLY A;  2J9D A;  5D15 A;  3TYT A;  4ID8 A;  3N6L A;  3IWX A;  3I96 A;  1UW4 A;  5ETK A;  3GG0 A;  4IH7 A;  3RR8 A;  4I2P A;  4IRD A;  3GII A;  3BYP A;  4DN9 A;  5HP1 B;  1SKU B;  4OHX A;  4KQZ A;  4QYZ J;  3WQP A;  1WSV A;  5HLF A;  2BW2 A;  1QSY A;  3B82 A;  5JUM A;  1WHV A;  1L3T A;  3L95 X;  2VJU A;  4RW7 A;  1WC3 A;  4ENO A;  5KFT A;  3T9N A;  4Z37 A;  1BWE A;  2FUG 9;  1URR A;  2LQB A;  2R8H A;  1TKX B;  4DV4 F;  5KT7 A;  3I0R B;  4UT4 A;  3OFE A;  3R27 A;  1S9F A;  3OQ2 A;  3D9B A;  1FKA F;  1C1C B;  4LBI A;  2R42 A;  2AZ1 A;  2ZEJ A;  1LXJ A;  3GR0 A;  2ZHO A;  2CNK B;  2A2D A;  1UVL A;  4ES3 A;  2ZBI A;  1QE1 B;  5HI7 A;  2APO A;  1RHM B;  1NB7 A;  4Q2L A;  1O6X A;  1VHI A;  1URN A;  3NY0 A;  1OSD A;  1MU2 A;  1RWW B;  2QT7 A;  3PW2 A;  4B9U A;  4DPY A;  5F3Z A;  2MPU A;  1U1L A;  2P6T A;  4UQT A;  2HHS A;  2L48 A;  1RWU A;  4EZ9 A;  4DPT A;  4X65 F;  1TKZ A;  3CCR S;  1RT7 A;  1Z2Z A;  1BWV A;  1U4B A;  1VQM S;  4NLU A;  2OGU A;  2MXY A;  2ZBQ A;  3NOG A;  3AJD A;  4J7C A;  4N5S A;  3M6X A;  4LF2 A;  1SV5 A;  3BN4 A;  4RWW A;  1HI1 A;  4OI0 A;  3PX0 A;  4ES2 A;  5J2P A;  3ILO A;  2ZVS A;  3OL9 A;  1VRU A;  2LQ9 A;  2COL A;  5EX0 A;  4NA2 A;  3IR7 B;  3C6U A;  2ZJP Q;  1KP6 A;  1VK8 A;  2IMW P;  2IC3 A;  3TZY A;  2C3Y A;  5GAD I;  3OFH A;  3KG1 A;  1LW2 B;  3QYY A;  2HHP A;  3EPG A;  2MST A;  1NAQ A;  3E51 A;  3BJY A;  1VGY A;  5AT1 B;  5JXS A;  4RU2 A;  3JSR A;  3RG6 A;  5KFZ A;  2PE8 A;  4HHH A;  4TYB A;  2GCF A;  5GAG I;  2H4Y B;  4C3K A;  4YB5 A;  4OZN A;  2C2Z B;  1CQN A;  3CC4 S;  1K1Q A;  2CPD A;  4F0K A;  4O3R A;  1C0T A;  4P2F A;  2FTR A;  3HSG A;  4KFB A;  2DGQ A;  1LFW A;  3MWB A;  2WSC C;  5DET A;  4U95 A;  4M5I A;  3PY8 A;  3MTK A;  3I9Z A;  1KOH A;  3MAA B;  4IFY A;  4B17 A;  5HJX A;  3T6J A;  3C14 A;  3KHG A;  1WEX A;  4ZS6 A;  6FD1 A;  4B9N A;  1S49 A;  2YPZ A;  3IC1 A;  2BOP A;  2ZJR Q;  1VBX A;  1X0P A;  2HKE A;  1HNV B;  2D41 A;  4JB8 B;  3FCH A;  5I42 A;  2DY1 A;  1NDK A;  1W2B R;  3T1Y F;  4OZ5 A;  3H7H B;  3DMJ A;  1YX2 A;  3CT9 A;  3KLG A;  4CNZ A;  3NMR A;  2AYM A;  3M4X A;  3CB4 A;  2ZM6 J;  1EP4 A;  2BOA A;  1HPZ B;  2ASL A;  3A8E A;  4GVB A;  4Y28 C;  4FDF A;  3K2Y A;  1ITP A;  2OD6 A;  4ERD A;  1H0H B;  2ZUG A;  1S1X A;  1H2T Z;  2HMI A;  3OHB A;  1RBO B;  3OUY B;  3MR6 A;  3SCL E;  1SJ1 A;  2VKZ G;  2M8H A;  3UW1 A;  1D9F A;  3NWG A;  2X51 A;  1IBM F;  2J6S A;  1U6F A;  2RD5 C;  2RH3 A;  1S1T B;  2I9S A;  3ZC4 A;  5LSR A;  1ZAX A;  1TZ0 A;  3GJR B;  2EW9 A;  4ZVE A;  2KVI A;  3W1Y C;  1U1R A;  1L3S A;  3LP2 A;  2DGX A;  2J5A A;  1NJZ A;  1M1H A;  4KGX B;  1UFK A;  3TP2 A;  5B09 A;  3I82 A;  5HP1 A;  5KFI A;  1KN6 A;  3IS9 A;  1VQS A;  3SV4 A;  5A8W B;  3M1V A;  3G6E S;  3BKT A;  1KTQ A;  4RO0 A;  1AXQ A;  2I5J B;  2WSF C;  2C3M A;  7FDR A;  4HHJ A;  2ILZ A;  2QMW A;  1S4F A;  4YQW A;  4PUO A;  1FWP A;  4ZPW R;  2IAJ A;  4BBY A;  4LF9 F;  4EZ6 A;  1V3S A;  1FDA A;  4HH0 A;  3RYL A;  1I1G A;  2DHA A;  5FII A;  1U45 A;  5J2Q A;  3CCM S;  4WFB Q;  4OHY A;  3FBC A;  5M2U A;  3K59 A;  2WW4 A;  1IWA A;  1TKT B;  5D4P A;  4I0W A;  3V4I B;  2W2N P;  2GX8 A;  5E7O B;  1HAR A;  3OTC A;  2AYG A;  4USM A;  4ZK7 M;  3TAM A;  5KT6 A;  4ECU A;  3N5B A;  2HVI A;  1HNX F;  2DBB A;  1U1P A;  2Z2Y B;  3IMQ J;  2XNR A;  1JXV A;  4MK7 A;  3PKM A;  4M5D B;  2ZH7 A;  3IAM 9;  3A4T A;  3CUL A;  2VON A;  2OPQ A;  1VHF A;  2OPP B;  3G86 A;  1SVD A;  4FS1 A;  4JYA F;  4X62 J;  3FFI A;  3J81 U;  1X0F A;  3GFX A;  2YQ1 A;  1P1L A;  3AXM A;  2I6W A;  3TUJ C;  3U27 A;  4UTG A;  1TQL A;  4G1Q A;  1NCL A;  3W2W A;  5D4L A;  5A8K A;  5D78 A;  2I2Y A;  3D3B J;  5B0D A;  3OTD A;  3P3D A;  4ZJQ A;  5U47 A;  2BV3 A;  2C2R A;  1GMW A;  1Y5N B;  4K4S A;  3FMW A;  4URS A;  3QAE A;  4DQR A;  4ANE A;  2FYX A;  2RUG A;  4CO1 A;  3MTJ A;  1ZPW X;  2VD3 A;  5HMY A;  1RKI A;  3LAN A;  4NXM F;  4UZC A;  4C7Q A;  1VLO A;  3DOL B;  2A2C A;  2KYX A;  1R3N A;  3WDO A;  1P8G A;  4CM2 A;  4M8L A;  1OMS A;  1FTC A;  2EBE A;  1E6Y B;  5DRK A;  2HBR B;  3G2X A;  3HFV A;  3PHT A;  2HGM A;  1SKW A;  2J8A A;  4UQG A;  3VF0 B;  1UCN A;  3TI0 A;  1U0H B;  5L1J A;  1U8W A;  2QA4 G;  3MAA A;  3P5B P;  2EFO A;  3H8Y A;  1S9E B;  4ZPC A;  3T1H J;  2DCL A;  2BBE A;  1MWY A;  1RWV B;  5AE1 A;  4RU9 A;  4EBD A;  2AEF A;  2I8E A;  3RAX A;  2YKO A;  2IMO A;  1NKB A;  3ENQ A;  3A1Y G;  1SC1 B;  3OT9 A;  3EZ5 A;  3EDR B;  1RE1 B;  4GVL A;  4P2M A;  2ZH4 A;  4U8Y A;  3E8O A;  2OPR B;  2WBM A;  1KRP A;  5A8R B;  2EFN A;  4ED8 A;  4MIW A;  4H4O A;  4B9L A;  3JTP A;  2DRB A;  4MKY A;  1FKO B;  2XMA A;  3CF5 Q;  2D7S A;  4RW9 B;  3VWS A;  4B9T A;  2ZZN A;  3BSN A;  3BPS P;  3EVW A;  1KVK A;  3CCV S;  3T5J A;  3DOM B;  4LF1 A;  3NGS A;  3OUY A;  1SKS A;  2EEY A;  4EO6 A;  3DRP A;  1N6Q B;  3LA0 A;  3UD4 P;  3MMJ A;  2OTL S;  1NU4 A;  5HAN A;  1KVJ A;  3UFC X;  2DO4 A;  3K5N A;  4OJ1 A;  1VQL S;  4BC7 A;  3PZP A;  2FJD B;  2FDN A;  5F0W A;  2EKY A;  4ZPV R;  2NCK L;  2R8G A;  4OX7 A;  5KFS A;  3JXO A;  2KRB A;  5IWA J;  1YWX A;  1S5Z A;  5KT3 A;  3OV7 A;  3BSO A;  3UDC A;  1SH0 A;  1VDH A;  2UXB F;  5HMZ A;  2H65 B;  1Y7P A;  2AGP A;  3LP1 B;  3SZ2 A;  1S1U B;  1RTD B;  5GMD A;  4M5L A;  4ICL B;  1X31 C;  2E1P A;  1S0N A;  2RS2 A;  1S0V A;  2LKZ A;  1UA0 A;  3NMA A;  4JBC A;  4CLU A;  4RX6 A;  3EE3 A;  4CRJ A;  2DGV A;  1KLM A;  4DPX A;  2UUW A;  1YLX A;  1H73 A;  4PYD A;  4NCG B;  4WJB A;  2W9C A;  3VQT A;  1FO1 A;  1DAX A;  1RTH B;  3IM9 A;  3HT0 A;  1TKT A;  1SKR A;  3LO3 A;  4ID5 A;  3P96 A;  3DI6 B;  3BR8 A;  1FJG J;  4DV3 F;  1JLB B;  2EI5 A;  4Q0B A;  2LYV A;  4J9K A;  2ZZT A;  2VIC A;  4E98 A;  1RIS A;  3L9Z A;  3D68 A;  2LDY A;  5HAT A;  2B51 A;  4ZPA A;  2NYI A;  1YBA A;  1REV A;  2MSS A;  2K2P A;  3VAF A;  3G87 A;  4DV0 J;  2DR6 A;  5KG4 A;  3HHN B;  4FBU A;  2HNZ B;  2AZ3 A;  3HFZ B;  1RT1 A;  4DFM A;  1JNZ B;  1KQF B;  2CG8 A;  4ZVP B;  1VC6 A;  1X4B A;  4DL3 A;  3D2W A;  4JV5 J;  3RRG A;  2IM0 A;  2ACM A;  5ETN A;  1IM4 A;  5DM6 Q;  1U1N A;  1DLO B;  4R5P B;  2C2D A;  4FYW B;  1GMU A;  1PBA A;  1R27 B;  2FJV A;  3UN3 A;  4Y2C A;  4QIF A;  1YRU A;  3QFW A;  4ECS A;  3HHK A;  4BHQ A;  1F5C A;  4IQM A;  5I3Q A;  5HQM A;  2W2P P;  3Q2T C;  2GQ2 A;  3SCK E;  4UOC A;  3KLH B;  4J5O A;  1TVR A;  1T03 B;  3BS9 A;  2HIQ A;  4R8U B;  4X84 A;  1JMT A;  3VTI A;  1VQP S;  4LIR A;  1BXN A;  2E7W A;  2CQI A;  1XIQ A;  1YBT A;  1C1B B;  2HND A;  1FVQ A;  1RT3 A;  2KVQ E;  3PDN A;  4LRB A;  3H4B A;  1L3V A;  2XUL A;  5EDW A;  1RWO B;  4DV4 J;  2UVR A;  4RW6 A;  3CJ4 A;  5F8I A;  1WF1 A;  3FBF A;  3EMT A;  3IR5 B;  1FFS B;  2HK3 A;  4WK1 A;  3PFE A;  1N5V A;  2ZWP A;  2CPY A;  3W9I A;  3CCJ S;  4WP3 A;  3BGO P;  4CO2 A;  4DQS A;  4O4G A;  1Z4U A;  4OHV A;  2YWK A;  3V81 A;  4KIA A;  1AA1 B;  2H5I B;  1LWF B;  3BB5 A;  4TU7 A;  3QRP A;  3AOC A;  5A0Y B;  1HR0 F;  3SI8 A;  4YR3 A;  4X65 J;  4HTI A;  3J7A N;  3CSK A;  4C98 A;  2PDA A;  2BAN A;  4QIW D;  4L73 A;  4NLV A;  4DUZ F;  5D0H A;  3CD6 S;  4U96 A;  4IO1 A;  3PFO A;  4O44 B;  1F3F A;  1VK3 A;  1OYD A;  1J5E F;  1AZS A;  2HRT A;  1K1S A;  4C8K A;  2XSJ B;  4I6A A;  4IOB A;  2QL7 B;  4AE5 A;  3J7Z T;  5B7W A;  1EKS A;  4RBV A;  5K9F A;  1NJI T;  4X4Q A;  3KLE B;  4QR1 A;  2YQ0 A;  3AD7 C;  4MMO A;  2GVZ B;  4PAA A;  3ZZ0 A;  3SDE A;  3JAM U;  2YWF A;  4WF9 Q;  5HL7 Q;  2AYE A;  4IOA Q;  5IT0 A;  4X4T A;  3V6D B;  4J9L A;  3ILI A;  5E41 A;  2G2Z A;  2FJE B;  3NOC A;  4RW4 A;  5EX3 A;  1U47 A;  1CS4 A;  2KHC A;  2WON B;  1PYS B;  4HKQ A;  2QYC A;  1P9Q C;  1JJ4 A;  1OJ4 A;  4GO5 X;  1MML A;  2MQM A;  4WU2 A;  5D4N A;  3N4W A;  3PXG a;  3MF5 A;  1GTE A;  5CD4 A;  4ED5 A;  4HDH A;  3GG1 A;  1LWE A;  2WB4 A;  3KJN B;  4I2Q B;  1FDB A;  1PYT A;  1KR4 A;  1HYS B;  3PX4 A;  3NNA A;  4OL8 A;  4JI0 F;  3IWL A;  3JQK A;  1FXR A;  3B78 A;  2BX6 A;  2HLT A;  1N33 F;  2RNE A;  4QJV A;  4U6P A;  3NG8 A;  4DQP A;  2MZR A;  3T1Y J;  1Y5L B;  2VPX B;  3OL7 A;  3DRS B;  2KXN B;  1U02 A;  4F0M A;  2FPH X;  3QSI A;  3RU0 A;  3P6Y C;  2HWH A;  3AAW B;  4TQR A;  2DK2 A;  2F3J A;  3W62 A;  1EQ0 A;  2YNG B;  3EGZ A;  3TO8 A;  2BQ3 A;  4CIO A;  4U9R A;  3AB4 B;  2ZWO A;  4GKJ F;  2CA9 A;  4ETZ A;  4KBI A;  1ZOT A;  1IBM J;  4HI2 A;  1H2U X;  5HK4 A;  1FES A;  2HNY B;  2GFF A;  5DQI A;  2VFS A;  5KFL A;  3TAR A;  4LRD A;  4EI2 A;  3TUI C;  3NKY A;  3QZ7 A;  3VAH A;  1T05 B;  2QLJ B;  3TX8 A;  4F3M A;  1U0S A;  2GMJ A;  2W24 A;  4NLY A;  1OQ6 A;  4WU3 A;  3GV8 B;  5KG2 A;  3M8P B;  1IKX A;  5F8M A;  2FD2 A;  4KT0 C;  2QLW A;  1KWM A;  1FF2 A;  3AD9 C;  2CJA A;  4U8V A;  4AYB D;  4QBU A;  3HHL B;  1NK4 A;  1Q16 B;  4OYZ A;  4DR5 F;  4LF9 J;  4O0N A;  1GXU A;  1HWK A;  1GNK A;  4K4T A;  2CNL B;  5ETM A;  2UZA A;  3GJQ B;  3QPI A;  2Z57 B;  1RT6 B;  1YJV A;  4U7C A;  3GYX B;  1X5S A;  1CJV B;  3ZNU A;  3BO4 A;  5KFC A;  5D0E A;  4E2F B;  4A8S A;  3LH2 S;  2XS2 A;  3GV7 B;  1HNX J;  1IQZ A;  2OEL A;  3O2I A;  4P72 A;  4WP9 A;  4LSZ B;  1B3T A;  4FF2 A;  1LWF A;  1WC4 A;  3BKU A;  4Q43 A;  4MAK A;  3VAL A;  1L3U A;  3EXC X;  4J9V A;  4JYA J;  5CXT A;  4FZV A;  3PYE A;  2AHO B;  3KTQ A;  3MPU B;  5DS7 A;  2CUY A;  1IQT A;  2LQJ A;  4F4X A;  4LFB F;  4DFJ A;  5L1K A;  3HT3 A;  1SC3 B;  4DL6 A;  2D3O R;  3MM6 B;  3OSP A;  2DHS A;  2E9Z A;  2CQD A;  4C8Z A;  2JLG A;  3MEG A;  2RKI B;  2KL8 A;  3C16 B;  4GO7 X;  4I6W A;  4G3I A;  4C8Y A;  1GMV A;  4C11 B;  2D3O 1;  1HNW F;  2W7O A;  1NHK L;  4TXS A;  5J1N A;  2XMW A;  3V4M A;  5F8L A;  2ZE2 B;  3T5H A;  3AFG A;  3I9V 9;  3MEK A;  3QJL A;  2CPH A;  1T9T A;  3NNH A;  3PJX A;  1LV5 A;  4NXM J;  2C2K B;  4EGL A;  4IYQ A;  2Q3P A;  2QN6 B;  2E66 A;  2VG5 B;  2NZ4 A;  2MJU A;  5FDL A;  5E3A A;  4NLD A;  4ATN A;  5KFU A;  1DRZ A;  1R31 A;  3RW7 A;  4KGV B;  4HAC A;  1JLA B;  4QWA A;  3LP0 A;  1NDP A;  4PXE A;  1S6P A;  3DM2 A;  4I56 A;  1Q82 T;  3FRZ A;  2BW7 A;  1HQE B;  1VQN S;  3PX6 A;  4NA1 A;  1M5V C;  4ZA1 A;  4AUK A;  4QQB A;  1GXL A;  2OEM A;  3PEH A;  4ZVR B;  1R8C A;  3JS9 A;  1WOR A;  1PIL A;  1YRT A;  2VOD A;  4ZVH A;  5DDO C;  1UKU A;  4QYZ K;  4OQJ A;  2O1P A;  1O8B A;  3M6V A;  4A8Q A;  4Q44 A;  1HWU A;  4ZP6 A;  5C2C A;  2JEG A;  1DTQ B;  4OZ1 A;  3I5A A;  1NJW A;  3WX8 A;  2KN4 A;  5MAO A;  2NPI A;  1W25 A;  4XDC A;  2MZT A;  3LW5 C;  5IT9 U;  2QA1 A;  3T19 A;  4M94 A;  3I55 S;  2NUU G;  3K5M A;  3C15 B;  3CED A;  5ETO A;  2FC8 A;  4DSF A;  1LNQ A;  1UVI A;  2PGC A;  1U1O A;  3BO2 A;  2Y1R I;  4TLR A;  2YY3 A;  2XYG B;  2W1B A;  2QC3 A;  2SXL A;  1NH7 A;  2HK2 A;  3VGS A;  3MM7 A;  2N7C A;  1JKH B;  3CJ8 A;  2HNY A;  4FYY B;  4DR2 F;  1SXL A;  5D0R A;  4B3O B;  5CH7 B;  4PQU B;  4PPZ A;  5D3G A;  2BRL A;  2FJA B;  2GHP A;  1HBM A;  1HBU B;  3RBX A;  2ZD1 B;  2R7U A;  2MKJ A;  4DJB A;  1Q8L A;  1TL7 A;  4WE1 B;  3D66 A;  2UXB J;  2F5G A;  5J2N A;  1S48 A;  1WG5 A;  4RW8 A;  3N0V A;  2CQ1 A;  1OS5 A;  1TAQ A;  1RTJ A;  1RAG B;  2CDR B;  1KD1 T;  4WP8 A;  2RHQ B;  3CVK A;  3L3C A;  1JJ2 R;  4XO0 A;  1TKD A;  1OY8 A;  5EGY A;  3F56 A;  2E29 A;  1YJU A;  2VBY A;  4Q5V A;  4UY8 5;  1U8S A;  5F9N A;  3FVY A;  2CQ3 A;  5LOQ A;  4NCB A;  5CCL A;  3DLE A;  4LRE A;  2FLL A;  2PSZ A;  3M32 A;  2RDI A;  2HGL A;  2X7I A;  1CJV A;  4I4B A;  4A8O A;  2GZO A;  5KFJ A;  4DV3 J;  3POT A;  1Q0N A;  3ULH A;  1VR6 A;  4EBE A;  1LXN A;  3SQG B;  4LMZ A;  4LJM A;  3EIC A;  3EPI A;  4NPO A;  1U25 A;  4KB7 A;  4U7U K;  5DG8 A;  3SEO A;  1YK9 A;  4P73 A;  1XQI A;  3O6Q A;  4B3M F;  2OD4 A;  1UVJ A;  1FDD A;  1K0T A;  2E9T A;  4KH0 B;  3OBI A;  1HBN B;  2YNH A;  3MPW A;  3UE2 A;  3KJV A;  2GO8 A;  1FFW B;  4RUH A;  2M0G B;  3CCE S;  5KFE A;  3O8W A;  5AJ3 F;  2LEC A;  3UDL A;  5IC4 B;  3DU6 A;  5AXK A;  3SMZ A;  4ZCI A;  3R2D J;  3EUN A;  2RKI A;  2ZHB A;  4USK A;  3M2V B;  4DZD A;  3IGV A;  5A2Q U;  2KKH A;  1ZBT A;  4ZCM A;  4O23 A;  2F9D A;  1PGZ A;  4DL2 A;  2CPI A;  4USV A;  3VZH A;  4P2S A;  2ZBP A;  2XBP A;  1VMB A;  1FJ7 A;  4NI2 A;  1KEK A;  1YJ7 A;  3RBZ A;  2IRX A;  2J0X A;  3CDE A;  3ELH A;  2XNQ A;  3FZB A;  1TFY A;  3VVU A;  4CDI A;  4CLF A;  2HWT A;  2VG7 B;  3GU0 A;  1VBZ A;  1WHY A;  2CRL A;  2AJF E;  3D6H B;  2J0S D;  4DEZ A;  3B4D A;  1HQE A;  3I5B A;  2J7W A;  2NUH A;  5LMN F;  1GT8 A;  1A0O B;  4WXW A;  3TUP A;  4F4A A;  3PYF A;  1F5B A;  5DG7 A;  1Q4R A;  1S1W B;  3G6X A;  4KHP F;  4LF5 F;  2F4V F;  2N3L A;  4UST A;  4KYZ A;  2JC0 A;  4UOH A;  1JLE A;  4ZCK A;  5B0B A;  1IKY B;  4DF4 A;  4EWT A;  4LVO P;  3M9N B;  3GLJ A;  4TY8 B;  3M9M B;  1KQK A;  4DL7 A;  1HR0 J;  4Y65 A;  3DGV A;  5GVQ A;  1CBK A;  4NLG A;  1JJC B;  3JAM Y;  3M8Y A;  1SJ3 P;  4ZLP A;  3TUZ C;  2FVP A;  4OZL A;  1HD0 A;  4EBC A;  4OX9 F;  4DSK A;  4WPA A;  3W8P A;  3MM8 B;  2RIL A;  3GCW P;  1LQ9 A;  3GE9 A;  3UCG A;  4DUZ J;  2M7S A;  2AYB A;  4PG5 A;  1E6V A;  4PWW A;  5DGA A;  1G4C A;  1VQ8 S;  2R8J A;  1S4E A;  2IRU A;  4EMD A;  2MZQ A;  5CD4 H;  2Q79 A;  4NLX A;  4ZMM A;  2FY1 A;  2IM2 A;  4Q8E A;  4WKR A;  2OSQ A;  3TVY A;  4TU8 A;  2AU0 A;  2GVD B;  1X8D A;  3QMQ A;  4OI6 A;  3R1L A;  2Y0B B;  4UOF A;  4L3K A;  4DX6 A;  1GAO A;  1KS2 A;  1WG1 A;  5LT5 A;  1KHV A;  2OFG X;  2DKO B;  5DZ7 A;  3MGJ A;  1A7G E;  2X1A A;  2WRM A;  1ULR A;  2ZH8 A;  1BQM B;  3QO9 B;  1T95 A;  3PCO B;  1FRX A;  2R7R A;  4QZV B;  4N56 A;  4ELV A;  2PMZ D;  2ZIT A;  5C42 B;  3R2C J;  5ETL A;  3LGN A;  1RAF B;  5DGB A;  2HQF A;  2LQ5 A;  5EWG A;  3PKY A;  2CPF A;  4IG0 A;  2F8M A;  1X5T A;  4JI0 J;  4CLZ A;  5DG9 A;  2XLJ A;  5C24 B;  4MH8 A;  3QQC D;  4HEA 9;  4Y00 A;  1N33 J;  1LOU A;  3M05 A;  3IRX B;  1FA0 A;  1HHT P;  4AL6 A;  4G6V B;  3L7P A;  5L38 A;  1FRI A;  2VL1 A;  1G2E A;  4C3M A;  5L39 A;  3KK3 A;  3D7S B;  2O67 A;  3QZ8 A;  2DEJ A;  3SQG A;  4DG1 B;  3RAQ A;  3G82 A;  4O3S A;  1UMJ A;  2IIH A;  3A3O B;  4MK8 A;  2K1R A;  2GJF A;  1VOM A;  4IRC A;  2HAF A;  4NZ7 A;  1LWC B;  2AJ0 A;  2Q1L A;  3B4M A;  4PWD A;  3ZZZ A;  2HS4 A;  4CYU A;  2YWW A;  4GKJ J;  5CYJ A;  4DXL A;  1KON A;  2HHW A;  2E7X A;  2F65 A;  4J9R A;  1KTV A;  3LGM A;  2V8V A;  3ETO A;  3BRE A;  4X4N A;  2PI5 A;  1HI8 A;  3HJV A;  4K8R A;  4OV1 A;  2N4C A;  1SUQ B;  1DHM A;  4U7U D;  2VG6 A;  4C48 A;  2ERR A;  5F8G A;  2B43 A;  1T0T V;  1EZZ B;  2FVC A;  5KG7 A;  3SFU A;  3TAN A;  2VH7 A;  2BJ7 A;  1N34 F;  1V5I B;  3BN7 A;  4CP5 A;  4CCH A;  2XMM A;  3KUH A;  3I5C A;  3QJJ A;  5KFK A;  2RDD A;  3CDU A;  2LQ8 A;  5DDR C;  1BQN A;  4PG8 A;  4A46 A;  2KO1 A;  3ZXW A;  1U49 A;  4AD6 A;  1SC4 B;  3JSB A;  3R5G A;  4Z7Y A;  1MG7 A;  3HHL C;  6AT1 B;  1UL3 A;  3JTN A;  5CYQ B;  1MWZ A;  4QIV A;  1XWL A;  4M1K A;  4H4K A;  2HHX A;  2J9C A;  1JLG B;  4QR2 A;  4C0H A;  2AEJ A;  3DOK B;  4MYU A;  2UUC F;  3OR2 B;  3RR7 A;  2YNI A;  1X4H A;  4ED4 A;  2F8E X;  2W9A A;  2HFU A;  3PW4 A;  3HD2 A;  2L9N A;  2OEJ A;  4WCE Q;  4RNO A;  3IAS 9;  5LSL A;  3BDE A;  1MNE A;  3H2V E;  3T5L A;  2VQE F;  3VZI A;  1S0O A;  4FXD A;  2JH3 A;  1RT5 A;  1TP7 A;  1T8E A;  2ZDO A;  2QSW A;  2KT2 A;  3MEC B;  3RGI A;  2YBV A;  4LBH A;  4LFB J;  3O44 A;  2X3G A;  1IKW B;  1AUS L;  5JVH Q;  3KUE A;  4DV1 F;  4MFB A;  3QGI A;  1TFW A;  2HBQ B;  3HLU A;  3EDQ B;  4DSI A;  2MZS A;  5IFM A;  2YKM A;  4O3P A;  4B9S A;  4I7F B;  1HNW J;  1XTZ A;  3C66 A;  2FVS A;  2AIR B;  2LXI A;  1HQU B;  4I6Y A;  1VI7 A;  2RQ4 A;  2G13 A;  1NDL A;  3ET6 B;  2VPZ B;  4D3H A;  3CD0 A;  2L08 A;  3LWM A;  1GX6 A;  2DPJ A;  4L6V 3;  2CQG A;  3AQP A;  1HWI A;  1RXO B;  5IM0 B;  3LGH A;  4OLO A;  1QUV A;  4OX6 A;  3D4J A;  2L3M A;  2H9Z A;  4OI3 A;  2KRR A;  4KV8 B;  4H4M A;  1B0P A;  4KTQ A;  1RT4 B;  2V2Q A;  1C2P A;  2XZW A;  3MPV A;  3KHR A;  1J27 A;  1YZ6 A;  4HT7 A;  1YHQ S;  1CVJ A;  1O5J A;  4J9Q A;  1R43 A;  1FKP B;  5L9X A;  3A3P B;  3CD7 A;  2C3U A;  2ZH2 A;  4ZHR B;  4X66 F;  3PR5 B;  2KG0 A;  5ADZ A;  4BLG A;  1CUL B;  3CO0 P;  2XQC A;  2PN6 A;  1RAA B;  2MKC A;  2EBG A;  1C4A A;  2UUA F;  2NS1 B;  2XMJ A;  3TVZ A;  5FLX Y;  3FSY A;  3KK1 B;  2AGO A;  2QJ3 A;  3ZZU A;  1NPR A;  3KHL A;  4CM0 A;  3B6B A;  1KQS R;  1HW8 A;  2OEK A;  2E5J A;  4A8X A;  1NJY A;  1HL6 A;  4KHR A;  3M30 A;  3HVT B;  5EWF A;  3NL0 A;  1C0U A;  3TNV A;  3NNC A;  3MR2 A;  3GPA A;  1LWC A;  4O3Q A;  2BDP A;  1B70 B;  4IH6 A;  3BZQ A;  3MOZ A;  3FEZ A;  4AL5 A;  5ITH A;  1NSA A;  1S7I A;  2MZ1 A;  1DQ8 A;  4C8O A;  5GAH U;  3AHP A;  2DNK A;  2CZ9 A;  4KHM A;  3PVX A;  1BD6 A;  5K14 A;  3KLI A;  4DR2 J;  2DNN A;  2QV6 A;  1OYE A;  1JIH A;  5J1P A;  1N32 F;  1H6K X;  2QE5 A;  3O1L A;  1RKJ A;  3KG0 A;  4ZPB A;  2HS3 A;  1VLY A;  3MM5 B;  1T3O A;  4PXD A;  2H1Y A;  5CA5 A;  5J2M B;  2FHO B;  1BUX A;  1NSQ A;  3M8R A;  2V4J B;  2HEK A;  3CCW A;  1RTI A;  6FDR A;  5F0U A;  4ZIV A;  3MUR P;  2HQG A;  1N5Y A;  2VDI A;  2KT5 A;  2KZM A;  4J9M A;  1TV6 B;  4X2B A;  5T7L A;  3R6L B;  2HLU A;  2QLX A;  5E5N A;  1RJJ A;  5I3U A;  2BE9 B;  1S9G B;  5THW A;  5G4D A;  3D54 A;  1RYS A;  1FNO A;  1B0V A;  2FJB B;  2IYI A;  3JYT B;  1S12 A;  1PYO B;  2NZC A;  4KO0 B;  1QSS A;  2HUR A;  2V9W A;  3CJT A;  2B7B B;  1VIO A;  3HMJ G;  3I0S B;  4USJ C;  3KWM A;  1A9N B;  3RB3 A;  3PJ9 A;  3W64 A;  2HQC A;  5LSO A;  4PZV A;  2NXC A;  4ER8 A;  2YKN B;  3MCO A;  2G9O A;  2WVF A;  1Q1K A;  3J7A 1;  5A2Q Y;  3AOA A;  3G71 S;  4ZN3 A;  2W01 A;  2QZ8 A;  3U7J A;  2DXE A;  4F4W A;  3KLV A;  5KG6 A;  4B3M J;  5L9N A;  1UJ4 A;  1Y3J A;  4OYO A;  4OYB A;  2P5V A;  1RT2 B;  1QDU B;  4RNF A;  3MR3 A;  2VOP A;  2CVI A;  2GC8 A;  1D9A A;  4YR0 A;  1W7W A;  1V5V A;  3P45 B;  5CAA A;  5AJ3 J;  3S01 A;  4DV6 F;  1S1V B;  2VBW A;  4MIA A;  3CPW R;  2VHG A;  2AKW B;  3W63 A;  3M2R B;  3MR7 A;  3UN2 A;  1JLC B;  1DUR A;  2BJE A;  1F5A A;  3HPO A;  2GS8 A;  4TU9 A;  5L8R C;  2F8H A;  2J76 E;  2DIU A;  2XCP A;  2I0X A;  4ECW A;  3QT5 A;  4Z7C A;  5HVG A;  1S6Q A;  1CJU A;  4RPF A;  3FZ2 A;  1U24 A;  5IV3 A;  4NRU A;  4K4U A;  2YNF B;  2KT3 A;  4LSL B;  2LEP A;  1VRQ C;  3K0J A;  3T6B A;  3HI9 A;  3AXK A;  2R7X A;  5KFH A;  4FN5 A;  2ALY B;  2W8L A;  3WX4 A;  2J6U A;  1RAH B;  4B9V A;  2EXU A;  3SFG A;  2CJQ A;  4OV6 A;  2C28 A;  5GAG U;  3D67 A;  2ATC B;  2M3D A;  5LMN J;  4XDD A;  1RBL A;  1ZH5 A;  3D5M A;  4KHP J;  4LF5 J;  1FFG B;  1LW0 B;  1JNR B;  2AV5 A;  2AJ2 A;  3EGV A;  3UVJ B;  3DGP A;  3H40 A;  2ADC A;  3GTY X;  4NXN F;  5KFO A;  3CGI A;  2HS0 A;  3EX7 B;  2W2O P;  2OMO A;  5AXM A;  3MI7 X;  4OJG A;  3L7U A;  4F50 A;  4DDF A;  4C4W A;  1UEK A;  1I6J A;  2XMU A;  2EG2 A;  1YJN S;  3M8Z A;  2OKQ A;  1MRO A;  1WDD A;  2BJ9 A;  2RVJ A;  3C6T A;  4TLQ A;  1LWX A;  3C46 A;  3OR1 B;  2VQF F;  1H2V Z;  1JLF A;  1F0X A;  4CLK A;  1NKC A;  4F4K A;  5M2P A;  1VQ4 S;  3DLH A;  1H38 A;  4FXV A;  3MMB B;  4JI4 F;  2G2O A;  2CVE A;  2NRE A;  5G0R B;  4WXO A;  4URQ U;  1IJF B;  4QU6 A;  3FC9 A;  1KHW A;  4FNH A;  3W3S A;  3BH6 B;  4A8W A;  2Z0G A;  1EKR A;  1HNI A;  1SH2 A;  4QW9 A;  2E1A A;  4OIX A;  2A6M A;  3RZA A;  3DYA B;  2PI4 A;  1QTM A;  3Q2S C;  1R8H A;  3BBC A;  1G6B A;  3LQV A;  4I69 A;  3BH7 B;  1D9D A;  2ZDP A;  3CIM A;  2K7K A;  3VCD A;  2DXF A;  5HBM A;  2B4U A;  3OL8 A;  1H98 A;  3FKB A;  3MMC A;  4AND A;  2MGZ A;  3MUT P;  1B7Y B;  2V4J A;  2YWG A;  1MW7 A;  3ZZP A;  3Q23 A;  4NA3 A;  3EGN A;  5CCM A;  1WOP A;  1DTT A;  3ZTO A;  2QLB B;  2BE2 A;  1ZM2 A;  1L3K A;  1ELO A;  1Y4Z B;  2DEI A;  3PR4 A;  3DHW C;  2A18 A;  5CYM B;  4EK2 A;  2BAC A;  3UN5 A;  1XC9 A;  2BM0 A;  3TA2 A;  4ILR A;  3M2U B;  1NHU A;  4KO0 A;  1UAW A;  2Y0S D;  1WNE A;  2BKN A;  2JSX A;  1CJK A;  1F9H A;  4RUC A;  1M5H A;  4OI1 A;  5J1E A;  1Y3K A;  3JSM B;  3FK4 A;  3N6M A;  5GAE U;  3A12 A;  2LDI A;  3MM9 B;  5JJB A;  1WEY A;  4F3Q A;  4C8M A;  3ZZR A;  3KHH A;  2ROP A;  4OYM A;  3KJF B;  3HM9 A;  1NZA A;  3R1H A;  2DHG A;  4DX8 H;  5K8M A;  2OSR A;  3LF0 A;  2VFU A;  1RT2 A;  3NWR A;  5CZV A;  2DGT A;  3ENV A;  4ZJO A;  1YG0 A;  2BAB A;  2U1A A;  3IG1 A;  1KBR A;  4CO4 A;  2XS7 A;  4NZ0 A;  2CZV C;  1WC0 A;  4Q2M A;  2RB7 A;  4M95 A;  4DR7 F;  4X4S A;  3MED A;  3OD2 A;  2HRY A;  4Q45 A;  2D3U A;  2XYH B;  1BMQ B;  4TQS A;  4NYO A;  2IRY A;  3QLH B;  5C5J A;  3CMA S;  1F9E B;  4E0D A;  1ZET A;  1RAD B;  3W5X A;  2CPX A;  2CXE A;  2MY8 A;  1N34 J;  5ETQ A;  1R0A A;  4RWX A;  3NBP B;  5C25 B;  3GJT B;  5KTQ A;  2ZH1 A;  4LFA F;  2O3D A;  1OY9 A;  1TK0 A;  2ZJQ Q;  4IFV A;  1N0V C;  2MKK A;  3K7R A;  1DAR A;  1FD8 A;  2CJB A;  3DLK B;  4P74 A;  5GMK a;  5HRO A;  4BWJ A;  1RHQ B;  3KLF B;  4HTJ A;  2XLK A;  2E9R X;  2VUG A;  5DLF A;  4J9U E;  1IBL F;  1KLN A;  4ED2 A;  3DKD A;  4CTA B;  3Q0A A;  2W9B A;  1WAC A;  1FK9 B;  3OTE A;  3UVJ A;  2UUC J;  3HP6 A;  8RUC A;  3MDF A;  3FMB A;  2PEB A;  4JI2 F;  2R7O A;  2H5E A;  4DX5 A;  2YQ3 A;  3GIR A;  2XEX A;  3EXY A;  2CNN B;  5KFF A;  2LU1 A;  2X1G A;  1SL2 A;  1XMQ F;  3LOU A;  1ZPV A;  3BGR B;  4IG3 A;  3R9L A;  3LAL A;  5BYS A;  3MMA A;  3R6G B;  1FXD A;  3U02 A;  4DV1 J;  1FD2 A;  2JJ4 D;  2Z30 B;  2HQD A;  1T9U A;  4QR0 A;  4DCP B;  4IO9 Q;  4A8K A;  2AJ4 A;  2ZUA A;  3MHY A;  1SL1 A;  4J9S A;  1VRT B;  1VJW A;  4A8M P;  2AEM A;  5H1S V;  2RU9 A;  2ZH6 A;  4O3O A;  3KMS A;  4NLW A;  5ETP A;  1T9V A;  2E1C A;  4UOG A;  2ZH3 A;  4A48 A;  1AB8 A;  3QRR A;  3DRX A;  1IKV B;  3FEY B;  3GWC A;  4QCL A;  4DFP A;  1XN9 A;  4LF6 F;  3I87 A;  4F2S A;  2DT9 A;  3VVT A;  3R5C A;  3BSC A;  1KDN A;  3GIM A;  4AQY F;  1Q78 A;  2ATL A;  2V0N A;  4WWS A;  1JX4 A;  4B02 A;  3HHD A;  2RQK A;  3W5Y A;  2QO3 A;  5HN0 A;  3EGW B;  3QIP B;  3M8Q B;  1IN0 A;  4LFC F;  3RRK A;  1TKX A;  2FB0 A;  2FGC A;  3SCJ E;  3I0R A;  4PKD B;  4Q8F A;  5GAE I;  4MTP A;  2NXU A;  1C1C A;  3HFK A;  4X66 J;  2MMY A;  3OXF A;  2JLF A;  3M7V A;  1RK8 A;  5EHH A;  3IM8 A;  2N4D A;  2WOM B;  1UFL A;  1QE1 A;  2UUA J;  4ZOS A;  4QU7 A;  1FE0 A;  3OSN A;  2EFG A;  2B4V A;  2VZ9 A;  1QTN B;  2QL5 B;  3CCT A;  4FNI A;  1P27 B;  1JLQ B;  3MM9 A;  2XG8 A;  1RA6 A;  4DCJ B;  2V5H G;  3OVS A;  1YZ7 A;  5KFR A;  3GON A;  3SSS A;  2B5J B;  4ED1 A;  1MWQ A;  4FYD A;  3IGN A;  2CKW A;  3R5B A;  2B6A B;  2CAJ A;  3BF4 A;  4QWC A;  4BDP A;  4P2X A;  4ZVT B;  2J7K A;  4LBP A;  4ILL A;  2YPY A;  4WII A;  4X4P A;  2LP4 A;  1H72 C;  2KB2 A;  1KVI A;  1M5O C;  2HHH F;  2FJX A;  3DN9 A;  2PT0 A;  2AX1 A;  4QWD A;  2KJW A;  1Q5Y A;  1X7V A;  2B9Y A;  2VOO A;  4PR6 A;  2ZOF A;  3R7B B;  3UDE A;  4DL0 C;  1LW2 A;  3IN5 A;  5BR8 F;  2QX0 A;  1N32 J;  2GW8 A;  5HVF A;  2D3Z A;  1SJ4 P;  2HFO A;  1YIT S;  2V94 A;  2VC1 A;  2OPS B;  4C3L A;  2VJV A;  2KDO A;  3MEE B;  3QLH A;  1ICE B;  3HDS A;  1RU1 A;  3KK2 B;  3W2V B;  1GQE A;  2JEJ A;  2Q6C A;  2BJ1 A;  4ZVS B;  2WTF A;  1HMV B;  2V8P A;  2HVH A;  2OIH A;  4XK8 C;  1KFD A;  2C2N A;  1TL1 B;  1UPP A;  2CYY A;  2MHE A;  4RNH A;  1ZZF A;  3T1A A;  5T41 A;  1K8A T;  1WJ9 A;  5EWE A;  1EQM A;  5K8P A;  3G8T A;  1V6H A;  4KH1 B;  4C0O C;  1NK0 A;  3HVR A;  3TQ1 A;  1D8Z A;  1SI9 A;  2GAG C;  1FE4 A;  4MYT A;  4KSE B;  2OAU A;  2ABY A;  4CLS A;  4NML A;  4OI4 A;  3KOA A;  4M5H A;  3THT A;  4A47 A;  3CTR A;  3N6N A;  4XIU A;  3W66 A;  4ZKA A;  2BJD A;  2HIY A;  1Q8I A;  1HNV A;  1HBO B;  3AQO A;  3RJM B;  3CJS A;  3OTB A;  5D0G A;  3LTO A;  3TZZ A;  2QG9 B;  1D0E A;  1CJT B;  3W8G A;  5K8O A;  3DDN A;  7FD1 A;  3FCW A;  2H5J B;  1HPZ A;  2W4P A;  3TJ8 A;  2WW8 A;  4NE9 C;  1FRJ A;  1PJ6 A;  3NGK A;  3S1T A;  1ZM4 A;  2HQ3 A;  3PRD A;  1RDR A;  4EFA C;  3K17 A;  2Z58 B;  4DV6 J;  3P49 B;  1SBR A;  3DLJ A;  1UVM A;  4MJK A;  4LF4 F;  3BDP A;  3PIO Q;  1UWB B;  4FPI A;  1GFW B;  3D0G E;  2KG1 A;  4JI6 F;  1S1T A;  5KFD A;  9ATC B;  4DR3 F;  2ZOG A;  4K59 A;  1NZ8 A;  3WBZ A;  3IBW A;  4W92 B;  3IBF B;  1DY3 A;  3VR1 A;  2FLN A;  4LF8 F;  1BQX A;  2D1C A;  4AXI A;  4DSJ A;  3TAP A;  2IBK A;  3H5U A;  1LK7 A;  2KXF A;  5A8W A;  4MIB A;  4LUB A;  1N4L A;  2N3O A;  4C2M A;  2FVQ A;  2HQI A;  2I5J A;  2C1E B;  4I2P B;  3MUV P;  4RKU C;  4D3G A;  2OUG A;  3TVK A;  1F9F A;  1EIY B;  2J0Q D;  3FDS A;  3ITH B;  2DB1 A;  1X9M A;  5HLF B;  4RNN A;  1GK8 A;  3ISN C;  4RW7 B;  2EVZ A;  3K89 A;  2KJV A;  5D4O A;  2R7W A;  3WIV A;  2RDJ A;  4OHW A;  3OJS A;  2B8Q A;  2B7C B;  1ZTW A;  4NXN J;  4UZB A;  2XMT A;  4Y2I A;  4HH1 A;  1NJX A;  2WOM A;  3TQE A;  3HSZ A;  5C7P A;  3V4I A;  5B08 A;  4QPX A;  2LA6 A;  2AMC B;  4YUD A;  1RAI B;  5F8J A;  3PO4 A;  3BGU A;  3ILL A;  4RNM A;  4M5D A;  2WHO A;  1UWA A;  1T7P A;  2NQP A;  1X4E A;  3QFH A;  2L9D A;  3T1H F;  2OPP A;  1ACM B;  1QD1 A;  4P10 A;  2CQC A;  1MU2 B;  3UCU P;  3EYZ A;  1B99 A;  1GTH A;  3T5K A;  2B5J A;  2VFT A;  4ZP9 A;  4DS5 A;  5RUB A;  4YB1 P;  1H7W A;  3TEH B;  4JI4 J;  1Q79 A;  2NSC A;  1RLC L;  2R3V A;  1TKZ B;  1RT7 B;  3SQO P;  4MKB A;  2IM3 A;  3JSY A;  2IBO A;  2IM1 A;  2HG4 A;  2ZKT A;  2O66 A;  3MCM A;  4N77 A;  4Y2A A;  4LR9 A;  1SV5 B;  1WI8 A;  1KKH A;  2MLY A;  4X4V A;  1R8B A;  4USI A;  2YX7 A;  5J2P B;  4YHH F;  3VQS A;  1VRU B;  2OPS A;  3AT1 B;  3PV8 A;  1VS3 A;  3DOL A;  2Y8W A;  1PJ7 A;  5EN1 A;  3C6U B;  2CWX A;  2IC3 B;  2PEH A;  1TK8 A;  3W2V A;  3HCX A;  2EFQ A;  1RUS A;  1E6Y A;  4OZ3 A;  3VAK A;  2UVU A;  3CCL S;  2JC1 A;  2WZ1 A;  2XY7 A;  1FRK A;  3I4H X;  3FRY A;  5KT4 A;  3UO0 A;  4DBQ A;  3WHI A;  1U0H A;  3HHL D;  2W7A A;  5MLC V;  1D09 B;  2XGP A;  3W61 A;  1FNM A;  2AQ4 A;  3ONQ A;  1S9E A;  1TEL A;  2M4M A;  3ETM A;  1C0T B;  1OPI A;  5DM7 Q;  5FD1 A;  1ZS6 A;  4KFB B;  5IOL A;  5E33 A;  3IFE A;  1APS A;  1FWL A;  1U2R A;  4ED7 A;  2QMX A;  3PHE A;  1TL3 B;  3IR6 B;  1F6T A;  1IBC B;  4IFY B;  5DQG A;  1RAC B;  4AT1 B;  1HBO A;  4F04 B;  3C14 B;  3CJR A;  1Y11 A;  3DDI A;  5D8H B;  4TYA A;  3GP9 A;  3GZ7 A;  2OPR A;  3DRR B;  5A8R A;  5A6P A;  1VBK A;  1VFJ A;  2FC9 A;  3OHA A;  1S59 A;  1M0S A;  3NLC A;  2XY6 A;  1LK5 A;  1EET B;  1FKO A;  3ICL A;  3BKF A;  5I42 B;  2HW3 A;  2XWX A;  1NO8 A;  3K57 A;  1TUG B;  3Q8R B;  2W7P A;  4CQ1 A;  4RW9 A;  4UUW A;  2PMH A;  3DMJ B;  3G4S S;  2FZG B;  3KLG B;  3DOM A;  1PC4 A;  1IR2 A;  3OVB A;  1RWP B;  1N6Q A;  4IUF A;  1EP4 B;  2GIR A;  4MT1 A;  4DR7 J;  1I51 B;  4GVB B;  3OFG A;  4ZIW A;  1S1X B;  3H5Y A;  2HMI B;  3CDB A;  2A6O A;  3TJ9 A;  4P6Q A;  2X1F A;  1L5U A;  2C3O A;  2MB0 B;  2CAD A;  2R2U A;  4F67 A;  3M8S A;  3RRH A;  5L1L A;  4LFA J;  1Y0H A;  2P9G A;  1FNX H;  3LP1 A;  2ZFH A;  2HWI A;  1NLK L;  2QEX S;  1M5S A;  2R8I A;  1S1U A;  1RTD A;  3LP2 B;  4IDK B;  3L4B C;  4ICL A;  4OFZ A;  4KJI A;  4G65 A;  4J9O A;  4O4R A;  3QSY B;  4YME A;  3KMQ A;  1VYA A;  1PG5 B;  1NK9 A;  4JI7 F;  3CCQ S;  3CE8 A;  1NKE A;  5HMW A;  3K5L A;  3IS9 B;  1JWW A;  1IBL J;  3ITH A;  4OMF G;  2KFY A;  3M1V B;  1IJE B;  5ETT A;  4DN0 A;  1NK6 A;  1RI7 A;  3SSR A;  3BYR A;  1TMJ A;  2XMK A;  3DRY A;  1KQG B;  1T9W A;  4NCG A;  2VFR A;  5KG0 A;  4PUO B;  2HZV A;  4JI2 J;  2R9L A;  4K4Z A;  1RTH A;  3HKZ D;  1X60 A;  2IAJ B;  3VAI A;  1VC5 A;  3DI6 A;  1JLB A;  2DRD A;  3PNI A;  2X3D A;  3N79 A;  1RYR A;  5J2Q B;  3FGV A;  1XMQ J;  5ETV A;  2C2M B;  2XI3 A;  2E5G A;  1H7X A;  2YX4 A;  3GYN A;  2W4C A;  4OYX A;  2BMB A;  2B4P A;  3D0I E;  1WI6 A;  4ZIT A;  4CNY A;  5L1I A;  2UV8 G;  2A3J A;  2HNZ A;  3T41 A;  3EJM A;  3PW0 A;  3TAM B;  2EC2 A;  4LT6 A;  4JI8 F;  4P7V A;  1FT8 A;  1UZD A;  2ZC4 A;  4EYH B;  2OFH X;  2EK1 A;  3CCZ A;  1PBU A;  2DR5 A;  2OPQ B;  3C2P A;  1RAB B;  1DLO A;  4R5P A;  1VCT A;  4NX9 A;  3Q8V A;  4RL1 A;  1D8Y A;  2M70 A;  4CZC A;  3FFI B;  1PIE A;  1WHX A;  2KH9 A;  4CH1 A;  4QW8 A;  2AP6 A;  2CDQ A;  4G1Q B;  4LF6 J;  3W2W B;  5A8K B;  2G1H A;  1IR0 A;  1F1B B;  2UXC F;  4LQ3 A;  3PRV A;  4F26 A;  4WFX A;  4URG A;  4HR2 A;  2JRS A;  4ELT A;  3KLH A;  4AQY J;  1GH8 A;  3MD3 A;  1T03 A;  2VBX A;  2DY9 A;  5IZH A;  2F40 A;  1AFJ A;  4R8U A;  4YB7 A;  2GAH C;  3AH6 A;  3GQC A;  3H4D A;  1MMD A;  4K2J A;  1C1B A;  4JI5 F;  1NPP A;  1OWX A;  1NEE A;  3B8H A;  2MY7 A;  1MSW D;  2J9D E;  4LFC J;  1VQ9 S;  4ZVG A;  2FHK A;  2RF2 B;  3HX9 A;  3MFH A;  5HQ8 A;  4A8F A;  1RP5 A;  3J81 Y;  1OPZ A;  4FF3 A;  3UNG C;  3DNC A;  4OYA A;  4OYP A;  1XBW A;  4DSL A;  3SBM A;  3OPK A;  4ECV A;  4EEY A;  2AWZ A;  2H4W B;  2A0F B;  3VGU A;  5M2R A;  3PW7 A;  1TL3 A;  4KGM A;  4OYW A;  5K5M A;  4DPU A;  3HZG A;  5A0Y A;  1U26 A;  2LA4 A;  1S77 D;  2H54 B;  1N0U A;  1OY6 A;  1ZTT A;  3DRR A;  4JUZ A;  1M5P C;  1T02 A;  5B0A A;  2ASJ A;  2F7V A;  2IVF B;  1EET A;  3Q83 A;  1IR1 A;  2LMI A;  2JVR A;  4O44 A;  2Z2L A;  1S57 A;  4R25 A;  3J7Y I;  2R2S A;  2HHH J;  2XSJ A;  2MQO A;  1TR0 A;  2DD8 S;  3W7B A;  4TNO A;  3PRB A;  2D9O A;  4H4O B;  3J81 j;  1UW9 A;  5KFM A;  3KLE A;  3CME S;  3UD3 P;  3H5X A;  2MDA A;  5KFY A;  2QL9 B;  2GVZ A;  2VA3 A;  5BR8 J;  2D74 B;  1NRK A;  2FIU A;  4K0K F;  2BQU A;  1ROF A;  3V6D A;  2CG4 A;  4DLE A;  4UY8 T;  3MZI A;  3DRP B;  2L41 A;  1QSL A;  2MJN A;  2WON A;  2X1B A;  4LSN B;  4Z2X A;  2NLW A;  1GXT A;  1HNZ F;  3A13 A;  4O0I A;  1UPM B;  3WC2 A;  2LFV A;  3ILJ A;  3KG4 A;  5DDP C;  2MLX A;  2XZD B;  1YKW A;  4PG6 A;  4IDK A;  1D1U A;  2QYG A;  3Q22 A;  1WTF A;  4AFF A;  4C8L A;  1XNR F;  5KFB A;  2IHR 1;  4I2Q A;  1S99 A;  4DV5 F;  1UET A;  1HYS A;  3KUG A;  3JTO A;  3KJQ B;  1ZZN A;  3N28 A;  2V4Q A;  1PO6 A;  1TMM A;  1R89 A;  4C8N A;  3W5Z A;  3S8S A;  2KU7 A;  2N82 B;  3HSD A;  4F3O A;  5AXN A;  1KLM B;  1T3N A;  1KSP A;  3DRS A;  2F63 A;  3TX0 A;  5EUH A;  4DWI A;  2DNG A;  2W9C B;  2ZNZ A;  3DLB A;  5E3C A;  1DQ9 A;  3DCA A;  2GGP B;  4B3R F;  3S7R A;  4RBU A;  1SPB P;  2Y1L B;  2YNG A;  5B0G A;  4DV7 F;  3NEK A;  4ID5 B;  1QAI A;  3FSI A;  4Q0B B;  2QGF B;  2XB2 D;  3HHE A;  1UEU A;  2UXD F;  4N7T A;  5BJR A;  3PTW A;  1NUE A;  1SIZ A;  7AT1 B;  2BJ8 A;  2CWK A;  4LF4 J;  1REV B;  2RHS B;  3H2L A;  5HVH A;  4IR9 A;  1CLF A;  5E0O A;  2J9E A;  4JI6 J;  3UCZ P;  5AE3 A;  4ZLL A;  2RE1 A;  4DR3 J;  1V3Z A;  1N5T A;  5JVG Q;  1KFS A;  1YBU A;  3BBB A;  1RT1 B;  3FBB A;  4WFY A;  5KFA A;  4X4R A;  1IVZ A;  4F4Z A;  2LEA A;  4F8R A;  1TK5 A;  4F4Y A;  1HHS A;  1T05 A;  4LF8 J;  2MKI A;  3RUB L;  5F3T A;  3D6T B;  3SIP B;  4LVN P;  5KOW A;  3LUY A;  2VC0 A;  2ACY A;  1Q7Y T;  3JB9 k;  2KFN A;  3ZTS A;  3M8P A;  1H74 A;  1RZM A;  3R5J B;  2XTJ P;  2R7V A;  4JV1 A;  1BHN A;  2EFP A;  3CMQ A;  2E5H A;  3H90 A;  3HHL A;  4LF7 F;  2EPI A;  3GSD A;  2FY8 A;  1SB6 A;  1TVR B;  2RF2 A;  2R2R A;  4XTT A;  3D6F B;  3D1O A;  4MK9 A;  5DZ6 A;  1RWM B;  3LPY A;  3CCU S;  5IQ6 A;  2B9X A;  1RT6 A;  4YOE A;  4DS4 A;  2HND B;  4NLO A;  1RT3 B;  1XMO F;  2RJZ A;  4FVC A;  1JXL A;  4ILM A;  4RW6 B;  2E5L F;  2XMV A;  3GIL A;  1VQ5 S;  3PYG A;  4F36 A;  5IS2 A;  4HL9 A;  2BVZ A;  2DNQ A;  2XHC A;  5LXR A;  2YH0 A;  4GC6 A;  5FJ4 A;  1AYE A;  2V4R A;  3CJ3 A;  3FSX A;  2DNH A;  3K5O A;  4QYR A;  4F7V A;  4ECR A;  1U1K A;  1NBE B;  3JQJ A;  2AT1 B;  4K5S A;  4YEA A;  3W65 A;  4O4G B;  1VIX A;  3V81 B;  5BYR A;  4E8U A;  3HKW A;  1W26 A;  2W25 A;  2Z56 B;  2IVM A;  2B9E A;  2GHW A;  3CC2 S;  2P9C A;  3UR0 A;  4C0B A;  5B0E A;  3PG9 A;  3MM6 A;  4OJH A;  3I31 A;  1YRX A;  3C16 A;  3PO5 A;  9RUB A;  1VQK S;  2HHQ A;  3QT7 A;  1Q95 G;  4DR1 F;  4C11 A;  2BAN B;  1VJQ A;  2ZE2 A;  3UR3 C;  1Q86 T;  2BEF A;  1SQE A;  1HLW A;  1K9M T;  2BR0 A;  2CJX B;  3ZTR A;  1CPZ A;  3NS5 A;  3G96 A;  2J8S A;  4YHH J;  2IDE A;  1AZS B;  1TUW A;  1DJ0 A;  3OLB A;  1XR7 A;  5A76 A;  2R7Q A;  2VG5 A;  4YDX A;  1SQG A;  3QT8 A;  4M5K A;  4PCQ A;  3C8Y A;  4HVZ A;  3DU5 A;  2P8I A;  4DHV A;  3AB2 B;  4N8O A;  2JOQ A;  2RML A;  2ROG A;  5KG5 A;  1AFI A;  1B4S A;  1SJF A;  3IP0 A;  1Y10 A;  4LSN A;  1WWH A;  4ECT A;  1JLA A;  3PAC A;  3SDE B;  3QAU A;  1U09 A;  1NSK L;  3V2U C;  1RAJ A;  2CPZ A;  1MN7 A;  3NXZ A;  1NK7 A;  2PII A;  2QFI A;  1M5K C;  4RW4 B;  5GME A;  4B08 A;  1CS4 B;  4NWB A;  1O0P A;  2P6S A;  2HRU A;  2ZNY A;  3N9U C;  4DLG A;  2O5D A;  1UJ6 A;  1M1G A;  1FER A;  4KC5 A;  1EJ7 L;  3T3F A;  5F8H A;  2XS5 A;  4P71 A;  1LWE B;  1DTQ A;  4GC7 A;  3VAG A;  2POK A;  4L3N A;  2UP1 A;  1S7H A;  4YP3 A;  4FXW A;  1OSC A;  4JV0 A;  3Q24 A;  1NK8 A;  2IPO B;  2CJK A;  3MAQ A;  1KC8 T;  1NB2 A;  2CQ2 A;  3QBC A;  3UDV A;  5DQH A;  5JMN A;  2Y1J A;  3C15 A;  2GGP A;  1UA1 A;  1J5E J;  1F60 B;  2UVV A;  2V9K A;  3MOJ B;  5A6W A;  2XWY A;  2DNY A;  4PG7 A;  4LRC A;  3J80 U;  2CJ9 A;  5E3Q A;  5I4M A;  4OJ3 A;  4RBT A;  2J6T A;  2J7U A;  1S97 A;  4QPT A;  1LEO A;  2R8K A;  1JKH A;  3CJ5 A;  3ENA A;  5HJY A;  4CLW A;  2UU9 F;  4B3O A;  4ZVF A;  4YB6 A;  4PQU A;  3QID A;  2FLO A;  2GIF A;  1U1Q A;  2UV8 A;  3V6J A;  3UPF A;  2JFD A;  2R7S A;  1HBU A;  3QRQ A;  2ZD1 A;  1ARO P;  3DLL Q;  4WE1 A;  2K06 A;  2MLZ A;  1SC6 A;  1Y5I B;  3CC7 S;  3CUN A;  1B0T A;  2QIF A;  2XHW A;  3BM7 A;  4R0J A;  2MQQ A;  1IXK A;  3GFY A;  3AOD A;  4CT9 A;  4USH A;  1WOO A;  2LXF A;  1FHT A;  4JI7 J;  2B8P A;  2FHJ D;  3QGH A;  1XK8 A;  3D3C J;  4K4Y A;  1XMB A;  3KKF A;  1S10 A;  1VQY A;  3DXB A;  1IKX B;  3BO3 A;  2V2V A;  4DR6 F;  2WVC A;  1X9S A;  3M6U A;  3A8J A;  3M6W A;  3B54 A;  8AT1 B;  3M8W A;  3NRB A;  5IC6 B;  3ZZO A;  3GV5 B;  5KFW A;  1R8A A;  5KFG A;  2I38 A;  1SQF A;  2VV5 A;  2ILY A;  1WC5 A;  1LFP A;  4NAS A;  2V50 A;  2RRA A;  2UUB F;  2ZH9 A;  1SJQ A;  1OIA A;  2HBY B;  2XY5 A;  2VF3 A;  3TZW A;  2KHD A;  5SZT A;  2EWH A;  1FRL A;  3NGT A;  2GO9 A;  1WC6 A;  4L72 B;  3D0H E;  2EKN A;  5HQL A;  1TL4 A;  4NZ6 A;  1MMN A;  3BPD A;  3RB0 A;  1HBN A;  4JI8 J;  2H48 B;  4J9P A;  4ED0 A;  4HT5 A;  1YTY A;  4CI0 B;  2XC9 A;  4DF8 A;  2HVE A;  3UD5 A;  1TU0 B;  2QLF B;  1QAX A;  4JV2 A;  1QY7 A;  4NLT A;  5LMU F;  3K5P A;  3M2V A;  3QAT A;  2F4F A;  2HVD A;  4X64 F;  4PXC A;  3TA1 A;  1Q8K A;  2UXC J;  4Y2M A;  3BV8 A;  4NLP A;  1JB0 C;  3MEG B;  1WG4 A;  1AT1 B;  4TN2 A;  2XCA A;  3IRW P;  5KAK A;  3NGD A;  1XJW B;  2ZBC A;  3QGG A;  2Z4P A;  2E1R A;  3OFF A;  4PG4 A;  2OJ3 A;  4JI5 J;  3D28 A;  3RW6 A;  4P75 A;  2VG7 A;  3G8S A;  3H25 A;  3GMG A;  4DR5 J;  2DNZ A;  2YTC A;  3P5T L;  3ZNJ 1;  3Q8P B;  5HSP A;  4DSE A;  1XR5 A;  4B3T F;  5FDL B;  4UF4 A;  1XER A;  4O3N A;  4ZP7 A;  3WC0 A;  2JEI A;  4ECQ A;  1S1W A;  4HAC B;  3WIU A;  2ZKU A;  3KDN A;  3NCP A;  3LP0 B;  4B3S F;  1N8R T;  4A8Y A;  1S6P B;  3DM2 B;  2IJN A;  3BSA A;  2JNJ A;  2DYA A;  1IKY A;  1QLN A;  3OXL A;  5B0C A;  2QMU B;  2W8K A;  3V6K A;  2DXD A;  4TY8 A;  1VQ7 S;  3Q8Q B;  4WFA Q;  3C3L A;  2C2E A;  4JI3 F;  3GSI A;  3EWG A;  3CJK B;  1WDT A;  1NND A;  2GQC A;  1RGV A;  4NYZ A;  4M5J A;  4ES1 A;  1HFE L;  3MPY A;  5H9F J;  3MM8 A;  3G9C A;  3RBE A;  3JQM A;  2ZH5 A;  4FPR A;  5D77 A;  4GMK A;  4RUA A;  3F41 A;  1D3W A; 
#chains in the Genus database with same CATH homology
 4LBI A;  3ZO7 A;  1S7I A;  1MWQ A;  3ZNJ 1;  4LBP A;  4LBH A;  3ZNU A;  4FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...