3ZNUA

Crystal structure of clcf in crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MLYLVRMTVNLPRNLDPREEERLKASEKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp.
pubmed doi rcsb
source organism Rhodococcus opacus
molecule tags Lyase
molecule keywords 5-CHLOROMUCONOLACTONE DEHALOGENASE
total genus 26
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02426 MIase Muconolactone delta-isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Dimeric alpha+beta barrel 3znuA00
4LBHA 1MWQA 3ZNUA 1S7IA 4LBIA 4LBPA 4FPIA 3ZO7A 3ZNJ1
chains in the Genus database with same CATH superfamily
5HQLA 3PRBA 6FD1A 2WHOA 1R0AB 3RR8A 1K47A 1S7IA 1CJVB 3FMBA 3I0RB 3Q89A 3QPIA 5HMXA 4ZPAA 3OLBA 2XS2A 1LWCA 4KFBA 4CLLA 4CTAB 4DPYA 4IDKA 2EI5A 1U48A 5H9EJ 1LFWA 4QIVA 2HYIB 4IRDA 1F5AA 2DNHA 1NKBA 1NDLA 4H4OA 3NAIA 2ASYA 1TP7A 2QT7A 2GMJA 5D4OA 2E1RA 3E01A 3JB9k 3P8BB 4WIIA 1FRIA 2VDIA 1UZDA 2IHR1 4DLEA 4J91A 1X0PA 2IRUA 4ZCKA 2OD4A 4JI7F 1DFDA 2DHHA 4OMFG 1HQEB 4ZVEA 2B3TB 3VR1A 1JXVA 3M8YA 2A2CA 2AD9A 2C2DA 2DR9A 2P9CA 2ATCB 1S9GA 3N6MA 4JV5J 2R8KA 1X4DA 4U7UK 4ID5A 2BQRA 3I87A 2FJEB 2PI5A 2R7OA 3WIUA 4KV8B 4RBVA 1K8AT 2CJ9A 4R5PA 1MN9A 2B6AB 4ZA1A 1N0VC 3T9NA 2Y9HA 2L3MA 5J1EB 1S97A 4NWBA 1F2HA 1HQUB 5JVGQ 3PKMA 2ZM6J 2LECA 2HK3A 2CWXA 3RB4A 2CQBA 2HVEA 1RCOB 4O4RA 1WF1A 5LM7E 4A8SA 3P5TL 2ZH2A 3DLLQ 5GAGU 3OJSA 1N56A 1FKPB 3T6JA 3WX8A 3CWJA 2GQCA 2FJAB 2WTFA 2JLGA 3ITHA 2ALZA 1EARA 4H4MB 1WOSA 2ZH9A 2KL8A 1Y4ZB 3OTCA 4ATNA 1WI6A 4X4PA 3H5YA 3M8SA 1WF2A 1UVLA 2RJZA 1CJUA 1A6LA 4USTA 1R27B 5I42B 2YNHA 4J9SA 4YHHJ 4QYZJ 2QFIA 1T95A 2M88A 2V4JB 2B5JA 3AD9C 3HDSA 2VJVA 1BWEA 3QO9B 3B4DA 2I9SA 3BKUA 4OJ1A 4U67Q 2DGQA 1MMDA 1HHSA 1FI4A 2HHPA 4I68A 4LRBA 4DQRA 4A8KA 5ETNA 4OZLA 1UVIA 1N5TA 3LGMA 2FJBB 4UW2A 4HVZA 2V69A 4Z7CA 5GAHI 3VV2B 2MGZA 2IYIA 2M4MA 3QJLA 1WSVA 1YQHA 3MM7A 2J5AA 1GMUA 2Z0GA 2A6MA 3S1TA 3UN5A 1XWLA 4IG3A 1F2GA 1CS4A 3N28A 5C2CA 4IFYB 3DLEB 4RW9A 1H72C 2WSFC 4M5DA 3RBXA 4D3HA 2C28A 1QSSA 4C0OC 1QAXA 3QT6A 2J7KA 2XBPA 1YVFA 5A2QY 3QGIA 3DYAB 2XSJB 3CO9A 2VPXB 3W8PA 2MKIA 4I64A 3MR7A 1NB7A 2VH7A 1MMNA 3RYLA 4IRCA 3C66A 1JJ4A 3JTPA 1RP5A 3LAKA 2IBKA 1H3DA 2JLFA 5F9NA 2W7OA 5HBMA 3J80U 2JFKA 1P1TA 2OEMA 2E9ZA 4RBUA 3KLGA 1B7YB 1PYTA 3GILA 4PZVA 2BANA 1TUGB 5CYQB 2YBVA 1WC0A 1PBUA 2M52A 2NUHA 3I5BA 3CCSS 2V34A 5F0UA 1B64A 1F5CA 4ED5A 4A8WA 1VQPS 2VODA 5KG6A 1YX2A 5CYMB 3J80Y 5HP1A 2EFNA 3O3LA 4X62J 2DNZA 4QYRA 1HNZJ 2EBEA 1N33J 2N7YA 4LQ3A 1H74A 3C19A 4CDIA 5GAEU 5E7OB 1HFEL 1HR0J 1KTQA 2CPXA 2ZBCA 2W9CA 4KKOA 2HFNA 3DLGA 1VRUA 1TUVA 2LEAA 1BQNA 5M2UA 4WFBQ 4JI4F 3D54A 4RJVA 5B0BA 5T7LB 4B9NA 1J5OA 5KFUA 2KI2A 3KK3B 3MEDA 2R8GA 4V19J 1LKZA 2RVJA 1AB8A 1EIYB 5ETSA 1WELA 2FLPA 4RW4B 4DR5F 1UTAA 4LF9J 1LW0B 1TAQA 1GXLA 5B0CA 2RU9A 3CMES 3BS9A 3V2UC 3J7A1 1WTFA 4C7QA 1GAOA 2DITA 5KG3A 3SMZA 2IMWP 1DTQB 1KS2A 2RF2A 4Y3CA 4DV5F 2MLXA 1N5YB 2IM3A 4ZPBA 2PFFB 3QGGA 3BGOP 4BC9A 4C97A 4RW6B 1RHQB 4WTYA 4CZCA 1PYOB 1FNOA 2B4PA 2DR5A 4J9NA 2KXNB 2I2YA 4YQWA 4JI7J 1NO8A 3FFIA 5E2QA 4D3GA 4E98A 3L09A 2GJ2A 3G6ES 2HLUA 3X3UA 3PFEA 4A8OA 1WG1A 2GHPA 2XC9A 4GO5X 5E3AA 5DG8A 1FFGB 3OUYA 1H73A 2XYPB 4I6WA 1SKSA 3CE8A 1KRPA 1HNWJ 3EVMA 4JOUA 4WP3A 4XDDA 2E66A 4B3MJ 3IM9A 2F8EX 5L1LA 3SYZA 3RAXA 4LF8J 4K8RA 3VAGA 4DJBA 4PWDB 1MSWD 3BN7A 4RW4A 2C2KB 3FFIB 3H42A 1J2VA 3UPFA 1M1HA 2MZQA 4OI4A 1WDDA 2OEJA 3IAS9 2DNQA 5ETQA 1NJXA 4M63A 1DQAA 1NB2A 2OH2A 4B9UA 2WB4A 4RW6A 2FTRA 5T7LA 3EE3A 4KGKA 2B8QA 4O4GA 4WKYA 2C2EA 1WSRA 5M2PA 1LV5A 1Q81T 1JLCB 3E8OA 4RX6A 1HMVB 1VRUB 3TA2A 1TK0A 1WTBA 4ECWA 2IBOA 1Q8IA 1D09B 5K20B 1YITS 1PJ5A 2YNIB 1S4EA 4DR7J 1X4EA 3PW5A 3PRDA 3NGSA 1FDDA 1XC9A 1GQEA 3MEDB 5FD1A 2IAJB 1S0OA 1D3WA 3C15A 1DQ9A 2VPYB 2E9RX 2QTWA 1X5TA 1NSPA 2V2KA 1FK9B 2F8MA 4LIRA 4M5HA 2BBEA 2UXDJ 2MLZA 4O3OA 4NLOA 2GIRA 3CDBA 1UW9A 4HR2A 5J2MA 3JSMA 5DJBA 3TX0A 3LWMA 2KG0A 4DFKA 2M2BA 2W25A 1QTNB 5IV4A 1UW4A 3H5SA 4MAKA 1SVDA 5KFGA 1NPPA 2E44A 4LFAJ 3GG1A 3UDVA 5K8OA 4TQSA 4IQXA 1HD1A 3CB4A 2YX4A 5CYMA 4YMEA 1FX4A 2MQLA 1Q4RA 2QN6B 4BC7A 3DGVA 2VKZG 2D41A 3PJ9A 1JLAA 3OXFA 2KVIA 2KG1A 2AJQA 2ZC3A 1CC7A 2F63A 2YKOA 2Q3PA 3W9HA 2V67A 1VBZA 2R7TA 1T9VA 2VQFJ 3BR8A 1VRTA 1JJHA 1UEVA 2VPWB 1KEKA 1T9UA 1QDUB 2CNOB 2NS1B 3M30B 3PIOQ 5KG0A 4G6VB 1KFSA 4TU8A 2RS2A 3D67A 3FRZA 2OO4A 3BF4A 2G4BA 1IQZA 1E6YB 2H4WB 2JC1A 4K5RA 5A8RB 5CHCB 4F0KA 2Q43A 3BJYA 1MN7A 3FSYA 2WOMA 3CMAS 4C8MA 5B08A 2M3DA 5DDRC 3DRRB 2AZ1A 4DS5A 3DHWC 3HCXA 4ELVA 5DETA 5JJBA 2VC0A 4PXCA 4HT5A 5KFJA 1TTHB 4ANCA 2JLEA 4RW9B 1PKUA 3QO9A 2YTCA 4UF4A 1Y3JA 2HQFA 1AXQA 1GFWB 5L9XA 4ZITA 1U47A 1R8PA 4IG3B 4DQPA 2ZOMA 2VBXA 2RDDA 1EZZB 3BKTA 3Q2SC 3SDEA 1AUSL 3M7VA 3MM7B 1U26A 2CPDA 4MKVA 4USVA 3O44A 4OJ3A 1O51A 2HRUA 3NY0A 3NKYA 4PG7A 3IO1A 5K14B 4CP5A 3DRSB 3TUIC 3UFCX 4GC6A 1VQMS 1GTEA 1JKHB 4FKYA 4DQSA 2Z2YB 4HDHA 4LQ9A 3VVTA 2NZ4A 3M30A 2VZ9A 2QLJB 4AD6A 5LXYA 5AJ3J 1FXRA 4ECRA 3NCQA 4U7CA 1CQMA 3QYYA 4DV3J 4B9MA 2IRYA 3GJQB 3CJRA 3VTIA 1T9YA 3GJRB 2YWKA 3M1VB 4OYZA 4A47A 1HARA 4PAAA 4F25A 4QQBA 1Y11A 1WEZA 3IA0A 4N77A 1RUSA 4CH0S 4C11A 1SL1A 2MZTA 2FLLA 1RLDA 4NLPA 4DQIA 4DV1J 1MG7A 2RIJA 3W64A 3AODA 3C6TB 4KE5A 5E3CA 1V3SA 2A2DA 3D9BA 2B51A 3BSOA 2YWHA 1N32F 2IY5B 4G3IA 1ROFA 2IVFB 2C22A 3Q8PB 2YY3A 2MMYA 2OPRB 4WWSA 4N47A 1IKWB 3ZZYA 3MM8B 1S1VA 1GEHA 2G2OA 4MK7A 5KFLA 2A6OA 5CQGA 3V6KA 2AEMA 3W5ZA 1SV5B 4HACB 1JLGB 1B0TA 2V9KA 3HULA 2EKYA 2QIFA 4RKUC 1TKDA 1NK0A 4NYPA 2VA2A 3ULHA 2ZH6A 1VBXA 3HVTA 1RI7A 4DSLA 3OL8A 3H4DA 1JLFA 4LREA 2ZD1A 3SQOP 3LUYA 3WIVA 4B02A 3D2WA 3IGNA 1SC4B 1QAJA 2ZH5A 2GMLA 4EO8A 3H98A 3N6LA 3KK2B 1TK5A 1VQ8S 1CG2A 1AFJA 4RW7A 2XLJA 3D28A 2ZOGA 2HS4A 1IKYA 5CXTA 1TMJA 2UUCF 4E2FB 5DRKA 4EO6A 1WHYA 2FJWA 4F2SA 2R2UA 1LW2A 1SI9A 3EMTA 3GG0A 5F8GA 2Y8WA 3L7OA 3RB3A 5J2QB 3VQTA 1XNQJ 1NH8A 1W2IA 2J0WA 2FD2A 5IXUA 2UUWA 4WTOB 1B4SA 2GIFA 3EGNA 3GYGA 3I4HX 4AXJA 1S0MA 2DGSA 3HSJA 3TEHB 1RU2A 1K0VA 3W61A 4K4WA 3CDWA 1BQXA 2B9YA 1Y9OA 4KSEB 4WK1A 4O3QA 3OUYB 4QWDA 2AGPA 2BZ2A 2H54B 2QA1A 4ES2A 4JV0A 4YFUA 2HFZA 1NJYA 2I38A 3B54A 2A3JA 3DCAA 4KAIA 4OX7A 3RG6A 3TQ1A 2BVZA 4B3TJ 1SV5A 4HACA 2KT2A 3GJTB 1LNQA 5KFQA 1K9MT 1Y5LB 2I0XA 3ZTRA 3PJWA 3OR2A 3SIPB 3R2CJ 2E1PA 2J7UA 4NXNF 2KJVA 2COLA 3BPSP 3CJ4A 1X5OA 1WHWA 2RF2B 3GU0A 4YDXA 4DR2J 2F9DA 2VPZB 2KM8C 2J0QD 1X31C 4NLXA 3FZ2A 3V4IB 1KTVA 3G87A 1X5SA 3HD1A 5T41A 3ZTPA 1NKCA 2XMTA 3MDFA 2CPEA 4ANEA 5FLXY 3D6FB 4QWCA 1VLYA 3T1HJ 4AL5A 1N5VA 2WW4A 4CT8A 4NXMJ 4ZVUB 4ZP9A 3GFHA 2G13A 5HMYA 1C1BA 3K58A 2R2RA 1N34F 3GTYX 2ZNZA 1YJWS 4YP3A 1U25A 3QZ7A 3CDEA 3Q8VA 2ADBA 2CPJA 1RBLA 3N5FA 1D1UA 2W4CA 1KR4A 4IFVB 3AQPA 3HVAA 4KKOB 2HS0A 1NZAA 2IIHA 1U1QA 2X1AA 4MKYA 1C0UB 1JKHA 3T19A 1YRTA 4J9RA 2LXIA 2YQ3A 2ZE2A 3KJNB 4KR0B 4OI2A 4F0MA 5GADU 3RGIA 4PYAA 1VK3A 5D4PA 1FRJA 1SC1B 3LO3A 3GSIA 4DR2F 4OX6A 1F6TA 4BS2A 5IT9Y 4OHZA 1T94A 2B9EA 3EXYA 3PYDA 4QWEA 2L48A 5HLFA 5CA5A 1O5JA 4E8UA 2KT5A 4TNOA 3SCJE 1MW7A 2BA9A 5I3QA 3CW2C 4X64J 1LXNA 4NZ6A 3BDPA 4N76A 1RTDA 3R5AA 2DCLA 2H48B 1JQGA 2G1DA 5B0EA 4RUHA 3D3CJ 2OKQA 3G6YA 1TV6A 2DNKA 3KJFB 5B0GA 1UMJA 1XMOJ 2QYCA 2JDJA 1RAHB 1HIYA 3DDKA 4UZBA 3PNIA 1U2CA 3RUBL 1FKAF 2RE1A 3CJSA 3F44A 3OHAA 2XULA 3BSCA 3HKWA 2B0GA 4IUFA 4K50A 4NA1A 5KFNA 1FWPA 2CNKB 1S12A 3B4MA 3HVTB 3IXQA 4DF8A 5HROA 2W4DA 1EB0A 3R5JB 3SZ2A 3ZFVA 4GKKF 3K8WA 2CXEA 2KKHA 2CQHA 1U1OA 2Y1JA 2JC0A 1X9WA 1N6QB 3N0VA 2ZH4A 4X4NA 3H25A 3H5UA 3UD3P 1IJEB 4NMXA 4JI5F 2CZVC 2YNFA 3KLEA 1X60A 3VAHA 4B3SJ 2F8HA 4YB1P 4I2QB 5LJ3Y 4MIBA 4X4SA 2W8KA 4DOZA 1XMQJ 1AZSA 2R2TA 1ZA1B 3LOUA 1IBLF 3TZXA 2OIHA 1AYEA 1HBOA 4RW8A 4FYYB 5J2PB 3T1HF 1Z1ZA 1TKZA 4TKTA 2V68A 2HZAA 2XMAA 2GNKA 3SQGB 4B9LA 2OP5A 1HPZA 1VS3A 4A8MP 3FQKA 4PPDA 5LSRA 3JTOA 3IBFB 3R8YA 5HQ8A 5KFBA 1T3OA 1DLOB 3PM9A 1H6KX 2QA4G 1D9FA 4ZOSA 2XZTB 1P1LA 2PMHA 2AEFA 4J9KA 3HD2A 2CJYB 1JNZB 1YRUA 1HMVA 3AAWB 3DRXA 3MZIA 4P74A 5F8IA 4DSFA 2ACYA 5IS2A 5D15A 4B3TF 4ZDNA 4UUXA 4WKRA 4WYWA 4DWIA 2GV1A 4J7CA 4ICLA 2V9WA 4OI6A 4DPWA 3FBEA 5J2PA 4F7VA 2LQ8A 1WOOA 2YQ0A 3TJ9A 1SJ1A 2P8IA 3CJ0A 4C0BA 1HQUA 1YJTA 3IWLA 1Q1KA 3MF5A 3P6YC 3T3FA 3ZTOA 3V81A 2AGOA 4DSIA 2HHUA 4OL8A 4I2QA 5HATA 3JYTA 1KOHA 3BPDA 4JV2A 3UE2A 3I31A 2QMWA 1SKUB 2EC2A 3UO0A 1OY6A 2HHQA 1FKOA 3KG1A 2XCAA 2XG8A 2MQOA 3KLVA 4ES1A 1GT8A 3W2VB 2DNGA 3Q0AA 3QZ8A 1KBRA 2DO4A 3CCMS 4EBDA 1FRLA 2ZEJA 4K0KJ 1FVQA 5GMDA 5GMEA 1Y5IB 1F0XA 1ACMB 1LWXA 3PW0A 5KFEA 3CD0A 1U8SA 1GMWD 4CH7A 2HNDB 2FVPA 4P52A 2F4VF 2E5LJ 2HQIA 2P5VA 3L95X 4USIA 4XTTA 5KAKA 3H90A 1VQ9S 1B3TA 1WORA 3J81Y 4UOHA 2XO7A 2ZHBA 2XY6A 2FJDB 4ZS6A 5GMKa 2JRSA 2AYEA 2DH9A 4NPOA 4QBUA 3RR7A 1ZZNA 1QLNA 2ZHAA 4PABA 3EPIA 3W9IA 4JUZA 2C3PA 3FRYA 2YWFA 4P9SA 4TLRA 4LRCA 1IKYB 4QPXA 1TL7A 2IC3A 3POTA 3OV7A 1Q16B 5ETTA 3KHGA 4RW7B 1REGX 2OFHX 3THVA 1WUUA 3KK2A 2JHEA 1IQTA 4USWA 4ID8A 4XO0A 1DJ0A 1WOPA 2W1BA 3JTNA 3MCMA 4WE1A 1R6YA 1RAGB 4QW9A 2CVIA 4IYQA 4ZJOA 1LK5A 1Y3KA 2CG4A 2F5GA 2AX0A 5HANA 5AE2A 2G0IA 2ZWOA 3TEGA 2DRBA 5B0AA 4LF6F 1Y00A 2WVEA 3FBCA 1C1CA 2BMBA 3PW4A 1JLEA 1TMMA 1YSJA 5HP1B 3CPWR 4IOCQ 5D77A 1M90T 4FYWB 3TP2A 4NLSA 3MAHA 1RB0A 4KHMA 2OAUA 4LRAA 4AQYJ 3I6PA 2V50A 3DRPB 3TAMA 4BWMA 1IKWA 1WC4A 3N5BA 4PQAA 3OQ2A 4KO0B 5F0WA 5BXIA 2CADA 4PKDB 3OVSA 1TL1A 2MLYA 4CT9A 1OS5A 2GQQA 4LVNP 1T03B 2J9DA 4C9DA 1PSDA 4IKAA 3Q83A 2FY1A 1CJTA 4M5KA 5GAHU 2BUNA 2DH8A 4DR3J 1TL3A 2QO3A 1RU1A 4EK2A 3V6DB 1I6JA 5HN0A 4K4TA 4C11B 5F9LA 5L8RC 2DVIA 4P2SA 2PC6A 3GSDA 3M8WA 4LF4J 5DG7A 3B78A 1ZTWA 4LF1A 5IT4A 4QU7A 1S1WB 3FEZA 1NXIA 2DO0A 4QCLA 1UZHA 2EKNA 3UCZP 4M5DB 2XYGB 2VG7A 5DDPC 2HIYA 4X4TA 5LXRA 2BQUA 5HMZA 4O0IA 2CDRB 2WVCA 3P49B 2R7XA 3TQEA 3G6XA 4A46A 4ZHRA 2PIIA 4K4VA 5ETKA 5IOLA 2XMVA 1QUVA 1RWKB 2LXUA 5A76A 2OTLS 2ADCA 1VC6A 4AQYF 1CVJA 2OELA 3G9CA 1SUQB 4DX7A 4ZVTB 3CTRA 3KXDA 3W65A 2VC1A 5KT3A 3OSNA 3VZIA 5FLXU 1EETA 2E1AA 2BKNA 4ETZA 3N79A 2XMJA 1FEHA 2Q1LA 3MGJA 5ETPA 2VBWA 4FDFA 4DV7J 3UCUP 3CIZA 3ENQA 2ZH3A 2BQ3A 3LQVA 4FF3A 2DCUB 2H9ZA 2FLOA 4UOGA 4EU0A 5ETRA 1X4HA 2FUG9 1YJRA 3R5BA 4YEAA 5HVFA 2P9GA 2Q66A 4CYUB 4LFAF 3W7BA 3GIRA 1IN0A 2EW9A 3ILOA 4YHHF 2I6WA 5HVGA 1I3OB 3A8EA 2YXLA 2HK2A 3C14B 2BW2A 4IH7A 1YLXA 1TQLA 3BGRB 1EP4B 3SXLA 1FTRA 2CA9A 4L72B 3BM7A 5CD4A 4ZN3A 2CPFA 1ZM9A 1IXKA 3DLKA 2UVUA 4B3RJ 2BJ1A 2QMUB 1IKVA 4NXNJ 3MR6A 2UUBJ 1WKJA 2IMOA 2DH7A 3MMAA 4M5NA 1NPKA 2V2ZA 2UXBJ 4QR0A 5DGAA 1M1KT 4C8LA 5K8NA 5ETOA 2JEFA 1TELA 1UPPA 5D4LA 2B6AA 1RE1B 2PGCA 3NBPB 2AQ4A 2LVWA 3J7YU 4PQUA 4CCHA 3J81U 1VI7A 5C42B 1HHTP 4K2JA 4XPCA 2L41A 3C14A 4CLUA 1OO0B 2YNGB 3GCWP 2GA7A 1UVMA 2HWTA 3M32B 3S8SA 2OI2A 5D0RA 5KTQA 2BABA 2HGNA 1UFLA 4ZVFA 2DHXA 1N54B 1ZS6A 2GAHC 3R2DJ 2F4FA 3OFEA 2PN6A 1LOUA 2V94A 4H4OB 3WBZA 3HT3A 3TANA 4YR2A 3FVYA 5ETVA 3KLEB 4TXSA 1FE4A 3K5MA 1CS4B 3M6XA 5BYSA 1LWCB 2BJEA 2KB2A 1HBNB 4KFBB 2H5EA 4DV6J 3ISNC 3RB0A 3C2PA 1BY9A 2HHTA 1HYSA 3BZQA 3OBIA 1RA6A 5EN1A 4G1QA 1RLCL 2QE5A 4AXIA 5D0EA 1RCXB 1RADB 2F1FA 2PMZD 1RGVA 2ZOFA 4NLRA 2ZUGA 4ANDA 3NWGA 1NMEB 2VB6A 1MROA 3EVWA 3NLCA 4UQTA 4B3SF 3MFIA 2NPIA 2RH3A 4OX9F 3M8ZA 3BSAA 3HMJG 4NEYA 2YWGA 1NLKL 3OFHA 2XI2A 5D3GA 2QSWA 5DZ6A 1NCLA 1FVSA 2P6SA 3AA9A 4OV1A 3S7RA 4ZHRB 1XNRJ 2DIUA 3DOMB 2HURA 4ECTA 1Q7YT 2RRNA 3UN3A 4KO0A 3TZWA 4AL6A 3R27A 2QYGA 4WIQA 1RDRA 2K1RA 1G2EA 3VQSA 2R7RA 4DN0A 3CUNA 2ASLA 4I7FA 1UWBB 4ENOA 3QT5A 1TL3B 3ISND 1N88A 3GFYA 3PHEA 3GP9A 3TZYA 5BJRA 2GO8A 2B4UA 3HFZB 3IR6B 5AXKA 4M5JA 2J8AA 2ROGA 1P27B 5AT1B 4C8KA 4F3QA 1RTJB 1FNMA 3NAHA 3N9UC 4R5PB 4ELTA 4USHA 1RHRB 3UD4P 3PX6A 1N48A 4EZ9A 5U47A 3A3OB 3P4UB 3J81j 3CEDA 5IFMA 3NCRA 2YH1A 3J7AN 1R6VA 2NSCA 3M8QA 4OI1A 1RQ0A 3ONQA 4NZ7A 2IM1A 2DNYA 3R5GA 4OFZA 2XCPA 2PE8A 3IBWA 1V6HA 1Q8KA 2KVQE 5ETLA 1EKRA 1RT1B 2PFDA 3IC1A 3RU0A 1JIHA 3RTVA 1F60B 1X4FA 5IV3A 3HHDA 2V2VA 1RHMB 4ZJQA 1PCAA 4OX8A 2O67A 5JUMA 2D3OR 3S01A 3TAPA 1RAAB 1S0VA 3UI3A 3ETOA 5LOQA 1T8EA 1X4GA 3QT7A 1CEZA 4ZVQB 2R9LA 9RUBA 2V8HA 1SQGA 3T5HA 4Q0BB 4HTJA 1S49A 4PR6A 4CTAA 2GAGC 5ADZA 3I0RA 5CYJA 1UWBA 4J9PA 5H9EK 1JXLA 3MM5B 3H59A 5FIIA 4C3KA 4NXMF 3EICA 2K1RB 2AWZA 5L1JA 1HI8A 3BYPA 3ISZA 1U0HB 2VFTA 2MZSA 3GONA 3CC7S 2C2ZB 3H2LA 4MMOA 2JOQA 3H40A 1VQ4S 4LF5J 3E2EA 2UP1A 4J90A 4ZCIA 1RHUB 3PXGa 2KFNA 4OHYA 3GYNA 4GRSA 1L3UA 1T7PA 4QR2A 5J1NA 5B7WA 1EAYC 5HBMB 4AFFA 3M9MB 1U0SA 3TOQA 4C8OA 1H7XA 3I9V9 4LBIA 2ZH7A 5FJ4A 3MM9A 2AP6A 1NK8A 4KGMA 1ELOA 4PUOB 4LRDA 4EZ6A 1LFPA 2FZGB 2QRRA 4CM2A 3DM2A 1ZZFA 1M5VC 1YKWA 2IRXA 3AOBA 1WC5A 2BM1A 1ZTTA 4UY8T 1IVZA 4ECVA 4EEYA 4ZVHA 1D8ZA 4DI6A 3K5LA 2MQ8A 4IFYA 3PJXA 2AKWB 2ROEA 3GCXP 4EBCA 3R1HA 4P2XA 1U49A 4Y2AA 4CLWA 1FKOB 3VHQA 1ZM2A 4LJMA 4ZP7A 4DCJB 1APSA 5FDLA 2HQGA 5G4DA 1U1RA 2HQDA 3HLUA 5LMUF 3L7UA 1PJ6A 1XNQF 2GO9A 2FYXA 1RT5B 2HNZA 3KLFB 4WXOA 2F40A 2Q6CA 2WSCC 4W92B 3OR1A 3BB5A 3HPOA 1VBKA 2W2PP 1O6XA 3AA8A 5GADI 3VVUA 4JP8A 2DNPA 5DQGA 5CCMA 3HHNB 1HBUA 3N6NA 2M8HA 2RB7A 3GE9A 5E33A 4WFAQ 1YK9A 2CQ2A 3OPKA 4F4ZA 3CGIA 1N52B 3O1LA 1IBKF 2GJIA 1IBKJ 2AJ1A 2H3EB 3A8KA 2GHVC 4QW8A 4TU7A 5LMNJ 2HHSA 5KFPA 1FDNA 3UN2A 3T6BA 1F3VA 4H4MA 5F41A 5A8KB 2MYFA 2W9CB 1AZSB 1RZMA 1IR2A 1X9SA 2J9DE 1B70B 1DLOA 3HK2A 1YRXA 2YPZA 4HT7A 4FYVB 3ZZOA 1CLFA 1XQIA 3BR9A 4DL5A 5GVQA 3KWMA 1NK9A 5DGBA 3PRVA 2OFGX 3QLHA 3F73A 3TNVA 1FTCA 2H4YB 1QVGR 2OMOA 2AJ4A 2ZC4A 4NEZA 2VOOA 4FYDA 3F0NA 4JI3J 2KFZA 4RLEA 3Q8QB 3QAUA 1YJNS 3LP0B 1IKVB 4DV7F 4L3KA 2AYGA 1NSKL 2DGOA 1UETA 3DLKB 5KFIA 1G4CA 3OFFA 4DMZA 1S1UB 3C46A 1R8HA 4PWWA 1TKTA 1YIJS 2HAFA 3D1HA 1ZM3A 4WF9Q 1URRA 4K59A 4HI1A 1RAIB 4ER8A 1PAEX 2NXJA 2HHHF 2VHGA 4NYZA 4ILMA 4DZ6A 2KHCA 4CI0B 3M8RA 4LR9A 3CC2S 1XMOF 4ZP6A 2XSJA 4M5LA 2NYHA 2XLIA 3DDNA 3G8TA 3PO5A 1RWPB 2YKAA 4O3SA 1VQKS 1RBOB 3R97A 4ZPDA 3FEYB 4B08A 4MKBA 3BKFA 1IBLJ 1KQGB 2PD1A 4IDKB 2W2MP 4TY8B 3THPA 3BYRA 5K8PA 1WI8A 4FNIA 3WC0A 2FJVA 2CJAA 2RMLA 3W2WB 1JLQA 1URNA 3MOJB 4Y0FA 3M05A 1YG0A 2AU0A 2KTQA 1V3RA 1U7LA 3CD5A 2V8PA 3CJ3A 1RTIA 4M94A 1EKSA 1ZM4A 4W98A 2XMKA 4WBFA 2XNRA 1YJVA 2H1YA 1Z2ZA 1ZETA 2DRAA 1QUPA 3I0SB 4PEOA 2BYCA 3AJ2A 1S1TA 5C24B 5KG5A 1SUQA 4NL5A 2V4RA 4AYBD 5D8HB 2QSFA 3T1YF 2HKEA 5KT5A 2E7WA 4H4KA 1SKWA 2XMMA 2RUGA 4MK9A 2JL9A 2WONA 4UT4A 4LSNA 1N34J 3V4IA 1RWNB 3EVOA 1UJ6A 2OD6A 3R1LA 4LF4F 3OVAA 3H20A 4WP8A 5F3ZA 1FO1A 1P9YA 1ICEB 2KXFA 3D6MB 2E5GA 2W2OP 4CLSA 3DRPA 2CYYA 1BLUA 4OI3A 4TVAB 3TAMB 2EG1A 3W66A 3PO4A 2DBBA 4Y00A 4CIOA 1M1GA 4EYIB 2N4CA 1F1BB 1T3NA 3VAIA 3MAQA 2A18A 3D1OA 1AA1B 2RNEA 2QV6A 1JLEB 1RTHB 4F04B 2CQCA 1U6BA 5EWFA 2FHJD 1MWYA 2DD8S 3FSXA 3NEKA 5IQ6A 3IGVA 5LJ5Y 1A0OB 2MJNA 3CVKA 3MR2A 4P10A 4R8UB 2E5LF 2F4VJ 4J9VA 4OZJA 2LDIA 3BGUA 4MKAA 3SSSA 5KOWA 2J0SD 2QFJA 5E5NA 4F3MA 2M7SA 3HKZD 1H2VZ 4NLUA 4L6V3 3TWZA 2HQCA 1HQEA 3OXGA 5J2QA 4M1KA 1DHMA 4FF1A 1Y5NB 2HRYA 3OT9A 1LW2B 3FDSA 4RPFA 3QGHA 1HNVB 3GR1A 3LH2S 2K7KA 2L9WA 1YGYA 4O23A 2V5HG 2WVFA 4V19X 2XMUA 5D6GA 3C6UB 3EYZA 1S59A 1NDCA 4M8LA 1O8BA 2VA3A 2G2YA 5IWAJ 3KK1B 1S6PA 4OLOA 1YZ7A 1SH3A 3SCLE 3ZZZA 3GIMA 5AXNA 2G0CA 5K8MA 3TVKA 4IO9Q 5I3UA 3DLJA 5B0FA 3W9JA 2HRTA 3Q22A 1PO6A 4BBYA 1FRHA 3AOCA 4PG6A 1VOMA 2APOA 1PGZA 4ILLA 4NLQA 3IS9A 3LAMA 5C2GA 3MURP 3BSNA 4ECSA 5C7PA 2L08A 2B9WA 2XHWA 3D0HE 3T5KA 4UY85 4TY9A 4GVBA 2W8LA 3CT9A 1VIXA 2HIQA 2HNDA 4ECYA 2DGTA 2AGQA 3SI8A 1U02A 1M5PC 4WFNQ 2MKHA 2UV8G 4R0JA 3MPWA 3ENWA 2W9BA 1LEOA 3RRGA 2VBZA 4K5SA 1GK8A 4U96A 4DDFA 2R2SA 3DRYA 3BQ1A 4OHXA 2W2NP 2OPSB 3UVJB 2FQQB 3HSGA 3V5RA 1VK8A 2DNMA 3D6HB 4U9RA 4DV5J 2XY5A 1S6QA 2BE2A 5JMNA 2EPIA 2BJ8A 5LT5A 3V6HA 1RT7A 3H7HB 4WK3A 1KNZA 1UJ4A 2IVYA 2X51A 3LPEA 1BQMA 3P5BP 4KPYA 4Q7AA 3DU5A 3GIJA 2OPRA 2R7WA 5AE1A 3JS9A 3DFEA 4LF9F 3T5LA 2ZZMA 1GNKA 2XI3A 3KDNA 5J2NA 4MFBB 4JI8J 3HHLD 5SZTA 1GX6A 1T02A 2NXEA 3C6TA 2YKQA 3EZUA 3M6WA 8AT1B 3JSYA 1RAOA 2FHMA 2SXLA 2V8GA 1CBKA 4ICLB 1GTHA 2B8PA 3DOKB 4OYIA 2JH3A 2VF3A 1RACB 2BJ9A 5C24A 2ZVSA 4ETXA 1OY8A 4EMDA 2ILYA 5EX3A 3RBEA 5EWEA 2FLNA 2PI4A 1S1XB 3QIPA 1RTIB 3UWTA 2DGUA 1YTYA 3ZZTA 1U4BA 3VAJA 3KLFA 4EWTA 5EHHA 1OY9A 4GVLA 1U24A 1Y0HA 2MKYA 4LFCF 1K1QA 3IG1A 3K7RA 5E3RA 4F3OA 3GQCA 4XDCA 2XLKA 3R7SB 3NMAA 5DG9A 3G82A 1KQSR 1RT7B 3G2XA 3U27A 1X0FA 3D0GE 3KJVB 1TVRB 3R7BB 4Y6IA 1FJ7A 3B6BA 2ZBPA 1PC4A 1HNIA 2BKOA 3D1QA 3MM6A 3NS5A 4ILRA 3WX4A 5IM0B 1SKRA 4PG8A 1S5ZA 5AE3A 2ABYA 5HAOA 4DR4F 3MCNA 4FYXB 4XAKA 4GKJF 1RSCA 2CDQA 2B4OA 4NCGA 4NA3A 1YI2S 4CO5A 2XHCA 2VQFF 3DGPA 1KONA 2MHEA 2POKA 2YNFB 3WHIA 1RTZA 1XTZA 5AJ3F 4B17A 1VQOS 4PUOA 2LCWA 3QQCD 3CSKA 4L3NA 3I5CA 3GV5B 4DLGA 2NR0A 3BBFA 1G6BA 2WSEC 1R0CB 2YKMA 2AT1B 2CJXB 3A3NB 3Q8YA 4MIAA 4MYUA 2OPPB 2X3GA 4K7QA 3DU6A 3FZBA 4BLGA 2UU9J 4WP9A 3DXSX 5I4MA 1SPBP 1VYAA 1RYSA 5HROB 3J7YI 4M5MA 3IAM9 4MIWA 3ZTQA 4F67A 4ED3A 4NCGB 1TZ0A 5F3TA 3FK4A 5CH7B 3Q8SB 1NJWA 4YS2A 2EEYA 4DF4A 4DCPB 2ZBRA 2MXYA 4YR0A 3MM6B 3P96A 4K4YA 4DUZF 3CCWA 3TUPA 3K59A 1FK9A 4Q2LA 1TVRA 3KOAA 2HFOA 2VFUA 3CDUA 1KOOA 2V63A 2VFSA 4P7TA 3TRGA 2MY7A 1BHNA 1OYDA 3O2IA 4UTGA 1SL2A 1KC8T 4ZLPA 3IG1B 3MPUB 3ADAC 2GJFA 1IKXA 2I5JB 2Z2MA 1LWFB 2HFUA 3AJ1A 4RO0A 1KN6A 1QE1B 2D74B 1P9QC 1RT1A 2O66A 2QLXA 3NNAA 3M6VA 3MEGB 4CO2A 4DR7F 2HPUA 3NCPA 4URGA 2Y1RI 3NGKA 4ED2A 3EJMA 1UAWA 3KDOA 3GFZA 3IR7B 3M2VB 1Q8BA 3QATA 2PEHA 3HT0A 3ZO7A 1N0UA 1CJKB 2CFXA 4OZ3A 2XSFA 3FKBA 3MXHP 3T9ZA 3T1YJ 4ALZA 1T11A 3QBCA 2UUAJ 5MAOA 1RTHA 1M5KC 2E29A 4ZMMA 1NAQA 1WKKA 1WWHA 3EDQB 2AV5A 4KHRA 4LF2A 3KYLA 3EGZA 3D4JA 2UVWA 3LP1B 1TFWA 1WNEA 4GKKJ 3IM8A 4TN2A 4F4XA 4B3MF 5L9NA 1SC6A 4QWBA 2BE2B 4BHQA 3CCRS 4DL4A 2J6TA 2BJDA 2M8DB 2LA4A 3NOGA 4KTQA 4X4QA 2HMIA 2LA6A 1RHKB 1VMBA 1J5EJ 5F8NA 3UCGA 2Y1LB 2IJFA 3IR5B 4ZN1A 3M2RB 7FD1A 1U6ZA 2BRLA 2FC8A 2QMXA 3MMBA 3MM9B 1NHVA 1SIZA 1UP1A 4OJGA 3ZTSA 4PG4A 4J9LA 3MEKA 1A9NB 4QIWD 5KFDA 1YDLA 2J9EA 2XWYA 1SB6A 2IDEA 4QPTA 5KFAA 2M0GB 4YR3A 2AEJA 5IZHA 1RJJA 2FVQA 2DXDA 2EK6A 2J76E 2NSBA 2GVDA 3KK3A 3PEJA 2R8HA 2UUAF 1YBUA 5HO4A 1RKIA 2CQ3A 1U0HA 3EGWB 4FN5A 2GS8A 2LQBA 5LL6d 4DR5J 4EBEA 3PZPA 2UVVA 4IH5A 4OZ5A 1M5OC 1NDPA 2BXJA 2GGPB 4HH0A 2NUUG 1IM6A 4WFYA 1S6PB 1T0TV 2P6TA 1DY3A 4WFZA 2VG6B 3AB2B 5A6WA 2WRMA 2UXCJ 4WFXA 2LQ9A 2B43A 3M2UB 3CJKB 2Y1IA 4Q43A 1IUJA 2NXNA 2BDPA 1MU2B 4CO1A 3TVYA 1MWZA 3BO4A 4AL7A 1M0SA 2AHOB 3HJFA 3N4WA 4KRWA 1XEZA 1VGYA 5HK4A 4X4VA 4DV3F 3QGPA 4X62F 1HWKA 3WDOA 3D6TB 2BKPA 4IQMA 4DX6A 3QRRA 1JNRB 1S1VB 3A13A 1R8AA 4KHPJ 2KU7A 4CO4A 1KQFB 2UUTA 2W01A 2WVBA 1T05A 3OTDA 5KG4A 5KFCA 1R89A 2CWKA 2FVSA 1PG5B 2J6SA 1W26A 1JLGA 2FDNA 2MKJA 1I5OB 3IRXA 3MHYA 1HKAA 2DEIA 3MD3A 3QLHB 2DNRA 5DM7Q 2ZH8A 3HHLC 1RT4B 5JXSA 2DIVA 1VQ5S 1U1MA 2HBQB 4ZVOB 3OTBA 4TQRA 1FJGF 5H9FK 1GMVA 3PDNA 1RKJA 2N4DA 4R0EA 4ZLJA 1RYRA 3FGVA 4DV1F 4G1IA 2M5YA 3U1MA 1SBRA 4LSNB 3BO2A 4A8YA 1FE0A 2O3DA 1TFYA 2KZZA 4I0WA 3TX8A 1TUWA 3KLHA 1F3FA 1KP6A 3ZXWA 2RS8A 5D3GB 1N33F 5K14A 1X9MA 3QJJA 3TUZC 3IN5A 4EI2A 1Z4UA 2R8IA 2NLWA 4L73A 1V5VA 3NMRA 1S77D 2DRDA 1OPZA 2CNLB 1MROB 3AJDA 1IM4A 1A7GE 2D3UA 3MECA 4P73A 3J7Z5 3CC4S 5G0RB 4ZLLA 2E7XA 4KGXB 1F9EB 2HGLA 3H2VE 5HI7A 4X64F 1VJQA 3MEEA 3GV8B 2YVSA 4UOCA 1JLQB 2JZ5A 1IR1A 4P7VA 3PR5B 1QTMA 1FXLA 2DNOA 4QIFA 3A3PB 1B99A 4PXDA 2WK4A 2GW8A 2P9EA 3PW2A 2C3OA 1XNRF 4TY8A 3R7NB 3NS6A 1U1PA 3MTKA 3FCWA 2BOPA 2IM0A 3WZ0A 2B7CB 1CQNA 3NP5A 3VGSA 4URQU 3AXKA 1XR6A 2YNHB 3KFWX 3NS7B 2FB0A 3VWSA 2RT3A 3W3SA 1RT4A 2HSEB 1WKLA 2X7IA 1N36J 3DLHA 2GCFA 3ET6A 3KMQA 2LU2A 4A8QA 1WC6A 1FD8A 4M5GA 5CZVA 3K5OA 4DR6J 4EUVA 4OYAA 2MPUA 2NYIA 2OUGA 2LEBA 1VRTB 5DDOC 1T03A 1WACA 3HFKA 1IBCB 4QU6A 1W25A 4XIUA 2OJ3A 4DFJA 4PQUB 4K4ZA 1HL6A 2RD5C 3D68A 3NBPA 3QIDA 1Z2LA 4DV6F 4DS4A 4IG0B 3C8YA 1KVJA 2GC8A 3HM9A 1HW9A 2IPOB 2V6AA 1S9GB 2B9XA 2JVOA 2NCKL 3CCQS 1FNXH 3MUMP 1HNXJ 1R7IA 3JQMA 1S10A 4LBHA 3VAKA 2AYBA 4ZKAA 1IBMJ 3OW2R 2D1CA 1SCJB 2KJWA 1MU2A 5E41A 5L1KA 2GVZB 4KV8A 2DXFA 4YN3B 1XJWB 4Z7YA 3IMQJ 5KFOA 2AJFE 2W9BB 2DY9A 5L1IA 3HO1A 4JI8F 1BXNA 2HFSA 3VGVA 5HSPA 3H2UB 1PAUB 4OYOA 5A8WB 4FPRA 5IC6B 4Z37A 5KG7A 1D0EA 2NZCA 3SEOA 2MB0B 5DO2A 1JLCA 5KFVA 4FKXA 3SFUA 1JX4A 2FPHX 5D78A 1RISA 1HWUA 2ZFHA 3TI0A 3QSIA 4ED0A 1RAFB 2CKWA 4DEZA 5CD4H 2UXBF 4TYBA 4F36A 2V8DA 4HKQA 2UUBF 2VG6A 4IR9A 2KRRA 4JBCA 3K17A 4GMKA 2HLTA 4N5SA 2UUCJ 1FCAA 2OPQA 4P71A 4OIXA 4JI0J 2ZKUA 4KT0C 1EETB 1WC3A 5DQHA 1VJWA 5GAGI 4PWUA 1S76D 4C48A 4O44B 3C6UA 5A0YA 2MQNA 4HL9A 3KG4A 2QLFB 3M2RA 4O4GB 4ECZA 2FVRA 1HI0P 4RNOA 4JV5F 3VZHA 4OV6A 4OYWA 1UVJA 1FESA 2EXUA 1SH2A 3Q8UA 5ETMA 4P2FA 4FXVA 1UPMB 4J5OA 1HNWF 2ACMA 2CG8A 2V0NA 2EBGA 3TVZA 4NRUA 4PXBA 1VDHA 5E0OA 4CM0A 2YX1A 3D66A 1FXDA 1HI1A 3CNQP 1RWUA 2GQ2A 1DTQA 2YKNA 1WF0A 1B0VA 1HWIA 2D9PA 2QC3A 3QWUA 1Y10A 2OPQB 4PPZA 5K5MA 3CCES 4ED8A 1LW0A 2Z2LA 1HNZF 2DR8A 2R7SA 1LK7A 2DKOB 3MAAB 2DR7A 1G7CB 4QOTA 3BGFA 1RWOB 3PKYA 2C42A 4QJVA 4ZCLA 7FDRA 4JI0F 1MMLA 3LTOA 2LP4A 2FY8A 4DV4J 1WJ9A 5I3PA 3J7ZT 4CO0A 4E0DA 3M8PA 2KO1A 4Q8FA 3MR3A 4Y65A 1K44A 2MTLA 2VFRA 1DARA 1QJHA 2WONB 2WBRA 1KKHA 2I5JA 2EVZA 4HI2A 1IKXB 4CLYA 3KHHA 2ZJRQ 1CULA 1TL5A 1V5IB 1WG4A 4OZ1A 4DU8A 1N4LA 1KD1T 2EC0A 4DR6F 4X4UA 3UDEA 4YDDB 3CDAA 2YWWA 2C2NA 1TU0B 1Q5YA 3MMCB 5GAEI 3OTOJ 2R7UA 3FUYA 3KG0A 3HHLB 4WJBA 1P6TA 3DLGB 4FS1A 2ZZNA 4MYTA 4CLKA 2JWNA 3R5DA 5CCLA 4DR1F 1HBMB 2XM3A 2DYAA 1REVB 2QL7B 1X5PA 2RDIA 3HVWA 3QAEA 5CYQA 5DQIA 3HZEA 4KB7A 1FT8A 2XWXA 4ZVRB 1KVIA 3AXMA 2JX2A 1S7HA 1QVFR 1OMSA 1N6QA 5KT6A 3MD1A 3CXCR 4FBUA 4DPXA 3EXCX 3I9ZA 4LIWA 1BC6A 1EQMA 2GMHA 4HH1A 1UVKA 4I6YA 4I7FB 1XR5A 1N5SA 1VBYA 2XGPA 3NG8A 2JNJA 2DB1A 3MR5A 3CCLS 1FD2A 5CZXA 4GC7A 5IT9U 5RUBA 3G8SA 1SQEA 2Z56B 2KDOA 2MSSA 2QA2A 2RHQB 3EM1A 2HVZA 4OJHA 2DY1A 3U7JA 5KFWA 2R4FA 3KJVA 4UZCA 2LQ5A 3RJMB 2PA3A 3L3CA 3L4BC 2O1PA 3RRKA 3G82B 1I94F 4U7UD 2ZWPA 3SFGA 2MJUA 1S9EA 3K89A 4LSLB 2CPHA 3DDIA 3DGPB 4U8YA 5EGYA 1WHVA 4P6QA 4YB7A 2YH0A 1REVA 2CVEA 4QIEA 4CH1A 5G0RA 2CAJA 3HSDA 4LUBA 5H1SV 4RUAA 2R7VA 3RW7A 1HNIB 2DHAA 2VFVA 3BH7B 3CO0P 3HHLA 4L75A 2B5JB 2R7QA 4DL7A 1D9DA 2CPIA 3PVXA 4J9MA 3IP0A 1W7WA 3FCVA 1HHQA 3Q24A 3ICLA 2AJ2A 2DGWA 1Q79A 2XMWA 3ZNUA 3M9OB 3SCIE 1SL0A 3TJ8A 1E6VA 2D69A 1KLMB 1IWAA 1NBEB 2VV5A 4KC5A 4USJC 2HAIA 4OZ2A 1NNDA 2HNYA 3I82A 4DG1A 5A8KA 5KT4A 5T14A 3OL6A 3QJPA 1ZA2B 2J7WA 2DJWA 1Q78A 4MH8A 5LSOA 1ULRA 3EX7B 4P75A 3ZNJ1 2OTJS 3JAMY 3M32A 1S6QB 2VOPA 2L9NA 1JB0C 2HS3A 4ECUA 1SJ4P 2YNGA 1TAUA 2OPSA 3UVJA 2E1CA 3T41A 2K2PA 4MFBA 3OLAA 4Q8EA 2W4PA 2RILA 4ZPWR 4ED7A 3QMQA 2BM0A 2HBRB 2LEPA 3QRPA 4IOBA 2UVRA 2JFDA 4Y2KA 3CJTA 1BQMB 1RBAA 2IJNA 3FEXB 4FVCA 4LSLA 4O3NA 3NGDA 1SH0A 1XERA 2BW7A 4U8VA 3P45B 4MK8A 4F50A 1NHUA 5KFSA 5LMNF 5IT0A 2RQMA 4NOHA 2WB1D 4NI2A 1VIOA 3Q8RB 2H51B 3QSYB 3KUGA 4QIGA 4ZK7M 3W5YA 9ATCB 4WZMA 3MMAB 1NJZA 2R8JA 4I67A 1JLBA 2VL1A 2C3YA 3GPAA 4LVOP 3DM2B 4URSA 5J1EA 4RBTA 4EGLA 3DOLA 3LP2B 2J8SA 1SJFA 3THTA 4C4WA 4RU9A 1KHVA 4GVBB 2NPFA 3LF0A 3PTWA 2QEXS 2CZ9A 1C0TB 1TR0A 3GLJA 2G2ZA 3DNCA 1HA1A 3KHRA 5LMUJ 2IC3B 1XBWA 1F9FA 1CJVA 1TL7B 3POTB 3IS9B 8RUCA 1R43A 4LSZB 1J5EF 1I94J 5DS7A 1R0AA 2ASDA 3NL0A 1QD1A 4X2BA 3VALA 1SXLA 3CF5Q 3R9LA 1WC1A 3TYTA 2VIHA 3HHKA 1AUDA 2EFQA 1HBMA 2BE9B 2PO4A 3AY0A 4OYXA 4Y34A 4PRFA 4KH0B 1C4AA 3KUHA 2GZOA 2WW8A 2VUGA 3AQOA 5A8WA 1UEKA 4X4RA 3SV4A 1AW0A 3CMQA 4LR8A 1U09A 5EUHA 3MMBB 1NHKL 2HZCA 4OLPA 4F4WA 2KYZA 1OSDA 3R5CA 4A8FA 2ZE2B 1YBAA 2MHNA 1JLFB 3RB6A 5A2QU 1C0UA 1HR0F 1B0PA 5ITHA 1DQ8A 4F4KA 4M95A 4IFVA 2ZUAA 1LXJA 1XK8A 1OSCA 4I1TA 3ENVA 3K5PA 3LGHA 1FJEB 2J0XA 3M8QB 3K8VA 2YKPA 4DR3F 5F8LA 1G3OA 4C8NA 5AXMA 4HTIA 4ITSA 5A6PA 4TLQA 5C25B 3RRHA 2EFOA 2HVDA 4DL2A 4R8UA 2XY7A 2W2QP 2PEBA 3MAAA 2HWIA 3TA0A 3SCKE 1RT6B 2CQGA 4KIAA 4RUBA 3VGTA 2CRLA 3US5A 4OQJA 2XYHB 4CWBA 3D0IE 3PHTA 1NUEA 2DEJA 3TW0A 2ZZTA 2FHJA 3PFOA 1L3KA 1ZYQA 2A0FB 2YKNB 1T9XA 3OD2A 1RT3A 3OFGA 2JEIA 4LFBJ 4DX8H 3TR5A 4FS2A 3GB0A 1DTTB 3M2VA 3T1AA 3LPYA 4FZVA 3M1VA 4F26A 2CZ4A 2FHKA 3MEGA 3SBMA 3CIMA 4KGVB 2C3UA 4OX9J 3DOMA 2Z57B 1QE1A 3MUVP 1Q0NA 4AT1B 1Q86T 1TL4A 3DRSA 4ZVPB 4JI1J 4CO3A 3R6LB 4NASA 1WEYA 5H9FJ 4DL0C 3NGUA 3SQGA 4CQ1A 2MQPA 1OQ3A 4DL6A 4AUKA 4F8RA 4X66J 1U1LA 3GIIA 1OYEA 1HBOB 1H0HB 4RW8B 1H2TZ 3KNAA 3MI7X 4ZVSB 2DGVA 3CCJS 4DR4J 1R31A 2W7PA 3NGTA 1UA1A 3QRQA 2VONA 3W2WA 2CQPA 2CQ0A 3A8IA 4RWWA 3A12A 4LFBF 1UCNA 1XR7A 5E3QA 2JEJA 1E6YA 1NPRA 3PW7A 3IRWP 2DTJA 4IOAQ 2ZBQA 3UNGC 2QGFB 4FP9A 1TKXB 3KLHB 3RZAA 3HXMA 4I56A 1FFSB 4C6AA 3A8JA 1UVNA 4RL1A 1U45A 1HLWA 1H38A 3HI9A 3CULA 1LQ9A 2E7VA 1VFJA 4H4KC 2ZD1B 2IYGA 3DOLB 2RQKA 2DK2A 3LW5C 3IBCB 2CNNB 1FFWB 1JLBB 4YY3F 1NKEA 3D3BJ 3IWNC 1YWXA 3W2VA 2M70A 1NDKA 2VG5B 4AE5A 3NRBA 3PV8A 3H4BA 1K0TA 4NZ0A 4O0NA 4PCQA 1TV6B 3LGNA 4DBQA 5L38A 2J9CA 1VQ6S 1OJ4A 4ERDA 2KT3A 2E1MC 4DUYJ 4A8XA 3JYTB 1WG5A 1NSQA 3FQLA 3MPYA 1RWMB 2HGMA 2V4QA 8ATCB 1RWXB 2ZJPQ 3CCZA 3KNGA 3LP0A 2EG2A 4Y2CA 4KQZA 5D4NA 3ZZPA 1FDBA 1MWQA 3FJ2A 3QIPB 1Q5VA 1ZPVA 5L46A 1NJIT 3V6DA 3ET6B 3RAQA 3CJ5A 1NM2A 3C15B 4FPIA 5IC4B 2A1BA 3UNYA 3G96A 2E5JA 5AXLA 1V9OA 3VGUA 1P8GA 2MKCA 4ED4A 1HNXF 3CCTA 2MKSA 1EP4A 1PYSB 5MLCV 3HJVA 4O3PA 4C0HA 4W90B 2G9OA 2HNYB 1VISA 1FWKA 3H0PA 5HQMA 1RT5A 3F41A 3MPDA 4NMLA 5SUHA 3M8PB 2NXCA 2MZRA 2ZDOA 3ZC4A 4CNZA 1QAYA 2BACA 2JJ4D 4K2XA 2MQMA 2O5DA 2VU5A 3CCVS 1NK6A 4DV2J 1DRZA 2V2QA 1U8WA 1S48A 1C1BB 4N8NA 1TKZB 2BRKA 1C2PA 4P2MA 4NX9A 4ZP8A 1XMQF 4LF7F 5HL7Q 1SJQA 3NNHA 1D8YA 1T9TA 1N36F 3OR1B 4CNYA 3EZOA 4DUYF 1FRMA 4LF5F 3BQ2A 4B9SA 3BV8A 4K4UA 3HFVA 2D9OA 3RBZA 1TK8A 4QYZK 3KTQA 3U1LA 5KFMA 4NLWA 3I55S 5EX0A 3I56S 4YY3J 2HMIB 3ELHA 1Q82T 1I51B 3B8HA 3MPVA 2BX6A 3AHPA 1VRQC 4KGZB 2DHGA 4Y28C 5B09A 5KOXA 2MZ1A 1U1KA 5LSLA 3RW6A 4N41A 1XN9A 3GWCA 2ASJA 4I6AA 2D3ZA 4Y2MA 1VQ7S 1N5YA 4B9VA 5BR8J 4O44A 4Q45A 4KJIA 3D7SB 3G86A 2K3IA 3IWXA 4KYZA 2VQEJ 1AT1B 4C8YA 2CJQA 3UDCA 4Q0BA 1LWEA 1UJ5A 2OHDA 4ZVGA 5F8JA 1UFWA 1Y7PA 3AT1B 3PG9A 2VASA 4N7TA 4ZIWA 2RRAA 2RKIB 2CQDA 3JQKA 2W9AA 3OTEA 2ATLA 1IBMF 3OVBA 5KFYA 1XMBA 3AD8C 4U95A 1VC5A 4USUA 3C3LA 1U6FA 3C16B 3W8GA 1GXUA 4JV1A 2F65A 1SJRA 3VAFA 4I2PB 2OEKA 2GX8A 3E3XA 3KLIB 2RAQA 2RSQA 1CSJA 1OIAA 1FEEA 3HHEA 3I5AA 4X65F 3PY8A 4FF4A 3V4MA 1W2BR 4NCBA 2IAJA 1RA7A 5F8HA 2AW0A 3M2UA 3CJKA 2O01C 3WQPA 3TA1A 1S0NA 1CULB 3G4SS 2LYVA 2GVZA 2FHOB 2Z58B 3BBCA 4WE1B 4WYLA 3ZZUA 2QZ8A 2LQJA 3JSRA 4I69A 3TO8A 3TZZA 2YNIA 3CJ8A 4JI6F 2FVCA 4BCAA 1X4AA 2IA0A 3TAQA 3FC9A 4X84A 3EPGA 2DPJA 5EWGA 4RU2A 2XTJP 3EWGA 2N7CA 1YBTA 2YQ1A 4LBPA 1NK4A 3RAMA 4IG0A 2CQIA 4JYAF 2PA8D 3FMWA 2HHWA 1QSLA 4HHJA 1R3NA 4MJKA 3W63A 2HBYB 5BR8F 5JVHQ 2QX0A 4OHWA 4IRKA 2AIRB 1N5QA 2RUSA 3EZ5A 3ZZ0A 2R42A 2OPPA 4ECXA 1L3VA 1Q8LA 2Y0SD 1D9AA 3AFGA 3DMJB 1KWMA 1VCTA 3VAMA 4J9QA 1ZH5A 3U1NA 2HHVA 4RNFA 7AT1B 4WXWA 2ZKTA 3NWRA 3EUNA 2BV3A 2G1HA 2YWEA 4I4BA 1S1TB 2HVIA 3LANA 3I0SA 4K4SA 3E51A 2ZVIA 1NK5A 2M9KA 3DYAA 3FBBA 4G1PA 4LT6A 1GMWA 4ZJLA 4DPOA 3DI6A 2IM2A 3HF5A 2PSZA 3QFWA 3QT8A 1R8BA 2K7JA 5DDQC 3GV7B 2RDJA 2HEKA 2WVDA 1KHWA 2KRBA 1S57A 2FZCB 4HLBA 1ZBTA 4BWJA 5IM0A 3K0JA 4FXDA 4NLYA 2VKRA 1NH7A 3CD7A 3TJAA 5A0YB 2C2MB 2FGCA 2WCXA 4RNMA 1JJ2R 5KG1A 2XNQA 3AOAA 3CCUS 3V81B 1ZAVA 2ILZA 2DHSA 3NXZA 2H65B 2HZVA 1FJGJ 4USKA 4DSEA 1IWGA 4MTPA 2MSTA 4FXWA 1S99A 5HVHA 2VBYA 2KYXA 1QM9A 4JI3F 3DN9A 4K0KF 4X4OA 1VHIA 1OPIA 3S6EA 2Z8QA 2WOMB 2ZITA 4G1QB 2FZKB 4K4XA 1HWLA 2WBMA 4JI2F 4DV0J 1HYSB 2KM8B 2XO6A 4F0HA 3LWLA 1IR0A 2NXUA 1DURA 1HBNA 2EFGA 3AH6A 1H7WA 1NU4A 1UL3A 4WU2A 4KHPF 4YOEA 3T5JA 2LDYA 5J2NB 2W7AA 4IO1A 3W60A 1LWFA 1VQYA 1TKTB 2LLZA 2OSRA 2U1AA 2BE7D 2K3KA 3VCDA 3OL7A 3VF0B 3CJ2A 4GO7X 3GJSB 3NGRA 4WZQA 2RRBA 1FKPA 1VLOA 4R25A 5KFRA 3M6UA 1Q53A 1WEXA 4N8OA 2HHHJ 2RQCA 3DLBA 1S4FA 1UEUA 1JLAB 2ZNYA 2VG5A 4JI5J 3HP6A 1L5UA 4M5IA 2UXCF 1FDAA 3OSPA 2D7SA 2U2FA 4C3LA 3PIPQ 5D0HA 1X7VA 4HYKA 2B7BB 2IA6A 5CAAA 1T05B 2HWHA 1WD6A 1FERA 1RK8A 2FC9A 3A4TA 1NZ8A 4DPUA 2BJ3A 3KHLA 2VICA 3KMSA 1QSYA 2E9TA 3MMJA 2KFYA 3BGRA 3JSMB 3BEGB 2MKKA 3HZGA 3EDRB 1YJ7A 2B4VA 2YKMB 5BYRA 2XB2D 5L39A 2IFXA 1L3TA 3Q2TC 2BOAA 4CYUA 1HBUB 3FNNA 1UWAA 3E01B 1X8DA 1WDTA 4XK8C 4FNHA 4Q2MA 4CLPA 4DPTA 1FX2A 2YPYA 2F3JA 2ZJQQ 2KXHA 3DLEA 4ZLNA 3O8WA 5F8MA 2DT9A 3DC2A 2BR0A 2GGPA 2ZHOA 1C4CA 1BGXT 3BO3A 1QY7A 4OYBA 3SV3A 2UU9F 3U02A 1IJFB 1EQ0A 3MEEB 2GVDB 2VDHA 5J1PA 1RTDB 4FF2A 4JYAJ 3UQSA 4J37A 4JI1F 1DBDA 2I8EA 2Q6BA 3MECB 3W1YC 3UD5A 5HLFB 1S1XA 4OYPA 3MTJA 5BYQA 2QLBB 5DM6Q 1S1WA 1YHQS 3BBBA 3V6JA 5B0DA 4GKJJ 1H98A 2RQ4A 4S0MA 1FRXA 3SSRA 4F4AA 2NQPA 2ERRA 4Z2XA 3DOKA 2B56A 1FRKA 5A8RA 1VC0A 3DKDA 3I96A 4O3RA 2DISA 1CJTB 3DMJA 2E5HA 1N8RT 3W62A 3M9NB 1OWXA 3ITHB 2VG7B 3SSQA 2BEFA 2Z2ZA 4LFCJ 4X65J 1SJ3P 3DI6B 1HW8A 2X3DA 3MUTP 5C25A 5IQQA 1S9FA 4CLTA 3RBDA 1O0PA 3JSBA 3NOCA 1U2FA 3R6GB 2GHWA 3MM5A 1VHFA 2N3OA 5KFHA 4X66F 3PYFA 3IRXB 3OJUA 5EDWA 3G6VA 3PX4A 1BMQB 2AJ0A 2BJ7A 4ZPVR 1BD6A 3PACA 1QAIA 4RNHA 1KVKA 2XGQA 5KT7A 1BWVA 3L7PA 1RXOB 2OMLA 1CJKA 2Z4PA 4DUZJ 2XEXA 1PBAA 1RABB 2OSQA 3I32A 4NLDA 3FCHA 3CD6S 4C8ZA 3OTOF 1V3ZA 4J9UE 2HQ3A 2UZAA 4OZNA 1AROP 4C2MA 2JEGA 1M5SA 1C1CB 1K1SA 4CLZA 2ALYB 1EHWA 3AD7C 3LA0A 4HHHA 5KFTA 3UDLA 2GIQA 5E3PA 4A4JA 2DNNA 1CPZA 2CPZA 1DZ5A 3BGLA 3Q86A 4H54A 2RKIA 5I3UB 1RTJA 4J9OA 4N56A 3PR4A 1S79A 3IFEA 1LWEB 5THWA 4DV4F 2QJ3A 4ZPCA 4NRTA 1YJ9S 2UV8A 2XZWA 3KLIA 4NCAA 2LMIA 2F9JA 2L9DA 4DFMA 4I2PA 1JWWA 3PEHA 1ZPWX 3TUJC 4CLFA 5M2RA 3C16A 4ZCMA 4NLTA 1AFIA 4LF7J 1X4BA 2CPYA 4KY3A 3KKFA 4FBTA 3BQ0A 3JXOA 4LF8F 4LMZA 2VQEF 4P72A 4YB5A 3KLGB 2C3MA 4V1Ak 1U1NA 2CJBA 4F02A 1KFDA 1C0TA 3F56A 3MCOA 4L74A 2AF6A 2I1RA 4NI2B 4EFAC 2OLWA 5KT2A 2GFFA 3O5TB 5HMWA 3UR0A 1MLAA 4DU7A 2H5JB 3LP2A 2AMCB 1BE4A 1U2RA 1R8CA 2ROPA 3ILLA 4OYMA 4UQGA 3TARA 3JAMU 1EJ7L 1SIWB 5DLFA 2H5IB 1Q95G 2Y0BB 3GFXA 2DGXA 4QWAA 2QA4S 4F4YA 1I1GA 3GR0A 1PIEA 3HVRA 3GMGA 4PG5A 4RWXA 4B3OB 3UR3C 1N32J 2PMWA 2V8VA 3WC2A 2P2CB 2CQ4A 1VQNS 5DLGA 3LP1A 2KHDA 1FF2A 3MM8A 3UW1A 3G71S 1ZAXA 1CC8A 4WPAA 2JSXA 1YJUA 2E5IA 5HJXA 5DZ7A 4DG1B 4LR7A 3ZZRA 3OL9A 4Q5VA 2K06A 2MZJA 3ETMA 4RR5A 4RUCA 3H5XA 4DV2F 3AB4B 2HW3A 1E6VB 4DSJA 3K57A 4JI4J 2HVHA 2KH9A 3R3TA 1VR6A 4FVMA 1HPZB 4MT1A 1JMTA 1J5OB 3A1YG 1CJUB 3JQJA 1GXTA 2MEWA 1HWJA 5D0GA 2IDLA 4DV0F 1BQNB 4JI2J 4BDPA 4B3RF 4QR1A 1YZ6A 4DCOB 4NLGA 4OHVA 4OI0A 1RT2B 3HSZA 4U6PA 3NNCA 1PJ7A 3B82A 3EGVA 1S72S 1KLMA 2QL9B 5C42A 2HBZB 2HFVA 3GYXB 5I42A 6AT1B 1UKUA 1HQ2A 2QL5B 1RWWB 1S6UA 3G8QA 1S6OA 3QWPA 2CIMA 1FWLA 3KUEA 2KZMA 3ILJA 3SDEB 4DFPA 4C3MA 3BREA 4IH6A 5HJYA 1HD0A 4RZRA 4JB8B 2IJRA 4DQQA 1PC5A 4ECQA 4IR1A 5KG2A 3W5XA 3Q23A 2MQQA 1UA0A 3DRRA 2ZBIA 4ZIVA 2Q79A 4KH1B 4L76A 1FJCA 2BANB 2OGUA 5IWAF 1S9EB 2EFVA 3MCSA 1BUXA 2EFPA 4ID5B 2HG4A 1VQSA 3FBFA 2N82B 4WCEQ 4TU9A 1ITPA 1G1XA 1R0BG 2C2OB 1DAXA 2Y3YA 1WHXA 2LU1A 2Y8YA 5KFZA 1KDNA 3K2YA 1JK9B 3I4PA 4UOFA 1XIQA 1S1UA 2MDAA 4PXEA 4ZPTR 2XQCA 1NSAA 2LKZA 2CUYA 5K9FA 2HHXA 3DHXA 2AX1A 2WAQD 1ZOTA 4OZ0A 3D5MA 2EK1A 3MWBA 3L9ZA 1JJCB 1TKXA 2R3VA 3KK1A 1RAJA 2DNLA 4CRJA 3MMCA 1B7FA 3BN4A 1NRKA 3H8YA 1GH8A 2DR6A 2EWHA 2QG9B 2UXDF 3KJQB 1L3SA 2AYMA 2XZDB 4JI6J 1RWVB 5KFFA 4HDGA 3QFHA 4DUTA 3ILIA 2MGZB 1HNVA 2FGOA 2XS5A 3O6QA 1F9HA 4USMA 1F5BA 5J2MB 2RHSB 4DHVA 1RT2A 3M4XA 3MFHA 3PYGA 1FA0A 2PT0A 1SQFA 3PYEA 3BDEA 4KPCA 4QZVB 2RU3A 3OXLA 3P3DA 2K8GA 2V4JA 2LFVA 4LRFA 2PDAA 4DSKA 3MOZA 3CJQA 4PYDA 2DPIA 5C5JA 2Z30B 2MY8A 2ZDPA 1J27A 2CQ1A 1PILA 4A48A 4Q44A 1UFKA 2FIUA 2DXEA 3K5NA 4ED6A 1NK7A 3GZ7A 1RHJB 2WZ1A 4KBIA 1M5HA 5KFKA 4DL3A 2C2RA 2A10A 4TYAA 2HNZB 1JXEA 1TL1B 2XS7A 1OQ6A 5KFXA 4UUWA 4NLVA 2J6UA 2G0JA 3ENAA 2C1EB 2F7VA 2KN4A 4DR1J 1EX8A 2JVRA 2LXFA 3LALA 1SC3B 5FDLB 1DTTA 2QLWA 1MNEA 4G65A 4Y2IA 6FDRA 3FSIA 4W4MA 2ZM6F 4B3OA 1RT3B 3BH6B 3OHBA 4NE9C 3PCOB 4HHUA 4EYHB 2X1GA 2N3LA 4PWDA 4ES3A 2FJXA 4XPEA 1K73T 1RT6A 4WU3A 4C98A 4DX5A 4HEA9 4B9TA 5CABA 4NA2A 4DZDA 1Q7LB 1ZAWA 1KLNA 2AZ3A 1NEEA 2CJKA 1H2UX 2X1BA 4F2RA 3X1LB 2IVMA 4DXLA 3QNWB 3OR2B 4YB6A 4YUDA 4RNNA 4ELUA 1GX5A 1T9WA 3DXBA 2D3O1 1VQLS 1KSPA 4LF6J 1RAEB 3HX9A 4NYOA 2YX7A 4DN9A 3GIKA 2VD3A 1FHTA 3N01A 3PX0A 1X4CA 2VJUA 2ZH1A 4ED1A 2X1FA 1KQKA 2W24A 2NREA
chains in the Genus database with same CATH topology
4LBHA 1MWQA 3ZNUA 1S7IA 4LBIA 4LBPA 4FPIA 3ZO7A 3ZNJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LBH A;  1MWQ A;  3ZNU A;  1S7I A;  4LBI A;  4LBP A;  4FPI A;  3ZO7 A;  3ZNJ 1; 
#chains in the Genus database with same CATH topology
 5HQL A;  3PRB A;  6FD1 A;  2WHO A;  1R0A B;  3RR8 A;  1K47 A;  1S7I A;  1CJV B;  3FMB A;  3I0R B;  3Q89 A;  3QPI A;  5HMX A;  4ZPA A;  3OLB A;  2XS2 A;  1LWC A;  4KFB A;  4CLL A;  4CTA B;  4DPY A;  4IDK A;  2EI5 A;  1U48 A;  5H9E J;  1LFW A;  4QIV A;  2HYI B;  4IRD A;  1F5A A;  2DNH A;  1NKB A;  1NDL A;  4H4O A;  3NAI A;  2ASY A;  1TP7 A;  2QT7 A;  2GMJ A;  5D4O A;  2E1R A;  3E01 A;  3JB9 k;  3P8B B;  4WII A;  1FRI A;  2VDI A;  1UZD A;  2IHR 1;  4DLE A;  4J91 A;  1X0P A;  2IRU A;  4ZCK A;  2OD4 A;  4JI7 F;  1DFD A;  2DHH A;  4OMF G;  1HQE B;  4ZVE A;  2B3T B;  3VR1 A;  1JXV A;  3M8Y A;  2A2C A;  2AD9 A;  2C2D A;  2DR9 A;  2P9C A;  2ATC B;  1S9G A;  3N6M A;  4JV5 J;  2R8K A;  1X4D A;  4U7U K;  4ID5 A;  2BQR A;  3I87 A;  2FJE B;  2PI5 A;  2R7O A;  3WIU A;  4KV8 B;  4RBV A;  1K8A T;  2CJ9 A;  4R5P A;  1MN9 A;  2B6A B;  4ZA1 A;  1N0V C;  3T9N A;  2Y9H A;  2L3M A;  5J1E B;  1S97 A;  4NWB A;  1F2H A;  1HQU B;  5JVG Q;  3PKM A;  2ZM6 J;  2LEC A;  2HK3 A;  2CWX A;  3RB4 A;  2CQB A;  2HVE A;  1RCO B;  4O4R A;  1WF1 A;  5LM7 E;  4A8S A;  3P5T L;  2ZH2 A;  3DLL Q;  5GAG U;  3OJS A;  1N56 A;  1FKP B;  3T6J A;  3WX8 A;  3CWJ A;  2GQC A;  2FJA B;  2WTF A;  2JLG A;  3ITH A;  2ALZ A;  1EAR A;  4H4M B;  1WOS A;  2ZH9 A;  2KL8 A;  1Y4Z B;  3OTC A;  4ATN A;  1WI6 A;  4X4P A;  3H5Y A;  3M8S A;  1WF2 A;  1UVL A;  2RJZ A;  1CJU A;  1A6L A;  4UST A;  1R27 B;  5I42 B;  2YNH A;  4J9S A;  4YHH J;  4QYZ J;  2QFI A;  1T95 A;  2M88 A;  2V4J B;  2B5J A;  3AD9 C;  3HDS A;  2VJV A;  1BWE A;  3QO9 B;  3B4D A;  2I9S A;  3BKU A;  4OJ1 A;  4U67 Q;  2DGQ A;  1MMD A;  1HHS A;  1FI4 A;  2HHP A;  4I68 A;  4LRB A;  4DQR A;  4A8K A;  5ETN A;  4OZL A;  1UVI A;  1N5T A;  3LGM A;  2FJB B;  4UW2 A;  4HVZ A;  2V69 A;  4Z7C A;  5GAH I;  3VV2 B;  2MGZ A;  2IYI A;  2M4M A;  3QJL A;  1WSV A;  1YQH A;  3MM7 A;  2J5A A;  1GMU A;  2Z0G A;  2A6M A;  3S1T A;  3UN5 A;  1XWL A;  4IG3 A;  1F2G A;  1CS4 A;  3N28 A;  5C2C A;  4IFY B;  3DLE B;  4RW9 A;  1H72 C;  2WSF C;  4M5D A;  3RBX A;  4D3H A;  2C28 A;  1QSS A;  4C0O C;  1QAX A;  3QT6 A;  2J7K A;  2XBP A;  1YVF A;  5A2Q Y;  3QGI A;  3DYA B;  2XSJ B;  3CO9 A;  2VPX B;  3W8P A;  2MKI A;  4I64 A;  3MR7 A;  1NB7 A;  2VH7 A;  1MMN A;  3RYL A;  4IRC A;  3C66 A;  1JJ4 A;  3JTP A;  1RP5 A;  3LAK A;  2IBK A;  1H3D A;  2JLF A;  5F9N A;  2W7O A;  5HBM A;  3J80 U;  2JFK A;  1P1T A;  2OEM A;  2E9Z A;  4RBU A;  3KLG A;  1B7Y B;  1PYT A;  3GIL A;  4PZV A;  2BAN A;  1TUG B;  5CYQ B;  2YBV A;  1WC0 A;  1PBU A;  2M52 A;  2NUH A;  3I5B A;  3CCS S;  2V34 A;  5F0U A;  1B64 A;  1F5C A;  4ED5 A;  4A8W A;  1VQP S;  2VOD A;  5KG6 A;  1YX2 A;  5CYM B;  3J80 Y;  5HP1 A;  2EFN A;  3O3L A;  4X62 J;  2DNZ A;  4QYR A;  1HNZ J;  2EBE A;  1N33 J;  2N7Y A;  4LQ3 A;  1H74 A;  3C19 A;  4CDI A;  5GAE U;  5E7O B;  1HFE L;  1HR0 J;  1KTQ A;  2CPX A;  2ZBC A;  2W9C A;  4KKO A;  2HFN A;  3DLG A;  1VRU A;  1TUV A;  2LEA A;  1BQN A;  5M2U A;  4WFB Q;  4JI4 F;  3D54 A;  4RJV A;  5B0B A;  5T7L B;  4B9N A;  1J5O A;  5KFU A;  2KI2 A;  3KK3 B;  3MED A;  2R8G A;  4V19 J;  1LKZ A;  2RVJ A;  1AB8 A;  1EIY B;  5ETS A;  1WEL A;  2FLP A;  4RW4 B;  4DR5 F;  1UTA A;  4LF9 J;  1LW0 B;  1TAQ A;  1GXL A;  5B0C A;  2RU9 A;  3CME S;  3BS9 A;  3V2U C;  3J7A 1;  1WTF A;  4C7Q A;  1GAO A;  2DIT A;  5KG3 A;  3SMZ A;  2IMW P;  1DTQ B;  1KS2 A;  2RF2 A;  4Y3C A;  4DV5 F;  2MLX A;  1N5Y B;  2IM3 A;  4ZPB A;  2PFF B;  3QGG A;  3BGO P;  4BC9 A;  4C97 A;  4RW6 B;  1RHQ B;  4WTY A;  4CZC A;  1PYO B;  1FNO A;  2B4P A;  2DR5 A;  4J9N A;  2KXN B;  2I2Y A;  4YQW A;  4JI7 J;  1NO8 A;  3FFI A;  5E2Q A;  4D3G A;  4E98 A;  3L09 A;  2GJ2 A;  3G6E S;  2HLU A;  3X3U A;  3PFE A;  4A8O A;  1WG1 A;  2GHP A;  2XC9 A;  4GO5 X;  5E3A A;  5DG8 A;  1FFG B;  3OUY A;  1H73 A;  2XYP B;  4I6W A;  1SKS A;  3CE8 A;  1KRP A;  1HNW J;  3EVM A;  4JOU A;  4WP3 A;  4XDD A;  2E66 A;  4B3M J;  3IM9 A;  2F8E X;  5L1L A;  3SYZ A;  3RAX A;  4LF8 J;  4K8R A;  3VAG A;  4DJB A;  4PWD B;  1MSW D;  3BN7 A;  4RW4 A;  2C2K B;  3FFI B;  3H42 A;  1J2V A;  3UPF A;  1M1H A;  2MZQ A;  4OI4 A;  1WDD A;  2OEJ A;  3IAS 9;  2DNQ A;  5ETQ A;  1NJX A;  4M63 A;  1DQA A;  1NB2 A;  2OH2 A;  4B9U A;  2WB4 A;  4RW6 A;  2FTR A;  5T7L A;  3EE3 A;  4KGK A;  2B8Q A;  4O4G A;  4WKY A;  2C2E A;  1WSR A;  5M2P A;  1LV5 A;  1Q81 T;  1JLC B;  3E8O A;  4RX6 A;  1HMV B;  1VRU B;  3TA2 A;  1TK0 A;  1WTB A;  4ECW A;  2IBO A;  1Q8I A;  1D09 B;  5K20 B;  1YIT S;  1PJ5 A;  2YNI B;  1S4E A;  4DR7 J;  1X4E A;  3PW5 A;  3PRD A;  3NGS A;  1FDD A;  1XC9 A;  1GQE A;  3MED B;  5FD1 A;  2IAJ B;  1S0O A;  1D3W A;  3C15 A;  1DQ9 A;  2VPY B;  2E9R X;  2QTW A;  1X5T A;  1NSP A;  2V2K A;  1FK9 B;  2F8M A;  4LIR A;  4M5H A;  2BBE A;  2UXD J;  2MLZ A;  4O3O A;  4NLO A;  2GIR A;  3CDB A;  1UW9 A;  4HR2 A;  5J2M A;  3JSM A;  5DJB A;  3TX0 A;  3LWM A;  2KG0 A;  4DFK A;  2M2B A;  2W25 A;  1QTN B;  5IV4 A;  1UW4 A;  3H5S A;  4MAK A;  1SVD A;  5KFG A;  1NPP A;  2E44 A;  4LFA J;  3GG1 A;  3UDV A;  5K8O A;  4TQS A;  4IQX A;  1HD1 A;  3CB4 A;  2YX4 A;  5CYM A;  4YME A;  1FX4 A;  2MQL A;  1Q4R A;  2QN6 B;  4BC7 A;  3DGV A;  2VKZ G;  2D41 A;  3PJ9 A;  1JLA A;  3OXF A;  2KVI A;  2KG1 A;  2AJQ A;  2ZC3 A;  1CC7 A;  2F63 A;  2YKO A;  2Q3P A;  3W9H A;  2V67 A;  1VBZ A;  2R7T A;  1T9V A;  2VQF J;  3BR8 A;  1VRT A;  1JJH A;  1UEV A;  2VPW B;  1KEK A;  1T9U A;  1QDU B;  2CNO B;  2NS1 B;  3M30 B;  3PIO Q;  5KG0 A;  4G6V B;  1KFS A;  4TU8 A;  2RS2 A;  3D67 A;  3FRZ A;  2OO4 A;  3BF4 A;  2G4B A;  1IQZ A;  1E6Y B;  2H4W B;  2JC1 A;  4K5R A;  5A8R B;  5CHC B;  4F0K A;  2Q43 A;  3BJY A;  1MN7 A;  3FSY A;  2WOM A;  3CMA S;  4C8M A;  5B08 A;  2M3D A;  5DDR C;  3DRR B;  2AZ1 A;  4DS5 A;  3DHW C;  3HCX A;  4ELV A;  5DET A;  5JJB A;  2VC0 A;  4PXC A;  4HT5 A;  5KFJ A;  1TTH B;  4ANC A;  2JLE A;  4RW9 B;  1PKU A;  3QO9 A;  2YTC A;  4UF4 A;  1Y3J A;  2HQF A;  1AXQ A;  1GFW B;  5L9X A;  4ZIT A;  1U47 A;  1R8P A;  4IG3 B;  4DQP A;  2ZOM A;  2VBX A;  2RDD A;  1EZZ B;  3BKT A;  3Q2S C;  3SDE A;  1AUS L;  3M7V A;  3MM7 B;  1U26 A;  2CPD A;  4MKV A;  4USV A;  3O44 A;  4OJ3 A;  1O51 A;  2HRU A;  3NY0 A;  3NKY A;  4PG7 A;  3IO1 A;  5K14 B;  4CP5 A;  3DRS B;  3TUI C;  3UFC X;  4GC6 A;  1VQM S;  1GTE A;  1JKH B;  4FKY A;  4DQS A;  2Z2Y B;  4HDH A;  4LQ9 A;  3VVT A;  2NZ4 A;  3M30 A;  2VZ9 A;  2QLJ B;  4AD6 A;  5LXY A;  5AJ3 J;  1FXR A;  4ECR A;  3NCQ A;  4U7C A;  1CQM A;  3QYY A;  4DV3 J;  4B9M A;  2IRY A;  3GJQ B;  3CJR A;  3VTI A;  1T9Y A;  3GJR B;  2YWK A;  3M1V B;  4OYZ A;  4A47 A;  1HAR A;  4PAA A;  4F25 A;  4QQB A;  1Y11 A;  1WEZ A;  3IA0 A;  4N77 A;  1RUS A;  4CH0 S;  4C11 A;  1SL1 A;  2MZT A;  2FLL A;  1RLD A;  4NLP A;  4DQI A;  4DV1 J;  1MG7 A;  2RIJ A;  3W64 A;  3AOD A;  3C6T B;  4KE5 A;  5E3C A;  1V3S A;  2A2D A;  3D9B A;  2B51 A;  3BSO A;  2YWH A;  1N32 F;  2IY5 B;  4G3I A;  1ROF A;  2IVF B;  2C22 A;  3Q8P B;  2YY3 A;  2MMY A;  2OPR B;  4WWS A;  4N47 A;  1IKW B;  3ZZY A;  3MM8 B;  1S1V A;  1GEH A;  2G2O A;  4MK7 A;  5KFL A;  2A6O A;  5CQG A;  3V6K A;  2AEM A;  3W5Z A;  1SV5 B;  4HAC B;  1JLG B;  1B0T A;  2V9K A;  3HUL A;  2EKY A;  2QIF A;  4RKU C;  1TKD A;  1NK0 A;  4NYP A;  2VA2 A;  3ULH A;  2ZH6 A;  1VBX A;  3HVT A;  1RI7 A;  4DSL A;  3OL8 A;  3H4D A;  1JLF A;  4LRE A;  2ZD1 A;  3SQO P;  3LUY A;  3WIV A;  4B02 A;  3D2W A;  3IGN A;  1SC4 B;  1QAJ A;  2ZH5 A;  2GML A;  4EO8 A;  3H98 A;  3N6L A;  3KK2 B;  1TK5 A;  1VQ8 S;  1CG2 A;  1AFJ A;  4RW7 A;  2XLJ A;  3D28 A;  2ZOG A;  2HS4 A;  1IKY A;  5CXT A;  1TMJ A;  2UUC F;  4E2F B;  5DRK A;  4EO6 A;  1WHY A;  2FJW A;  4F2S A;  2R2U A;  1LW2 A;  1SI9 A;  3EMT A;  3GG0 A;  5F8G A;  2Y8W A;  3L7O A;  3RB3 A;  5J2Q B;  3VQT A;  1XNQ J;  1NH8 A;  1W2I A;  2J0W A;  2FD2 A;  5IXU A;  2UUW A;  4WTO B;  1B4S A;  2GIF A;  3EGN A;  3GYG A;  3I4H X;  4AXJ A;  1S0M A;  2DGS A;  3HSJ A;  3TEH B;  1RU2 A;  1K0V A;  3W61 A;  4K4W A;  3CDW A;  1BQX A;  2B9Y A;  1Y9O A;  4KSE B;  4WK1 A;  4O3Q A;  3OUY B;  4QWD A;  2AGP A;  2BZ2 A;  2H54 B;  2QA1 A;  4ES2 A;  4JV0 A;  4YFU A;  2HFZ A;  1NJY A;  2I38 A;  3B54 A;  2A3J A;  3DCA A;  4KAI A;  4OX7 A;  3RG6 A;  3TQ1 A;  2BVZ A;  4B3T J;  1SV5 A;  4HAC A;  2KT2 A;  3GJT B;  1LNQ A;  5KFQ A;  1K9M T;  1Y5L B;  2I0X A;  3ZTR A;  3PJW A;  3OR2 A;  3SIP B;  3R2C J;  2E1P A;  2J7U A;  4NXN F;  2KJV A;  2COL A;  3BPS P;  3CJ4 A;  1X5O A;  1WHW A;  2RF2 B;  3GU0 A;  4YDX A;  4DR2 J;  2F9D A;  2VPZ B;  2KM8 C;  2J0Q D;  1X31 C;  4NLX A;  3FZ2 A;  3V4I B;  1KTV A;  3G87 A;  1X5S A;  3HD1 A;  5T41 A;  3ZTP A;  1NKC A;  2XMT A;  3MDF A;  2CPE A;  4ANE A;  5FLX Y;  3D6F B;  4QWC A;  1VLY A;  3T1H J;  4AL5 A;  1N5V A;  2WW4 A;  4CT8 A;  4NXM J;  4ZVU B;  4ZP9 A;  3GFH A;  2G13 A;  5HMY A;  1C1B A;  3K58 A;  2R2R A;  1N34 F;  3GTY X;  2ZNZ A;  1YJW S;  4YP3 A;  1U25 A;  3QZ7 A;  3CDE A;  3Q8V A;  2ADB A;  2CPJ A;  1RBL A;  3N5F A;  1D1U A;  2W4C A;  1KR4 A;  4IFV B;  3AQP A;  3HVA A;  4KKO B;  2HS0 A;  1NZA A;  2IIH A;  1U1Q A;  2X1A A;  4MKY A;  1C0U B;  1JKH A;  3T19 A;  1YRT A;  4J9R A;  2LXI A;  2YQ3 A;  2ZE2 A;  3KJN B;  4KR0 B;  4OI2 A;  4F0M A;  5GAD U;  3RGI A;  4PYA A;  1VK3 A;  5D4P A;  1FRJ A;  1SC1 B;  3LO3 A;  3GSI A;  4DR2 F;  4OX6 A;  1F6T A;  4BS2 A;  5IT9 Y;  4OHZ A;  1T94 A;  2B9E A;  3EXY A;  3PYD A;  4QWE A;  2L48 A;  5HLF A;  5CA5 A;  1O5J A;  4E8U A;  2KT5 A;  4TNO A;  3SCJ E;  1MW7 A;  2BA9 A;  5I3Q A;  3CW2 C;  4X64 J;  1LXN A;  4NZ6 A;  3BDP A;  4N76 A;  1RTD A;  3R5A A;  2DCL A;  2H48 B;  1JQG A;  2G1D A;  5B0E A;  4RUH A;  3D3C J;  2OKQ A;  3G6Y A;  1TV6 A;  2DNK A;  3KJF B;  5B0G A;  1UMJ A;  1XMO J;  2QYC A;  2JDJ A;  1RAH B;  1HIY A;  3DDK A;  4UZB A;  3PNI A;  1U2C A;  3RUB L;  1FKA F;  2RE1 A;  3CJS A;  3F44 A;  3OHA A;  2XUL A;  3BSC A;  3HKW A;  2B0G A;  4IUF A;  4K50 A;  4NA1 A;  5KFN A;  1FWP A;  2CNK B;  1S12 A;  3B4M A;  3HVT B;  3IXQ A;  4DF8 A;  5HRO A;  2W4D A;  1EB0 A;  3R5J B;  3SZ2 A;  3ZFV A;  4GKK F;  3K8W A;  2CXE A;  2KKH A;  2CQH A;  1U1O A;  2Y1J A;  2JC0 A;  1X9W A;  1N6Q B;  3N0V A;  2ZH4 A;  4X4N A;  3H25 A;  3H5U A;  3UD3 P;  1IJE B;  4NMX A;  4JI5 F;  2CZV C;  2YNF A;  3KLE A;  1X60 A;  3VAH A;  4B3S J;  2F8H A;  4YB1 P;  4I2Q B;  5LJ3 Y;  4MIB A;  4X4S A;  2W8K A;  4DOZ A;  1XMQ J;  1AZS A;  2R2T A;  1ZA1 B;  3LOU A;  1IBL F;  3TZX A;  2OIH A;  1AYE A;  1HBO A;  4RW8 A;  4FYY B;  5J2P B;  3T1H F;  1Z1Z A;  1TKZ A;  4TKT A;  2V68 A;  2HZA A;  2XMA A;  2GNK A;  3SQG B;  4B9L A;  2OP5 A;  1HPZ A;  1VS3 A;  4A8M P;  3FQK A;  4PPD A;  5LSR A;  3JTO A;  3IBF B;  3R8Y A;  5HQ8 A;  5KFB A;  1T3O A;  1DLO B;  3PM9 A;  1H6K X;  2QA4 G;  1D9F A;  4ZOS A;  2XZT B;  1P1L A;  2PMH A;  2AEF A;  4J9K A;  3HD2 A;  2CJY B;  1JNZ B;  1YRU A;  1HMV A;  3AAW B;  3DRX A;  3MZI A;  4P74 A;  5F8I A;  4DSF A;  2ACY A;  5IS2 A;  5D15 A;  4B3T F;  4ZDN A;  4UUX A;  4WKR A;  4WYW A;  4DWI A;  2GV1 A;  4J7C A;  4ICL A;  2V9W A;  4OI6 A;  4DPW A;  3FBE A;  5J2P A;  4F7V A;  2LQ8 A;  1WOO A;  2YQ0 A;  3TJ9 A;  1SJ1 A;  2P8I A;  3CJ0 A;  4C0B A;  1HQU A;  1YJT A;  3IWL A;  1Q1K A;  3MF5 A;  3P6Y C;  3T3F A;  3ZTO A;  3V81 A;  2AGO A;  4DSI A;  2HHU A;  4OL8 A;  4I2Q A;  5HAT A;  3JYT A;  1KOH A;  3BPD A;  4JV2 A;  3UE2 A;  3I31 A;  2QMW A;  1SKU B;  2EC2 A;  3UO0 A;  1OY6 A;  2HHQ A;  1FKO A;  3KG1 A;  2XCA A;  2XG8 A;  2MQO A;  3KLV A;  4ES1 A;  1GT8 A;  3W2V B;  2DNG A;  3Q0A A;  3QZ8 A;  1KBR A;  2DO4 A;  3CCM S;  4EBD A;  1FRL A;  2ZEJ A;  4K0K J;  1FVQ A;  5GMD A;  5GME A;  1Y5I B;  1F0X A;  1ACM B;  1LWX A;  3PW0 A;  5KFE A;  3CD0 A;  1U8S A;  1GMW D;  4CH7 A;  2HND B;  2FVP A;  4P52 A;  2F4V F;  2E5L J;  2HQI A;  2P5V A;  3L95 X;  4USI A;  4XTT A;  5KAK A;  3H90 A;  1VQ9 S;  1B3T A;  1WOR A;  3J81 Y;  4UOH A;  2XO7 A;  2ZHB A;  2XY6 A;  2FJD B;  4ZS6 A;  5GMK a;  2JRS A;  2AYE A;  2DH9 A;  4NPO A;  4QBU A;  3RR7 A;  1ZZN A;  1QLN A;  2ZHA A;  4PAB A;  3EPI A;  3W9I A;  4JUZ A;  2C3P A;  3FRY A;  2YWF A;  4P9S A;  4TLR A;  4LRC A;  1IKY B;  4QPX A;  1TL7 A;  2IC3 A;  3POT A;  3OV7 A;  1Q16 B;  5ETT A;  3KHG A;  4RW7 B;  1REG X;  2OFH X;  3THV A;  1WUU A;  3KK2 A;  2JHE A;  1IQT A;  4USW A;  4ID8 A;  4XO0 A;  1DJ0 A;  1WOP A;  2W1B A;  3JTN A;  3MCM A;  4WE1 A;  1R6Y A;  1RAG B;  4QW9 A;  2CVI A;  4IYQ A;  4ZJO A;  1LK5 A;  1Y3K A;  2CG4 A;  2F5G A;  2AX0 A;  5HAN A;  5AE2 A;  2G0I A;  2ZWO A;  3TEG A;  2DRB A;  5B0A A;  4LF6 F;  1Y00 A;  2WVE A;  3FBC A;  1C1C A;  2BMB A;  3PW4 A;  1JLE A;  1TMM A;  1YSJ A;  5HP1 B;  3CPW R;  4IOC Q;  5D77 A;  1M90 T;  4FYW B;  3TP2 A;  4NLS A;  3MAH A;  1RB0 A;  4KHM A;  2OAU A;  4LRA A;  4AQY J;  3I6P A;  2V50 A;  3DRP B;  3TAM A;  4BWM A;  1IKW A;  1WC4 A;  3N5B A;  4PQA A;  3OQ2 A;  4KO0 B;  5F0W A;  5BXI A;  2CAD A;  4PKD B;  3OVS A;  1TL1 A;  2MLY A;  4CT9 A;  1OS5 A;  2GQQ A;  4LVN P;  1T03 B;  2J9D A;  4C9D A;  1PSD A;  4IKA A;  3Q83 A;  2FY1 A;  1CJT A;  4M5K A;  5GAH U;  2BUN A;  2DH8 A;  4DR3 J;  1TL3 A;  2QO3 A;  1RU1 A;  4EK2 A;  3V6D B;  1I6J A;  5HN0 A;  4K4T A;  4C11 B;  5F9L A;  5L8R C;  2DVI A;  4P2S A;  2PC6 A;  3GSD A;  3M8W A;  4LF4 J;  5DG7 A;  3B78 A;  1ZTW A;  4LF1 A;  5IT4 A;  4QU7 A;  1S1W B;  3FEZ A;  1NXI A;  2DO0 A;  4QCL A;  1UZH A;  2EKN A;  3UCZ P;  4M5D B;  2XYG B;  2VG7 A;  5DDP C;  2HIY A;  4X4T A;  5LXR A;  2BQU A;  5HMZ A;  4O0I A;  2CDR B;  2WVC A;  3P49 B;  2R7X A;  3TQE A;  3G6X A;  4A46 A;  4ZHR A;  2PII A;  4K4V A;  5ETK A;  5IOL A;  2XMV A;  1QUV A;  1RWK B;  2LXU A;  5A76 A;  2OTL S;  2ADC A;  1VC6 A;  4AQY F;  1CVJ A;  2OEL A;  3G9C A;  1SUQ B;  4DX7 A;  4ZVT B;  3CTR A;  3KXD A;  3W65 A;  2VC1 A;  5KT3 A;  3OSN A;  3VZI A;  5FLX U;  1EET A;  2E1A A;  2BKN A;  4ETZ A;  3N79 A;  2XMJ A;  1FEH A;  2Q1L A;  3MGJ A;  5ETP A;  2VBW A;  4FDF A;  4DV7 J;  3UCU P;  3CIZ A;  3ENQ A;  2ZH3 A;  2BQ3 A;  3LQV A;  4FF3 A;  2DCU B;  2H9Z A;  2FLO A;  4UOG A;  4EU0 A;  5ETR A;  1X4H A;  2FUG 9;  1YJR A;  3R5B A;  4YEA A;  5HVF A;  2P9G A;  2Q66 A;  4CYU B;  4LFA F;  3W7B A;  3GIR A;  1IN0 A;  2EW9 A;  3ILO A;  4YHH F;  2I6W A;  5HVG A;  1I3O B;  3A8E A;  2YXL A;  2HK2 A;  3C14 B;  2BW2 A;  4IH7 A;  1YLX A;  1TQL A;  3BGR B;  1EP4 B;  3SXL A;  1FTR A;  2CA9 A;  4L72 B;  3BM7 A;  5CD4 A;  4ZN3 A;  2CPF A;  1ZM9 A;  1IXK A;  3DLK A;  2UVU A;  4B3R J;  2BJ1 A;  2QMU B;  1IKV A;  4NXN J;  3MR6 A;  2UUB J;  1WKJ A;  2IMO A;  2DH7 A;  3MMA A;  4M5N A;  1NPK A;  2V2Z A;  2UXB J;  4QR0 A;  5DGA A;  1M1K T;  4C8L A;  5K8N A;  5ETO A;  2JEF A;  1TEL A;  1UPP A;  5D4L A;  2B6A A;  1RE1 B;  2PGC A;  3NBP B;  2AQ4 A;  2LVW A;  3J7Y U;  4PQU A;  4CCH A;  3J81 U;  1VI7 A;  5C42 B;  1HHT P;  4K2J A;  4XPC A;  2L41 A;  3C14 A;  4CLU A;  1OO0 B;  2YNG B;  3GCW P;  2GA7 A;  1UVM A;  2HWT A;  3M32 B;  3S8S A;  2OI2 A;  5D0R A;  5KTQ A;  2BAB A;  2HGN A;  1UFL A;  4ZVF A;  2DHX A;  1N54 B;  1ZS6 A;  2GAH C;  3R2D J;  2F4F A;  3OFE A;  2PN6 A;  1LOU A;  2V94 A;  4H4O B;  3WBZ A;  3HT3 A;  3TAN A;  4YR2 A;  3FVY A;  5ETV A;  3KLE B;  4TXS A;  1FE4 A;  3K5M A;  1CS4 B;  3M6X A;  5BYS A;  1LWC B;  2BJE A;  2KB2 A;  1HBN B;  4KFB B;  2H5E A;  4DV6 J;  3ISN C;  3RB0 A;  3C2P A;  1BY9 A;  2HHT A;  1HYS A;  3BZQ A;  3OBI A;  1RA6 A;  5EN1 A;  4G1Q A;  1RLC L;  2QE5 A;  4AXI A;  5D0E A;  1RCX B;  1RAD B;  2F1F A;  2PMZ D;  1RGV A;  2ZOF A;  4NLR A;  2ZUG A;  4AND A;  3NWG A;  1NME B;  2VB6 A;  1MRO A;  3EVW A;  3NLC A;  4UQT A;  4B3S F;  3MFI A;  2NPI A;  2RH3 A;  4OX9 F;  3M8Z A;  3BSA A;  3HMJ G;  4NEY A;  2YWG A;  1NLK L;  3OFH A;  2XI2 A;  5D3G A;  2QSW A;  5DZ6 A;  1NCL A;  1FVS A;  2P6S A;  3AA9 A;  4OV1 A;  3S7R A;  4ZHR B;  1XNR J;  2DIU A;  3DOM B;  2HUR A;  4ECT A;  1Q7Y T;  2RRN A;  3UN3 A;  4KO0 A;  3TZW A;  4AL6 A;  3R27 A;  2QYG A;  4WIQ A;  1RDR A;  2K1R A;  1G2E A;  3VQS A;  2R7R A;  4DN0 A;  3CUN A;  2ASL A;  4I7F A;  1UWB B;  4ENO A;  3QT5 A;  1TL3 B;  3ISN D;  1N88 A;  3GFY A;  3PHE A;  3GP9 A;  3TZY A;  5BJR A;  2GO8 A;  2B4U A;  3HFZ B;  3IR6 B;  5AXK A;  4M5J A;  2J8A A;  2ROG A;  1P27 B;  5AT1 B;  4C8K A;  4F3Q A;  1RTJ B;  1FNM A;  3NAH A;  3N9U C;  4R5P B;  4ELT A;  4USH A;  1RHR B;  3UD4 P;  3PX6 A;  1N48 A;  4EZ9 A;  5U47 A;  3A3O B;  3P4U B;  3J81 j;  3CED A;  5IFM A;  3NCR A;  2YH1 A;  3J7A N;  1R6V A;  2NSC A;  3M8Q A;  4OI1 A;  1RQ0 A;  3ONQ A;  4NZ7 A;  2IM1 A;  2DNY A;  3R5G A;  4OFZ A;  2XCP A;  2PE8 A;  3IBW A;  1V6H A;  1Q8K A;  2KVQ E;  5ETL A;  1EKR A;  1RT1 B;  2PFD A;  3IC1 A;  3RU0 A;  1JIH A;  3RTV A;  1F60 B;  1X4F A;  5IV3 A;  3HHD A;  2V2V A;  1RHM B;  4ZJQ A;  1PCA A;  4OX8 A;  2O67 A;  5JUM A;  2D3O R;  3S01 A;  3TAP A;  1RAA B;  1S0V A;  3UI3 A;  3ETO A;  5LOQ A;  1T8E A;  1X4G A;  3QT7 A;  1CEZ A;  4ZVQ B;  2R9L A;  9RUB A;  2V8H A;  1SQG A;  3T5H A;  4Q0B B;  4HTJ A;  1S49 A;  4PR6 A;  4CTA A;  2GAG C;  5ADZ A;  3I0R A;  5CYJ A;  1UWB A;  4J9P A;  5H9E K;  1JXL A;  3MM5 B;  3H59 A;  5FII A;  4C3K A;  4NXM F;  3EIC A;  2K1R B;  2AWZ A;  5L1J A;  1HI8 A;  3BYP A;  3ISZ A;  1U0H B;  2VFT A;  2MZS A;  3GON A;  3CC7 S;  2C2Z B;  3H2L A;  4MMO A;  2JOQ A;  3H40 A;  1VQ4 S;  4LF5 J;  3E2E A;  2UP1 A;  4J90 A;  4ZCI A;  1RHU B;  3PXG a;  2KFN A;  4OHY A;  3GYN A;  4GRS A;  1L3U A;  1T7P A;  4QR2 A;  5J1N A;  5B7W A;  1EAY C;  5HBM B;  4AFF A;  3M9M B;  1U0S A;  3TOQ A;  4C8O A;  1H7X A;  3I9V 9;  4LBI A;  2ZH7 A;  5FJ4 A;  3MM9 A;  2AP6 A;  1NK8 A;  4KGM A;  1ELO A;  4PUO B;  4LRD A;  4EZ6 A;  1LFP A;  2FZG B;  2QRR A;  4CM2 A;  3DM2 A;  1ZZF A;  1M5V C;  1YKW A;  2IRX A;  3AOB A;  1WC5 A;  2BM1 A;  1ZTT A;  4UY8 T;  1IVZ A;  4ECV A;  4EEY A;  4ZVH A;  1D8Z A;  4DI6 A;  3K5L A;  2MQ8 A;  4IFY A;  3PJX A;  2AKW B;  2ROE A;  3GCX P;  4EBC A;  3R1H A;  4P2X A;  1U49 A;  4Y2A A;  4CLW A;  1FKO B;  3VHQ A;  1ZM2 A;  4LJM A;  4ZP7 A;  4DCJ B;  1APS A;  5FDL A;  2HQG A;  5G4D A;  1U1R A;  2HQD A;  3HLU A;  5LMU F;  3L7U A;  1PJ6 A;  1XNQ F;  2GO9 A;  2FYX A;  1RT5 B;  2HNZ A;  3KLF B;  4WXO A;  2F40 A;  2Q6C A;  2WSC C;  4W92 B;  3OR1 A;  3BB5 A;  3HPO A;  1VBK A;  2W2P P;  1O6X A;  3AA8 A;  5GAD I;  3VVU A;  4JP8 A;  2DNP A;  5DQG A;  5CCM A;  3HHN B;  1HBU A;  3N6N A;  2M8H A;  2RB7 A;  3GE9 A;  5E33 A;  4WFA Q;  1YK9 A;  2CQ2 A;  3OPK A;  4F4Z A;  3CGI A;  1N52 B;  3O1L A;  1IBK F;  2GJI A;  1IBK J;  2AJ1 A;  2H3E B;  3A8K A;  2GHV C;  4QW8 A;  4TU7 A;  5LMN J;  2HHS A;  5KFP A;  1FDN A;  3UN2 A;  3T6B A;  1F3V A;  4H4M A;  5F41 A;  5A8K B;  2MYF A;  2W9C B;  1AZS B;  1RZM A;  1IR2 A;  1X9S A;  2J9D E;  1B70 B;  1DLO A;  3HK2 A;  1YRX A;  2YPZ A;  4HT7 A;  4FYV B;  3ZZO A;  1CLF A;  1XQI A;  3BR9 A;  4DL5 A;  5GVQ A;  3KWM A;  1NK9 A;  5DGB A;  3PRV A;  2OFG X;  3QLH A;  3F73 A;  3TNV A;  1FTC A;  2H4Y B;  1QVG R;  2OMO A;  2AJ4 A;  2ZC4 A;  4NEZ A;  2VOO A;  4FYD A;  3F0N A;  4JI3 J;  2KFZ A;  4RLE A;  3Q8Q B;  3QAU A;  1YJN S;  3LP0 B;  1IKV B;  4DV7 F;  4L3K A;  2AYG A;  1NSK L;  2DGO A;  1UET A;  3DLK B;  5KFI A;  1G4C A;  3OFF A;  4DMZ A;  1S1U B;  3C46 A;  1R8H A;  4PWW A;  1TKT A;  1YIJ S;  2HAF A;  3D1H A;  1ZM3 A;  4WF9 Q;  1URR A;  4K59 A;  4HI1 A;  1RAI B;  4ER8 A;  1PAE X;  2NXJ A;  2HHH F;  2VHG A;  4NYZ A;  4ILM A;  4DZ6 A;  2KHC A;  4CI0 B;  3M8R A;  4LR9 A;  3CC2 S;  1XMO F;  4ZP6 A;  2XSJ A;  4M5L A;  2NYH A;  2XLI A;  3DDN A;  3G8T A;  3PO5 A;  1RWP B;  2YKA A;  4O3S A;  1VQK S;  1RBO B;  3R97 A;  4ZPD A;  3FEY B;  4B08 A;  4MKB A;  3BKF A;  1IBL J;  1KQG B;  2PD1 A;  4IDK B;  2W2M P;  4TY8 B;  3THP A;  3BYR A;  5K8P A;  1WI8 A;  4FNI A;  3WC0 A;  2FJV A;  2CJA A;  2RML A;  3W2W B;  1JLQ A;  1URN A;  3MOJ B;  4Y0F A;  3M05 A;  1YG0 A;  2AU0 A;  2KTQ A;  1V3R A;  1U7L A;  3CD5 A;  2V8P A;  3CJ3 A;  1RTI A;  4M94 A;  1EKS A;  1ZM4 A;  4W98 A;  2XMK A;  4WBF A;  2XNR A;  1YJV A;  2H1Y A;  1Z2Z A;  1ZET A;  2DRA A;  1QUP A;  3I0S B;  4PEO A;  2BYC A;  3AJ2 A;  1S1T A;  5C24 B;  5KG5 A;  1SUQ A;  4NL5 A;  2V4R A;  4AYB D;  5D8H B;  2QSF A;  3T1Y F;  2HKE A;  5KT5 A;  2E7W A;  4H4K A;  1SKW A;  2XMM A;  2RUG A;  4MK9 A;  2JL9 A;  2WON A;  4UT4 A;  4LSN A;  1N34 J;  3V4I A;  1RWN B;  3EVO A;  1UJ6 A;  2OD6 A;  3R1L A;  4LF4 F;  3OVA A;  3H20 A;  4WP8 A;  5F3Z A;  1FO1 A;  1P9Y A;  1ICE B;  2KXF A;  3D6M B;  2E5G A;  2W2O P;  4CLS A;  3DRP A;  2CYY A;  1BLU A;  4OI3 A;  4TVA B;  3TAM B;  2EG1 A;  3W66 A;  3PO4 A;  2DBB A;  4Y00 A;  4CIO A;  1M1G A;  4EYI B;  2N4C A;  1F1B B;  1T3N A;  3VAI A;  3MAQ A;  2A18 A;  3D1O A;  1AA1 B;  2RNE A;  2QV6 A;  1JLE B;  1RTH B;  4F04 B;  2CQC A;  1U6B A;  5EWF A;  2FHJ D;  1MWY A;  2DD8 S;  3FSX A;  3NEK A;  5IQ6 A;  3IGV A;  5LJ5 Y;  1A0O B;  2MJN A;  3CVK A;  3MR2 A;  4P10 A;  4R8U B;  2E5L F;  2F4V J;  4J9V A;  4OZJ A;  2LDI A;  3BGU A;  4MKA A;  3SSS A;  5KOW A;  2J0S D;  2QFJ A;  5E5N A;  4F3M A;  2M7S A;  3HKZ D;  1H2V Z;  4NLU A;  4L6V 3;  3TWZ A;  2HQC A;  1HQE A;  3OXG A;  5J2Q A;  4M1K A;  1DHM A;  4FF1 A;  1Y5N B;  2HRY A;  3OT9 A;  1LW2 B;  3FDS A;  4RPF A;  3QGH A;  1HNV B;  3GR1 A;  3LH2 S;  2K7K A;  2L9W A;  1YGY A;  4O23 A;  2V5H G;  2WVF A;  4V19 X;  2XMU A;  5D6G A;  3C6U B;  3EYZ A;  1S59 A;  1NDC A;  4M8L A;  1O8B A;  2VA3 A;  2G2Y A;  5IWA J;  3KK1 B;  1S6P A;  4OLO A;  1YZ7 A;  1SH3 A;  3SCL E;  3ZZZ A;  3GIM A;  5AXN A;  2G0C A;  5K8M A;  3TVK A;  4IO9 Q;  5I3U A;  3DLJ A;  5B0F A;  3W9J A;  2HRT A;  3Q22 A;  1PO6 A;  4BBY A;  1FRH A;  3AOC A;  4PG6 A;  1VOM A;  2APO A;  1PGZ A;  4ILL A;  4NLQ A;  3IS9 A;  3LAM A;  5C2G A;  3MUR P;  3BSN A;  4ECS A;  5C7P A;  2L08 A;  2B9W A;  2XHW A;  3D0H E;  3T5K A;  4UY8 5;  4TY9 A;  4GVB A;  2W8L A;  3CT9 A;  1VIX A;  2HIQ A;  2HND A;  4ECY A;  2DGT A;  2AGQ A;  3SI8 A;  1U02 A;  1M5P C;  4WFN Q;  2MKH A;  2UV8 G;  4R0J A;  3MPW A;  3ENW A;  2W9B A;  1LEO A;  3RRG A;  2VBZ A;  4K5S A;  1GK8 A;  4U96 A;  4DDF A;  2R2S A;  3DRY A;  3BQ1 A;  4OHX A;  2W2N P;  2OPS B;  3UVJ B;  2FQQ B;  3HSG A;  3V5R A;  1VK8 A;  2DNM A;  3D6H B;  4U9R A;  4DV5 J;  2XY5 A;  1S6Q A;  2BE2 A;  5JMN A;  2EPI A;  2BJ8 A;  5LT5 A;  3V6H A;  1RT7 A;  3H7H B;  4WK3 A;  1KNZ A;  1UJ4 A;  2IVY A;  2X51 A;  3LPE A;  1BQM A;  3P5B P;  4KPY A;  4Q7A A;  3DU5 A;  3GIJ A;  2OPR A;  2R7W A;  5AE1 A;  3JS9 A;  3DFE A;  4LF9 F;  3T5L A;  2ZZM A;  1GNK A;  2XI3 A;  3KDN A;  5J2N A;  4MFB B;  4JI8 J;  3HHL D;  5SZT A;  1GX6 A;  1T02 A;  2NXE A;  3C6T A;  2YKQ A;  3EZU A;  3M6W A;  8AT1 B;  3JSY A;  1RAO A;  2FHM A;  2SXL A;  2V8G A;  1CBK A;  4ICL B;  1GTH A;  2B8P A;  3DOK B;  4OYI A;  2JH3 A;  2VF3 A;  1RAC B;  2BJ9 A;  5C24 A;  2ZVS A;  4ETX A;  1OY8 A;  4EMD A;  2ILY A;  5EX3 A;  3RBE A;  5EWE A;  2FLN A;  2PI4 A;  1S1X B;  3QIP A;  1RTI B;  3UWT A;  2DGU A;  1YTY A;  3ZZT A;  1U4B A;  3VAJ A;  3KLF A;  4EWT A;  5EHH A;  1OY9 A;  4GVL A;  1U24 A;  1Y0H A;  2MKY A;  4LFC F;  1K1Q A;  3IG1 A;  3K7R A;  5E3R A;  4F3O A;  3GQC A;  4XDC A;  2XLK A;  3R7S B;  3NMA A;  5DG9 A;  3G82 A;  1KQS R;  1RT7 B;  3G2X A;  3U27 A;  1X0F A;  3D0G E;  3KJV B;  1TVR B;  3R7B B;  4Y6I A;  1FJ7 A;  3B6B A;  2ZBP A;  1PC4 A;  1HNI A;  2BKO A;  3D1Q A;  3MM6 A;  3NS5 A;  4ILR A;  3WX4 A;  5IM0 B;  1SKR A;  4PG8 A;  1S5Z A;  5AE3 A;  2ABY A;  5HAO A;  4DR4 F;  3MCN A;  4FYX B;  4XAK A;  4GKJ F;  1RSC A;  2CDQ A;  2B4O A;  4NCG A;  4NA3 A;  1YI2 S;  4CO5 A;  2XHC A;  2VQF F;  3DGP A;  1KON A;  2MHE A;  2POK A;  2YNF B;  3WHI A;  1RTZ A;  1XTZ A;  5AJ3 F;  4B17 A;  1VQO S;  4PUO A;  2LCW A;  3QQC D;  3CSK A;  4L3N A;  3I5C A;  3GV5 B;  4DLG A;  2NR0 A;  3BBF A;  1G6B A;  2WSE C;  1R0C B;  2YKM A;  2AT1 B;  2CJX B;  3A3N B;  3Q8Y A;  4MIA A;  4MYU A;  2OPP B;  2X3G A;  4K7Q A;  3DU6 A;  3FZB A;  4BLG A;  2UU9 J;  4WP9 A;  3DXS X;  5I4M A;  1SPB P;  1VYA A;  1RYS A;  5HRO B;  3J7Y I;  4M5M A;  3IAM 9;  4MIW A;  3ZTQ A;  4F67 A;  4ED3 A;  4NCG B;  1TZ0 A;  5F3T A;  3FK4 A;  5CH7 B;  3Q8S B;  1NJW A;  4YS2 A;  2EEY A;  4DF4 A;  4DCP B;  2ZBR A;  2MXY A;  4YR0 A;  3MM6 B;  3P96 A;  4K4Y A;  4DUZ F;  3CCW A;  3TUP A;  3K59 A;  1FK9 A;  4Q2L A;  1TVR A;  3KOA A;  2HFO A;  2VFU A;  3CDU A;  1KOO A;  2V63 A;  2VFS A;  4P7T A;  3TRG A;  2MY7 A;  1BHN A;  1OYD A;  3O2I A;  4UTG A;  1SL2 A;  1KC8 T;  4ZLP A;  3IG1 B;  3MPU B;  3ADA C;  2GJF A;  1IKX A;  2I5J B;  2Z2M A;  1LWF B;  2HFU A;  3AJ1 A;  4RO0 A;  1KN6 A;  1QE1 B;  2D74 B;  1P9Q C;  1RT1 A;  2O66 A;  2QLX A;  3NNA A;  3M6V A;  3MEG B;  4CO2 A;  4DR7 F;  2HPU A;  3NCP A;  4URG A;  2Y1R I;  3NGK A;  4ED2 A;  3EJM A;  1UAW A;  3KDO A;  3GFZ A;  3IR7 B;  3M2V B;  1Q8B A;  3QAT A;  2PEH A;  3HT0 A;  3ZO7 A;  1N0U A;  1CJK B;  2CFX A;  4OZ3 A;  2XSF A;  3FKB A;  3MXH P;  3T9Z A;  3T1Y J;  4ALZ A;  1T11 A;  3QBC A;  2UUA J;  5MAO A;  1RTH A;  1M5K C;  2E29 A;  4ZMM A;  1NAQ A;  1WKK A;  1WWH A;  3EDQ B;  2AV5 A;  4KHR A;  4LF2 A;  3KYL A;  3EGZ A;  3D4J A;  2UVW A;  3LP1 B;  1TFW A;  1WNE A;  4GKK J;  3IM8 A;  4TN2 A;  4F4X A;  4B3M F;  5L9N A;  1SC6 A;  4QWB A;  2BE2 B;  4BHQ A;  3CCR S;  4DL4 A;  2J6T A;  2BJD A;  2M8D B;  2LA4 A;  3NOG A;  4KTQ A;  4X4Q A;  2HMI A;  2LA6 A;  1RHK B;  1VMB A;  1J5E J;  5F8N A;  3UCG A;  2Y1L B;  2IJF A;  3IR5 B;  4ZN1 A;  3M2R B;  7FD1 A;  1U6Z A;  2BRL A;  2FC8 A;  2QMX A;  3MMB A;  3MM9 B;  1NHV A;  1SIZ A;  1UP1 A;  4OJG A;  3ZTS A;  4PG4 A;  4J9L A;  3MEK A;  1A9N B;  4QIW D;  5KFD A;  1YDL A;  2J9E A;  2XWY A;  1SB6 A;  2IDE A;  4QPT A;  5KFA A;  2M0G B;  4YR3 A;  2AEJ A;  5IZH A;  1RJJ A;  2FVQ A;  2DXD A;  2EK6 A;  2J76 E;  2NSB A;  2GVD A;  3KK3 A;  3PEJ A;  2R8H A;  2UUA F;  1YBU A;  5HO4 A;  1RKI A;  2CQ3 A;  1U0H A;  3EGW B;  4FN5 A;  2GS8 A;  2LQB A;  5LL6 d;  4DR5 J;  4EBE A;  3PZP A;  2UVV A;  4IH5 A;  4OZ5 A;  1M5O C;  1NDP A;  2BXJ A;  2GGP B;  4HH0 A;  2NUU G;  1IM6 A;  4WFY A;  1S6P B;  1T0T V;  2P6T A;  1DY3 A;  4WFZ A;  2VG6 B;  3AB2 B;  5A6W A;  2WRM A;  2UXC J;  4WFX A;  2LQ9 A;  2B43 A;  3M2U B;  3CJK B;  2Y1I A;  4Q43 A;  1IUJ A;  2NXN A;  2BDP A;  1MU2 B;  4CO1 A;  3TVY A;  1MWZ A;  3BO4 A;  4AL7 A;  1M0S A;  2AHO B;  3HJF A;  3N4W A;  4KRW A;  1XEZ A;  1VGY A;  5HK4 A;  4X4V A;  4DV3 F;  3QGP A;  4X62 F;  1HWK A;  3WDO A;  3D6T B;  2BKP A;  4IQM A;  4DX6 A;  3QRR A;  1JNR B;  1S1V B;  3A13 A;  1R8A A;  4KHP J;  2KU7 A;  4CO4 A;  1KQF B;  2UUT A;  2W01 A;  2WVB A;  1T05 A;  3OTD A;  5KG4 A;  5KFC A;  1R89 A;  2CWK A;  2FVS A;  1PG5 B;  2J6S A;  1W26 A;  1JLG A;  2FDN A;  2MKJ A;  1I5O B;  3IRX A;  3MHY A;  1HKA A;  2DEI A;  3MD3 A;  3QLH B;  2DNR A;  5DM7 Q;  2ZH8 A;  3HHL C;  1RT4 B;  5JXS A;  2DIV A;  1VQ5 S;  1U1M A;  2HBQ B;  4ZVO B;  3OTB A;  4TQR A;  1FJG F;  5H9F K;  1GMV A;  3PDN A;  1RKJ A;  2N4D A;  4R0E A;  4ZLJ A;  1RYR A;  3FGV A;  4DV1 F;  4G1I A;  2M5Y A;  3U1M A;  1SBR A;  4LSN B;  3BO2 A;  4A8Y A;  1FE0 A;  2O3D A;  1TFY A;  2KZZ A;  4I0W A;  3TX8 A;  1TUW A;  3KLH A;  1F3F A;  1KP6 A;  3ZXW A;  2RS8 A;  5D3G B;  1N33 F;  5K14 A;  1X9M A;  3QJJ A;  3TUZ C;  3IN5 A;  4EI2 A;  1Z4U A;  2R8I A;  2NLW A;  4L73 A;  1V5V A;  3NMR A;  1S77 D;  2DRD A;  1OPZ A;  2CNL B;  1MRO B;  3AJD A;  1IM4 A;  1A7G E;  2D3U A;  3MEC A;  4P73 A;  3J7Z 5;  3CC4 S;  5G0R B;  4ZLL A;  2E7X A;  4KGX B;  1F9E B;  2HGL A;  3H2V E;  5HI7 A;  4X64 F;  1VJQ A;  3MEE A;  3GV8 B;  2YVS A;  4UOC A;  1JLQ B;  2JZ5 A;  1IR1 A;  4P7V A;  3PR5 B;  1QTM A;  1FXL A;  2DNO A;  4QIF A;  3A3P B;  1B99 A;  4PXD A;  2WK4 A;  2GW8 A;  2P9E A;  3PW2 A;  2C3O A;  1XNR F;  4TY8 A;  3R7N B;  3NS6 A;  1U1P A;  3MTK A;  3FCW A;  2BOP A;  2IM0 A;  3WZ0 A;  2B7C B;  1CQN A;  3NP5 A;  3VGS A;  4URQ U;  3AXK A;  1XR6 A;  2YNH B;  3KFW X;  3NS7 B;  2FB0 A;  3VWS A;  2RT3 A;  3W3S A;  1RT4 A;  2HSE B;  1WKL A;  2X7I A;  1N36 J;  3DLH A;  2GCF A;  3ET6 A;  3KMQ A;  2LU2 A;  4A8Q A;  1WC6 A;  1FD8 A;  4M5G A;  5CZV A;  3K5O A;  4DR6 J;  4EUV A;  4OYA A;  2MPU A;  2NYI A;  2OUG A;  2LEB A;  1VRT B;  5DDO C;  1T03 A;  1WAC A;  3HFK A;  1IBC B;  4QU6 A;  1W25 A;  4XIU A;  2OJ3 A;  4DFJ A;  4PQU B;  4K4Z A;  1HL6 A;  2RD5 C;  3D68 A;  3NBP A;  3QID A;  1Z2L A;  4DV6 F;  4DS4 A;  4IG0 B;  3C8Y A;  1KVJ A;  2GC8 A;  3HM9 A;  1HW9 A;  2IPO B;  2V6A A;  1S9G B;  2B9X A;  2JVO A;  2NCK L;  3CCQ S;  1FNX H;  3MUM P;  1HNX J;  1R7I A;  3JQM A;  1S10 A;  4LBH A;  3VAK A;  2AYB A;  4ZKA A;  1IBM J;  3OW2 R;  2D1C A;  1SCJ B;  2KJW A;  1MU2 A;  5E41 A;  5L1K A;  2GVZ B;  4KV8 A;  2DXF A;  4YN3 B;  1XJW B;  4Z7Y A;  3IMQ J;  5KFO A;  2AJF E;  2W9B B;  2DY9 A;  5L1I A;  3HO1 A;  4JI8 F;  1BXN A;  2HFS A;  3VGV A;  5HSP A;  3H2U B;  1PAU B;  4OYO A;  5A8W B;  4FPR A;  5IC6 B;  4Z37 A;  5KG7 A;  1D0E A;  2NZC A;  3SEO A;  2MB0 B;  5DO2 A;  1JLC A;  5KFV A;  4FKX A;  3SFU A;  1JX4 A;  2FPH X;  5D78 A;  1RIS A;  1HWU A;  2ZFH A;  3TI0 A;  3QSI A;  4ED0 A;  1RAF B;  2CKW A;  4DEZ A;  5CD4 H;  2UXB F;  4TYB A;  4F36 A;  2V8D A;  4HKQ A;  2UUB F;  2VG6 A;  4IR9 A;  2KRR A;  4JBC A;  3K17 A;  4GMK A;  2HLT A;  4N5S A;  2UUC J;  1FCA A;  2OPQ A;  4P71 A;  4OIX A;  4JI0 J;  2ZKU A;  4KT0 C;  1EET B;  1WC3 A;  5DQH A;  1VJW A;  5GAG I;  4PWU A;  1S76 D;  4C48 A;  4O44 B;  3C6U A;  5A0Y A;  2MQN A;  4HL9 A;  3KG4 A;  2QLF B;  3M2R A;  4O4G B;  4ECZ A;  2FVR A;  1HI0 P;  4RNO A;  4JV5 F;  3VZH A;  4OV6 A;  4OYW A;  1UVJ A;  1FES A;  2EXU A;  1SH2 A;  3Q8U A;  5ETM A;  4P2F A;  4FXV A;  1UPM B;  4J5O A;  1HNW F;  2ACM A;  2CG8 A;  2V0N A;  2EBG A;  3TVZ A;  4NRU A;  4PXB A;  1VDH A;  5E0O A;  4CM0 A;  2YX1 A;  3D66 A;  1FXD A;  1HI1 A;  3CNQ P;  1RWU A;  2GQ2 A;  1DTQ A;  2YKN A;  1WF0 A;  1B0V A;  1HWI A;  2D9P A;  2QC3 A;  3QWU A;  1Y10 A;  2OPQ B;  4PPZ A;  5K5M A;  3CCE S;  4ED8 A;  1LW0 A;  2Z2L A;  1HNZ F;  2DR8 A;  2R7S A;  1LK7 A;  2DKO B;  3MAA B;  2DR7 A;  1G7C B;  4QOT A;  3BGF A;  1RWO B;  3PKY A;  2C42 A;  4QJV A;  4ZCL A;  7FDR A;  4JI0 F;  1MML A;  3LTO A;  2LP4 A;  2FY8 A;  4DV4 J;  1WJ9 A;  5I3P A;  3J7Z T;  4CO0 A;  4E0D A;  3M8P A;  2KO1 A;  4Q8F A;  3MR3 A;  4Y65 A;  1K44 A;  2MTL A;  2VFR A;  1DAR A;  1QJH A;  2WON B;  2WBR A;  1KKH A;  2I5J A;  2EVZ A;  4HI2 A;  1IKX B;  4CLY A;  3KHH A;  2ZJR Q;  1CUL A;  1TL5 A;  1V5I B;  1WG4 A;  4OZ1 A;  4DU8 A;  1N4L A;  1KD1 T;  2EC0 A;  4DR6 F;  4X4U A;  3UDE A;  4YDD B;  3CDA A;  2YWW A;  2C2N A;  1TU0 B;  1Q5Y A;  3MMC B;  5GAE I;  3OTO J;  2R7U A;  3FUY A;  3KG0 A;  3HHL B;  4WJB A;  1P6T A;  3DLG B;  4FS1 A;  2ZZN A;  4MYT A;  4CLK A;  2JWN A;  3R5D A;  5CCL A;  4DR1 F;  1HBM B;  2XM3 A;  2DYA A;  1REV B;  2QL7 B;  1X5P A;  2RDI A;  3HVW A;  3QAE A;  5CYQ A;  5DQI A;  3HZE A;  4KB7 A;  1FT8 A;  2XWX A;  4ZVR B;  1KVI A;  3AXM A;  2JX2 A;  1S7H A;  1QVF R;  1OMS A;  1N6Q A;  5KT6 A;  3MD1 A;  3CXC R;  4FBU A;  4DPX A;  3EXC X;  3I9Z A;  4LIW A;  1BC6 A;  1EQM A;  2GMH A;  4HH1 A;  1UVK A;  4I6Y A;  4I7F B;  1XR5 A;  1N5S A;  1VBY A;  2XGP A;  3NG8 A;  2JNJ A;  2DB1 A;  3MR5 A;  3CCL S;  1FD2 A;  5CZX A;  4GC7 A;  5IT9 U;  5RUB A;  3G8S A;  1SQE A;  2Z56 B;  2KDO A;  2MSS A;  2QA2 A;  2RHQ B;  3EM1 A;  2HVZ A;  4OJH A;  2DY1 A;  3U7J A;  5KFW A;  2R4F A;  3KJV A;  4UZC A;  2LQ5 A;  3RJM B;  2PA3 A;  3L3C A;  3L4B C;  2O1P A;  3RRK A;  3G82 B;  1I94 F;  4U7U D;  2ZWP A;  3SFG A;  2MJU A;  1S9E A;  3K89 A;  4LSL B;  2CPH A;  3DDI A;  3DGP B;  4U8Y A;  5EGY A;  1WHV A;  4P6Q A;  4YB7 A;  2YH0 A;  1REV A;  2CVE A;  4QIE A;  4CH1 A;  5G0R A;  2CAJ A;  3HSD A;  4LUB A;  5H1S V;  4RUA A;  2R7V A;  3RW7 A;  1HNI B;  2DHA A;  2VFV A;  3BH7 B;  3CO0 P;  3HHL A;  4L75 A;  2B5J B;  2R7Q A;  4DL7 A;  1D9D A;  2CPI A;  3PVX A;  4J9M A;  3IP0 A;  1W7W A;  3FCV A;  1HHQ A;  3Q24 A;  3ICL A;  2AJ2 A;  2DGW A;  1Q79 A;  2XMW A;  3ZNU A;  3M9O B;  3SCI E;  1SL0 A;  3TJ8 A;  1E6V A;  2D69 A;  1KLM B;  1IWA A;  1NBE B;  2VV5 A;  4KC5 A;  4USJ C;  2HAI A;  4OZ2 A;  1NND A;  2HNY A;  3I82 A;  4DG1 A;  5A8K A;  5KT4 A;  5T14 A;  3OL6 A;  3QJP A;  1ZA2 B;  2J7W A;  2DJW A;  1Q78 A;  4MH8 A;  5LSO A;  1ULR A;  3EX7 B;  4P75 A;  3ZNJ 1;  2OTJ S;  3JAM Y;  3M32 A;  1S6Q B;  2VOP A;  2L9N A;  1JB0 C;  2HS3 A;  4ECU A;  1SJ4 P;  2YNG A;  1TAU A;  2OPS A;  3UVJ A;  2E1C A;  3T41 A;  2K2P A;  4MFB A;  3OLA A;  4Q8E A;  2W4P A;  2RIL A;  4ZPW R;  4ED7 A;  3QMQ A;  2BM0 A;  2HBR B;  2LEP A;  3QRP A;  4IOB A;  2UVR A;  2JFD A;  4Y2K A;  3CJT A;  1BQM B;  1RBA A;  2IJN A;  3FEX B;  4FVC A;  4LSL A;  4O3N A;  3NGD A;  1SH0 A;  1XER A;  2BW7 A;  4U8V A;  3P45 B;  4MK8 A;  4F50 A;  1NHU A;  5KFS A;  5LMN F;  5IT0 A;  2RQM A;  4NOH A;  2WB1 D;  4NI2 A;  1VIO A;  3Q8R B;  2H51 B;  3QSY B;  3KUG A;  4QIG A;  4ZK7 M;  3W5Y A;  9ATC B;  4WZM A;  3MMA B;  1NJZ A;  2R8J A;  4I67 A;  1JLB A;  2VL1 A;  2C3Y A;  3GPA A;  4LVO P;  3DM2 B;  4URS A;  5J1E A;  4RBT A;  4EGL A;  3DOL A;  3LP2 B;  2J8S A;  1SJF A;  3THT A;  4C4W A;  4RU9 A;  1KHV A;  4GVB B;  2NPF A;  3LF0 A;  3PTW A;  2QEX S;  2CZ9 A;  1C0T B;  1TR0 A;  3GLJ A;  2G2Z A;  3DNC A;  1HA1 A;  3KHR A;  5LMU J;  2IC3 B;  1XBW A;  1F9F A;  1CJV A;  1TL7 B;  3POT B;  3IS9 B;  8RUC A;  1R43 A;  4LSZ B;  1J5E F;  1I94 J;  5DS7 A;  1R0A A;  2ASD A;  3NL0 A;  1QD1 A;  4X2B A;  3VAL A;  1SXL A;  3CF5 Q;  3R9L A;  1WC1 A;  3TYT A;  2VIH A;  3HHK A;  1AUD A;  2EFQ A;  1HBM A;  2BE9 B;  2PO4 A;  3AY0 A;  4OYX A;  4Y34 A;  4PRF A;  4KH0 B;  1C4A A;  3KUH A;  2GZO A;  2WW8 A;  2VUG A;  3AQO A;  5A8W A;  1UEK A;  4X4R A;  3SV4 A;  1AW0 A;  3CMQ A;  4LR8 A;  1U09 A;  5EUH A;  3MMB B;  1NHK L;  2HZC A;  4OLP A;  4F4W A;  2KYZ A;  1OSD A;  3R5C A;  4A8F A;  2ZE2 B;  1YBA A;  2MHN A;  1JLF B;  3RB6 A;  5A2Q U;  1C0U A;  1HR0 F;  1B0P A;  5ITH A;  1DQ8 A;  4F4K A;  4M95 A;  4IFV A;  2ZUA A;  1LXJ A;  1XK8 A;  1OSC A;  4I1T A;  3ENV A;  3K5P A;  3LGH A;  1FJE B;  2J0X A;  3M8Q B;  3K8V A;  2YKP A;  4DR3 F;  5F8L A;  1G3O A;  4C8N A;  5AXM A;  4HTI A;  4ITS A;  5A6P A;  4TLQ A;  5C25 B;  3RRH A;  2EFO A;  2HVD A;  4DL2 A;  4R8U A;  2XY7 A;  2W2Q P;  2PEB A;  3MAA A;  2HWI A;  3TA0 A;  3SCK E;  1RT6 B;  2CQG A;  4KIA A;  4RUB A;  3VGT A;  2CRL A;  3US5 A;  4OQJ A;  2XYH B;  4CWB A;  3D0I E;  3PHT A;  1NUE A;  2DEJ A;  3TW0 A;  2ZZT A;  2FHJ A;  3PFO A;  1L3K A;  1ZYQ A;  2A0F B;  2YKN B;  1T9X A;  3OD2 A;  1RT3 A;  3OFG A;  2JEI A;  4LFB J;  4DX8 H;  3TR5 A;  4FS2 A;  3GB0 A;  1DTT B;  3M2V A;  3T1A A;  3LPY A;  4FZV A;  3M1V A;  4F26 A;  2CZ4 A;  2FHK A;  3MEG A;  3SBM A;  3CIM A;  4KGV B;  2C3U A;  4OX9 J;  3DOM A;  2Z57 B;  1QE1 A;  3MUV P;  1Q0N A;  4AT1 B;  1Q86 T;  1TL4 A;  3DRS A;  4ZVP B;  4JI1 J;  4CO3 A;  3R6L B;  4NAS A;  1WEY A;  5H9F J;  4DL0 C;  3NGU A;  3SQG A;  4CQ1 A;  2MQP A;  1OQ3 A;  4DL6 A;  4AUK A;  4F8R A;  4X66 J;  1U1L A;  3GII A;  1OYE A;  1HBO B;  1H0H B;  4RW8 B;  1H2T Z;  3KNA A;  3MI7 X;  4ZVS B;  2DGV A;  3CCJ S;  4DR4 J;  1R31 A;  2W7P A;  3NGT A;  1UA1 A;  3QRQ A;  2VON A;  3W2W A;  2CQP A;  2CQ0 A;  3A8I A;  4RWW A;  3A12 A;  4LFB F;  1UCN A;  1XR7 A;  5E3Q A;  2JEJ A;  1E6Y A;  1NPR A;  3PW7 A;  3IRW P;  2DTJ A;  4IOA Q;  2ZBQ A;  3UNG C;  2QGF B;  4FP9 A;  1TKX B;  3KLH B;  3RZA A;  3HXM A;  4I56 A;  1FFS B;  4C6A A;  3A8J A;  1UVN A;  4RL1 A;  1U45 A;  1HLW A;  1H38 A;  3HI9 A;  3CUL A;  1LQ9 A;  2E7V A;  1VFJ A;  4H4K C;  2ZD1 B;  2IYG A;  3DOL B;  2RQK A;  2DK2 A;  3LW5 C;  3IBC B;  2CNN B;  1FFW B;  1JLB B;  4YY3 F;  1NKE A;  3D3B J;  3IWN C;  1YWX A;  3W2V A;  2M70 A;  1NDK A;  2VG5 B;  4AE5 A;  3NRB A;  3PV8 A;  3H4B A;  1K0T A;  4NZ0 A;  4O0N A;  4PCQ A;  1TV6 B;  3LGN A;  4DBQ A;  5L38 A;  2J9C A;  1VQ6 S;  1OJ4 A;  4ERD A;  2KT3 A;  2E1M C;  4DUY J;  4A8X A;  3JYT B;  1WG5 A;  1NSQ A;  3FQL A;  3MPY A;  1RWM B;  2HGM A;  2V4Q A;  8ATC B;  1RWX B;  2ZJP Q;  3CCZ A;  3KNG A;  3LP0 A;  2EG2 A;  4Y2C A;  4KQZ A;  5D4N A;  3ZZP A;  1FDB A;  1MWQ A;  3FJ2 A;  3QIP B;  1Q5V A;  1ZPV A;  5L46 A;  1NJI T;  3V6D A;  3ET6 B;  3RAQ A;  3CJ5 A;  1NM2 A;  3C15 B;  4FPI A;  5IC4 B;  2A1B A;  3UNY A;  3G96 A;  2E5J A;  5AXL A;  1V9O A;  3VGU A;  1P8G A;  2MKC A;  4ED4 A;  1HNX F;  3CCT A;  2MKS A;  1EP4 A;  1PYS B;  5MLC V;  3HJV A;  4O3P A;  4C0H A;  4W90 B;  2G9O A;  2HNY B;  1VIS A;  1FWK A;  3H0P A;  5HQM A;  1RT5 A;  3F41 A;  3MPD A;  4NML A;  5SUH A;  3M8P B;  2NXC A;  2MZR A;  2ZDO A;  3ZC4 A;  4CNZ A;  1QAY A;  2BAC A;  2JJ4 D;  4K2X A;  2MQM A;  2O5D A;  2VU5 A;  3CCV S;  1NK6 A;  4DV2 J;  1DRZ A;  2V2Q A;  1U8W A;  1S48 A;  1C1B B;  4N8N A;  1TKZ B;  2BRK A;  1C2P A;  4P2M A;  4NX9 A;  4ZP8 A;  1XMQ F;  4LF7 F;  5HL7 Q;  1SJQ A;  3NNH A;  1D8Y A;  1T9T A;  1N36 F;  3OR1 B;  4CNY A;  3EZO A;  4DUY F;  1FRM A;  4LF5 F;  3BQ2 A;  4B9S A;  3BV8 A;  4K4U A;  3HFV A;  2D9O A;  3RBZ A;  1TK8 A;  4QYZ K;  3KTQ A;  3U1L A;  5KFM A;  4NLW A;  3I55 S;  5EX0 A;  3I56 S;  4YY3 J;  2HMI B;  3ELH A;  1Q82 T;  1I51 B;  3B8H A;  3MPV A;  2BX6 A;  3AHP A;  1VRQ C;  4KGZ B;  2DHG A;  4Y28 C;  5B09 A;  5KOX A;  2MZ1 A;  1U1K A;  5LSL A;  3RW6 A;  4N41 A;  1XN9 A;  3GWC A;  2ASJ A;  4I6A A;  2D3Z A;  4Y2M A;  1VQ7 S;  1N5Y A;  4B9V A;  5BR8 J;  4O44 A;  4Q45 A;  4KJI A;  3D7S B;  3G86 A;  2K3I A;  3IWX A;  4KYZ A;  2VQE J;  1AT1 B;  4C8Y A;  2CJQ A;  3UDC A;  4Q0B A;  1LWE A;  1UJ5 A;  2OHD A;  4ZVG A;  5F8J A;  1UFW A;  1Y7P A;  3AT1 B;  3PG9 A;  2VAS A;  4N7T A;  4ZIW A;  2RRA A;  2RKI B;  2CQD A;  3JQK A;  2W9A A;  3OTE A;  2ATL A;  1IBM F;  3OVB A;  5KFY A;  1XMB A;  3AD8 C;  4U95 A;  1VC5 A;  4USU A;  3C3L A;  1U6F A;  3C16 B;  3W8G A;  1GXU A;  4JV1 A;  2F65 A;  1SJR A;  3VAF A;  4I2P B;  2OEK A;  2GX8 A;  3E3X A;  3KLI B;  2RAQ A;  2RSQ A;  1CSJ A;  1OIA A;  1FEE A;  3HHE A;  3I5A A;  4X65 F;  3PY8 A;  4FF4 A;  3V4M A;  1W2B R;  4NCB A;  2IAJ A;  1RA7 A;  5F8H A;  2AW0 A;  3M2U A;  3CJK A;  2O01 C;  3WQP A;  3TA1 A;  1S0N A;  1CUL B;  3G4S S;  2LYV A;  2GVZ A;  2FHO B;  2Z58 B;  3BBC A;  4WE1 B;  4WYL A;  3ZZU A;  2QZ8 A;  2LQJ A;  3JSR A;  4I69 A;  3TO8 A;  3TZZ A;  2YNI A;  3CJ8 A;  4JI6 F;  2FVC A;  4BCA A;  1X4A A;  2IA0 A;  3TAQ A;  3FC9 A;  4X84 A;  3EPG A;  2DPJ A;  5EWG A;  4RU2 A;  2XTJ P;  3EWG A;  2N7C A;  1YBT A;  2YQ1 A;  4LBP A;  1NK4 A;  3RAM A;  4IG0 A;  2CQI A;  4JYA F;  2PA8 D;  3FMW A;  2HHW A;  1QSL A;  4HHJ A;  1R3N A;  4MJK A;  3W63 A;  2HBY B;  5BR8 F;  5JVH Q;  2QX0 A;  4OHW A;  4IRK A;  2AIR B;  1N5Q A;  2RUS A;  3EZ5 A;  3ZZ0 A;  2R42 A;  2OPP A;  4ECX A;  1L3V A;  1Q8L A;  2Y0S D;  1D9A A;  3AFG A;  3DMJ B;  1KWM A;  1VCT A;  3VAM A;  4J9Q A;  1ZH5 A;  3U1N A;  2HHV A;  4RNF A;  7AT1 B;  4WXW A;  2ZKT A;  3NWR A;  3EUN A;  2BV3 A;  2G1H A;  2YWE A;  4I4B A;  1S1T B;  2HVI A;  3LAN A;  3I0S A;  4K4S A;  3E51 A;  2ZVI A;  1NK5 A;  2M9K A;  3DYA A;  3FBB A;  4G1P A;  4LT6 A;  1GMW A;  4ZJL A;  4DPO A;  3DI6 A;  2IM2 A;  3HF5 A;  2PSZ A;  3QFW A;  3QT8 A;  1R8B A;  2K7J A;  5DDQ C;  3GV7 B;  2RDJ A;  2HEK A;  2WVD A;  1KHW A;  2KRB A;  1S57 A;  2FZC B;  4HLB A;  1ZBT A;  4BWJ A;  5IM0 A;  3K0J A;  4FXD A;  4NLY A;  2VKR A;  1NH7 A;  3CD7 A;  3TJA A;  5A0Y B;  2C2M B;  2FGC A;  2WCX A;  4RNM A;  1JJ2 R;  5KG1 A;  2XNQ A;  3AOA A;  3CCU S;  3V81 B;  1ZAV A;  2ILZ A;  2DHS A;  3NXZ A;  2H65 B;  2HZV A;  1FJG J;  4USK A;  4DSE A;  1IWG A;  4MTP A;  2MST A;  4FXW A;  1S99 A;  5HVH A;  2VBY A;  2KYX A;  1QM9 A;  4JI3 F;  3DN9 A;  4K0K F;  4X4O A;  1VHI A;  1OPI A;  3S6E A;  2Z8Q A;  2WOM B;  2ZIT A;  4G1Q B;  2FZK B;  4K4X A;  1HWL A;  2WBM A;  4JI2 F;  4DV0 J;  1HYS B;  2KM8 B;  2XO6 A;  4F0H A;  3LWL A;  1IR0 A;  2NXU A;  1DUR A;  1HBN A;  2EFG A;  3AH6 A;  1H7W A;  1NU4 A;  1UL3 A;  4WU2 A;  4KHP F;  4YOE A;  3T5J A;  2LDY A;  5J2N B;  2W7A A;  4IO1 A;  3W60 A;  1LWF A;  1VQY A;  1TKT B;  2LLZ A;  2OSR A;  2U1A A;  2BE7 D;  2K3K A;  3VCD A;  3OL7 A;  3VF0 B;  3CJ2 A;  4GO7 X;  3GJS B;  3NGR A;  4WZQ A;  2RRB A;  1FKP A;  1VLO A;  4R25 A;  5KFR A;  3M6U A;  1Q53 A;  1WEX A;  4N8O A;  2HHH J;  2RQC A;  3DLB A;  1S4F A;  1UEU A;  1JLA B;  2ZNY A;  2VG5 A;  4JI5 J;  3HP6 A;  1L5U A;  4M5I A;  2UXC F;  1FDA A;  3OSP A;  2D7S A;  2U2F A;  4C3L A;  3PIP Q;  5D0H A;  1X7V A;  4HYK A;  2B7B B;  2IA6 A;  5CAA A;  1T05 B;  2HWH A;  1WD6 A;  1FER A;  1RK8 A;  2FC9 A;  3A4T A;  1NZ8 A;  4DPU A;  2BJ3 A;  3KHL A;  2VIC A;  3KMS A;  1QSY A;  2E9T A;  3MMJ A;  2KFY A;  3BGR A;  3JSM B;  3BEG B;  2MKK A;  3HZG A;  3EDR B;  1YJ7 A;  2B4V A;  2YKM B;  5BYR A;  2XB2 D;  5L39 A;  2IFX A;  1L3T A;  3Q2T C;  2BOA A;  4CYU A;  1HBU B;  3FNN A;  1UWA A;  3E01 B;  1X8D A;  1WDT A;  4XK8 C;  4FNH A;  4Q2M A;  4CLP A;  4DPT A;  1FX2 A;  2YPY A;  2F3J A;  2ZJQ Q;  2KXH A;  3DLE A;  4ZLN A;  3O8W A;  5F8M A;  2DT9 A;  3DC2 A;  2BR0 A;  2GGP A;  2ZHO A;  1C4C A;  1BGX T;  3BO3 A;  1QY7 A;  4OYB A;  3SV3 A;  2UU9 F;  3U02 A;  1IJF B;  1EQ0 A;  3MEE B;  2GVD B;  2VDH A;  5J1P A;  1RTD B;  4FF2 A;  4JYA J;  3UQS A;  4J37 A;  4JI1 F;  1DBD A;  2I8E A;  2Q6B A;  3MEC B;  3W1Y C;  3UD5 A;  5HLF B;  1S1X A;  4OYP A;  3MTJ A;  5BYQ A;  2QLB B;  5DM6 Q;  1S1W A;  1YHQ S;  3BBB A;  3V6J A;  5B0D A;  4GKJ J;  1H98 A;  2RQ4 A;  4S0M A;  1FRX A;  3SSR A;  4F4A A;  2NQP A;  2ERR A;  4Z2X A;  3DOK A;  2B56 A;  1FRK A;  5A8R A;  1VC0 A;  3DKD A;  3I96 A;  4O3R A;  2DIS A;  1CJT B;  3DMJ A;  2E5H A;  1N8R T;  3W62 A;  3M9N B;  1OWX A;  3ITH B;  2VG7 B;  3SSQ A;  2BEF A;  2Z2Z A;  4LFC J;  4X65 J;  1SJ3 P;  3DI6 B;  1HW8 A;  2X3D A;  3MUT P;  5C25 A;  5IQQ A;  1S9F A;  4CLT A;  3RBD A;  1O0P A;  3JSB A;  3NOC A;  1U2F A;  3R6G B;  2GHW A;  3MM5 A;  1VHF A;  2N3O A;  5KFH A;  4X66 F;  3PYF A;  3IRX B;  3OJU A;  5EDW A;  3G6V A;  3PX4 A;  1BMQ B;  2AJ0 A;  2BJ7 A;  4ZPV R;  1BD6 A;  3PAC A;  1QAI A;  4RNH A;  1KVK A;  2XGQ A;  5KT7 A;  1BWV A;  3L7P A;  1RXO B;  2OML A;  1CJK A;  2Z4P A;  4DUZ J;  2XEX A;  1PBA A;  1RAB B;  2OSQ A;  3I32 A;  4NLD A;  3FCH A;  3CD6 S;  4C8Z A;  3OTO F;  1V3Z A;  4J9U E;  2HQ3 A;  2UZA A;  4OZN A;  1ARO P;  4C2M A;  2JEG A;  1M5S A;  1C1C B;  1K1S A;  4CLZ A;  2ALY B;  1EHW A;  3AD7 C;  3LA0 A;  4HHH A;  5KFT A;  3UDL A;  2GIQ A;  5E3P A;  4A4J A;  2DNN A;  1CPZ A;  2CPZ A;  1DZ5 A;  3BGL A;  3Q86 A;  4H54 A;  2RKI A;  5I3U B;  1RTJ A;  4J9O A;  4N56 A;  3PR4 A;  1S79 A;  3IFE A;  1LWE B;  5THW A;  4DV4 F;  2QJ3 A;  4ZPC A;  4NRT A;  1YJ9 S;  2UV8 A;  2XZW A;  3KLI A;  4NCA A;  2LMI A;  2F9J A;  2L9D A;  4DFM A;  4I2P A;  1JWW A;  3PEH A;  1ZPW X;  3TUJ C;  4CLF A;  5M2R A;  3C16 A;  4ZCM A;  4NLT A;  1AFI A;  4LF7 J;  1X4B A;  2CPY A;  4KY3 A;  3KKF A;  4FBT A;  3BQ0 A;  3JXO A;  4LF8 F;  4LMZ A;  2VQE F;  4P72 A;  4YB5 A;  3KLG B;  2C3M A;  4V1A k;  1U1N A;  2CJB A;  4F02 A;  1KFD A;  1C0T A;  3F56 A;  3MCO A;  4L74 A;  2AF6 A;  2I1R A;  4NI2 B;  4EFA C;  2OLW A;  5KT2 A;  2GFF A;  3O5T B;  5HMW A;  3UR0 A;  1MLA A;  4DU7 A;  2H5J B;  3LP2 A;  2AMC B;  1BE4 A;  1U2R A;  1R8C A;  2ROP A;  3ILL A;  4OYM A;  4UQG A;  3TAR A;  3JAM U;  1EJ7 L;  1SIW B;  5DLF A;  2H5I B;  1Q95 G;  2Y0B B;  3GFX A;  2DGX A;  4QWA A;  2QA4 S;  4F4Y A;  1I1G A;  3GR0 A;  1PIE A;  3HVR A;  3GMG A;  4PG5 A;  4RWX A;  4B3O B;  3UR3 C;  1N32 J;  2PMW A;  2V8V A;  3WC2 A;  2P2C B;  2CQ4 A;  1VQN S;  5DLG A;  3LP1 A;  2KHD A;  1FF2 A;  3MM8 A;  3UW1 A;  3G71 S;  1ZAX A;  1CC8 A;  4WPA A;  2JSX A;  1YJU A;  2E5I A;  5HJX A;  5DZ7 A;  4DG1 B;  4LR7 A;  3ZZR A;  3OL9 A;  4Q5V A;  2K06 A;  2MZJ A;  3ETM A;  4RR5 A;  4RUC A;  3H5X A;  4DV2 F;  3AB4 B;  2HW3 A;  1E6V B;  4DSJ A;  3K57 A;  4JI4 J;  2HVH A;  2KH9 A;  3R3T A;  1VR6 A;  4FVM A;  1HPZ B;  4MT1 A;  1JMT A;  1J5O B;  3A1Y G;  1CJU B;  3JQJ A;  1GXT A;  2MEW A;  1HWJ A;  5D0G A;  2IDL A;  4DV0 F;  1BQN B;  4JI2 J;  4BDP A;  4B3R F;  4QR1 A;  1YZ6 A;  4DCO B;  4NLG A;  4OHV A;  4OI0 A;  1RT2 B;  3HSZ A;  4U6P A;  3NNC A;  1PJ7 A;  3B82 A;  3EGV A;  1S72 S;  1KLM A;  2QL9 B;  5C42 A;  2HBZ B;  2HFV A;  3GYX B;  5I42 A;  6AT1 B;  1UKU A;  1HQ2 A;  2QL5 B;  1RWW B;  1S6U A;  3G8Q A;  1S6O A;  3QWP A;  2CIM A;  1FWL A;  3KUE A;  2KZM A;  3ILJ A;  3SDE B;  4DFP A;  4C3M A;  3BRE A;  4IH6 A;  5HJY A;  1HD0 A;  4RZR A;  4JB8 B;  2IJR A;  4DQQ A;  1PC5 A;  4ECQ A;  4IR1 A;  5KG2 A;  3W5X A;  3Q23 A;  2MQQ A;  1UA0 A;  3DRR A;  2ZBI A;  4ZIV A;  2Q79 A;  4KH1 B;  4L76 A;  1FJC A;  2BAN B;  2OGU A;  5IWA F;  1S9E B;  2EFV A;  3MCS A;  1BUX A;  2EFP A;  4ID5 B;  2HG4 A;  1VQS A;  3FBF A;  2N82 B;  4WCE Q;  4TU9 A;  1ITP A;  1G1X A;  1R0B G;  2C2O B;  1DAX A;  2Y3Y A;  1WHX A;  2LU1 A;  2Y8Y A;  5KFZ A;  1KDN A;  3K2Y A;  1JK9 B;  3I4P A;  4UOF A;  1XIQ A;  1S1U A;  2MDA A;  4PXE A;  4ZPT R;  2XQC A;  1NSA A;  2LKZ A;  2CUY A;  5K9F A;  2HHX A;  3DHX A;  2AX1 A;  2WAQ D;  1ZOT A;  4OZ0 A;  3D5M A;  2EK1 A;  3MWB A;  3L9Z A;  1JJC B;  1TKX A;  2R3V A;  3KK1 A;  1RAJ A;  2DNL A;  4CRJ A;  3MMC A;  1B7F A;  3BN4 A;  1NRK A;  3H8Y A;  1GH8 A;  2DR6 A;  2EWH A;  2QG9 B;  2UXD F;  3KJQ B;  1L3S A;  2AYM A;  2XZD B;  4JI6 J;  1RWV B;  5KFF A;  4HDG A;  3QFH A;  4DUT A;  3ILI A;  2MGZ B;  1HNV A;  2FGO A;  2XS5 A;  3O6Q A;  1F9H A;  4USM A;  1F5B A;  5J2M B;  2RHS B;  4DHV A;  1RT2 A;  3M4X A;  3MFH A;  3PYG A;  1FA0 A;  2PT0 A;  1SQF A;  3PYE A;  3BDE A;  4KPC A;  4QZV B;  2RU3 A;  3OXL A;  3P3D A;  2K8G A;  2V4J A;  2LFV A;  4LRF A;  2PDA A;  4DSK A;  3MOZ A;  3CJQ A;  4PYD A;  2DPI A;  5C5J A;  2Z30 B;  2MY8 A;  2ZDP A;  1J27 A;  2CQ1 A;  1PIL A;  4A48 A;  4Q44 A;  1UFK A;  2FIU A;  2DXE A;  3K5N A;  4ED6 A;  1NK7 A;  3GZ7 A;  1RHJ B;  2WZ1 A;  4KBI A;  1M5H A;  5KFK A;  4DL3 A;  2C2R A;  2A10 A;  4TYA A;  2HNZ B;  1JXE A;  1TL1 B;  2XS7 A;  1OQ6 A;  5KFX A;  4UUW A;  4NLV A;  2J6U A;  2G0J A;  3ENA A;  2C1E B;  2F7V A;  2KN4 A;  4DR1 J;  1EX8 A;  2JVR A;  2LXF A;  3LAL A;  1SC3 B;  5FDL B;  1DTT A;  2QLW A;  1MNE A;  4G65 A;  4Y2I A;  6FDR A;  3FSI A;  4W4M A;  2ZM6 F;  4B3O A;  1RT3 B;  3BH6 B;  3OHB A;  4NE9 C;  3PCO B;  4HHU A;  4EYH B;  2X1G A;  2N3L A;  4PWD A;  4ES3 A;  2FJX A;  4XPE A;  1K73 T;  1RT6 A;  4WU3 A;  4C98 A;  4DX5 A;  4HEA 9;  4B9T A;  5CAB A;  4NA2 A;  4DZD A;  1Q7L B;  1ZAW A;  1KLN A;  2AZ3 A;  1NEE A;  2CJK A;  1H2U X;  2X1B A;  4F2R A;  3X1L B;  2IVM A;  4DXL A;  3QNW B;  3OR2 B;  4YB6 A;  4YUD A;  4RNN A;  4ELU A;  1GX5 A;  1T9W A;  3DXB A;  2D3O 1;  1VQL S;  1KSP A;  4LF6 J;  1RAE B;  3HX9 A;  4NYO A;  2YX7 A;  4DN9 A;  3GIK A;  2VD3 A;  1FHT A;  3N01 A;  3PX0 A;  1X4C A;  2VJU A;  2ZH1 A;  4ED1 A;  2X1F A;  1KQK A;  2W24 A;  2NRE A; 
#chains in the Genus database with same CATH homology
 4LBH A;  1MWQ A;  3ZNU A;  1S7I A;  4LBI A;  4LBP A;  4FPI A;  3ZO7 A;  3ZNJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...