3ZNUA

Crystal structure of clcf in crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MLYLVRMTVNLPRNLDPREEERLKASEKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTIDVEPLSHHPARVGKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp.
pubmed doi rcsb
source organism Rhodococcus opacus
molecule tags Lyase
molecule keywords 5-CHLOROMUCONOLACTONE DEHALOGENASE
total genus 26
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02426 MIase Muconolactone delta-isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1060 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Dimeric alpha+beta barrel 3znuA00
3ZNJ1 4LBPA 1S7IA 3ZNUA 3ZO7A 4LBHA 4LBIA 1MWQA 4FPIA
chains in the Genus database with same CATH superfamily
3M32A 4ZP6A 3PR4A 1SH0A 2DB1A 2LCWA 4CDIA 1T8EA 1NSAA 3GJTB 4FXWA 4KE5A 4YDXA 3ZTOA 1GNKA 1LWEB 4ZITA 4ECYA 1KD1T 4FYYB 4RL1A 2E7XA 3TA2A 2IC3B 3BBFA 3GV8B 3PW2A 4LFBJ 2G0IA 2VOPA 4PZVA 1IQTA 1DLOA 1GH8A 1X4BA 3PY8A 3PM9A 1AFJA 4I4BA 4NLXA 5FLXY 2W2NP 4B9SA 4KPYA 2UXCJ 2AZ1A 4DV1F 3OXGA 2ZOMA 3OVSA 5KFZA 2J6UA 3LP0A 5JMNA 3P3DA 1Y11A 2ZE2A 3GIKA 1M1KT 3VV2B 2WTFA 2PD1A 1RISA 1VBZA 1WHVA 2APOA 2B4UA 4CQ1A 2PMZD 5CYMA 4RUAA 1FNOA 1K44A 2VFTA 5DZ7A 4YB7A 3CULA 1IR2A 4NXNF 1HARA 2E1AA 3HDSA 2BE2B 4WTYA 2ZM6F 3PW0A 1W2BR 4KB7A 4DR6F 2G2OA 1U1KA 1JK9B 1K9MT 4LRFA 2ZZNA 4HACB 5I3UA 1SKRA 4N56A 4NASA 2HQGA 4NEZA 2UUAJ 2KFZA 1R8PA 4OX8A 4WFZA 2BJ9A 4MFBA 5F0WA 3UPFA 2P9EA 3U27A 3VQSA 1RCOB 2CDQA 3LP2A 3BN7A 3LANA 5HI7A 5L1IA 2ROGA 3H7HB 3H90A 4QQBA 3AA9A 2V8GA 3QJJA 1EETB 4O0IA 4RW6A 1X4CA 5B0GA 2CJBA 5J2MB 1R0BG 2XS7A 2V68A 1TL3A 4L72B 3EGVA 5LOQA 4UOCA 2V94A 1BGXT 1MROA 5KFYA 3ZZZA 4OHVA 1RTDB 1VC5A 4B9VA 5AXNA 4M94A 1NAQA 5DJBA 4X4QA 4J9QA 4DR5F 3KFWX 1IJEB 4I2PA 1VQ9S 1YG0A 3I0SB 4U8VA 3ETOA 4Y2AA 4CLWA 4ETZA 1QUPA 2C3MA 5A8RA 4BBYA 3K5LA 1C1CA 2EBGA 2VFSA 3AY0A 4CTAB 2OPRA 4P2FA 1T95A 5D4PA 5HROA 2EW9A 1YBTA 1YRUA 3IBFB 5THWA 2L08A 4P6QA 5LSRA 4LF8J 1DURA 1RT7A 3OHAA 4NLSA 2Z4PA 2KT2A 3P4UB 1VIXA 4OYOA 3PX4A 1MG7A 4IG3A 3ZNUA 1BLUA 1S4FA 1VLYA 2JRSA 1Q86T 2KZZA 5KG4A 3JYTA 2FJEB 1FX2A 1PAUB 3KXDA 3O2IA 1U2FA 1IXKA 1NLKL 5B0EA 5DM7Q 3IXQA 4CLYA 2DGOA 3KG1A 2BQUA 2QLWA 2ZBCA 4IG0A 4C9DA 3M32B 5F9NA 2HZCA 2EEYA 1U25A 4A8KA 1Z2ZA 2B51A 2X1BA 4LF9J 3Q8YA 5IV4A 5C42A 1WG1A 4DQQA 1VI7A 1ITPA 2DGXA 3BO4A 1HNXF 4YFUA 2ZH5A 3FSIA 1F9FA 3CSKA 1RUSA 2OPQA 3BO2A 3R2DJ 2MPUA 3FVYA 3C3LA 2HVEA 4OJ3A 2MDAA 2O3DA 3M1VB 1NSPA 4PWUA 2AYEA 4ANDA 2IVFB 4DR7F 2KG1A 4EWTA 2FGCA 1HW8A 4ECSA 3CJ3A 1WC1A 4LVNP 2NZ4A 2J9CA 4IFVB 3SBMA 4LFCF 4DSJA 1W2IA 3DCAA 1HBMA 4TQSA 2EKYA 5JJBA 4DL5A 2A3JA 2EFGA 1YJ7A 3ULHA 3SQGB 3QIPB 4V1Ak 5ETTA 3LWLA 4USWA 2HSEB 1RLCL 1FNMA 2L9NA 2ZC4A 5AXMA 2GIRA 1DTTA 2XNQA 1S1XA 3I0RB 2FLOA 3ILIA 4HDGA 4CO1A 3J81Y 3OL7A 3RRHA 3D6FB 4UUXA 2CIMA 1G3OA 2KRRA 2XMJA 5I4MA 5BR8F 5K8OA 2M52A 4X4PA 1SKSA 2G4BA 5ETQA 3Q8RB 4RW8A 2DNLA 1N32J 1RACB 3D67A 2F4FA 4JB8B 3RU0A 1B70B 3KJQB 1WHYA 2DNRA 1HLWA 3MAAA 3UW1A 5B0BA 2B9XA 2V8PA 1B3TA 3G8SA 2NYIA 3UD3P 1FEHA 2JFDA 1AXQA 4ED3A 1RT6A 2C2OB 4P2MA 3M6UA 2C28A 4KC5A 3LQVA 2R8KA 2R7UA 2KT3A 1DTQA 2RAQA 3N6LA 4MKAA 1EP4A 4IFVA 4NLTA 2EFQA 1I5OB 4RKUC 3RTVA 4LJMA 5KFXA 5MAOA 2ZC3A 4NI2B 2X1GA 3H5SA 3IAS9 4RNHA 3I56S 5DLGA 1HYSB 3BYRA 4HTJA 3VAIA 3LALA 1PG5B 3MGJA 4WKYA 1N36J 5HO4A 2QA4G 3SYZA 1HNZF 2VF3A 3VAFA 1FJGF 5K9FA 2JEJA 2D41A 5HMYA 2EKNA 3PR5B 4IOCQ 1L5UA 3DKDA 1LQ9A 1OSDA 3HLUA 2IAJB 2HG4A 2MQNA 1X60A 3DI6A 1RABB 4LUBA 2VC0A 5M2RA 4DN0A 5HMZA 3L95X 5SUHA 1NM2A 3MTKA 1OPIA 1SV5A 3W64A 5GAHU 4RNNA 2D74B 2MJUA 2QMUB 1ZM9A 2OFGX 1NHVA 2ZE2B 2FVRA 4R0EA 2FLPA 4DR1F 3NNAA 3Q8UA 3KHHA 1X9MA 2KM8B 1CS4B 2JX2A 3IR6B 1TKZB 4NLOA 2D3O1 3K89A 3A1YG 4Z37A 3KWMA 1XERA 2DHHA 2KYZA 3CCVS 3N5FA 1S6PB 4KV8B 1B99A 4PXDA 2M9KA 3GE9A 4QWDA 1IBMF 4YMEA 5AXLA 3W5ZA 1X5PA 3W9HA 2QZ8A 2D3OR 3TANA 4M8LA 1UJ6A 2I6WA 1RYSA 4MYUA 1FCAA 2W7OA 1CQNA 2R7OA 3A8EA 2CQ1A 4ZLLA 1FI4A 2FHJD 4A8XA 4CM2A 1PGZA 3ISNC 2YKAA 4YR2A 2DNKA 3AD8C 3SSQA 1AB8A 2GAHC 2C2NA 4XPCA 4UZBA 2ZH8A 4BCAA 2QT7A 4HEA9 4L76A 3DOKA 2BJ3A 2XBPA 4O23A 3P49B 5G4DA 1YTYA 4QWCA 1RTJA 3CC4S 4FDFA 5D3GA 2WVEA 2J5AA 4KFBA 1XR6A 2DEIA 2IVMA 3DM2B 3LAMA 4NRTA 3B54A 3TW0A 2AX0A 3CJQA 3N0VA 4KKOA 4C6AA 5HVHA 2DGVA 3FRZA 4UY8T 1UP1A 4OHXA 4LIWA 2W9BA 4MK9A 2Y1JA 2AW0A 4NLUA 1Q0NA 2WSEC 2HHHF 2WCXA 4G1IA 3PXGa 3SDEA 3MR6A 3U7JA 2GV1A 4RBTA 1M5VC 1B0TA 3HCXA 3IGNA 3W63A 2J8AA 1HNWJ 4MIAA 4JI7J 2HHUA 3VF0B 4U6PA 2BRKA 1NPPA 4WFNQ 2IIHA 1HNWF 4EEYA 3TI0A 4B3SJ 1YIJS 1P6TA 3M8YA 3MECB 3EDRB 4W92B 3VGUA 4Y3CA 2OSRA 4LF1A 1F1BB 2RH3A 1U26A 2UXDF 2EK6A 2WONA 1LW2B 4Y2KA 5IFMA 4DMZA 3D2WA 2UUCF 3DM2A 2LP4A 4M5DA 4RO0A 1N4LA 1FFGB 2HAFA 1T9TA 3CB4A 1YJWS 4CLSA 2FJBB 1SKWA 5EWGA 1IKYB 3TA0A 4KKOB 3BF4A 1K73T 3C15A 2QX0A 1S1UB 3M8QA 4HHHA 2BRLA 3LGNA 2LXUA 4PQAA 4B3RF 4JI8J 1J5OA 1OPZA 2ZUGA 5F3ZA 1VBXA 3C66A 3CDEA 4LFAJ 1NK0A 1SCJB 2JNJA 2B8QA 2J9DA 3IP0A 1AUDA 4USVA 3RRGA 1S10A 1VRTA 1K1SA 1LOUA 1EQ0A 4YOEA 4XO0A 5HN0A 4FN5A 3M2VB 4TYBA 5HSPA 2NPFA 2PN6A 4RU9A 1JJ4A 1RT1B 4B3OA 1IBLJ 3M9OB 1HI8A 4X62F 2VQEJ 4KBIA 4RX6A 3TZYA 2GMLA 3QSIA 1NU4A 1HBMB 2AJ1A 2RIJA 3MF5A 4ALZA 4FVMA 3AXKA 2J0SD 4J9OA 4DU8A 2HIYA 1TL7B 1W7WA 4QWEA 1RAHB 4DPYA 4ES3A 5A76A 2W4PA 2WW4A 2HAIA 4NCGB 3MD3A 5KG5A 4IUFA 3HFKA 4DX7A 1FRJA 4MH8A 3N6MA 1KHVA 2B4OA 3HJVA 4QR0A 3Q86A 3HHLC 4ZVFA 3MMAB 3RYLA 3RBDA 3LPEA 1QLNA 2DEJA 1X4AA 2YVSA 4F0HA 1Y5IB 2J7UA 3MTJA 2BKOA 2FHOB 4F4ZA 3L7PA 1NK7A 1CJTA 1VRUB 2XEXA 1KSPA 3DYAA 4DPWA 4CLFA 1OMSA 4P7VA 2ILYA 2OI2A 2KG0A 3F73A 2YWKA 1D3WA 1UEKA 4C3MA 4H4OB 2KDOA 2OO4A 2J0WA 4OX6A 4ENOA 2L9DA 4ED7A 1Q16B 4WIQA 5DQGA 1H6KX 4WK1A 1IR1A 2F8EX 3N4WA 4X4UA 4NLWA 2QYGA 1S6QA 5LJ3Y 3QZ7A 4OI0A 5CAAA 2HHSA 3UDVA 1U45A 4C8YA 5CD4H 1UTAA 2GMHA 4GVBA 1SUQB 1NH7A 4ZJLA 3CF5Q 2KJVA 4DX6A 2MZJA 3ZZOA 5AE2A 3I9V9 4CM0A 5KOWA 3MWBA 4J9SA 1DHMA 3GFXA 3HPOA 2DNGA 1TKZA 3ITHB 5D0RA 2VPZB 3PFEA 3HSDA 2R8IA 1HNIA 1S49A 4EO6A 3ENVA 2MY7A 2ZJPQ 1TKDA 2XTJP 1JLEB 1UWAA 2HW3A 1EAYC 1O8BA 4DCJB 4DUYJ 1G2EA 5MLCV 4C48A 1TELA 1U47A 2X3GA 1DJ0A 3MEEB 4M5IA 4JI0J 4TY8B 4HTIA 3HVAA 5BYQA 1B64A 1RGVA 6FDRA 1B7YB 3FZ2A 4WIIA 4F2RA 2MKYA 2WAQD 1Q79A 5K5MA 4JI3J 1MSWD 4NWBA 4UZCA 4LRCA 4M5LA 4LRBA 5DG8A 4Q44A 2VQFF 1UW9A 4QZVB 2CYYA 4NLRA 1OQ3A 4PWDB 4DPXA 4ECQA 1O6XA 2P8IA 3NCRA 5KFJA 2LVWA 1K0VA 2ZH4A 4NA3A 2VJUA 3NMAA 5KT2A 4DV7J 4J37A 5K20B 4YY3J 2R7TA 2HNDA 2UV8A 2QSWA 3EZ5A 4U7UD 4OQJA 1S59A 3BGOP 4DZ6A 3EGWB 2RUGA 2AJ0A 3FCVA 3TAMB 3KLEA 3NAHA 4KR0B 2HPUA 3BREA 3DDNA 1U2RA 4HHJA 1LFPA 1VQNS 2ZBRA 3P45B 3QGHA 2IFXA 4O44A 2W25A 2ZWOA 4NLDA 3THTA 3M4XA 2HNZA 1MLAA 1NZ8A 4J9MA 4DQPA 1M5KC 2BEFA 3K5PA 2MYFA 2BQRA 3G9CA 2R4FA 3N28A 2KFNA 1H0HB 4KGZB 5F41A 3R7BB 5D4NA 8RUCA 4P72A 4DL3A 3T1HF 3LGMA 5CA5A 3MM7B 2DGQA 4HKQA 2O66A 4GO7X 3SFUA 1XMQJ 1SJ4P 4C8OA 1YJRA 4DL6A 1WEXA 2NXCA 4NA1A 2EC2A 5L9NA 2AD9A 3DGPB 3NNCA 3CJRA 4ICLA 4X4VA 3DYAB 1W26A 1RT2B 2COLA 1YWXA 3KLIB 1Q7LB 2FLNA 2GJ2A 5L8RC 3CJ0A 2MQOA 1HA1A 1LEOA 3T5HA 5H9FK 3R9LA 4URSA 1IKWA 3LO3A 1ZM3A 3QNWB 1QJHA 1ZBTA 4QW8A 1T9XA 1SC1B 2PEHA 2G0CA 1OSCA 4N77A 2PIIA 1LW0A 1WACA 1RTHA 1WI8A 3MMCA 3PHEA 4KAIA 1YSJA 1DY3A 2JH3A 4U95A 1XMOJ 4IRDA 2OKQA 3MM9B 1S9GB 3W2WB 2FZCB 4WP8A 3IC1A 3M8PB 4H54A 2N7YA 4O4GA 2CQHA 1RHKB 1RT4A 2PFDA 4RUHA 3J7ZT 4XTTA 2HFNA 5AE3A 3CGIA 3SDEB 5HANA 3ZZPA 2GJFA 1U6ZA 1PIEA 1FFSB 2H48B 1RHUB 2E1RA 5LSOA 1NPKA 1PC5A 2CPDA 5CCMA 1PJ6A 4DFJA 2UXDJ 4I6AA 1VISA 2F3JA 2YY3A 3QGIA 2KB2A 3MEKA 4G1QA 4O4GB 2YQ1A 5GMKa 3AAWB 3ET6A 5HQMA 1QDUB 2EG1A 1RT5A 2FPHX 2QYCA 3BEGB 3DRSA 2EWHA 5A8WB 2LEBA 2D3ZA 3ELHA 3SQOP 1A7GE 3IMQJ 2PO4A 2IRXA 3I0RA 4QU6A 4MAKA 3TZWA 3TAMA 3DMJA 2C2EA 2R7SA 2ZNZA 2CNOB 3CMQA 5A0YA 3CMES 4CLUA 2ZH7A 3QRPA 1OJ4A 3GZ7A 4E8UA 2UVWA 4GKJF 2PGCA 4LR8A 2DRDA 4Y6IA 3MDFA 3W60A 3KMSA 1RU1A 3IN5A 4UOFA 2VIHA 4DL4A 1VQLS 1SUQA 4G3IA 1KTVA 4FYVB 2HGMA 1JLFB 3OBIA 4IH7A 4EK2A 1WELA 3QSYB 2XYHB 3NMRA 1CJKB 3HI9A 5F8MA 1ICEB 4IR1A 5C24A 5HP1A 2DGWA 3DOMB 5ETLA 1AZSA 2RDIA 2IBKA 2XMAA 4IFYA 3J7YI 3CXCR 2OTLS 3KYLA 2KXHA 3W5YA 1FE0A 3I82A 1HYSA 2MKIA 4Q2LA 4NMLA 2HQCA 4JI5F 1UKUA 5DRKA 2OMOA 2RQCA 2R2UA 4TY9A 4X2BA 3M6VA 3RG6A 4YB6A 4OI6A 3M7VA 5KG1A 4I0WA 1J2VA 5J1EA 1F3VA 4OYAA 1IKWB 1D8YA 4FF2A 3C8YA 4IH6A 5ETRA 4Y2CA 3M8SA 2VA2A 2E9ZA 2KO1A 4BDPA 2JEIA 4PR6A 3QT5A 2HLTA 1JLAB 2RF2A 1U1PA 4DSKA 3IWNC 2XSJA 2IM1A 2YNFA 1JLCA 3EZUA 4U96A 1SVDA 2PMHA 4IO1A 4YR0A 1R89A 4EO8A 4F4YA 4DUZJ 2AX1A 2L48A 1H98A 3T41A 1MWZA 2K3IA 5T14A 3ZFVA 4J9KA 1U8SA 3SV3A 5KFTA 3EDQB 5SZTA 5L1KA 3VR1A 1TKXB 2VD3A 4B3TJ 3OR1B 2YWFA 4CLTA 1HFEL 2LMIA 1KVJA 1KLMB 3MAQA 3NWRA 4M5HA 3BQ1A 2UUCJ 1ACMB 3MEDA 2FY8A 1Q7YT 1ZZFA 3C16B 1N34J 5DDQC 1Y4ZB 2GQCA 2NXUA 1UA1A 1RXOB 1KRPA 2F65A 1FFWB 4JI5J 2NUUG 4ILMA 1VQ8S 3NOCA 2WRMA 5I3QA 5KFPA 1OWXA 2BOPA 1OO0B 5CZXA 3DLKB 2CNLB 1LK7A 1T9VA 4N8OA 4NL5A 4P73A 4C8MA 5B08A 4DUYF 1VLOA 1IKYA 1YRTA 2V69A 2YKPA 1TFWA 5A8WA 4MKBA 2M5YA 2W4CA 1MWQA 4UF4A 1M1GA 2HZVA 2CA9A 2V9WA 2QL9B 3OFFA 4C8NA 1YHQS 1UZDA 3MPUB 4M5NA 4IH5A 4R5PA 1NK8A 3SCJE 4GKKF 2PC6A 2XO6A 2JLGA 5HBMB 2AF6A 2CVEA 2OPPA 3DRYA 7FDRA 4KJIA 1VQ7S 4Q8EA 5J2PB 4UOHA 3IFEA 2AEMA 1MNEA 1Q53A 2JZ5A 2MQLA 2WW8A 3K58A 5KFUA 4RW6B 3TUIC 1WNEA 4B3RJ 1K1QA 1JX4A 1NHUA 1RT3B 2GHPA 4C3LA 4FS2A 5G0RA 2KZMA 2HRYA 1AUSL 1FRIA 5T41A 5KFVA 4DV0F 3MFHA 4PPDA 2HQ3A 2Z57B 1RCXB 2BJEA 4NXMF 3W8PA 1WEYA 2WOMB 3KK1B 1L3SA 4XIUA 4FPRA 1N32F 3CNQP 1FEEA 3CCZA 1G4CA 1HNVA 5KFLA 3TRGA 5ETNA 4CP5A 3VAJA 1CLFA 1RTIA 4IQXA 2ATLA 2AMCB 2B9YA 2GQQA 3LP0B 5F0UA 1S76D 2MZSA 8AT1B 3O6QA 4CTAA 2B7CB 2C1EB 4B9NA 1VQ5S 1S0NA 2B4PA 4ELTA 4ZPTR 5A6WA 3G6YA 2OFHX 2AQ4A 3KOAA 3B78A 1KQGB 2K06A 3K17A 3I87A 2HQDA 3PYFA 2KJWA 2XI3A 3IO1A 3PW4A 2LFVA 3PIOQ 2LQBA 2IC3A 1S9EB 1RDRA 2MTLA 5E3QA 3WC0A 2GO8A 3R5CA 4DHVA 2EC0A 1KVKA 4OZ2A 2CJAA 2HYIB 2A1BA 1FF2A 5CXTA 4NYOA 3S7RA 2VFUA 3BYPA 1SC4B 1ZPWX 2VODA 1SL0A 3GYXB 4O3OA 1EIYB 3Q83A 3GMGA 1BY9A 2CJQA 4A8QA 1BQMA 2YNHB 3DGPA 3MFIA 3DLHA 2F1FA 2FB0A 5C2CA 2MSTA 2R42A 1VR6A 1Q5VA 2CQDA 3NRBA 5AT1B 2YKQA 2R8HA 3BQ2A 5LMNJ 2UUBF 1PO6A 1PSDA 1X4EA 1YVFA 3JS9A 5F3TA 3GONA 1PJ7A 2W9CB 2LQ9A 4HACA 1MU2A 4IKAA 2RDJA 3MPDA 4PUOB 2DH8A 3BV8A 4M63A 5HMXA 2CDRB 1HPZA 3KG4A 4ZVTB 3HK2A 5ETKA 3HT3A 1MW7A 1VJQA 1I3OB 2Q43A 3I96A 3TZZA 3ZO7A 4P71A 1RTZA 3CMAS 2F8HA 3EWGA 3JTNA 1TKTA 4X4RA 1N48A 2JVRA 2H4WB 2YKNB 2HVIA 2FC8A 4CH7A 2CPIA 3H5UA 5J2NA 1MN7A 1Q81T 4JP8A 2MKCA 4S0MA 3NNHA 4MT1A 2UV8G 4DN9A 4I2QB 5KFRA 2HGNA 2VICA 2AJFE 4F36A 3RGIA 4R8UB 3O3LA 1X8DA 1FD2A 2VFVA 1LWFA 1ZH5A 4PYAA 2Q6CA 3BO3A 1S99A 2UUAF 1TV6B 5A8RB 2LDIA 2GMJA 3BH6B 3N5BA 1S5ZA 2AGQA 3V81B 2VKRA 3QRQA 2V4JB 3CC2S 4KIAA 1IWAA 2ASYA 3M30B 2ZUAA 4NLYA 3RJMB 1OS5A 4CT8A 3RZAA 4YUDA 3KK3B 2OSQA 2CPFA 1DTQB 1HBOB 4WFXA 3V81A 1VQ6S 4CI0B 3DU6A 1S57A 1BHNA 5DZ6A 4Y65A 4OMFG 1ZAWA 2VPWB 3NY0A 4KSEB 4QR1A 5E3CA 3T19A 4OI4A 1VBKA 4N41A 5J2MA 3OFEA 2BE7D 1QM9A 2DK2A 1NNDA 3D9BA 3D28A 3GR1A 3BGFA 3NS7B 5GAEI 3ZC4A 3M30A 3IR5B 3R6LB 1RWXB 4UTGA 1MROB 4YHHF 5BXIA 2DNYA 3C46A 5ETPA 5LL6d 2XB2D 4OHYA 3OJUA 2YWHA 1WG5A 3ZTQA 3GCWP 3TUZC 3T5LA 1RKJA 3OVBA 2ZZTA 2GZOA 2H51B 1NKCA 5ETMA 4KTQA 2DKOB 3PJXA 3D6HB 3QIPA 5D15A 1LWEA 4IDKA 2VG7A 4URQU 4CIOA 1T05A 3K0JA 4EMDA 2NYHA 3CT9A 3KJVB 3TEHB 5F8JA 4L74A 2LECA 2E5JA 2J0QD 5CYQB 3ZZYA 5HBMA 5HK4A 1YJVA 2VUGA 1YI2S 2A6MA 3HJFA 3Q89A 5E3RA 1FRLA 3GV5B 4DR3J 4AD6A 1S0VA 1MN9A 2RHQB 1WJ9A 1X4HA 3CC7S 1XR5A 1WHXA 2RF2B 3MZIA 4PG4A 1SJ3P 4GC7A 3EE3A 3EMTA 4G1PA 4DG1B 3D0GE 5LXYA 1HBNA 3RRKA 2VJVA 3ILJA 5EUHA 4IG0B 4LF6F 5KFWA 1HQEA 3ENQA 3NGRA 4ED6A 2C2ZB 2R7XA 3BS9A 2NXJA 5DG7A 3HT0A 1S7IA 3MCOA 3M2VA 2F40A 4OYZA 7FD1A 4LFBF 2HRUA 1FESA 4X4OA 1R8BA 1U0HB 2QL5B 3IA0A 2QN6B 2XCPA 1TVRB 4A8SA 2QFIA 1R0AA 1Z4UA 5C24B 2CQPA 1SIWB 2UZAA 2UXCF 3AJDA 3W62A 1WORA 2ZH2A 1RA7A 4PQUA 1YBUA 2GO9A 1JLAA 2XMMA 4PG8A 3M1VA 2LDYA 4WP3A 3CCMS 3QIDA 3TARA 2ZH3A 1XMQF 1QAJA 1F3FA 4C0BA 3MHYA 3P8BB 4CO3A 3MR5A 3TAQA 3BPSP 3BZQA 2L3MA 2C2DA 1FDBA 2EXUA 5U47A 3CE8A 2PMWA 3PYGA 2KL8A 3BGRA 4I69A 4CH1A 3RR8A 1S6UA 2B0GA 1KQKA 1BWEA 3HVTB 2HNYA 1JXLA 5GMEA 1NZAA 1TL7A 3BBCA 3ZNJ1 3K5OA 3OUYA 4KRWA 2Y1LB 3NGTA 5EHHA 4OZ1A 5LMUJ 4WTOB 3SXLA 3IBWA 3EPIA 1U24A 2EFPA 4I7FB 1S1XB 2BM0A 3Q22A 2QEXS 3MM6A 4ZPVR 5HP1B 1BE4A 2C2MB 1QY7A 3TEGA 1ZAVA 3KLEB 1GX5A 3Q24A 3C2PA 4OZNA 2R7WA 2V8DA 2FJXA 1EX8A 2CFXA 1F6TA 1XR7A 1VYAA 4HLBA 1GAOA 2CPEA 4JV5J 3M6XA 1WHWA 4A48A 3A8KA 3D1QA 2CJXB 3KLVA 2W1BA 2K2PA 2AGPA 4NLQA 1TUGB 2RKIA 4NZ6A 2OD4A 2AIRB 3C15B 1KQFB 4R5PB 4ED2A 1W25A 4BHQA 1TL4A 2YX4A 1X5TA 3VWSA 3FEYB 5C25B 2HMIA 4MKYA 5D78A 3G82B 3EVOA 5HLFA 2B5JB 2QL7B 2HNYB 3AJ2A 3NBPB 2IBOA 4I2PB 1S1TA 4QU7A 2OAUA 4UT4A 1ZA2B 3HKZD 1I94F 4RNOA 2W01A 2YPYA 4I7FA 4GVLA 4K7QA 2C2RA 3UNYA 4FYWB 2HHTA 4LF8F 3LOUA 4PCQA 1J5EF 3ZZUA 3G87A 4ID8A 5E41A 1JWWA 3NAIA 4GRSA 5B0AA 4AXIA 2O5DA 4Q0BB 2CWXA 1FJ7A 3TOQA 4DX8H 8ATCB 3M2UA 5KFQA 4K4SA 4BLGA 1F9HA 5B0FA 4P75A 1YZ6A 1NJIT 4I2QA 2HQFA 3CJ4A 3QJPA 1JXEA 1N5VA 2Z2MA 2HQIA 3JQJA 4K4YA 1M0SA 1F2GA 2YKMB 2WVFA 3PTWA 3U1LA 1FXRA 1HMVB 3HX9A 1RT4B 5BYSA 2N3OA 4X62J 2VQEF 2K7JA 4TVAB 3CCES 4OX9J 1IBCB 2DBBA 3A12A 5DDRC 3OLBA 4TNOA 5FDLA 3A3PB 3UD5A 1UPPA 2E9RX 4USHA 1YJUA 2HZAA 1IN0A 4H4OA 4QYRA 3TAPA 3PX0A 2HBRB 5DLFA 2M8DB 3CCWA 4UQGA 5C5JA 2HBZB 4FS1A 4DR2F 2ZHOA 3HHEA 2QJ3A 1VHFA 1HMVA 2M7SA 2XI2A 2HFUA 3AOCA 3T1YF 2I2YA 3JYTB 4EZ6A 4Y2MA 4H4KA 1JKHA 3LAKA 1FXDA 1RI7A 5FDLB 3TX8A 4CWBA 4Y0FA 5JVGQ 2BVZA 1ELOA 2FGOA 2IPOB 5GAEU 4IQMA 1R31A 1N0UA 2V9KA 3IG1A 2HWTA 4O0NA 3BB5A 3LP2B 2XHWA 2HWHA 3HHLB 5K8MA 2HNZB 3HSGA 4OZLA 3FKBA 5KAKA 1E6VA 2ZJQQ 2MLXA 3GJRB 3R7SB 3MEDB 4DXLA 4FVCA 2G9OA 5A8KB 2YNHA 6AT1B 1Y9OA 5AJ3F 3MCSA 3G2XA 3KUGA 2KTQA 1UJ5A 2LKZA 1GMWD 4PKDB 1HIYA 2WVCA 4Q2MA 2OJ3A 1YGYA 3G82A 3JTOA 1BQNA 1S79A 2OD6A 3I0SA 3R5GA 2LU1A 4H4MB 4K59A 5AXKA 1S9EA 3R6GB 2NUHA 5J1NA 4CNYA 4DEZA 3DLBA 2DCUB 4RW7B 4LMZA 1NUEA 3PACA 4RR5A 3MECA 3HP6A 3M6WA 1HWJA 2P5VA 3FK4A 4EYIB 2Z2YB 1SJRA 2BANA 3FGVA 2B9WA 3KKFA 2AHOB 3PCOB 3PRBA 1IM6A 1XWLA 2CZ9A 2PE8A 3PJ9A 4W98A 3P5TL 1UAWA 5KFIA 3X3UA 4ES1A 3BSOA 5GVQA 1R27B 4IOAQ 4LSNA 5EX3A 5KG7A 2CPYA 4U7UK 2DRAA 2IMOA 5D77A 2F9JA 2RB7A 4ZVQB 4EU0A 1TUWA 4DBQA 1J5EJ 1JNZB 1H3DA 1I1GA 3MM9A 2DH9A 1CSJA 4U9RA 4ZCLA 3TVZA 2J7KA 3K57A 1OY8A 3UR0A 4DL0C 2IYIA 4O4RA 2DR5A 3DLEB 5HJXA 5DG9A 2VBWA 1IM4A 5KG2A 4LRAA 1HNIB 4ZVHA 3GPAA 2DNQA 2Y1IA 1RBAA 3BSNA 4JI1J 4Q8FA 2NREA 1U1MA 4J9NA 3GB0A 1NH8A 1RKIA 5DS7A 4FF3A 4FXDA 4ZLPA 3AFGA 5IT4A 4E98A 1PYSB 3TNVA 3VGSA 4X64J 1CVJA 3R5BA 3S1TA 1FX4A 2RRAA 4WYWA 2BJDA 3LP1A 4NLPA 1KEKA 3D4JA 3N79A 2G2YA 4OJGA 3V6DB 3B6BA 2K7KA 2I5JB 3CIMA 3JSYA 4ZJOA 3VZHA 3JQMA 1SJFA 4WYLA 2KXFA 1FVQA 4J90A 5M2PA 4URGA 4FNIA 4M5KA 4F3QA 4J9PA 3QFHA 5DGBA 2B56A 1KVIA 4ZCMA 1Q8KA 4EGLA 2N4CA 1SB6A 5L1JA 4F3OA 1RWWB 1I51B 1R0AB 4USUA 2V5HG 3J80U 3T6JA 3S6EA 3GG0A 4CO4A 2DNNA 1D9AA 3JB9k 2SXLA 2Q6BA 3BPDA 4CZCA 4CLPA 5ADZA 5HJYA 2K1RB 2G13A 2D3UA 3H40A 2F7VA 3DHWC 5ITHA 3Q8PB 1Y5LB 1BC6A 4DSIA 3NXZA 4N8NA 1FWPA 1Q78A 1HQEB 1SJQA 1V9OA 2V50A 3HZGA 1UW4A 3OTCA 4NYZA 4QJVA 4IO9Q 1L3UA 5F8HA 1ZM2A 2Z2ZA 2DIUA 3PHTA 2CG4A 3O44A 4QBUA 1SL2A 2N3LA 3VAMA 1C0TA 1LK5A 2E5GA 4C98A 1NMEB 2CZ4A 1WOPA 2LEAA 2A10A 1DAXA 3E51A 4IYQA 2MZ1A 3V4IA 1SKUB 1VQOS 2E5LF 2HS4A 4ED5A 1FT8A 3CJKB 3GV7B 1S12A 5T7LA 5F8LA 2YKMA 2CQ0A 2HWIA 3CW2C 1ZAXA 2ZDOA 1KFDA 5KFEA 4OJHA 4QPTA 2NLWA 4WFYA 5DGAA 1N6QB 4RBUA 7AT1B 1KR4A 1N56A 2A6OA 2KHCA 4OZJA 3GG1A 1UVNA 2IVYA 1YJNS 4ICLB 2BYCA 1CULB 1RADB 3HD2A 2C2KB 2WSFC 5IXUA 1HR0F 1B0PA 4ZP7A 1S1UA 3M8QB 4DSLA 1H2TZ 3VGTA 2ALYB 3F0NA 3JSRA 3PEJA 1FKOA 1MWYA 3PRDA 2BANB 3BSAA 3D6TB 3MPWA 4LIRA 3W9IA 3PW5A 2H9ZA 2OPQB 1HWUA 4PXBA 3LA0A 1RAEB 2WK4A 3QT6A 2M70A 2QC3A 4EBEA 2CJKA 2FVPA 1Q4RA 2VASA 1WEZA 1EHWA 1U1OA 4DPOA 2J6TA 4B3MF 2P6SA 2DHGA 3G6VA 2W2OP 1S1VA 4MTPA 1AW0A 1UVIA 4WCEQ 1DLOB 2UU9F 5IT0A 4NX9A 2I9SA 3KJFB 4GC6A 4ECXA 2WHOA 3FBCA 5KFOA 4DV6J 3CCLS 1X7VA 1YRXA 4K0KJ 1FDDA 4FZVA 4NLGA 1Q8LA 1C1BB 2BKPA 2DYAA 5DDPC 1RWPB 3AJ1A 3NL0A 2YKNA 3OTEA 4KQZA 3ENAA 4HH0A 1HW9A 1R0CB 2IM0A 3MMBB 2J6SA 2JHEA 4DOZA 5KT4A 4ZPAA 2MQMA 2O67A 3C14A 3UQSA 4QCLA 4K2XA 3IR7B 2DR8A 4IRKA 2DITA 4I6WA 5KFSA 5HQLA 3NOGA 1GK8A 2YXLA 3ZZRA 3G71S 3KK2B 2LA4A 3SIPB 4J5OA 3J81U 4DQIA 1SQFA 3QLHB 3LW5C 2PA8D 3AQOA 1HI1A 3H42A 3OR2A 1B4SA 4OI2A 1TL3B 4LRDA 1DQ9A 2N4DA 5I42B 3R1LA 2F4VF 3OL6A 2UVUA 1FVSA 2VPYB 2OEKA 1PC4A 3AH6A 1CJVB 1QE1B 4K5RA 4C3KA 3FRYA 4DS4A 4KHPJ 3H20A 4ZPWR 1FJEB 5LMUF 3IM9A 2CQIA 2W8LA 4ER8A 1ZTWA 1U1QA 2OP5A 3QO9A 4A4JA 1KOHA 1LXJA 1VRTB 3HHLA 1P9QC 1KBRA 2I8EA 4K50A 3D7SB 1H73A 2CPHA 3M2UB 3EUNA 3UDCA 4ID5A 2QGFB 4XAKA 1RT1A 2GS8A 4ZOSA 1QTNB 5HMWA 3GQCA 1T3NA 1N5YB 2YX1A 4USKA 2XM3A 1WDDA 1ZM4A 2GIFA 2VU5A 2BOAA 3G6XA 3HHLD 3V6JA 4LR7A 4RU2A 1U6BA 1M5PC 1NJXA 3T5JA 2CPZA 1RT7B 2ZNYA 5KFAA 5KFMA 1IBKJ 4M5DB 2V4QA 2WBRA 1YX2A 2IJNA 3L7UA 3CJ5A 1EKSA 4JI6J 2X1AA 1GFWB 2AT1B 4JI0F 2RQMA 3D0IE 3Q0AA 3SEOA 2ZD1A 2IJFA 4RUBA 2XWYA 2XYGB 1XJWB 1U1RA 4CLLA 1RHQB 2NXNA 2AEFA 4A8WA 4HYKA 1FD8A 4JUZA 3JSBA 2CZVC 1XNQF 2LXIA 3N6NA 1XEZA 3WX8A 3DC2A 2GNKA 3MR7A 2FJWA 4CH0S 1T02A 3M9NB 2RS8A 1CJUA 3AOAA 3OQ2A 3G8QA 3POTA 4I1TA 4K2JA 4MKVA 3IGVA 1IKXA 1YJTA 3GP9A 3RUBL 1UVJA 4DQSA 4K0KF 1AYEA 2Y3YA 2J8SA 3KDOA 4O3RA 4RWWA 3MEGB 3T3FA 4Y2IA 2YQ3A 4MFBB 2R3VA 3MM5B 4P9SA 4CYUA 4ECVA 3I4HX 2XCAA 3RB0A 5FIIA 5IOLA 4CO5A 1NJYA 3PRVA 2R9LA 1NJWA 5A0YB 3M9MB 1VCTA 2RVJA 3BKFA 3QRRA 4LBIA 2NSBA 1CC7A 2OHDA 3SQGA 2K8GA 3QGPA 2B5JA 4LSZB 5DDOC 1LWXA 2R2TA 1WKKA 4DFMA 1JLEA 2XLKA 1FA0A 4OFZA 3G4SS 4XDDA 3UDEA 1N36F 1DTTB 3V2UC 1RK8A 2LU2A 2I38A 2M0GB 2GGPB 3E3XA 1KNZA 4Q43A 3QT7A 3BGRB 2ZBIA 1KWMA 2HBYB 2IA6A 1UMJA 1NK6A 3BSCA 2M88A 4F67A 3IRXA 4B9TA 1TU0B 2MKJA 4YR3A 4DV7F 1UETA 2LA6A 3VTIA 2B8PA 4ZKAA 1RT2A 3Q8VA 4ECZA 4ID5B 1CJVA 2B4VA 3GSDA 4L73A 4OLPA 2XSFA 4ZVUB 4AUKA 1KOOA 3LP1B 5B09A 3MR3A 1TFYA 4WU2A 3GFYA 5GAHI 4D3HA 2ZH1A 3OV7A 3DRRA 1U0SA 2IA0A 1U1NA 3QO9B 1XNRJ 2RT3A 3KMQA 5F9LA 4LF6J 1QAYA 4FYDA 2AGOA 2XZWA 4OI1A 2KFYA 2X1FA 2HHHJ 4OX9F 2JWNA 4MK8A 4NCGA 1OIAA 1X4FA 4YP3A 3DOLA 4B3OB 1EARA 3KG0A 4LF9F 2HURA 5EWFA 5D3GB 3IBCB 1N5QA 2EBEA 3ADAC 3H2LA 4PABA 3US5A 1BWVA 3ISND 4FKXA 1ROFA 3DRRB 4KGKA 2MJNA 4OZ0A 3VCDA 5IS2A 5LJ5Y 2DJWA 1TMMA 2V34A 1JXVA 2DTJA 3KLIA 1TTHB 1IR0A 4AYBD 4D3GA 1REGX 2HS0A 1GQEA 4LR9A 1JIHA 1TVRA 3R27A 5DO2A 2I0XA 2IMWP 4LF5J 1S77D 2OLWA 3ISZA 1URRA 1LKZA 4JI2F 3BGLA 1N33J 1NEEA 2V0NA 1WC5A 3EM1A 4X84A 3OSNA 4GO5X 4NZ0A 4ZPBA 1N33F 2JJ4D 2N82B 1K0TA 3HFVA 3KNGA 3FBFA 3J80Y 2OPRB 1HQ2A 1TMJA 4JI4J 2RSQA 2VG6B 2ZVSA 3CO0P 2E5LJ 4NXMJ 3NGUA 2BE9B 1EKRA 1QVGR 1LW2A 3NKYA 1IWGA 4FYXB 4AL6A 2OTJS 4LVOP 4LT6A 1Y7PA 4WZMA 2CPXA 1LFWA 2DIVA 3MUTP 2NS1B 2A0FB 1PAEX 2QSFA 1CC8A 3OXLA 3PFOA 4HH1A 1R43A 2O01C 4LF4F 4YHHJ 3MM5A 3W1YC 4KGXB 4CYUB 3HSJA 3K59A 5HATA 3KJVA 1VS3A 2JDJA 3DLJA 3H5YA 2VG7B 3I4PA 1T05B 2X51A 2YPZA 2MHEA 4LQ9A 4G1QB 2R8GA 1V3RA 2E44A 2FQQB 2IAJA 1FKPB 2Q3PA 1U09A 3DI6B 1XN9A 1M5SA 3R3TA 4JBCA 4DV2F 3OR1A 4NCBA 2WB1D 3KNAA 1O5JA 4KH1B 2Y0SD 4OHZA 4RUCA 3PYEA 5RUBA 4HI2A 4RW9A 3T6BA 1U48A 2E7VA 4B9UA 1VIOA 2RNEA 3HVWA 4B3MJ 4OYMA 4LFCJ 3THPA 2GQ2A 5GADI 1TQLA 2JOQA 2A18A 4ZCKA 3W5XA 2IM2A 2DR9A 1C0TB 4LF7J 1VQKS 1KDNA 4TN2A 3RB4A 2QFJA 3JSMB 1LWCB 2BBEA 3I9ZA 2QIFA 1YQHA 3P96A 1BUXA 3CJKA 2YH0A 2ZHBA 2PA3A 5GMDA 5ETVA 3SCLE 2E1PA 5FD1A 4Q7AA 5JUMA 1IUJA 1UWBB 2W8KA 4HHUA 4F4KA 3MMAA 2BJ8A 4N7TA 3KLHB 1NKEA 2HVDA 3R8YA 1NKBA 4B02A 1Q82T 1F0XA 5D4OA 5E7OB 2MKKA 2QLXA 2BMBA 2YWGA 4RJVA 3VHQA 4JOUA 2LLZA 2B7BB 3AA8A 2OELA 3Q2SC 2H5JB 4LSLA 5LT5A 2V6AA 5H1SV 1C1BA 4UQTA 1WDTA 1XC9A 2DNHA 4YQWA 1D9DA 3F41A 4USTA 3ZZ0A 5J2NB 3FJ2A 2DISA 1OYDA 4DPUA 4TKTA 4JV2A 2EVZA 2D9PA 1MMLA 2X3DA 3S8SA 3BQ0A 1JJ2R 2IDEA 3GYGA 3MUMP 1S0MA 5KFNA 3I55S 2VG6A 2C42A 2VBZA 3A4TA 2DGTA 4RNMA 1RAJA 3FNNA 5LMNF 2DVIA 3EPGA 4DV5J 1WI6A 4NPOA 1Q8BA 1Q95G 1X5OA 2XGPA 3H8YA 2FJDB 5HVGA 2PI4A 4BC9A 2Z8QA 3LUYA 1R8HA 3PO4A 1FRHA 4OV6A 3CD6S 3CCUS 1N34F 5LM7E 4KHMA 3WQPA 2C3PA 3OPKA 2H54B 2VDHA 2RE1A 5CQGA 4DV6F 2UP1A 1IKXB 1PBUA 2OGUA 3ZZTA 3TJAA 4DX5A 1RHJB 4ZHRA 1TL1A 2CNKB 2JL9A 2YNGB 1N0VC 2F5GA 2XS5A 4C7QA 3UWTA 5KFKA 2JFKA 2MXYA 2E5HA 4K4VA 1XK8A 3AD9C 2R2SA 3GTYX 3DNCA 4P2SA 3PYDA 2HVHA 2DNZA 2Z56B 2KU7A 3TO8A 1HR0J 4YN3B 2Y1RI 5H9FJ 3BH7B 5DQIA 1FKPA 3RBEA 5E33A 1KP6A 2Y8YA 4OYBA 2GC8A 4NOHA 3VAGA 3V6KA 4GKKJ 4QWBA 4ZMMA 2LEPA 1LNQA 3TVKA 3GYNA 5CHCB 3GIJA 3R5DA 1FE4A 1WKJA 5KFGA 3T9ZA 4ES2A 1SL1A 4C8LA 3PX6A 2RHSB 5H9EJ 3W9JA 2RRBA 3EGZA 4V19X 5IC6B 2OUGA 5KFBA 2ZVIA 4WJBA 1N5SA 2MQ8A 4TQRA 2ZKTA 3ITHA 1VK8A 4ILRA 4NZ7A 4K4ZA 4PWWA 3C19A 3V6DA 1TP7A 2RILA 3DDIA 2BJ1A 2KI2A 4DV4J 3W66A 4ED4A 3UCGA 4NA2A 3BR9A 1IBLF 1N5YA 1RB0A 3QJLA 3R7NB 1U6FA 1SXLA 4K8RA 1N5TA 3UVJB 4KO0B 4KYZA 2P9GA 5E3PA 2NR0A 2NXEA 2AV5A 4E2FB 4USIA 2E9TA 5GAGU 1SPBP 3AB4B 1WF0A 2XMVA 5JXSA 2IJRA 2JVOA 1SC3B 1C2PA 1FDNA 3E01A 3U1NA 5EN1A 1V3SA 3NS5A 1P8GA 3I6PA 5B0CA 4DF4A 2BZ2A 5DETA 3BKUA 4C8KA 3EZOA 1HD0A 1H38A 3DRPA 3PNIA 1R7IA 2ZDPA 4A8OA 1Y0HA 4CLZA 5KFHA 2VKZG 1UEUA 4MJKA 4CO2A 3RB3A 1RTDA 2G0JA 2E1CA 3W7BA 2HHWA 2MY8A 1SBRA 1HWKA 2DO4A 3CJTA 4O3PA 4ZLJA 1YITS 3J7YU 2ZOFA 3AD7C 4X4SA 2BABA 1KONA 4OYWA 2XZTB 2QV6A 3I32A 4RWXA 4YB1P 4P74A 4ELVA 1G6BA 4QIGA 4Z7YA 5J2PA 3PZPA 2DGSA 1X0FA 4Q45A 3H2VE 2F4VJ 1WOSA 4L3KA 3M2RA 2HRTA 1Q1KA 2ATCB 2AJQA 1FHTA 3OW2R 1R8CA 4KGMA 2MKSA 4KO0A 5K8PA 1XNQJ 2L41A 3OTDA 2VG5A 1FTRA 3EICA 2VV5A 3A8IA 3Q23A 2FVSA 2HFVA 2QMXA 3QATA 2W7AA 4K4UA 1X0PA 4QYZJ 1L3TA 1YDLA 2VONA 2Z0GA 3W3SA 3IRWP 2DHXA 2DHAA 1QAIA 4CCHA 1FTCA 1R3NA 4NI2A 3OL8A 4PAAA 1QSYA 2RD5C 5IZHA 4TY8A 4Q0BA 5D4LA 3UN5A 4DQRA 3ZTPA 1DZ5A 4A8YA 1RWUA 4WK3A 5ETOA 1T94A 3OL9A 3NP5A 4RPFA 1LWCA 4EBCA 3QWUA 5B7WA 1RT6B 2HHXA 2RU9A 4RBVA 1FRMA 2DY1A 3M05A 3VALA 3QT8A 3I31A 4WE1A 5C25A 3R5AA 3MI7X 4J9UE 3KHLA 4K5SA 2ROPA 1XBWA 4J91A 5IQQA 3VVUA 5M2UA 4EBDA 4EZ9A 3DLEA 5CZVA 4QIVA 1KHWA 2NQPA 4I64A 3FMWA 2ALZA 1RP5A 1U7LA 1E6VB 3AT1B 4DR7J 3HFZB 3TQ1A 3PVXA 2EG2A 2ZZMA 2EFNA 2ZWPA 4CO0A 4JI8F 5KOXA 4C11A 3UCZP 1QTMA 4ZDNA 4M5GA 4B9MA 4X4NA 4NEYA 1QE1A 2XS2A 2JSXA 2LQ5A 3FCHA 4X66F 4QW9A 5L46A 3M8PA 3CCSS 4F2SA 1C4AA 3QYYA 4DLGA 2AWZA 4X66J 3AOBA 2UU9J 2OPPB 3CWJA 4GKJJ 1HPZB 2UUBJ 1Z2LA 1U49A 1VOMA 1S7HA 2JC1A 3MD1A 3GR0A 3VZIA 3PG9A 1JLQA 2E66A 2NCKL 3MM8A 2POKA 4OJ1A 1K8AT 2MEWA 5CD4A 1FK9B 3ET6B 2VA3A 3B4MA 4J7CA 4RZRA 1T9UA 4GVBB 5KFCA 4ILLA 3RBXA 3ZXWA 4B17A 4IDKB 4QIEA 3D68A 1WTFA 4YS2A 1SH2A 3NWGA 4OHWA 2KXNB 1P1TA 3K8VA 2DPJA 2K1RA 2ILZA 5D0EA 4ZPDA 3RW7A 4ZN3A 5ETSA 3PV8A 3IG1B 4R8UA 2EI5A 1JB0C 1GMWA 1YKWA 2H5EA 2IRYA 3E8OA 3IRXB 1RAIB 1CEZA 3FFIB 4R0JA 4GMKA 1O0PA 3CCTA 2VG5B 3ICLA 1TAQA 4RLEA 1HBUA 2KKHA 2M2BA 3QPIA 3V4MA 3HHDA 4AL7A 4ECWA 3OSPA 4EYHB 2JC0A 1S0OA 3FC9A 2W9BB 3DLGB 1HBNB 1C1CB 4MMOA 3M2RB 4WF9Q 3UN3A 1UVMA 4WFAQ 5FJ4A 4USJC 3KLHA 3TR5A 1RAFB 5T7LB 1AROP 5E0OA 3MM8B 2ZKUA 4PYDA 3PW7A 4Y34A 3DN9A 1D0EA 1L3KA 2V2VA 3HF5A 3NGKA 1MU2B 2UUWA 1HHSA 2F8MA 1C4CA 1REVA 2P2CB 2KRBA 1S1TB 4UUWA 4AQYJ 3N9UC 3OHBA 2W7PA 5I42A 2FVQA 5BR8J 2WBMA 2L9WA 3OFHA 4A47A 1D1UA 2W4DA 3DLGA 4ZVPB 4HT5A 1KC8T 1T7PA 4FBTA 2MQQA 2RUSA 2HMIB 3KK2A 2WONB 2KYXA 5HQ8A 4F02A 4FF4A 2Y8WA 1NXIA 1HWLA 3OTOJ 3CDWA 2MKHA 3C6TB 4KH0B 5I3PA 3EYZA 2BKNA 2A2DA 1E6YB 4FBUA 1WKLA 3TZXA 4W4MA 4ED0A 3BR8A 1U02A 1IJFB 1YBAA 1Z1ZA 1S72S 4W90B 3FEXB 3FDSA 4TLQA 5K14A 2IDLA 3KUHA 1VK3A 1JJCB 1RHRB 4E0DA 1ZZNA 1TKTB 2QLFB 2AKWB 1IKVB 1A6LA 2Z30B 3CJ8A 4NXNJ 1BQNB 4H4MA 2BX6A 2DPIA 1TR0A 5E5NA 2V63A 2VDIA 4N76A 4OYIA 4NCAA 3DOKB 2N7CA 4RW7A 1TK0A 1XQIA 1BXNA 4HI1A 3RAMA 1UJ4A 4EUVA 2IHR1 3UDLA 4DR3F 3AODA 1VGYA 2KM8C 4KFBB 2IY5B 3JXOA 1NB7A 1UPMB 2U2FA 2W2QP 2H3EB 2EK1A 3DRSB 4L75A 4L3NA 5K8NA 1M90T 2WVDA 1E6YA 3EVWA 4ITSA 4C97A 3SCIE 1JNRB 2HHQA 3O8WA 4OIXA 3BKTA 4O3NA 3MAHA 4JI7F 3GJSB 4HL9A 4NMXA 1LV5A 4PWDA 2H5IB 2HIQA 2WVBA 5K14B 2D69A 2ROEA 1VMBA 1HHQA 4ECUA 1WSRA 1FKOB 2VB6A 4B3SF 3VGVA 1IVZA 2QLJB 5L1LA 4O3QA 1P1LA 2HFZA 2H4YB 2J0XA 5GADU 2OEMA 1H7XA 2CXEA 2BW2A 3MMCB 3OXFA 5IC4B 2HBQB 4K4XA 2ASJA 4DWIA 1RJJA 1UFWA 1YZ7A 3FZBA 3K8WA 4WE1B 3KLGB 1ZTTA 3FBBA 2NZCA 2VZ9A 5LSLA 5D0GA 3HO1A 1JMTA 1F5CA 1FO1A 1RTJB 2DT9A 3D66A 1JLBB 3GFHA 4ZPCA 4TU9A 3WC2A 4BWJA 2I1RA 4DF8A 2YX7A 3MAAB 3UI3A 3NCQA 4PUOA 2A2CA 1CJTB 1VRUA 2Q1LA 1NK4A 3ENWA 2W2PP 2C3YA 4BS2A 4LF7F 1KN6A 5C2GA 3H5XA 2M4MA 1A0OB 3W2VA 2J9DE 3EXYA 1NBEB 5J1EB 2RU3A 1WTBA 1SI9A 3MM7A 3QAEA 1KFSA 1RWOB 2ZBQA 3KLFA 2HHPA 1SQEA 2LYVA 4P10A 1KS2A 3H25A 4F4AA 3NGDA 3UD4P 2AZ3A 1XNRF 2QLBB 1S6PA 1G7CB 3GCXP 4ZVOB 2OPSB 4QIWD 1UEVA 1XMOF 3G86A 9RUBA 2DXDA 1JQGA 1FWLA 1PYTA 2BW7A 4F8RA 4H4KC 1RQ0A 2V8VA 2IYGA 4LSLB 3WIUA 1IBKF 3L9ZA 2AYMA 3FUYA 2MZRA 3CDAA 2VBYA 2VFRA 3KLFB 4WFBQ 2JEFA 1ULRA 3NBPA 1JKHB 1BD6A 3NS6A 3QLHA 5BYRA 4V19J 3IAM9 4ATNA 2EFOA 2XULA 2R2RA 3K2YA 3ZTRA 1F60B 2ABYA 5KG3A 1JLGB 1H72C 2EFVA 1SH3A 2FZGB 2O1PA 5CABA 2KVIA 3MURP 1B0VA 3CPWR 3PIPQ 4LREA 3D3CJ 3MMBA 2ZM6J 3SZ2A 5E2QA 2UVRA 2VL1A 3MEGA 4DFKA 3AXMA 5IWAF 3K5NA 3IS9A 3K7RA 2OPSA 1F2HA 1RTIB 4DPTA 3A3OB 1TZ0A 2QE5A 3U02A 2XO7A 3CCRS 4C11B 1H2UX 2DHSA 4YY3F 1VQYA 4CNZA 2RQKA 3CO9A 2BE2A 4DDFA 3BGUA 3PEHA 4IG3B 4JI1F 2CVIA 1PBAA 3KHRA 1YLXA 2D7SA 2XYPB 2GCFA 2M8HA 3PJWA 5G0RB 4ELUA 2J7WA 2Y0BB 3MM6B 2KVQE 1R6VA 2F9DA 3UR3C 5D0HA 3DU5A 1QUVA 3MMJA 3J81j 4C0HA 5KT3A 4ZLNA 2QO3A 1GMVA 1TV6A 2CQ4A 5EX0A 2Z2LA 3HM9A 1BQXA 1T0TV 2CAJA 1REVB 3HULA 3T1AA 3DXBA 4A46A 5IV3A 2B9EA 3A3NB 3VVTA 5L39A 5EDWA 2XLJA 1QVFR 3KK3A 3SI8A 1UVKA 5KTQA 4ZA1A 1WD6A 1BMQB 1NDCA 2V4JA 2VQFJ 2E7WA 4P52A 1WC6A 2F63A 1RYRA 4F0KA 5EWEA 4K4WA 3T1YJ 3DLKA 1HWIA 2QTWA 2OEJA 2CQBA 1S48A 3PO5A 5HL7Q 2GVDA 4FXVA 3SV4A 3FFIA 4ANCA 4KV8A 4N47A 4DUZF 3A13A 3LH2S 2LQ8A 2PT0A 2V2KA 2PDAA 2GJIA 2HFSA 3W2WA 5HROB 3P5BP 3UO0A 4OL8A 1SIZA 3CD5A 3H4BA 2RMLA 1S6OA 3Q2TC 1DFDA 3AHPA 1GMUA 3D1OA 3RB6A 5D6GA 2AP6A 2FHMA 3RBZA 2B6AA 2I5JA 1J5OB 1FJCA 4XPEA 1F5AA 2GHWA 1WOOA 1UFLA 3BJYA 1P27B 1AFIA 2AEJA 5AJ3J 2DR7A 4F50A 3WHIA 1UWBA 3QMQA 3CTRA 1P9YA 2BJ7A 3CVKA 5F8IA 5E3AA 1MMNA 1HNXJ 1ZOTA 3B82A 2B6AB 4M5MA 4Y00A 4DV3F 4JV5F 3JTPA 1M1HA 3UNGC 3WX4A 3JAMY 1HNVB 4B08A 4ZIWA 3OVAA 4EI2A 2KT5A 5J1PA 4KY3A 1SV5B 4F0MA 4DV3J 2BQ3A 4O3SA 3UFCX 2UXBF 4FF1A 4UY85 2CQ3A 2DRBA 2YTCA 2H65B 3UCUP 4DI6A 2YWWA 5L38A 2V4RA 4IOBA 2VPXB 1VDHA 1TL5A 1FRKA 3MEEA 2EPIA 2QG9B 4G6VB 4UW2A 1WF2A 3W61A 4DU7A 3G96A 4JI3F 2B43A 3MCNA 3R2CJ 2AJ2A 1VC0A 1X9SA 1VRQC 2IM3A 2MZTA 2OMLA 1T03B 5A2QU 3H59A 1JLQB 1GX6A 1NO8A 3FCWA 3DMJB 5A8KA 2MGZA 4ZVSB 2BDPA 3V5RA 1RZMA 5IT9U 2WZ1A 1J27A 4PXEA 4DCPB 1WC4A 1SJ1A 1FK9A 3PDNA 5HLFB 4O44B 3MOZA 3UE2A 4PG5A 4U8YA 1RA6A 2MB0B 5CH7B 1V5VA 2PFFB 2G2ZA 3SCKE 1HKAA 3GLJA 1RBLA 9ATCB 2YH1A 5KFDA 4X64F 2DNOA 2RS2A 1U2CA 4M95A 3SSSA 2CJ9A 3CDBA 4HDHA 4M5JA 1O51A 1WF1A 3CJ2A 2RRNA 1S1WA 1H2VZ 1IKVA 2V8HA 3D6MB 3GJQB 1N6QA 4LF4J 4LBPA 1TL1B 2W24A 2YNGA 3C6TA 2E29A 1CULA 2R8JA 3TX0A 1PJ5A 3I5BA 2CADA 1M5OC 2G1DA 1Q5YA 3TQEA 1I94J 2XLIA 3FSYA 3H98A 3MPVA 3BBBA 1MMDA 3R1HA 1U8WA 1S9FA 1SQGA 4MYTA 2KN4A 4DLEA 2UVVA 1FDAA 2XQCA 1WC0A 4F04B 4U67Q 1NSQA 1GEHA 3FQLA 2XSJB 2YNFB 4LFAF 1ZYQA 1V3ZA 1RAOA 2ACMA 3M8ZA 3JQKA 4J9VA 1RWKB 3CD7A 4L6V3 2R7QA 4OI3A 3QZ8A 3CUNA 5B0DA 1NB2A 2YNIB 3GSIA 2FIUA 2ZH9A 3F44A 3VQTA 4TYAA 4NLVA 4PQUB 1KLMA 2U1AA 3HHKA 1HI0P 2YKOA 1KKHA 3L4BC 3MPYA 5HAOA 3WDOA 2HK2A 3C14B 3QWPA 3U1MA 3KJNB 2XMTA 1WWHA 2FZKB 4PXCA 2BV3A 3HKWA 3TYTA 3W8GA 3RAXA 1Y00A 3DOMA 2AU0A 2BR0A 1CS4A 1N52B 4J9RA 1YJ9S 3S01A 4DV1J 4KT0C 3T1HJ 5IT9Y 4DL2A 1V5IB 1G1XA 1GXTA 4DJBA 2GVZA 3GILA 4ED8A 1H74A 1PILA 2HKEA 3JSMA 3ILOA 1C0UA 4X65F 4WP9A 3OT9A 2XY6A 1RWMB 3DOLB 3CD0A 2Y9HA 4DCOB 3OD2A 2GHVC 3CJSA 2MGZB 1YK9A 5IM0B 2QA4S 1FRXA 2FHJA 2CKWA 2YNIA 3TJ8A 2FJAB 2WSCC 1GXLA 3E01B 4DSEA 1QAXA 2DD8S 1X4DA 5IWAJ 4DSFA 2HS3A 1CPZA 4ZVEA 5J2QB 3TVYA 2KH9A 3L3CA 1GTEA 3DXSX 3GIIA 1QSLA 1ZETA 1UZHA 4NRUA 1HD1A 1PCAA 4PPZA 1NSKL 4PG7A 3SMZA 5CYQA 1R6YA 4AL5A 1F5BA 1EP4B 1WC3A 2D1CA 2YBVA 3IWLA 3POTB 3ZTSA 1ZPVA 1NK9A 4IFYB 1UCNA 2CPJA 1S1WB 2Q79A 2WOMA 4JV0A 3KK1A 1X9WA 2QMWA 3LGHA 1I6JA 4C4WA 1EETA 1PYOB 2FLLA 3GIMA 1GXUA 3OTOF 4ZS6A 4AXJA 4Z2XA 1WSVA 1FJGJ 3GU0A 2VBXA 2GGPA 1JLFA 2E1MC 2FDNA 2K3KA 2DO0A 3QAUA 4KPCA 1SC6A 1NDLA 3H4DA 4DR5J 3SFGA 2W2MP 5L9XA 2IRUA 3FEZA 3H2UB 1TK5A 3LF0A 3B4DA 2GX8A 1RBOB 2HEKA 2MQPA 4N5SA 1LW0B 5CYJA 4F3MA 4PRFA 1UVLA 4ZIVA 4B9LA 1RAAB 1AT1B 1CBKA 3R97A 2ZEJA 4AT1B 3Q8SB 3VAHA 5D8HB 1RSCA 1S1VB 3OFGA 3BDEA 2JEGA 4F4XA 5AE1A 2MLYA 2QRRA 3TWZA 1N88A 4JV1A 3HZEA 1XIQA 3ONQA 1NPRA 1BQMB 2FVCA 5DM6Q 3DGVA 2FTRA 2GVDB 2NSCA 3O5TB 3QFWA 5C7PA 3LWMA 4AE5A 2ERRA 1T03A 4KHPF 3NG8A 3I5AA 4IRCA 1KLNA 2CUYA 2XWXA 2YWEA 3L7OA 1NHKL 4LF2A 4G65A 5A6PA 4WPAA 3BDPA 2MZQA 4MIWA 3WIVA 1DARA 4ECRA 4FKYA 3B8HA 3C6UB 2PEBA 4A8FA 2CQGA 2ACYA 2DH7A 2VH7A 2Z58B 1VFJA 1TKXA 3QQCD 3TP2A 2ADCA 4OLOA 2FHKA 2XMKA 2C3UA 1X5SA 3BN4A 3M8WA 4DUTA 5FLXU 3Q8QB 1L3VA 4DG1A 1N8RT 4JYAF 4DR2J 1H7WA 4DZDA 3KLGA 1B7FA 4RW4A 4WWSA 4WKRA 1RHMB 4KGVB 4ZP8A 3TJ9A 1RWNB 3IWXA 1Q8IA 3GIRA 4OZ5A 5KFFA 5H9EK 1DQAA 2ASDA 4X65J 2GIQA 2MLZA 2HNDB 2XG8A 4KHRA 2DR6A 4QPXA 4IR9A 2FJVA 2FUG9 3T9NA 3HSZA 4I56A 3TA1A 4WXOA 1FWKA 4P2XA 3T5KA 2NPIA 1D09B 3PKYA 1OYEA 5LXRA 3OJSA 1VQ4S 2FC9A 3LTOA 3D1HA 4BC7A 5HVFA 3DDKA 4B3TF 2QA2A 1VC6A 2XHCA 5CCLA 2VHGA 2OH2A 4JI4F 3EVMA 1T9YA 2CQCA 2VC1A 4ZK7M 4AQYF 3DLLQ 1URNA 3P6YC 4F4WA 4CLKA 1KTQA 4Q5VA 3J7A1 1OY6A 3DRXA 3O1LA 3TUJC 2BACA 1FXLA 1LXNA 1HQUB 4ZN1A 2AJ4A 1DRZA 3HHNB 3OTBA 4DL7A 4CT9A 4DR4J 4I67A 3J7Z5 3CCQS 4A8MP 3G8TA 3D0HE 1JLCB 2OIHA 3NLCA 2XNRA 1Y5NB 3L09A 1QSSA 3MXHP 4MK7A 1Y3KA 4LBHA 4MIBA 4DV2J 4ECTA 4LF5F 4WZQA 1HQUA 4I6YA 2DXEA 2XY7A 3M8RA 1CQMA 1T11A 2C3OA 1GT8A 4ZHRB 2MHNA 4OX7A 1UL3A 1FERA 1D9FA 1T9WA 2W9AA 1K47A 4XK8C 1RT3A 3FBEA 4TU8A 3R5JB 3JAMU 3IS9B 4X4TA 4QOTA 1XMBA 1NRKA 4R25A 3W65A 1AZSB 3FQKA 1CG2A 3AQPA 2ZD1B 5IQ6A 1LWFB 2R7RA 1R8AA 5A2QY 1NDPA 4QYZK 4FPIA 2DCLA 2JLEA 1X4GA 4LSNB 2RJZA 2C22A 3WBZA 3FSXA 1GTHA 3GFZA 1VQSA 2FD2A 1NDKA 2RQ4A 3E2EA 1IQZA 2Q66A 1C0UB 3ETMA 5KT5A 1TAUA 4HVZA 5CYMB 1HBOA 1RLDA 2JLFA 2P9CA 4QIFA 3J7AN 3TUPA 3X1LB 4OV1A 4F25A 2XMWA 3CIZA 3EJMA 4RW8B 4C0OC 2ZBPA 2W9CA 1D8ZA 1S6QB 3KUEA 4PG6A 5F8NA 1OQ6A 5JVHQ 4JYAJ 1RT5B 1U1LA 3FMBA 1U0HA 1F9EB 2YQ0A 4U7CA 3A8JA 1UFKA 4ZVGA 3HVRA 1HNZJ 3D54A 2R7VA 1EJ7L 3CCJS 5KG0A 2RDDA 2V2ZA 4K4TA 3NCPA 5KT7A 4FP9A 2GAGC 1FNXH 2M3DA 4NE9C 3N01A 1QD1A 4ANEA 4TU7A 2BM1A 3HD1A 4BWMA 2CQ2A 1RU2A 2V2QA 3H0PA 1WUUA 2AYBA 1VJWA 2HK3A 3RW6A 1WG4A 3NEKA 2ZITA 2LQJA 2XC9A 4DV5F 4DR1J 3EXCX 1HHTP 3KTQA 4ERDA 2WB4A 1TK8A 2CNNB 3D5MA 2H1YA 4DFPA 2HHVA 3QBCA 2J76E 3VAKA 2ZJRQ 1VQPS 2MSSA 4HT7A 1VBYA 1A9NB 1IBMJ 5KT6A 1JLBA 4DR4F 2ADBA 1S97A 4OYXA 3NGSA 1FKAF 2GVZB 1HL6A 3SSRA 2ASLA 4QR2A 1NJZA 1Y3JA 2FYXA 1ZA1B 1CJKA 2RKIB 3QGGA 3RAQA 2D9OA 4RNFA 4ED1A 4J9LA 4RW9B 2MMYA 4JI6F 4UOGA 2GA7A 3EX7B 4AFFA 3RR7A 2UXBJ 1CJUB 2XY5A 1S9GA 4F26A 1VHIA 4ETXA 2DGUA 3UN2A 1UA0A 4JI2J 2PI5A 2UUTA 2HGLA 2E5IA 1RE1B 2XGQA 2HFOA 2P6TA 1AA1B 2HLUA 2XZDB 5I3UB 3F56A 4DR6J 1KQSR 1VQMS 2BXJA 5C42B 3PKMA 1PKUA 3EGNA 2CG8A 1DQ8A 4YDDB 4I68A 3K5MA 3WZ0A 3GWCA 1JLGA 2QA1A 3HVTA 1NCLA 2GFFA 4EFAC 1X31C 3KDNA 5IM0A 4DV4F 3THVA 4WU3A 2CRLA 4LQ3A 4DV0J 1ZS6A 1EZZB 1HBUB 1V6HA 1Y10A 1M5HA 2BA9A 4M1KA 4Z7CA 4ZCIA 4HR2A 3CEDA 5EGYA 3MR2A 1U4BA 4F7VA 4OYPA 4FNHA 4QWAA 4P7TA 3ILLA 3LPYA 1APSA 2G1HA 2DXFA 2PSZA 2FY1A 2V67A 3DHXA 1RWVB 3OLAA 2ZOGA 1EB0A 3DFEA 2KHDA 3MOJB 2DNMA 4ZP9A 3V6HA 3V4IB 1N54B 3I5CA 4YB5A 3BM7A 3C16A 3D3BJ 2ZH6A 4WBFA 2DY9A 3OR2B 4WXWA 5KG6A 2ZFHA 5BJRA 4TXSA 3W2VB 2AYGA 1OY9A 3AB2B 2BUNA 2X7IA 3DRPB 1S4EA 3MCMA 3G6ES 2VOOA 5F8GA 3KHGA 4USMA 4RW4B 4XDCA 4Y28C 1XTZA 4C2MA 4ZVRB 5GAGI 1NK5A 3HXMA 5J2QA 2DNPA 3OUYB 2GW8A 3IM8A 4C8ZA 4NYPA 2HVZA 1DBDA 1JJHA 1RTHB 1EQMA 4OZ3A 3MUVP 4CRJA 2CJYB 2XMUA 6FD1A 4DS5A 4TLRA 3UVJA 5DQHA 2ZHAA 2CWKA 2B3TB 3CDUA 1T3OA 3C6UA 4ZJQA 4PEOA 2LXFA 4YEAA 3HMJG 2J9EA 1RAGB 1TUVA
chains in the Genus database with same CATH topology
3ZNJ1 4LBPA 1S7IA 3ZNUA 3ZO7A 4LBHA 4LBIA 1MWQA 4FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNJ 1;  4LBP A;  1S7I A;  3ZNU A;  3ZO7 A;  4LBH A;  4LBI A;  1MWQ A;  4FPI A; 
#chains in the Genus database with same CATH topology
 3M32 A;  4ZP6 A;  3PR4 A;  1SH0 A;  2DB1 A;  2LCW A;  4CDI A;  1T8E A;  1NSA A;  3GJT B;  4FXW A;  4KE5 A;  4YDX A;  3ZTO A;  1GNK A;  1LWE B;  4ZIT A;  4ECY A;  1KD1 T;  4FYY B;  4RL1 A;  2E7X A;  3TA2 A;  2IC3 B;  3BBF A;  3GV8 B;  3PW2 A;  4LFB J;  2G0I A;  2VOP A;  4PZV A;  1IQT A;  1DLO A;  1GH8 A;  1X4B A;  3PY8 A;  3PM9 A;  1AFJ A;  4I4B A;  4NLX A;  5FLX Y;  2W2N P;  4B9S A;  4KPY A;  2UXC J;  2AZ1 A;  4DV1 F;  3OXG A;  2ZOM A;  3OVS A;  5KFZ A;  2J6U A;  3LP0 A;  5JMN A;  3P3D A;  1Y11 A;  2ZE2 A;  3GIK A;  1M1K T;  3VV2 B;  2WTF A;  2PD1 A;  1RIS A;  1VBZ A;  1WHV A;  2APO A;  2B4U A;  4CQ1 A;  2PMZ D;  5CYM A;  4RUA A;  1FNO A;  1K44 A;  2VFT A;  5DZ7 A;  4YB7 A;  3CUL A;  1IR2 A;  4NXN F;  1HAR A;  2E1A A;  3HDS A;  2BE2 B;  4WTY A;  2ZM6 F;  3PW0 A;  1W2B R;  4KB7 A;  4DR6 F;  2G2O A;  1U1K A;  1JK9 B;  1K9M T;  4LRF A;  2ZZN A;  4HAC B;  5I3U A;  1SKR A;  4N56 A;  4NAS A;  2HQG A;  4NEZ A;  2UUA J;  2KFZ A;  1R8P A;  4OX8 A;  4WFZ A;  2BJ9 A;  4MFB A;  5F0W A;  3UPF A;  2P9E A;  3U27 A;  3VQS A;  1RCO B;  2CDQ A;  3LP2 A;  3BN7 A;  3LAN A;  5HI7 A;  5L1I A;  2ROG A;  3H7H B;  3H90 A;  4QQB A;  3AA9 A;  2V8G A;  3QJJ A;  1EET B;  4O0I A;  4RW6 A;  1X4C A;  5B0G A;  2CJB A;  5J2M B;  1R0B G;  2XS7 A;  2V68 A;  1TL3 A;  4L72 B;  3EGV A;  5LOQ A;  4UOC A;  2V94 A;  1BGX T;  1MRO A;  5KFY A;  3ZZZ A;  4OHV A;  1RTD B;  1VC5 A;  4B9V A;  5AXN A;  4M94 A;  1NAQ A;  5DJB A;  4X4Q A;  4J9Q A;  4DR5 F;  3KFW X;  1IJE B;  4I2P A;  1VQ9 S;  1YG0 A;  3I0S B;  4U8V A;  3ETO A;  4Y2A A;  4CLW A;  4ETZ A;  1QUP A;  2C3M A;  5A8R A;  4BBY A;  3K5L A;  1C1C A;  2EBG A;  2VFS A;  3AY0 A;  4CTA B;  2OPR A;  4P2F A;  1T95 A;  5D4P A;  5HRO A;  2EW9 A;  1YBT A;  1YRU A;  3IBF B;  5THW A;  2L08 A;  4P6Q A;  5LSR A;  4LF8 J;  1DUR A;  1RT7 A;  3OHA A;  4NLS A;  2Z4P A;  2KT2 A;  3P4U B;  1VIX A;  4OYO A;  3PX4 A;  1MG7 A;  4IG3 A;  3ZNU A;  1BLU A;  1S4F A;  1VLY A;  2JRS A;  1Q86 T;  2KZZ A;  5KG4 A;  3JYT A;  2FJE B;  1FX2 A;  1PAU B;  3KXD A;  3O2I A;  1U2F A;  1IXK A;  1NLK L;  5B0E A;  5DM7 Q;  3IXQ A;  4CLY A;  2DGO A;  3KG1 A;  2BQU A;  2QLW A;  2ZBC A;  4IG0 A;  4C9D A;  3M32 B;  5F9N A;  2HZC A;  2EEY A;  1U25 A;  4A8K A;  1Z2Z A;  2B51 A;  2X1B A;  4LF9 J;  3Q8Y A;  5IV4 A;  5C42 A;  1WG1 A;  4DQQ A;  1VI7 A;  1ITP A;  2DGX A;  3BO4 A;  1HNX F;  4YFU A;  2ZH5 A;  3FSI A;  1F9F A;  3CSK A;  1RUS A;  2OPQ A;  3BO2 A;  3R2D J;  2MPU A;  3FVY A;  3C3L A;  2HVE A;  4OJ3 A;  2MDA A;  2O3D A;  3M1V B;  1NSP A;  4PWU A;  2AYE A;  4AND A;  2IVF B;  4DR7 F;  2KG1 A;  4EWT A;  2FGC A;  1HW8 A;  4ECS A;  3CJ3 A;  1WC1 A;  4LVN P;  2NZ4 A;  2J9C A;  4IFV B;  3SBM A;  4LFC F;  4DSJ A;  1W2I A;  3DCA A;  1HBM A;  4TQS A;  2EKY A;  5JJB A;  4DL5 A;  2A3J A;  2EFG A;  1YJ7 A;  3ULH A;  3SQG B;  3QIP B;  4V1A k;  5ETT A;  3LWL A;  4USW A;  2HSE B;  1RLC L;  1FNM A;  2L9N A;  2ZC4 A;  5AXM A;  2GIR A;  1DTT A;  2XNQ A;  1S1X A;  3I0R B;  2FLO A;  3ILI A;  4HDG A;  4CO1 A;  3J81 Y;  3OL7 A;  3RRH A;  3D6F B;  4UUX A;  2CIM A;  1G3O A;  2KRR A;  2XMJ A;  5I4M A;  5BR8 F;  5K8O A;  2M52 A;  4X4P A;  1SKS A;  2G4B A;  5ETQ A;  3Q8R B;  4RW8 A;  2DNL A;  1N32 J;  1RAC B;  3D67 A;  2F4F A;  4JB8 B;  3RU0 A;  1B70 B;  3KJQ B;  1WHY A;  2DNR A;  1HLW A;  3MAA A;  3UW1 A;  5B0B A;  2B9X A;  2V8P A;  1B3T A;  3G8S A;  2NYI A;  3UD3 P;  1FEH A;  2JFD A;  1AXQ A;  4ED3 A;  1RT6 A;  2C2O B;  4P2M A;  3M6U A;  2C28 A;  4KC5 A;  3LQV A;  2R8K A;  2R7U A;  2KT3 A;  1DTQ A;  2RAQ A;  3N6L A;  4MKA A;  1EP4 A;  4IFV A;  4NLT A;  2EFQ A;  1I5O B;  4RKU C;  3RTV A;  4LJM A;  5KFX A;  5MAO A;  2ZC3 A;  4NI2 B;  2X1G A;  3H5S A;  3IAS 9;  4RNH A;  3I56 S;  5DLG A;  1HYS B;  3BYR A;  4HTJ A;  3VAI A;  3LAL A;  1PG5 B;  3MGJ A;  4WKY A;  1N36 J;  5HO4 A;  2QA4 G;  3SYZ A;  1HNZ F;  2VF3 A;  3VAF A;  1FJG F;  5K9F A;  2JEJ A;  2D41 A;  5HMY A;  2EKN A;  3PR5 B;  4IOC Q;  1L5U A;  3DKD A;  1LQ9 A;  1OSD A;  3HLU A;  2IAJ B;  2HG4 A;  2MQN A;  1X60 A;  3DI6 A;  1RAB B;  4LUB A;  2VC0 A;  5M2R A;  4DN0 A;  5HMZ A;  3L95 X;  5SUH A;  1NM2 A;  3MTK A;  1OPI A;  1SV5 A;  3W64 A;  5GAH U;  4RNN A;  2D74 B;  2MJU A;  2QMU B;  1ZM9 A;  2OFG X;  1NHV A;  2ZE2 B;  2FVR A;  4R0E A;  2FLP A;  4DR1 F;  3NNA A;  3Q8U A;  3KHH A;  1X9M A;  2KM8 B;  1CS4 B;  2JX2 A;  3IR6 B;  1TKZ B;  4NLO A;  2D3O 1;  3K89 A;  3A1Y G;  4Z37 A;  3KWM A;  1XER A;  2DHH A;  2KYZ A;  3CCV S;  3N5F A;  1S6P B;  4KV8 B;  1B99 A;  4PXD A;  2M9K A;  3GE9 A;  4QWD A;  1IBM F;  4YME A;  5AXL A;  3W5Z A;  1X5P A;  3W9H A;  2QZ8 A;  2D3O R;  3TAN A;  4M8L A;  1UJ6 A;  2I6W A;  1RYS A;  4MYU A;  1FCA A;  2W7O A;  1CQN A;  2R7O A;  3A8E A;  2CQ1 A;  4ZLL A;  1FI4 A;  2FHJ D;  4A8X A;  4CM2 A;  1PGZ A;  3ISN C;  2YKA A;  4YR2 A;  2DNK A;  3AD8 C;  3SSQ A;  1AB8 A;  2GAH C;  2C2N A;  4XPC A;  4UZB A;  2ZH8 A;  4BCA A;  2QT7 A;  4HEA 9;  4L76 A;  3DOK A;  2BJ3 A;  2XBP A;  4O23 A;  3P49 B;  5G4D A;  1YTY A;  4QWC A;  1RTJ A;  3CC4 S;  4FDF A;  5D3G A;  2WVE A;  2J5A A;  4KFB A;  1XR6 A;  2DEI A;  2IVM A;  3DM2 B;  3LAM A;  4NRT A;  3B54 A;  3TW0 A;  2AX0 A;  3CJQ A;  3N0V A;  4KKO A;  4C6A A;  5HVH A;  2DGV A;  3FRZ A;  4UY8 T;  1UP1 A;  4OHX A;  4LIW A;  2W9B A;  4MK9 A;  2Y1J A;  2AW0 A;  4NLU A;  1Q0N A;  2WSE C;  2HHH F;  2WCX A;  4G1I A;  3PXG a;  3SDE A;  3MR6 A;  3U7J A;  2GV1 A;  4RBT A;  1M5V C;  1B0T A;  3HCX A;  3IGN A;  3W63 A;  2J8A A;  1HNW J;  4MIA A;  4JI7 J;  2HHU A;  3VF0 B;  4U6P A;  2BRK A;  1NPP A;  4WFN Q;  2IIH A;  1HNW F;  4EEY A;  3TI0 A;  4B3S J;  1YIJ S;  1P6T A;  3M8Y A;  3MEC B;  3EDR B;  4W92 B;  3VGU A;  4Y3C A;  2OSR A;  4LF1 A;  1F1B B;  2RH3 A;  1U26 A;  2UXD F;  2EK6 A;  2WON A;  1LW2 B;  4Y2K A;  5IFM A;  4DMZ A;  3D2W A;  2UUC F;  3DM2 A;  2LP4 A;  4M5D A;  4RO0 A;  1N4L A;  1FFG B;  2HAF A;  1T9T A;  3CB4 A;  1YJW S;  4CLS A;  2FJB B;  1SKW A;  5EWG A;  1IKY B;  3TA0 A;  4KKO B;  3BF4 A;  1K73 T;  3C15 A;  2QX0 A;  1S1U B;  3M8Q A;  4HHH A;  2BRL A;  3LGN A;  2LXU A;  4PQA A;  4B3R F;  4JI8 J;  1J5O A;  1OPZ A;  2ZUG A;  5F3Z A;  1VBX A;  3C66 A;  3CDE A;  4LFA J;  1NK0 A;  1SCJ B;  2JNJ A;  2B8Q A;  2J9D A;  3IP0 A;  1AUD A;  4USV A;  3RRG A;  1S10 A;  1VRT A;  1K1S A;  1LOU A;  1EQ0 A;  4YOE A;  4XO0 A;  5HN0 A;  4FN5 A;  3M2V B;  4TYB A;  5HSP A;  2NPF A;  2PN6 A;  4RU9 A;  1JJ4 A;  1RT1 B;  4B3O A;  1IBL J;  3M9O B;  1HI8 A;  4X62 F;  2VQE J;  4KBI A;  4RX6 A;  3TZY A;  2GML A;  3QSI A;  1NU4 A;  1HBM B;  2AJ1 A;  2RIJ A;  3MF5 A;  4ALZ A;  4FVM A;  3AXK A;  2J0S D;  4J9O A;  4DU8 A;  2HIY A;  1TL7 B;  1W7W A;  4QWE A;  1RAH B;  4DPY A;  4ES3 A;  5A76 A;  2W4P A;  2WW4 A;  2HAI A;  4NCG B;  3MD3 A;  5KG5 A;  4IUF A;  3HFK A;  4DX7 A;  1FRJ A;  4MH8 A;  3N6M A;  1KHV A;  2B4O A;  3HJV A;  4QR0 A;  3Q86 A;  3HHL C;  4ZVF A;  3MMA B;  3RYL A;  3RBD A;  3LPE A;  1QLN A;  2DEJ A;  1X4A A;  2YVS A;  4F0H A;  1Y5I B;  2J7U A;  3MTJ A;  2BKO A;  2FHO B;  4F4Z A;  3L7P A;  1NK7 A;  1CJT A;  1VRU B;  2XEX A;  1KSP A;  3DYA A;  4DPW A;  4CLF A;  1OMS A;  4P7V A;  2ILY A;  2OI2 A;  2KG0 A;  3F73 A;  2YWK A;  1D3W A;  1UEK A;  4C3M A;  4H4O B;  2KDO A;  2OO4 A;  2J0W A;  4OX6 A;  4ENO A;  2L9D A;  4ED7 A;  1Q16 B;  4WIQ A;  5DQG A;  1H6K X;  4WK1 A;  1IR1 A;  2F8E X;  3N4W A;  4X4U A;  4NLW A;  2QYG A;  1S6Q A;  5LJ3 Y;  3QZ7 A;  4OI0 A;  5CAA A;  2HHS A;  3UDV A;  1U45 A;  4C8Y A;  5CD4 H;  1UTA A;  2GMH A;  4GVB A;  1SUQ B;  1NH7 A;  4ZJL A;  3CF5 Q;  2KJV A;  4DX6 A;  2MZJ A;  3ZZO A;  5AE2 A;  3I9V 9;  4CM0 A;  5KOW A;  3MWB A;  4J9S A;  1DHM A;  3GFX A;  3HPO A;  2DNG A;  1TKZ A;  3ITH B;  5D0R A;  2VPZ B;  3PFE A;  3HSD A;  2R8I A;  1HNI A;  1S49 A;  4EO6 A;  3ENV A;  2MY7 A;  2ZJP Q;  1TKD A;  2XTJ P;  1JLE B;  1UWA A;  2HW3 A;  1EAY C;  1O8B A;  4DCJ B;  4DUY J;  1G2E A;  5MLC V;  4C48 A;  1TEL A;  1U47 A;  2X3G A;  1DJ0 A;  3MEE B;  4M5I A;  4JI0 J;  4TY8 B;  4HTI A;  3HVA A;  5BYQ A;  1B64 A;  1RGV A;  6FDR A;  1B7Y B;  3FZ2 A;  4WII A;  4F2R A;  2MKY A;  2WAQ D;  1Q79 A;  5K5M A;  4JI3 J;  1MSW D;  4NWB A;  4UZC A;  4LRC A;  4M5L A;  4LRB A;  5DG8 A;  4Q44 A;  2VQF F;  1UW9 A;  4QZV B;  2CYY A;  4NLR A;  1OQ3 A;  4PWD B;  4DPX A;  4ECQ A;  1O6X A;  2P8I A;  3NCR A;  5KFJ A;  2LVW A;  1K0V A;  2ZH4 A;  4NA3 A;  2VJU A;  3NMA A;  5KT2 A;  4DV7 J;  4J37 A;  5K20 B;  4YY3 J;  2R7T A;  2HND A;  2UV8 A;  2QSW A;  3EZ5 A;  4U7U D;  4OQJ A;  1S59 A;  3BGO P;  4DZ6 A;  3EGW B;  2RUG A;  2AJ0 A;  3FCV A;  3TAM B;  3KLE A;  3NAH A;  4KR0 B;  2HPU A;  3BRE A;  3DDN A;  1U2R A;  4HHJ A;  1LFP A;  1VQN S;  2ZBR A;  3P45 B;  3QGH A;  2IFX A;  4O44 A;  2W25 A;  2ZWO A;  4NLD A;  3THT A;  3M4X A;  2HNZ A;  1MLA A;  1NZ8 A;  4J9M A;  4DQP A;  1M5K C;  2BEF A;  3K5P A;  2MYF A;  2BQR A;  3G9C A;  2R4F A;  3N28 A;  2KFN A;  1H0H B;  4KGZ B;  5F41 A;  3R7B B;  5D4N A;  8RUC A;  4P72 A;  4DL3 A;  3T1H F;  3LGM A;  5CA5 A;  3MM7 B;  2DGQ A;  4HKQ A;  2O66 A;  4GO7 X;  3SFU A;  1XMQ J;  1SJ4 P;  4C8O A;  1YJR A;  4DL6 A;  1WEX A;  2NXC A;  4NA1 A;  2EC2 A;  5L9N A;  2AD9 A;  3DGP B;  3NNC A;  3CJR A;  4ICL A;  4X4V A;  3DYA B;  1W26 A;  1RT2 B;  2COL A;  1YWX A;  3KLI B;  1Q7L B;  2FLN A;  2GJ2 A;  5L8R C;  3CJ0 A;  2MQO A;  1HA1 A;  1LEO A;  3T5H A;  5H9F K;  3R9L A;  4URS A;  1IKW A;  3LO3 A;  1ZM3 A;  3QNW B;  1QJH A;  1ZBT A;  4QW8 A;  1T9X A;  1SC1 B;  2PEH A;  2G0C A;  1OSC A;  4N77 A;  2PII A;  1LW0 A;  1WAC A;  1RTH A;  1WI8 A;  3MMC A;  3PHE A;  4KAI A;  1YSJ A;  1DY3 A;  2JH3 A;  4U95 A;  1XMO J;  4IRD A;  2OKQ A;  3MM9 B;  1S9G B;  3W2W B;  2FZC B;  4WP8 A;  3IC1 A;  3M8P B;  4H54 A;  2N7Y A;  4O4G A;  2CQH A;  1RHK B;  1RT4 A;  2PFD A;  4RUH A;  3J7Z T;  4XTT A;  2HFN A;  5AE3 A;  3CGI A;  3SDE B;  5HAN A;  3ZZP A;  2GJF A;  1U6Z A;  1PIE A;  1FFS B;  2H48 B;  1RHU B;  2E1R A;  5LSO A;  1NPK A;  1PC5 A;  2CPD A;  5CCM A;  1PJ6 A;  4DFJ A;  2UXD J;  4I6A A;  1VIS A;  2F3J A;  2YY3 A;  3QGI A;  2KB2 A;  3MEK A;  4G1Q A;  4O4G B;  2YQ1 A;  5GMK a;  3AAW B;  3ET6 A;  5HQM A;  1QDU B;  2EG1 A;  1RT5 A;  2FPH X;  2QYC A;  3BEG B;  3DRS A;  2EWH A;  5A8W B;  2LEB A;  2D3Z A;  3ELH A;  3SQO P;  1A7G E;  3IMQ J;  2PO4 A;  2IRX A;  3I0R A;  4QU6 A;  4MAK A;  3TZW A;  3TAM A;  3DMJ A;  2C2E A;  2R7S A;  2ZNZ A;  2CNO B;  3CMQ A;  5A0Y A;  3CME S;  4CLU A;  2ZH7 A;  3QRP A;  1OJ4 A;  3GZ7 A;  4E8U A;  2UVW A;  4GKJ F;  2PGC A;  4LR8 A;  2DRD A;  4Y6I A;  3MDF A;  3W60 A;  3KMS A;  1RU1 A;  3IN5 A;  4UOF A;  2VIH A;  4DL4 A;  1VQL S;  1SUQ A;  4G3I A;  1KTV A;  4FYV B;  2HGM A;  1JLF B;  3OBI A;  4IH7 A;  4EK2 A;  1WEL A;  3QSY B;  2XYH B;  3NMR A;  1CJK B;  3HI9 A;  5F8M A;  1ICE B;  4IR1 A;  5C24 A;  5HP1 A;  2DGW A;  3DOM B;  5ETL A;  1AZS A;  2RDI A;  2IBK A;  2XMA A;  4IFY A;  3J7Y I;  3CXC R;  2OTL S;  3KYL A;  2KXH A;  3W5Y A;  1FE0 A;  3I82 A;  1HYS A;  2MKI A;  4Q2L A;  4NML A;  2HQC A;  4JI5 F;  1UKU A;  5DRK A;  2OMO A;  2RQC A;  2R2U A;  4TY9 A;  4X2B A;  3M6V A;  3RG6 A;  4YB6 A;  4OI6 A;  3M7V A;  5KG1 A;  4I0W A;  1J2V A;  5J1E A;  1F3V A;  4OYA A;  1IKW B;  1D8Y A;  4FF2 A;  3C8Y A;  4IH6 A;  5ETR A;  4Y2C A;  3M8S A;  2VA2 A;  2E9Z A;  2KO1 A;  4BDP A;  2JEI A;  4PR6 A;  3QT5 A;  2HLT A;  1JLA B;  2RF2 A;  1U1P A;  4DSK A;  3IWN C;  2XSJ A;  2IM1 A;  2YNF A;  1JLC A;  3EZU A;  4U96 A;  1SVD A;  2PMH A;  4IO1 A;  4YR0 A;  1R89 A;  4EO8 A;  4F4Y A;  4DUZ J;  2AX1 A;  2L48 A;  1H98 A;  3T41 A;  1MWZ A;  2K3I A;  5T14 A;  3ZFV A;  4J9K A;  1U8S A;  3SV3 A;  5KFT A;  3EDQ B;  5SZT A;  5L1K A;  3VR1 A;  1TKX B;  2VD3 A;  4B3T J;  3OR1 B;  2YWF A;  4CLT A;  1HFE L;  2LMI A;  1KVJ A;  1KLM B;  3MAQ A;  3NWR A;  4M5H A;  3BQ1 A;  2UUC J;  1ACM B;  3MED A;  2FY8 A;  1Q7Y T;  1ZZF A;  3C16 B;  1N34 J;  5DDQ C;  1Y4Z B;  2GQC A;  2NXU A;  1UA1 A;  1RXO B;  1KRP A;  2F65 A;  1FFW B;  4JI5 J;  2NUU G;  4ILM A;  1VQ8 S;  3NOC A;  2WRM A;  5I3Q A;  5KFP A;  1OWX A;  2BOP A;  1OO0 B;  5CZX A;  3DLK B;  2CNL B;  1LK7 A;  1T9V A;  4N8O A;  4NL5 A;  4P73 A;  4C8M A;  5B08 A;  4DUY F;  1VLO A;  1IKY A;  1YRT A;  2V69 A;  2YKP A;  1TFW A;  5A8W A;  4MKB A;  2M5Y A;  2W4C A;  1MWQ A;  4UF4 A;  1M1G A;  2HZV A;  2CA9 A;  2V9W A;  2QL9 B;  3OFF A;  4C8N A;  1YHQ S;  1UZD A;  3MPU B;  4M5N A;  4IH5 A;  4R5P A;  1NK8 A;  3SCJ E;  4GKK F;  2PC6 A;  2XO6 A;  2JLG A;  5HBM B;  2AF6 A;  2CVE A;  2OPP A;  3DRY A;  7FDR A;  4KJI A;  1VQ7 S;  4Q8E A;  5J2P B;  4UOH A;  3IFE A;  2AEM A;  1MNE A;  1Q53 A;  2JZ5 A;  2MQL A;  2WW8 A;  3K58 A;  5KFU A;  4RW6 B;  3TUI C;  1WNE A;  4B3R J;  1K1Q A;  1JX4 A;  1NHU A;  1RT3 B;  2GHP A;  4C3L A;  4FS2 A;  5G0R A;  2KZM A;  2HRY A;  1AUS L;  1FRI A;  5T41 A;  5KFV A;  4DV0 F;  3MFH A;  4PPD A;  2HQ3 A;  2Z57 B;  1RCX B;  2BJE A;  4NXM F;  3W8P A;  1WEY A;  2WOM B;  3KK1 B;  1L3S A;  4XIU A;  4FPR A;  1N32 F;  3CNQ P;  1FEE A;  3CCZ A;  1G4C A;  1HNV A;  5KFL A;  3TRG A;  5ETN A;  4CP5 A;  3VAJ A;  1CLF A;  1RTI A;  4IQX A;  2ATL A;  2AMC B;  2B9Y A;  2GQQ A;  3LP0 B;  5F0U A;  1S76 D;  2MZS A;  8AT1 B;  3O6Q A;  4CTA A;  2B7C B;  2C1E B;  4B9N A;  1VQ5 S;  1S0N A;  2B4P A;  4ELT A;  4ZPT R;  5A6W A;  3G6Y A;  2OFH X;  2AQ4 A;  3KOA A;  3B78 A;  1KQG B;  2K06 A;  3K17 A;  3I87 A;  2HQD A;  3PYF A;  2KJW A;  2XI3 A;  3IO1 A;  3PW4 A;  2LFV A;  3PIO Q;  2LQB A;  2IC3 A;  1S9E B;  1RDR A;  2MTL A;  5E3Q A;  3WC0 A;  2GO8 A;  3R5C A;  4DHV A;  2EC0 A;  1KVK A;  4OZ2 A;  2CJA A;  2HYI B;  2A1B A;  1FF2 A;  5CXT A;  4NYO A;  3S7R A;  2VFU A;  3BYP A;  1SC4 B;  1ZPW X;  2VOD A;  1SL0 A;  3GYX B;  4O3O A;  1EIY B;  3Q83 A;  3GMG A;  1BY9 A;  2CJQ A;  4A8Q A;  1BQM A;  2YNH B;  3DGP A;  3MFI A;  3DLH A;  2F1F A;  2FB0 A;  5C2C A;  2MST A;  2R42 A;  1VR6 A;  1Q5V A;  2CQD A;  3NRB A;  5AT1 B;  2YKQ A;  2R8H A;  3BQ2 A;  5LMN J;  2UUB F;  1PO6 A;  1PSD A;  1X4E A;  1YVF A;  3JS9 A;  5F3T A;  3GON A;  1PJ7 A;  2W9C B;  2LQ9 A;  4HAC A;  1MU2 A;  4IKA A;  2RDJ A;  3MPD A;  4PUO B;  2DH8 A;  3BV8 A;  4M63 A;  5HMX A;  2CDR B;  1HPZ A;  3KG4 A;  4ZVT B;  3HK2 A;  5ETK A;  3HT3 A;  1MW7 A;  1VJQ A;  1I3O B;  2Q43 A;  3I96 A;  3TZZ A;  3ZO7 A;  4P71 A;  1RTZ A;  3CMA S;  2F8H A;  3EWG A;  3JTN A;  1TKT A;  4X4R A;  1N48 A;  2JVR A;  2H4W B;  2YKN B;  2HVI A;  2FC8 A;  4CH7 A;  2CPI A;  3H5U A;  5J2N A;  1MN7 A;  1Q81 T;  4JP8 A;  2MKC A;  4S0M A;  3NNH A;  4MT1 A;  2UV8 G;  4DN9 A;  4I2Q B;  5KFR A;  2HGN A;  2VIC A;  2AJF E;  4F36 A;  3RGI A;  4R8U B;  3O3L A;  1X8D A;  1FD2 A;  2VFV A;  1LWF A;  1ZH5 A;  4PYA A;  2Q6C A;  3BO3 A;  1S99 A;  2UUA F;  1TV6 B;  5A8R B;  2LDI A;  2GMJ A;  3BH6 B;  3N5B A;  1S5Z A;  2AGQ A;  3V81 B;  2VKR A;  3QRQ A;  2V4J B;  3CC2 S;  4KIA A;  1IWA A;  2ASY A;  3M30 B;  2ZUA A;  4NLY A;  3RJM B;  1OS5 A;  4CT8 A;  3RZA A;  4YUD A;  3KK3 B;  2OSQ A;  2CPF A;  1DTQ B;  1HBO B;  4WFX A;  3V81 A;  1VQ6 S;  4CI0 B;  3DU6 A;  1S57 A;  1BHN A;  5DZ6 A;  4Y65 A;  4OMF G;  1ZAW A;  2VPW B;  3NY0 A;  4KSE B;  4QR1 A;  5E3C A;  3T19 A;  4OI4 A;  1VBK A;  4N41 A;  5J2M A;  3OFE A;  2BE7 D;  1QM9 A;  2DK2 A;  1NND A;  3D9B A;  3D28 A;  3GR1 A;  3BGF A;  3NS7 B;  5GAE I;  3ZC4 A;  3M30 A;  3IR5 B;  3R6L B;  1RWX B;  4UTG A;  1MRO B;  4YHH F;  5BXI A;  2DNY A;  3C46 A;  5ETP A;  5LL6 d;  2XB2 D;  4OHY A;  3OJU A;  2YWH A;  1WG5 A;  3ZTQ A;  3GCW P;  3TUZ C;  3T5L A;  1RKJ A;  3OVB A;  2ZZT A;  2GZO A;  2H51 B;  1NKC A;  5ETM A;  4KTQ A;  2DKO B;  3PJX A;  3D6H B;  3QIP A;  5D15 A;  1LWE A;  4IDK A;  2VG7 A;  4URQ U;  4CIO A;  1T05 A;  3K0J A;  4EMD A;  2NYH A;  3CT9 A;  3KJV B;  3TEH B;  5F8J A;  4L74 A;  2LEC A;  2E5J A;  2J0Q D;  5CYQ B;  3ZZY A;  5HBM A;  5HK4 A;  1YJV A;  2VUG A;  1YI2 S;  2A6M A;  3HJF A;  3Q89 A;  5E3R A;  1FRL A;  3GV5 B;  4DR3 J;  4AD6 A;  1S0V A;  1MN9 A;  2RHQ B;  1WJ9 A;  1X4H A;  3CC7 S;  1XR5 A;  1WHX A;  2RF2 B;  3MZI A;  4PG4 A;  1SJ3 P;  4GC7 A;  3EE3 A;  3EMT A;  4G1P A;  4DG1 B;  3D0G E;  5LXY A;  1HBN A;  3RRK A;  2VJV A;  3ILJ A;  5EUH A;  4IG0 B;  4LF6 F;  5KFW A;  1HQE A;  3ENQ A;  3NGR A;  4ED6 A;  2C2Z B;  2R7X A;  3BS9 A;  2NXJ A;  5DG7 A;  3HT0 A;  1S7I A;  3MCO A;  3M2V A;  2F40 A;  4OYZ A;  7FD1 A;  4LFB F;  2HRU A;  1FES A;  4X4O A;  1R8B A;  1U0H B;  2QL5 B;  3IA0 A;  2QN6 B;  2XCP A;  1TVR B;  4A8S A;  2QFI A;  1R0A A;  1Z4U A;  5C24 B;  2CQP A;  1SIW B;  2UZA A;  2UXC F;  3AJD A;  3W62 A;  1WOR A;  2ZH2 A;  1RA7 A;  4PQU A;  1YBU A;  2GO9 A;  1JLA A;  2XMM A;  4PG8 A;  3M1V A;  2LDY A;  4WP3 A;  3CCM S;  3QID A;  3TAR A;  2ZH3 A;  1XMQ F;  1QAJ A;  1F3F A;  4C0B A;  3MHY A;  3P8B B;  4CO3 A;  3MR5 A;  3TAQ A;  3BPS P;  3BZQ A;  2L3M A;  2C2D A;  1FDB A;  2EXU A;  5U47 A;  3CE8 A;  2PMW A;  3PYG A;  2KL8 A;  3BGR A;  4I69 A;  4CH1 A;  3RR8 A;  1S6U A;  2B0G A;  1KQK A;  1BWE A;  3HVT B;  2HNY A;  1JXL A;  5GME A;  1NZA A;  1TL7 A;  3BBC A;  3ZNJ 1;  3K5O A;  3OUY A;  4KRW A;  2Y1L B;  3NGT A;  5EHH A;  4OZ1 A;  5LMU J;  4WTO B;  3SXL A;  3IBW A;  3EPI A;  1U24 A;  2EFP A;  4I7F B;  1S1X B;  2BM0 A;  3Q22 A;  2QEX S;  3MM6 A;  4ZPV R;  5HP1 B;  1BE4 A;  2C2M B;  1QY7 A;  3TEG A;  1ZAV A;  3KLE B;  1GX5 A;  3Q24 A;  3C2P A;  4OZN A;  2R7W A;  2V8D A;  2FJX A;  1EX8 A;  2CFX A;  1F6T A;  1XR7 A;  1VYA A;  4HLB A;  1GAO A;  2CPE A;  4JV5 J;  3M6X A;  1WHW A;  4A48 A;  3A8K A;  3D1Q A;  2CJX B;  3KLV A;  2W1B A;  2K2P A;  2AGP A;  4NLQ A;  1TUG B;  2RKI A;  4NZ6 A;  2OD4 A;  2AIR B;  3C15 B;  1KQF B;  4R5P B;  4ED2 A;  1W25 A;  4BHQ A;  1TL4 A;  2YX4 A;  1X5T A;  3VWS A;  3FEY B;  5C25 B;  2HMI A;  4MKY A;  5D78 A;  3G82 B;  3EVO A;  5HLF A;  2B5J B;  2QL7 B;  2HNY B;  3AJ2 A;  3NBP B;  2IBO A;  4I2P B;  1S1T A;  4QU7 A;  2OAU A;  4UT4 A;  1ZA2 B;  3HKZ D;  1I94 F;  4RNO A;  2W01 A;  2YPY A;  4I7F A;  4GVL A;  4K7Q A;  2C2R A;  3UNY A;  4FYW B;  2HHT A;  4LF8 F;  3LOU A;  4PCQ A;  1J5E F;  3ZZU A;  3G87 A;  4ID8 A;  5E41 A;  1JWW A;  3NAI A;  4GRS A;  5B0A A;  4AXI A;  2O5D A;  4Q0B B;  2CWX A;  1FJ7 A;  3TOQ A;  4DX8 H;  8ATC B;  3M2U A;  5KFQ A;  4K4S A;  4BLG A;  1F9H A;  5B0F A;  4P75 A;  1YZ6 A;  1NJI T;  4I2Q A;  2HQF A;  3CJ4 A;  3QJP A;  1JXE A;  1N5V A;  2Z2M A;  2HQI A;  3JQJ A;  4K4Y A;  1M0S A;  1F2G A;  2YKM B;  2WVF A;  3PTW A;  3U1L A;  1FXR A;  1HMV B;  3HX9 A;  1RT4 B;  5BYS A;  2N3O A;  4X62 J;  2VQE F;  2K7J A;  4TVA B;  3CCE S;  4OX9 J;  1IBC B;  2DBB A;  3A12 A;  5DDR C;  3OLB A;  4TNO A;  5FDL A;  3A3P B;  3UD5 A;  1UPP A;  2E9R X;  4USH A;  1YJU A;  2HZA A;  1IN0 A;  4H4O A;  4QYR A;  3TAP A;  3PX0 A;  2HBR B;  5DLF A;  2M8D B;  3CCW A;  4UQG A;  5C5J A;  2HBZ B;  4FS1 A;  4DR2 F;  2ZHO A;  3HHE A;  2QJ3 A;  1VHF A;  1HMV A;  2M7S A;  2XI2 A;  2HFU A;  3AOC A;  3T1Y F;  2I2Y A;  3JYT B;  4EZ6 A;  4Y2M A;  4H4K A;  1JKH A;  3LAK A;  1FXD A;  1RI7 A;  5FDL B;  3TX8 A;  4CWB A;  4Y0F A;  5JVG Q;  2BVZ A;  1ELO A;  2FGO A;  2IPO B;  5GAE U;  4IQM A;  1R31 A;  1N0U A;  2V9K A;  3IG1 A;  2HWT A;  4O0N A;  3BB5 A;  3LP2 B;  2XHW A;  2HWH A;  3HHL B;  5K8M A;  2HNZ B;  3HSG A;  4OZL A;  3FKB A;  5KAK A;  1E6V A;  2ZJQ Q;  2MLX A;  3GJR B;  3R7S B;  3MED B;  4DXL A;  4FVC A;  2G9O A;  5A8K B;  2YNH A;  6AT1 B;  1Y9O A;  5AJ3 F;  3MCS A;  3G2X A;  3KUG A;  2KTQ A;  1UJ5 A;  2LKZ A;  1GMW D;  4PKD B;  1HIY A;  2WVC A;  4Q2M A;  2OJ3 A;  1YGY A;  3G82 A;  3JTO A;  1BQN A;  1S79 A;  2OD6 A;  3I0S A;  3R5G A;  2LU1 A;  4H4M B;  4K59 A;  5AXK A;  1S9E A;  3R6G B;  2NUH A;  5J1N A;  4CNY A;  4DEZ A;  3DLB A;  2DCU B;  4RW7 B;  4LMZ A;  1NUE A;  3PAC A;  4RR5 A;  3MEC A;  3HP6 A;  3M6W A;  1HWJ A;  2P5V A;  3FK4 A;  4EYI B;  2Z2Y B;  1SJR A;  2BAN A;  3FGV A;  2B9W A;  3KKF A;  2AHO B;  3PCO B;  3PRB A;  1IM6 A;  1XWL A;  2CZ9 A;  2PE8 A;  3PJ9 A;  4W98 A;  3P5T L;  1UAW A;  5KFI A;  3X3U A;  4ES1 A;  3BSO A;  5GVQ A;  1R27 B;  4IOA Q;  4LSN A;  5EX3 A;  5KG7 A;  2CPY A;  4U7U K;  2DRA A;  2IMO A;  5D77 A;  2F9J A;  2RB7 A;  4ZVQ B;  4EU0 A;  1TUW A;  4DBQ A;  1J5E J;  1JNZ B;  1H3D A;  1I1G A;  3MM9 A;  2DH9 A;  1CSJ A;  4U9R A;  4ZCL A;  3TVZ A;  2J7K A;  3K57 A;  1OY8 A;  3UR0 A;  4DL0 C;  2IYI A;  4O4R A;  2DR5 A;  3DLE B;  5HJX A;  5DG9 A;  2VBW A;  1IM4 A;  5KG2 A;  4LRA A;  1HNI B;  4ZVH A;  3GPA A;  2DNQ A;  2Y1I A;  1RBA A;  3BSN A;  4JI1 J;  4Q8F A;  2NRE A;  1U1M A;  4J9N A;  3GB0 A;  1NH8 A;  1RKI A;  5DS7 A;  4FF3 A;  4FXD A;  4ZLP A;  3AFG A;  5IT4 A;  4E98 A;  1PYS B;  3TNV A;  3VGS A;  4X64 J;  1CVJ A;  3R5B A;  3S1T A;  1FX4 A;  2RRA A;  4WYW A;  2BJD A;  3LP1 A;  4NLP A;  1KEK A;  3D4J A;  3N79 A;  2G2Y A;  4OJG A;  3V6D B;  3B6B A;  2K7K A;  2I5J B;  3CIM A;  3JSY A;  4ZJO A;  3VZH A;  3JQM A;  1SJF A;  4WYL A;  2KXF A;  1FVQ A;  4J90 A;  5M2P A;  4URG A;  4FNI A;  4M5K A;  4F3Q A;  4J9P A;  3QFH A;  5DGB A;  2B56 A;  1KVI A;  4ZCM A;  1Q8K A;  4EGL A;  2N4C A;  1SB6 A;  5L1J A;  4F3O A;  1RWW B;  1I51 B;  1R0A B;  4USU A;  2V5H G;  3J80 U;  3T6J A;  3S6E A;  3GG0 A;  4CO4 A;  2DNN A;  1D9A A;  3JB9 k;  2SXL A;  2Q6B A;  3BPD A;  4CZC A;  4CLP A;  5ADZ A;  5HJY A;  2K1R B;  2G13 A;  2D3U A;  3H40 A;  2F7V A;  3DHW C;  5ITH A;  3Q8P B;  1Y5L B;  1BC6 A;  4DSI A;  3NXZ A;  4N8N A;  1FWP A;  1Q78 A;  1HQE B;  1SJQ A;  1V9O A;  2V50 A;  3HZG A;  1UW4 A;  3OTC A;  4NYZ A;  4QJV A;  4IO9 Q;  1L3U A;  5F8H A;  1ZM2 A;  2Z2Z A;  2DIU A;  3PHT A;  2CG4 A;  3O44 A;  4QBU A;  1SL2 A;  2N3L A;  3VAM A;  1C0T A;  1LK5 A;  2E5G A;  4C98 A;  1NME B;  2CZ4 A;  1WOP A;  2LEA A;  2A10 A;  1DAX A;  3E51 A;  4IYQ A;  2MZ1 A;  3V4I A;  1SKU B;  1VQO S;  2E5L F;  2HS4 A;  4ED5 A;  1FT8 A;  3CJK B;  3GV7 B;  1S12 A;  5T7L A;  5F8L A;  2YKM A;  2CQ0 A;  2HWI A;  3CW2 C;  1ZAX A;  2ZDO A;  1KFD A;  5KFE A;  4OJH A;  4QPT A;  2NLW A;  4WFY A;  5DGA A;  1N6Q B;  4RBU A;  7AT1 B;  1KR4 A;  1N56 A;  2A6O A;  2KHC A;  4OZJ A;  3GG1 A;  1UVN A;  2IVY A;  1YJN S;  4ICL B;  2BYC A;  1CUL B;  1RAD B;  3HD2 A;  2C2K B;  2WSF C;  5IXU A;  1HR0 F;  1B0P A;  4ZP7 A;  1S1U A;  3M8Q B;  4DSL A;  1H2T Z;  3VGT A;  2ALY B;  3F0N A;  3JSR A;  3PEJ A;  1FKO A;  1MWY A;  3PRD A;  2BAN B;  3BSA A;  3D6T B;  3MPW A;  4LIR A;  3W9I A;  3PW5 A;  2H9Z A;  2OPQ B;  1HWU A;  4PXB A;  3LA0 A;  1RAE B;  2WK4 A;  3QT6 A;  2M70 A;  2QC3 A;  4EBE A;  2CJK A;  2FVP A;  1Q4R A;  2VAS A;  1WEZ A;  1EHW A;  1U1O A;  4DPO A;  2J6T A;  4B3M F;  2P6S A;  2DHG A;  3G6V A;  2W2O P;  1S1V A;  4MTP A;  1AW0 A;  1UVI A;  4WCE Q;  1DLO B;  2UU9 F;  5IT0 A;  4NX9 A;  2I9S A;  3KJF B;  4GC6 A;  4ECX A;  2WHO A;  3FBC A;  5KFO A;  4DV6 J;  3CCL S;  1X7V A;  1YRX A;  4K0K J;  1FDD A;  4FZV A;  4NLG A;  1Q8L A;  1C1B B;  2BKP A;  2DYA A;  5DDP C;  1RWP B;  3AJ1 A;  3NL0 A;  2YKN A;  3OTE A;  4KQZ A;  3ENA A;  4HH0 A;  1HW9 A;  1R0C B;  2IM0 A;  3MMB B;  2J6S A;  2JHE A;  4DOZ A;  5KT4 A;  4ZPA A;  2MQM A;  2O67 A;  3C14 A;  3UQS A;  4QCL A;  4K2X A;  3IR7 B;  2DR8 A;  4IRK A;  2DIT A;  4I6W A;  5KFS A;  5HQL A;  3NOG A;  1GK8 A;  2YXL A;  3ZZR A;  3G71 S;  3KK2 B;  2LA4 A;  3SIP B;  4J5O A;  3J81 U;  4DQI A;  1SQF A;  3QLH B;  3LW5 C;  2PA8 D;  3AQO A;  1HI1 A;  3H42 A;  3OR2 A;  1B4S A;  4OI2 A;  1TL3 B;  4LRD A;  1DQ9 A;  2N4D A;  5I42 B;  3R1L A;  2F4V F;  3OL6 A;  2UVU A;  1FVS A;  2VPY B;  2OEK A;  1PC4 A;  3AH6 A;  1CJV B;  1QE1 B;  4K5R A;  4C3K A;  3FRY A;  4DS4 A;  4KHP J;  3H20 A;  4ZPW R;  1FJE B;  5LMU F;  3IM9 A;  2CQI A;  2W8L A;  4ER8 A;  1ZTW A;  1U1Q A;  2OP5 A;  3QO9 A;  4A4J A;  1KOH A;  1LXJ A;  1VRT B;  3HHL A;  1P9Q C;  1KBR A;  2I8E A;  4K50 A;  3D7S B;  1H73 A;  2CPH A;  3M2U B;  3EUN A;  3UDC A;  4ID5 A;  2QGF B;  4XAK A;  1RT1 A;  2GS8 A;  4ZOS A;  1QTN B;  5HMW A;  3GQC A;  1T3N A;  1N5Y B;  2YX1 A;  4USK A;  2XM3 A;  1WDD A;  1ZM4 A;  2GIF A;  2VU5 A;  2BOA A;  3G6X A;  3HHL D;  3V6J A;  4LR7 A;  4RU2 A;  1U6B A;  1M5P C;  1NJX A;  3T5J A;  2CPZ A;  1RT7 B;  2ZNY A;  5KFA A;  5KFM A;  1IBK J;  4M5D B;  2V4Q A;  2WBR A;  1YX2 A;  2IJN A;  3L7U A;  3CJ5 A;  1EKS A;  4JI6 J;  2X1A A;  1GFW B;  2AT1 B;  4JI0 F;  2RQM A;  3D0I E;  3Q0A A;  3SEO A;  2ZD1 A;  2IJF A;  4RUB A;  2XWY A;  2XYG B;  1XJW B;  1U1R A;  4CLL A;  1RHQ B;  2NXN A;  2AEF A;  4A8W A;  4HYK A;  1FD8 A;  4JUZ A;  3JSB A;  2CZV C;  1XNQ F;  2LXI A;  3N6N A;  1XEZ A;  3WX8 A;  3DC2 A;  2GNK A;  3MR7 A;  2FJW A;  4CH0 S;  1T02 A;  3M9N B;  2RS8 A;  1CJU A;  3AOA A;  3OQ2 A;  3G8Q A;  3POT A;  4I1T A;  4K2J A;  4MKV A;  3IGV A;  1IKX A;  1YJT A;  3GP9 A;  3RUB L;  1UVJ A;  4DQS A;  4K0K F;  1AYE A;  2Y3Y A;  2J8S A;  3KDO A;  4O3R A;  4RWW A;  3MEG B;  3T3F A;  4Y2I A;  2YQ3 A;  4MFB B;  2R3V A;  3MM5 B;  4P9S A;  4CYU A;  4ECV A;  3I4H X;  2XCA A;  3RB0 A;  5FII A;  5IOL A;  4CO5 A;  1NJY A;  3PRV A;  2R9L A;  1NJW A;  5A0Y B;  3M9M B;  1VCT A;  2RVJ A;  3BKF A;  3QRR A;  4LBI A;  2NSB A;  1CC7 A;  2OHD A;  3SQG A;  2K8G A;  3QGP A;  2B5J A;  4LSZ B;  5DDO C;  1LWX A;  2R2T A;  1WKK A;  4DFM A;  1JLE A;  2XLK A;  1FA0 A;  4OFZ A;  3G4S S;  4XDD A;  3UDE A;  1N36 F;  1DTT B;  3V2U C;  1RK8 A;  2LU2 A;  2I38 A;  2M0G B;  2GGP B;  3E3X A;  1KNZ A;  4Q43 A;  3QT7 A;  3BGR B;  2ZBI A;  1KWM A;  2HBY B;  2IA6 A;  1UMJ A;  1NK6 A;  3BSC A;  2M88 A;  4F67 A;  3IRX A;  4B9T A;  1TU0 B;  2MKJ A;  4YR3 A;  4DV7 F;  1UET A;  2LA6 A;  3VTI A;  2B8P A;  4ZKA A;  1RT2 A;  3Q8V A;  4ECZ A;  4ID5 B;  1CJV A;  2B4V A;  3GSD A;  4L73 A;  4OLP A;  2XSF A;  4ZVU B;  4AUK A;  1KOO A;  3LP1 B;  5B09 A;  3MR3 A;  1TFY A;  4WU2 A;  3GFY A;  5GAH I;  4D3H A;  2ZH1 A;  3OV7 A;  3DRR A;  1U0S A;  2IA0 A;  1U1N A;  3QO9 B;  1XNR J;  2RT3 A;  3KMQ A;  5F9L A;  4LF6 J;  1QAY A;  4FYD A;  2AGO A;  2XZW A;  4OI1 A;  2KFY A;  2X1F A;  2HHH J;  4OX9 F;  2JWN A;  4MK8 A;  4NCG A;  1OIA A;  1X4F A;  4YP3 A;  3DOL A;  4B3O B;  1EAR A;  3KG0 A;  4LF9 F;  2HUR A;  5EWF A;  5D3G B;  3IBC B;  1N5Q A;  2EBE A;  3ADA C;  3H2L A;  4PAB A;  3US5 A;  1BWV A;  3ISN D;  4FKX A;  1ROF A;  3DRR B;  4KGK A;  2MJN A;  4OZ0 A;  3VCD A;  5IS2 A;  5LJ5 Y;  2DJW A;  1TMM A;  2V34 A;  1JXV A;  2DTJ A;  3KLI A;  1TTH B;  1IR0 A;  4AYB D;  4D3G A;  1REG X;  2HS0 A;  1GQE A;  4LR9 A;  1JIH A;  1TVR A;  3R27 A;  5DO2 A;  2I0X A;  2IMW P;  4LF5 J;  1S77 D;  2OLW A;  3ISZ A;  1URR A;  1LKZ A;  4JI2 F;  3BGL A;  1N33 J;  1NEE A;  2V0N A;  1WC5 A;  3EM1 A;  4X84 A;  3OSN A;  4GO5 X;  4NZ0 A;  4ZPB A;  1N33 F;  2JJ4 D;  2N82 B;  1K0T A;  3HFV A;  3KNG A;  3FBF A;  3J80 Y;  2OPR B;  1HQ2 A;  1TMJ A;  4JI4 J;  2RSQ A;  2VG6 B;  2ZVS A;  3CO0 P;  2E5L J;  4NXM J;  3NGU A;  2BE9 B;  1EKR A;  1QVG R;  1LW2 A;  3NKY A;  1IWG A;  4FYX B;  4AL6 A;  2OTJ S;  4LVO P;  4LT6 A;  1Y7P A;  4WZM A;  2CPX A;  1LFW A;  2DIV A;  3MUT P;  2NS1 B;  2A0F B;  1PAE X;  2QSF A;  1CC8 A;  3OXL A;  3PFO A;  4HH1 A;  1R43 A;  2O01 C;  4LF4 F;  4YHH J;  3MM5 A;  3W1Y C;  4KGX B;  4CYU B;  3HSJ A;  3K59 A;  5HAT A;  3KJV A;  1VS3 A;  2JDJ A;  3DLJ A;  3H5Y A;  2VG7 B;  3I4P A;  1T05 B;  2X51 A;  2YPZ A;  2MHE A;  4LQ9 A;  4G1Q B;  2R8G A;  1V3R A;  2E44 A;  2FQQ B;  2IAJ A;  1FKP B;  2Q3P A;  1U09 A;  3DI6 B;  1XN9 A;  1M5S A;  3R3T A;  4JBC A;  4DV2 F;  3OR1 A;  4NCB A;  2WB1 D;  3KNA A;  1O5J A;  4KH1 B;  2Y0S D;  4OHZ A;  4RUC A;  3PYE A;  5RUB A;  4HI2 A;  4RW9 A;  3T6B A;  1U48 A;  2E7V A;  4B9U A;  1VIO A;  2RNE A;  3HVW A;  4B3M J;  4OYM A;  4LFC J;  3THP A;  2GQ2 A;  5GAD I;  1TQL A;  2JOQ A;  2A18 A;  4ZCK A;  3W5X A;  2IM2 A;  2DR9 A;  1C0T B;  4LF7 J;  1VQK S;  1KDN A;  4TN2 A;  3RB4 A;  2QFJ A;  3JSM B;  1LWC B;  2BBE A;  3I9Z A;  2QIF A;  1YQH A;  3P96 A;  1BUX A;  3CJK A;  2YH0 A;  2ZHB A;  2PA3 A;  5GMD A;  5ETV A;  3SCL E;  2E1P A;  5FD1 A;  4Q7A A;  5JUM A;  1IUJ A;  1UWB B;  2W8K A;  4HHU A;  4F4K A;  3MMA A;  2BJ8 A;  4N7T A;  3KLH B;  1NKE A;  2HVD A;  3R8Y A;  1NKB A;  4B02 A;  1Q82 T;  1F0X A;  5D4O A;  5E7O B;  2MKK A;  2QLX A;  2BMB A;  2YWG A;  4RJV A;  3VHQ A;  4JOU A;  2LLZ A;  2B7B B;  3AA8 A;  2OEL A;  3Q2S C;  2H5J B;  4LSL A;  5LT5 A;  2V6A A;  5H1S V;  1C1B A;  4UQT A;  1WDT A;  1XC9 A;  2DNH A;  4YQW A;  1D9D A;  3F41 A;  4UST A;  3ZZ0 A;  5J2N B;  3FJ2 A;  2DIS A;  1OYD A;  4DPU A;  4TKT A;  4JV2 A;  2EVZ A;  2D9P A;  1MML A;  2X3D A;  3S8S A;  3BQ0 A;  1JJ2 R;  2IDE A;  3GYG A;  3MUM P;  1S0M A;  5KFN A;  3I55 S;  2VG6 A;  2C42 A;  2VBZ A;  3A4T A;  2DGT A;  4RNM A;  1RAJ A;  3FNN A;  5LMN F;  2DVI A;  3EPG A;  4DV5 J;  1WI6 A;  4NPO A;  1Q8B A;  1Q95 G;  1X5O A;  2XGP A;  3H8Y A;  2FJD B;  5HVG A;  2PI4 A;  4BC9 A;  2Z8Q A;  3LUY A;  1R8H A;  3PO4 A;  1FRH A;  4OV6 A;  3CD6 S;  3CCU S;  1N34 F;  5LM7 E;  4KHM A;  3WQP A;  2C3P A;  3OPK A;  2H54 B;  2VDH A;  2RE1 A;  5CQG A;  4DV6 F;  2UP1 A;  1IKX B;  1PBU A;  2OGU A;  3ZZT A;  3TJA A;  4DX5 A;  1RHJ B;  4ZHR A;  1TL1 A;  2CNK B;  2JL9 A;  2YNG B;  1N0V C;  2F5G A;  2XS5 A;  4C7Q A;  3UWT A;  5KFK A;  2JFK A;  2MXY A;  2E5H A;  4K4V A;  1XK8 A;  3AD9 C;  2R2S A;  3GTY X;  3DNC A;  4P2S A;  3PYD A;  2HVH A;  2DNZ A;  2Z56 B;  2KU7 A;  3TO8 A;  1HR0 J;  4YN3 B;  2Y1R I;  5H9F J;  3BH7 B;  5DQI A;  1FKP A;  3RBE A;  5E33 A;  1KP6 A;  2Y8Y A;  4OYB A;  2GC8 A;  4NOH A;  3VAG A;  3V6K A;  4GKK J;  4QWB A;  4ZMM A;  2LEP A;  1LNQ A;  3TVK A;  3GYN A;  5CHC B;  3GIJ A;  3R5D A;  1FE4 A;  1WKJ A;  5KFG A;  3T9Z A;  4ES2 A;  1SL1 A;  4C8L A;  3PX6 A;  2RHS B;  5H9E J;  3W9J A;  2RRB A;  3EGZ A;  4V19 X;  5IC6 B;  2OUG A;  5KFB A;  2ZVI A;  4WJB A;  1N5S A;  2MQ8 A;  4TQR A;  2ZKT A;  3ITH A;  1VK8 A;  4ILR A;  4NZ7 A;  4K4Z A;  4PWW A;  3C19 A;  3V6D A;  1TP7 A;  2RIL A;  3DDI A;  2BJ1 A;  2KI2 A;  4DV4 J;  3W66 A;  4ED4 A;  3UCG A;  4NA2 A;  3BR9 A;  1IBL F;  1N5Y A;  1RB0 A;  3QJL A;  3R7N B;  1U6F A;  1SXL A;  4K8R A;  1N5T A;  3UVJ B;  4KO0 B;  4KYZ A;  2P9G A;  5E3P A;  2NR0 A;  2NXE A;  2AV5 A;  4E2F B;  4USI A;  2E9T A;  5GAG U;  1SPB P;  3AB4 B;  1WF0 A;  2XMV A;  5JXS A;  2IJR A;  2JVO A;  1SC3 B;  1C2P A;  1FDN A;  3E01 A;  3U1N A;  5EN1 A;  1V3S A;  3NS5 A;  1P8G A;  3I6P A;  5B0C A;  4DF4 A;  2BZ2 A;  5DET A;  3BKU A;  4C8K A;  3EZO A;  1HD0 A;  1H38 A;  3DRP A;  3PNI A;  1R7I A;  2ZDP A;  4A8O A;  1Y0H A;  4CLZ A;  5KFH A;  2VKZ G;  1UEU A;  4MJK A;  4CO2 A;  3RB3 A;  1RTD A;  2G0J A;  2E1C A;  3W7B A;  2HHW A;  2MY8 A;  1SBR A;  1HWK A;  2DO4 A;  3CJT A;  4O3P A;  4ZLJ A;  1YIT S;  3J7Y U;  2ZOF A;  3AD7 C;  4X4S A;  2BAB A;  1KON A;  4OYW A;  2XZT B;  2QV6 A;  3I32 A;  4RWX A;  4YB1 P;  4P74 A;  4ELV A;  1G6B A;  4QIG A;  4Z7Y A;  5J2P A;  3PZP A;  2DGS A;  1X0F A;  4Q45 A;  3H2V E;  2F4V J;  1WOS A;  4L3K A;  3M2R A;  2HRT A;  1Q1K A;  2ATC B;  2AJQ A;  1FHT A;  3OW2 R;  1R8C A;  4KGM A;  2MKS A;  4KO0 A;  5K8P A;  1XNQ J;  2L41 A;  3OTD A;  2VG5 A;  1FTR A;  3EIC A;  2VV5 A;  3A8I A;  3Q23 A;  2FVS A;  2HFV A;  2QMX A;  3QAT A;  2W7A A;  4K4U A;  1X0P A;  4QYZ J;  1L3T A;  1YDL A;  2VON A;  2Z0G A;  3W3S A;  3IRW P;  2DHX A;  2DHA A;  1QAI A;  4CCH A;  1FTC A;  1R3N A;  4NI2 A;  3OL8 A;  4PAA A;  1QSY A;  2RD5 C;  5IZH A;  4TY8 A;  4Q0B A;  5D4L A;  3UN5 A;  4DQR A;  3ZTP A;  1DZ5 A;  4A8Y A;  1RWU A;  4WK3 A;  5ETO A;  1T94 A;  3OL9 A;  3NP5 A;  4RPF A;  1LWC A;  4EBC A;  3QWU A;  5B7W A;  1RT6 B;  2HHX A;  2RU9 A;  4RBV A;  1FRM A;  2DY1 A;  3M05 A;  3VAL A;  3QT8 A;  3I31 A;  4WE1 A;  5C25 A;  3R5A A;  3MI7 X;  4J9U E;  3KHL A;  4K5S A;  2ROP A;  1XBW A;  4J91 A;  5IQQ A;  3VVU A;  5M2U A;  4EBD A;  4EZ9 A;  3DLE A;  5CZV A;  4QIV A;  1KHW A;  2NQP A;  4I64 A;  3FMW A;  2ALZ A;  1RP5 A;  1U7L A;  1E6V B;  3AT1 B;  4DR7 J;  3HFZ B;  3TQ1 A;  3PVX A;  2EG2 A;  2ZZM A;  2EFN A;  2ZWP A;  4CO0 A;  4JI8 F;  5KOX A;  4C11 A;  3UCZ P;  1QTM A;  4ZDN A;  4M5G A;  4B9M A;  4X4N A;  4NEY A;  1QE1 A;  2XS2 A;  2JSX A;  2LQ5 A;  3FCH A;  4X66 F;  4QW9 A;  5L46 A;  3M8P A;  3CCS S;  4F2S A;  1C4A A;  3QYY A;  4DLG A;  2AWZ A;  4X66 J;  3AOB A;  2UU9 J;  2OPP B;  3CWJ A;  4GKJ J;  1HPZ B;  2UUB J;  1Z2L A;  1U49 A;  1VOM A;  1S7H A;  2JC1 A;  3MD1 A;  3GR0 A;  3VZI A;  3PG9 A;  1JLQ A;  2E66 A;  2NCK L;  3MM8 A;  2POK A;  4OJ1 A;  1K8A T;  2MEW A;  5CD4 A;  1FK9 B;  3ET6 B;  2VA3 A;  3B4M A;  4J7C A;  4RZR A;  1T9U A;  4GVB B;  5KFC A;  4ILL A;  3RBX A;  3ZXW A;  4B17 A;  4IDK B;  4QIE A;  3D68 A;  1WTF A;  4YS2 A;  1SH2 A;  3NWG A;  4OHW A;  2KXN B;  1P1T A;  3K8V A;  2DPJ A;  2K1R A;  2ILZ A;  5D0E A;  4ZPD A;  3RW7 A;  4ZN3 A;  5ETS A;  3PV8 A;  3IG1 B;  4R8U A;  2EI5 A;  1JB0 C;  1GMW A;  1YKW A;  2H5E A;  2IRY A;  3E8O A;  3IRX B;  1RAI B;  1CEZ A;  3FFI B;  4R0J A;  4GMK A;  1O0P A;  3CCT A;  2VG5 B;  3ICL A;  1TAQ A;  4RLE A;  1HBU A;  2KKH A;  2M2B A;  3QPI A;  3V4M A;  3HHD A;  4AL7 A;  4ECW A;  3OSP A;  4EYH B;  2JC0 A;  1S0O A;  3FC9 A;  2W9B B;  3DLG B;  1HBN B;  1C1C B;  4MMO A;  3M2R B;  4WF9 Q;  3UN3 A;  1UVM A;  4WFA Q;  5FJ4 A;  4USJ C;  3KLH A;  3TR5 A;  1RAF B;  5T7L B;  1ARO P;  5E0O A;  3MM8 B;  2ZKU A;  4PYD A;  3PW7 A;  4Y34 A;  3DN9 A;  1D0E A;  1L3K A;  2V2V A;  3HF5 A;  3NGK A;  1MU2 B;  2UUW A;  1HHS A;  2F8M A;  1C4C A;  1REV A;  2P2C B;  2KRB A;  1S1T B;  4UUW A;  4AQY J;  3N9U C;  3OHB A;  2W7P A;  5I42 A;  2FVQ A;  5BR8 J;  2WBM A;  2L9W A;  3OFH A;  4A47 A;  1D1U A;  2W4D A;  3DLG A;  4ZVP B;  4HT5 A;  1KC8 T;  1T7P A;  4FBT A;  2MQQ A;  2RUS A;  2HMI B;  3KK2 A;  2WON B;  2KYX A;  5HQ8 A;  4F02 A;  4FF4 A;  2Y8W A;  1NXI A;  1HWL A;  3OTO J;  3CDW A;  2MKH A;  3C6T B;  4KH0 B;  5I3P A;  3EYZ A;  2BKN A;  2A2D A;  1E6Y B;  4FBU A;  1WKL A;  3TZX A;  4W4M A;  4ED0 A;  3BR8 A;  1U02 A;  1IJF B;  1YBA A;  1Z1Z A;  1S72 S;  4W90 B;  3FEX B;  3FDS A;  4TLQ A;  5K14 A;  2IDL A;  3KUH A;  1VK3 A;  1JJC B;  1RHR B;  4E0D A;  1ZZN A;  1TKT B;  2QLF B;  2AKW B;  1IKV B;  1A6L A;  2Z30 B;  3CJ8 A;  4NXN J;  1BQN B;  4H4M A;  2BX6 A;  2DPI A;  1TR0 A;  5E5N A;  2V63 A;  2VDI A;  4N76 A;  4OYI A;  4NCA A;  3DOK B;  2N7C A;  4RW7 A;  1TK0 A;  1XQI A;  1BXN A;  4HI1 A;  3RAM A;  1UJ4 A;  4EUV A;  2IHR 1;  3UDL A;  4DR3 F;  3AOD A;  1VGY A;  2KM8 C;  4KFB B;  2IY5 B;  3JXO A;  1NB7 A;  1UPM B;  2U2F A;  2W2Q P;  2H3E B;  2EK1 A;  3DRS B;  4L75 A;  4L3N A;  5K8N A;  1M90 T;  2WVD A;  1E6Y A;  3EVW A;  4ITS A;  4C97 A;  3SCI E;  1JNR B;  2HHQ A;  3O8W A;  4OIX A;  3BKT A;  4O3N A;  3MAH A;  4JI7 F;  3GJS B;  4HL9 A;  4NMX A;  1LV5 A;  4PWD A;  2H5I B;  2HIQ A;  2WVB A;  5K14 B;  2D69 A;  2ROE A;  1VMB A;  1HHQ A;  4ECU A;  1WSR A;  1FKO B;  2VB6 A;  4B3S F;  3VGV A;  1IVZ A;  2QLJ B;  5L1L A;  4O3Q A;  1P1L A;  2HFZ A;  2H4Y B;  2J0X A;  5GAD U;  2OEM A;  1H7X A;  2CXE A;  2BW2 A;  3MMC B;  3OXF A;  5IC4 B;  2HBQ B;  4K4X A;  2ASJ A;  4DWI A;  1RJJ A;  1UFW A;  1YZ7 A;  3FZB A;  3K8W A;  4WE1 B;  3KLG B;  1ZTT A;  3FBB A;  2NZC A;  2VZ9 A;  5LSL A;  5D0G A;  3HO1 A;  1JMT A;  1F5C A;  1FO1 A;  1RTJ B;  2DT9 A;  3D66 A;  1JLB B;  3GFH A;  4ZPC A;  4TU9 A;  3WC2 A;  4BWJ A;  2I1R A;  4DF8 A;  2YX7 A;  3MAA B;  3UI3 A;  3NCQ A;  4PUO A;  2A2C A;  1CJT B;  1VRU A;  2Q1L A;  1NK4 A;  3ENW A;  2W2P P;  2C3Y A;  4BS2 A;  4LF7 F;  1KN6 A;  5C2G A;  3H5X A;  2M4M A;  1A0O B;  3W2V A;  2J9D E;  3EXY A;  1NBE B;  5J1E B;  2RU3 A;  1WTB A;  1SI9 A;  3MM7 A;  3QAE A;  1KFS A;  1RWO B;  2ZBQ A;  3KLF A;  2HHP A;  1SQE A;  2LYV A;  4P10 A;  1KS2 A;  3H25 A;  4F4A A;  3NGD A;  3UD4 P;  2AZ3 A;  1XNR F;  2QLB B;  1S6P A;  1G7C B;  3GCX P;  4ZVO B;  2OPS B;  4QIW D;  1UEV A;  1XMO F;  3G86 A;  9RUB A;  2DXD A;  1JQG A;  1FWL A;  1PYT A;  2BW7 A;  4F8R A;  4H4K C;  1RQ0 A;  2V8V A;  2IYG A;  4LSL B;  3WIU A;  1IBK F;  3L9Z A;  2AYM A;  3FUY A;  2MZR A;  3CDA A;  2VBY A;  2VFR A;  3KLF B;  4WFB Q;  2JEF A;  1ULR A;  3NBP A;  1JKH B;  1BD6 A;  3NS6 A;  3QLH A;  5BYR A;  4V19 J;  3IAM 9;  4ATN A;  2EFO A;  2XUL A;  2R2R A;  3K2Y A;  3ZTR A;  1F60 B;  2ABY A;  5KG3 A;  1JLG B;  1H72 C;  2EFV A;  1SH3 A;  2FZG B;  2O1P A;  5CAB A;  2KVI A;  3MUR P;  1B0V A;  3CPW R;  3PIP Q;  4LRE A;  3D3C J;  3MMB A;  2ZM6 J;  3SZ2 A;  5E2Q A;  2UVR A;  2VL1 A;  3MEG A;  4DFK A;  3AXM A;  5IWA F;  3K5N A;  3IS9 A;  3K7R A;  2OPS A;  1F2H A;  1RTI B;  4DPT A;  3A3O B;  1TZ0 A;  2QE5 A;  3U02 A;  2XO7 A;  3CCR S;  4C11 B;  1H2U X;  2DHS A;  4YY3 F;  1VQY A;  4CNZ A;  2RQK A;  3CO9 A;  2BE2 A;  4DDF A;  3BGU A;  3PEH A;  4IG3 B;  4JI1 F;  2CVI A;  1PBA A;  3KHR A;  1YLX A;  2D7S A;  2XYP B;  2GCF A;  2M8H A;  3PJW A;  5G0R B;  4ELU A;  2J7W A;  2Y0B B;  3MM6 B;  2KVQ E;  1R6V A;  2F9D A;  3UR3 C;  5D0H A;  3DU5 A;  1QUV A;  3MMJ A;  3J81 j;  4C0H A;  5KT3 A;  4ZLN A;  2QO3 A;  1GMV A;  1TV6 A;  2CQ4 A;  5EX0 A;  2Z2L A;  3HM9 A;  1BQX A;  1T0T V;  2CAJ A;  1REV B;  3HUL A;  3T1A A;  3DXB A;  4A46 A;  5IV3 A;  2B9E A;  3A3N B;  3VVT A;  5L39 A;  5EDW A;  2XLJ A;  1QVF R;  3KK3 A;  3SI8 A;  1UVK A;  5KTQ A;  4ZA1 A;  1WD6 A;  1BMQ B;  1NDC A;  2V4J A;  2VQF J;  2E7W A;  4P52 A;  1WC6 A;  2F63 A;  1RYR A;  4F0K A;  5EWE A;  4K4W A;  3T1Y J;  3DLK A;  1HWI A;  2QTW A;  2OEJ A;  2CQB A;  1S48 A;  3PO5 A;  5HL7 Q;  2GVD A;  4FXV A;  3SV4 A;  3FFI A;  4ANC A;  4KV8 A;  4N47 A;  4DUZ F;  3A13 A;  3LH2 S;  2LQ8 A;  2PT0 A;  2V2K A;  2PDA A;  2GJI A;  2HFS A;  3W2W A;  5HRO B;  3P5B P;  3UO0 A;  4OL8 A;  1SIZ A;  3CD5 A;  3H4B A;  2RML A;  1S6O A;  3Q2T C;  1DFD A;  3AHP A;  1GMU A;  3D1O A;  3RB6 A;  5D6G A;  2AP6 A;  2FHM A;  3RBZ A;  2B6A A;  2I5J A;  1J5O B;  1FJC A;  4XPE A;  1F5A A;  2GHW A;  1WOO A;  1UFL A;  3BJY A;  1P27 B;  1AFI A;  2AEJ A;  5AJ3 J;  2DR7 A;  4F50 A;  3WHI A;  1UWB A;  3QMQ A;  3CTR A;  1P9Y A;  2BJ7 A;  3CVK A;  5F8I A;  5E3A A;  1MMN A;  1HNX J;  1ZOT A;  3B82 A;  2B6A B;  4M5M A;  4Y00 A;  4DV3 F;  4JV5 F;  3JTP A;  1M1H A;  3UNG C;  3WX4 A;  3JAM Y;  1HNV B;  4B08 A;  4ZIW A;  3OVA A;  4EI2 A;  2KT5 A;  5J1P A;  4KY3 A;  1SV5 B;  4F0M A;  4DV3 J;  2BQ3 A;  4O3S A;  3UFC X;  2UXB F;  4FF1 A;  4UY8 5;  2CQ3 A;  2DRB A;  2YTC A;  2H65 B;  3UCU P;  4DI6 A;  2YWW A;  5L38 A;  2V4R A;  4IOB A;  2VPX B;  1VDH A;  1TL5 A;  1FRK A;  3MEE A;  2EPI A;  2QG9 B;  4G6V B;  4UW2 A;  1WF2 A;  3W61 A;  4DU7 A;  3G96 A;  4JI3 F;  2B43 A;  3MCN A;  3R2C J;  2AJ2 A;  1VC0 A;  1X9S A;  1VRQ C;  2IM3 A;  2MZT A;  2OML A;  1T03 B;  5A2Q U;  3H59 A;  1JLQ B;  1GX6 A;  1NO8 A;  3FCW A;  3DMJ B;  5A8K A;  2MGZ A;  4ZVS B;  2BDP A;  3V5R A;  1RZM A;  5IT9 U;  2WZ1 A;  1J27 A;  4PXE A;  4DCP B;  1WC4 A;  1SJ1 A;  1FK9 A;  3PDN A;  5HLF B;  4O44 B;  3MOZ A;  3UE2 A;  4PG5 A;  4U8Y A;  1RA6 A;  2MB0 B;  5CH7 B;  1V5V A;  2PFF B;  2G2Z A;  3SCK E;  1HKA A;  3GLJ A;  1RBL A;  9ATC B;  2YH1 A;  5KFD A;  4X64 F;  2DNO A;  2RS2 A;  1U2C A;  4M95 A;  3SSS A;  2CJ9 A;  3CDB A;  4HDH A;  4M5J A;  1O51 A;  1WF1 A;  3CJ2 A;  2RRN A;  1S1W A;  1H2V Z;  1IKV A;  2V8H A;  3D6M B;  3GJQ B;  1N6Q A;  4LF4 J;  4LBP A;  1TL1 B;  2W24 A;  2YNG A;  3C6T A;  2E29 A;  1CUL A;  2R8J A;  3TX0 A;  1PJ5 A;  3I5B A;  2CAD A;  1M5O C;  2G1D A;  1Q5Y A;  3TQE A;  1I94 J;  2XLI A;  3FSY A;  3H98 A;  3MPV A;  3BBB A;  1MMD A;  3R1H A;  1U8W A;  1S9F A;  1SQG A;  4MYT A;  2KN4 A;  4DLE A;  2UVV A;  1FDA A;  2XQC A;  1WC0 A;  4F04 B;  4U67 Q;  1NSQ A;  1GEH A;  3FQL A;  2XSJ B;  2YNF B;  4LFA F;  1ZYQ A;  1V3Z A;  1RAO A;  2ACM A;  3M8Z A;  3JQK A;  4J9V A;  1RWK B;  3CD7 A;  4L6V 3;  2R7Q A;  4OI3 A;  3QZ8 A;  3CUN A;  5B0D A;  1NB2 A;  2YNI B;  3GSI A;  2FIU A;  2ZH9 A;  3F44 A;  3VQT A;  4TYA A;  4NLV A;  4PQU B;  1KLM A;  2U1A A;  3HHK A;  1HI0 P;  2YKO A;  1KKH A;  3L4B C;  3MPY A;  5HAO A;  3WDO A;  2HK2 A;  3C14 B;  3QWP A;  3U1M A;  3KJN B;  2XMT A;  1WWH A;  2FZK B;  4PXC A;  2BV3 A;  3HKW A;  3TYT A;  3W8G A;  3RAX A;  1Y00 A;  3DOM A;  2AU0 A;  2BR0 A;  1CS4 A;  1N52 B;  4J9R A;  1YJ9 S;  3S01 A;  4DV1 J;  4KT0 C;  3T1H J;  5IT9 Y;  4DL2 A;  1V5I B;  1G1X A;  1GXT A;  4DJB A;  2GVZ A;  3GIL A;  4ED8 A;  1H74 A;  1PIL A;  2HKE A;  3JSM A;  3ILO A;  1C0U A;  4X65 F;  4WP9 A;  3OT9 A;  2XY6 A;  1RWM B;  3DOL B;  3CD0 A;  2Y9H A;  4DCO B;  3OD2 A;  2GHV C;  3CJS A;  2MGZ B;  1YK9 A;  5IM0 B;  2QA4 S;  1FRX A;  2FHJ A;  2CKW A;  2YNI A;  3TJ8 A;  2FJA B;  2WSC C;  1GXL A;  3E01 B;  4DSE A;  1QAX A;  2DD8 S;  1X4D A;  5IWA J;  4DSF A;  2HS3 A;  1CPZ A;  4ZVE A;  5J2Q B;  3TVY A;  2KH9 A;  3L3C A;  1GTE A;  3DXS X;  3GII A;  1QSL A;  1ZET A;  1UZH A;  4NRU A;  1HD1 A;  1PCA A;  4PPZ A;  1NSK L;  4PG7 A;  3SMZ A;  5CYQ A;  1R6Y A;  4AL5 A;  1F5B A;  1EP4 B;  1WC3 A;  2D1C A;  2YBV A;  3IWL A;  3POT B;  3ZTS A;  1ZPV A;  1NK9 A;  4IFY B;  1UCN A;  2CPJ A;  1S1W B;  2Q79 A;  2WOM A;  4JV0 A;  3KK1 A;  1X9W A;  2QMW A;  3LGH A;  1I6J A;  4C4W A;  1EET A;  1PYO B;  2FLL A;  3GIM A;  1GXU A;  3OTO F;  4ZS6 A;  4AXJ A;  4Z2X A;  1WSV A;  1FJG J;  3GU0 A;  2VBX A;  2GGP A;  1JLF A;  2E1M C;  2FDN A;  2K3K A;  2DO0 A;  3QAU A;  4KPC A;  1SC6 A;  1NDL A;  3H4D A;  4DR5 J;  3SFG A;  2W2M P;  5L9X A;  2IRU A;  3FEZ A;  3H2U B;  1TK5 A;  3LF0 A;  3B4D A;  2GX8 A;  1RBO B;  2HEK A;  2MQP A;  4N5S A;  1LW0 B;  5CYJ A;  4F3M A;  4PRF A;  1UVL A;  4ZIV A;  4B9L A;  1RAA B;  1AT1 B;  1CBK A;  3R97 A;  2ZEJ A;  4AT1 B;  3Q8S B;  3VAH A;  5D8H B;  1RSC A;  1S1V B;  3OFG A;  3BDE A;  2JEG A;  4F4X A;  5AE1 A;  2MLY A;  2QRR A;  3TWZ A;  1N88 A;  4JV1 A;  3HZE A;  1XIQ A;  3ONQ A;  1NPR A;  1BQM B;  2FVC A;  5DM6 Q;  3DGV A;  2FTR A;  2GVD B;  2NSC A;  3O5T B;  3QFW A;  5C7P A;  3LWM A;  4AE5 A;  2ERR A;  1T03 A;  4KHP F;  3NG8 A;  3I5A A;  4IRC A;  1KLN A;  2CUY A;  2XWX A;  2YWE A;  3L7O A;  1NHK L;  4LF2 A;  4G65 A;  5A6P A;  4WPA A;  3BDP A;  2MZQ A;  4MIW A;  3WIV A;  1DAR A;  4ECR A;  4FKY A;  3B8H A;  3C6U B;  2PEB A;  4A8F A;  2CQG A;  2ACY A;  2DH7 A;  2VH7 A;  2Z58 B;  1VFJ A;  1TKX A;  3QQC D;  3TP2 A;  2ADC A;  4OLO A;  2FHK A;  2XMK A;  2C3U A;  1X5S A;  3BN4 A;  3M8W A;  4DUT A;  5FLX U;  3Q8Q B;  1L3V A;  4DG1 A;  1N8R T;  4JYA F;  4DR2 J;  1H7W A;  4DZD A;  3KLG A;  1B7F A;  4RW4 A;  4WWS A;  4WKR A;  1RHM B;  4KGV B;  4ZP8 A;  3TJ9 A;  1RWN B;  3IWX A;  1Q8I A;  3GIR A;  4OZ5 A;  5KFF A;  5H9E K;  1DQA A;  2ASD A;  4X65 J;  2GIQ A;  2MLZ A;  2HND B;  2XG8 A;  4KHR A;  2DR6 A;  4QPX A;  4IR9 A;  2FJV A;  2FUG 9;  3T9N A;  3HSZ A;  4I56 A;  3TA1 A;  4WXO A;  1FWK A;  4P2X A;  3T5K A;  2NPI A;  1D09 B;  3PKY A;  1OYE A;  5LXR A;  3OJS A;  1VQ4 S;  2FC9 A;  3LTO A;  3D1H A;  4BC7 A;  5HVF A;  3DDK A;  4B3T F;  2QA2 A;  1VC6 A;  2XHC A;  5CCL A;  2VHG A;  2OH2 A;  4JI4 F;  3EVM A;  1T9Y A;  2CQC A;  2VC1 A;  4ZK7 M;  4AQY F;  3DLL Q;  1URN A;  3P6Y C;  4F4W A;  4CLK A;  1KTQ A;  4Q5V A;  3J7A 1;  1OY6 A;  3DRX A;  3O1L A;  3TUJ C;  2BAC A;  1FXL A;  1LXN A;  1HQU B;  4ZN1 A;  2AJ4 A;  1DRZ A;  3HHN B;  3OTB A;  4DL7 A;  4CT9 A;  4DR4 J;  4I67 A;  3J7Z 5;  3CCQ S;  4A8M P;  3G8T A;  3D0H E;  1JLC B;  2OIH A;  3NLC A;  2XNR A;  1Y5N B;  3L09 A;  1QSS A;  3MXH P;  4MK7 A;  1Y3K A;  4LBH A;  4MIB A;  4DV2 J;  4ECT A;  4LF5 F;  4WZQ A;  1HQU A;  4I6Y A;  2DXE A;  2XY7 A;  3M8R A;  1CQM A;  1T11 A;  2C3O A;  1GT8 A;  4ZHR B;  2MHN A;  4OX7 A;  1UL3 A;  1FER A;  1D9F A;  1T9W A;  2W9A A;  1K47 A;  4XK8 C;  1RT3 A;  3FBE A;  4TU8 A;  3R5J B;  3JAM U;  3IS9 B;  4X4T A;  4QOT A;  1XMB A;  1NRK A;  4R25 A;  3W65 A;  1AZS B;  3FQK A;  1CG2 A;  3AQP A;  2ZD1 B;  5IQ6 A;  1LWF B;  2R7R A;  1R8A A;  5A2Q Y;  1NDP A;  4QYZ K;  4FPI A;  2DCL A;  2JLE A;  1X4G A;  4LSN B;  2RJZ A;  2C22 A;  3WBZ A;  3FSX A;  1GTH A;  3GFZ A;  1VQS A;  2FD2 A;  1NDK A;  2RQ4 A;  3E2E A;  1IQZ A;  2Q66 A;  1C0U B;  3ETM A;  5KT5 A;  1TAU A;  4HVZ A;  5CYM B;  1HBO A;  1RLD A;  2JLF A;  2P9C A;  4QIF A;  3J7A N;  3TUP A;  3X1L B;  4OV1 A;  4F25 A;  2XMW A;  3CIZ A;  3EJM A;  4RW8 B;  4C0O C;  2ZBP A;  2W9C A;  1D8Z A;  1S6Q B;  3KUE A;  4PG6 A;  5F8N A;  1OQ6 A;  5JVH Q;  4JYA J;  1RT5 B;  1U1L A;  3FMB A;  1U0H A;  1F9E B;  2YQ0 A;  4U7C A;  3A8J A;  1UFK A;  4ZVG A;  3HVR A;  1HNZ J;  3D54 A;  2R7V A;  1EJ7 L;  3CCJ S;  5KG0 A;  2RDD A;  2V2Z A;  4K4T A;  3NCP A;  5KT7 A;  4FP9 A;  2GAG C;  1FNX H;  2M3D A;  4NE9 C;  3N01 A;  1QD1 A;  4ANE A;  4TU7 A;  2BM1 A;  3HD1 A;  4BWM A;  2CQ2 A;  1RU2 A;  2V2Q A;  3H0P A;  1WUU A;  2AYB A;  1VJW A;  2HK3 A;  3RW6 A;  1WG4 A;  3NEK A;  2ZIT A;  2LQJ A;  2XC9 A;  4DV5 F;  4DR1 J;  3EXC X;  1HHT P;  3KTQ A;  4ERD A;  2WB4 A;  1TK8 A;  2CNN B;  3D5M A;  2H1Y A;  4DFP A;  2HHV A;  3QBC A;  2J76 E;  3VAK A;  2ZJR Q;  1VQP S;  2MSS A;  4HT7 A;  1VBY A;  1A9N B;  1IBM J;  5KT6 A;  1JLB A;  4DR4 F;  2ADB A;  1S97 A;  4OYX A;  3NGS A;  1FKA F;  2GVZ B;  1HL6 A;  3SSR A;  2ASL A;  4QR2 A;  1NJZ A;  1Y3J A;  2FYX A;  1ZA1 B;  1CJK A;  2RKI B;  3QGG A;  3RAQ A;  2D9O A;  4RNF A;  4ED1 A;  4J9L A;  4RW9 B;  2MMY A;  4JI6 F;  4UOG A;  2GA7 A;  3EX7 B;  4AFF A;  3RR7 A;  2UXB J;  1CJU B;  2XY5 A;  1S9G A;  4F26 A;  1VHI A;  4ETX A;  2DGU A;  3UN2 A;  1UA0 A;  4JI2 J;  2PI5 A;  2UUT A;  2HGL A;  2E5I A;  1RE1 B;  2XGQ A;  2HFO A;  2P6T A;  1AA1 B;  2HLU A;  2XZD B;  5I3U B;  3F56 A;  4DR6 J;  1KQS R;  1VQM S;  2BXJ A;  5C42 B;  3PKM A;  1PKU A;  3EGN A;  2CG8 A;  1DQ8 A;  4YDD B;  4I68 A;  3K5M A;  3WZ0 A;  3GWC A;  1JLG A;  2QA1 A;  3HVT A;  1NCL A;  2GFF A;  4EFA C;  1X31 C;  3KDN A;  5IM0 A;  4DV4 F;  3THV A;  4WU3 A;  2CRL A;  4LQ3 A;  4DV0 J;  1ZS6 A;  1EZZ B;  1HBU B;  1V6H A;  1Y10 A;  1M5H A;  2BA9 A;  4M1K A;  4Z7C A;  4ZCI A;  4HR2 A;  3CED A;  5EGY A;  3MR2 A;  1U4B A;  4F7V A;  4OYP A;  4FNH A;  4QWA A;  4P7T A;  3ILL A;  3LPY A;  1APS A;  2G1H A;  2DXF A;  2PSZ A;  2FY1 A;  2V67 A;  3DHX A;  1RWV B;  3OLA A;  2ZOG A;  1EB0 A;  3DFE A;  2KHD A;  3MOJ B;  2DNM A;  4ZP9 A;  3V6H A;  3V4I B;  1N54 B;  3I5C A;  4YB5 A;  3BM7 A;  3C16 A;  3D3B J;  2ZH6 A;  4WBF A;  2DY9 A;  3OR2 B;  4WXW A;  5KG6 A;  2ZFH A;  5BJR A;  4TXS A;  3W2V B;  2AYG A;  1OY9 A;  3AB2 B;  2BUN A;  2X7I A;  3DRP B;  1S4E A;  3MCM A;  3G6E S;  2VOO A;  5F8G A;  3KHG A;  4USM A;  4RW4 B;  4XDC A;  4Y28 C;  1XTZ A;  4C2M A;  4ZVR B;  5GAG I;  1NK5 A;  3HXM A;  5J2Q A;  2DNP A;  3OUY B;  2GW8 A;  3IM8 A;  4C8Z A;  4NYP A;  2HVZ A;  1DBD A;  1JJH A;  1RTH B;  1EQM A;  4OZ3 A;  3MUV P;  4CRJ A;  2CJY B;  2XMU A;  6FD1 A;  4DS5 A;  4TLR A;  3UVJ A;  5DQH A;  2ZHA A;  2CWK A;  2B3T B;  3CDU A;  1T3O A;  3C6U A;  4ZJQ A;  4PEO A;  2LXF A;  4YEA A;  3HMJ G;  2J9E A;  1RAG B;  1TUV A; 
#chains in the Genus database with same CATH homology
 3ZNJ 1;  4LBP A;  1S7I A;  3ZNU A;  3ZO7 A;  4LBH A;  4LBI A;  1MWQ A;  4FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...