3ZNZB

Crystal structure of otulin otu domain (c129a) in complex with met1- di ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
146
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Otulin Antagonizes Lubac Signaling by Specifically Hydrolyzing met1-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN FAM105B
total genus 43
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3znzB01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3znzB02
3TMPB 3VTUA 1WJ6A 3R3MA 3KW5B 2O6VB 2OOBB 2ZNVB 4GIVA 4K7UA 2RSUA 4ANUA 3ZUNA 4BOSC 3TJPA 5JH5C 1WZ0A 4AP4C 4MELA 3V6CB 2K8BA 3R66C 5FR6A 3ZDMC 2KDBA 3RUIB 4N9F4 3WAOA 4HCPB 2CU1A 3KH0A 2IO2B 1V2YA 2N7EA 4AJWA 2DHZA 4JLCA 1J19A 2FIFA 2IO0B 3AU4A 2ZCCA 4JIOU 4TV3A 4I6NB 4FA6A 3DBRI 3PVLA 1LQBA 1P3QU 2DENB 2M17A 3B08A 4KV2A 3UIOB 2KMAA 4I6PA 3JSVA 4WWNA 3ML8A 4JGHB 4MJSA 4IWOA 4KSKC 4OVUA 3HIZA 4MGZE 2L7RA 3UINB 4BBNF 2KDFB 5D94A 2JXXA 2N9XA 4W9HA 4YL8A 1WFYA 2O2VB 1V5TA 4AOFA 4IW0A 4DHJB 3AU5A 2BWFA 3DCGA 4KIKB 1TTNA 1WGRA 1XQQA 2D10A 2JT4B 1KM7A 2V4LA 2L76A 3R7QA 2FUHB 3DVGX 1EO6A 4LJOB 2KK8A 1EF1A 3PT2B 2KFJA 1UGMA 3PSEB 2PE6B 4A20A 3CSTA 3DVNU 1C3TA 2L3ZA 3BY4B 2A4ZA 4EKUA 2D2QA 5DPSA 2D3GA 1HE8A 3L0WB 3SHQA 1RAXA 4FBJB 1WZ3A 1J8CA 1H4RA 4GOCA 3UQBA 3N3KB 4MGIE 2AWTA 3BINA 3KUDB 3EECA 1E90A 4DHZE 2XEWA 3QWZB 4G50A 2K25A 2CS4A 3IBEA 2LGXA 2DZKA 5JZEB 2N7DA 1UZXB 1P98A 3R7RA 3RCZA 1OGWA 4GSWA 2WDTB 1WX8A 1RFAA 4ANWA 3QA8A 2L8JA 1WXVA 2KLGA 3K9OB 4DBGA 2RPQA 4EZJA 1KLVA 2JVCA 2LVOA 1J0GA 4B6WA 1L2NA 1WMHA 3KUCB 2DZIA 3HHMA 5DPTA 3VUWA 2K1FA 4DHJD 1OQYA 4GDLA 5IA7A 4ICUA 2MP2B 2R2OA 4FJVB 2IO3B 2ZPNA 3N32A 2L00B 4II2B 1X1MA 2GOWA 4GGQA 4DHZB 2CR5A 1WF9A 2BYFA 3DOWA 3NY5A 4FLHA 3GOEA 2KJHB 3K9PB 4G0NB 4GN1A 3WA0A 4CYEA 2GBMA 4HPMB 4HLEA 3PPAA 2IO1B 4NPNA 3APDA 2DZMA 5L83A 1BT0A 1XT9B 3MJWA 3RZFA 4KDIC 2KFKB 3O65B 4WAAA 3JYUA 5D6JB 2DAJA 4HPLB 2RR9A 3T9LA 3WANA 4GB9A 2BPSA 2J0JA 4EZLA 3EHVA 5JHAA 2D11A 2JF5A 4PS7A 3TL5A 4TQ1A 3QHTA 2KO3A 1EF5A 5CHWA 2GBKA 4XZ4A 2KTFA 4NAWA 1V86A 1NDDA 1XD3B 3A9JA 2KKCA 2RD0A 3X0WA 3ZTDA 2R2QA 3QJZA 4HWIB 4HDOA 1GUAB 1YQBA 2A5UA 5DPWA 2KDEB 4WJPA 2AEHA 3VUXA 3L08A 2IBIB 4B95A 2YVCA 2BYEA 2HJ8A 3L54A 3APFA 1R4NI 1FXTB 3EC8A 1SIFA 2CHWA 1E8WA 3P2BA 1GC6A 4W9CA 4E3CA 1V5OA 2ZNVC 4MM3A 5L95C 4F8CB 1R4MI 2N1VA 4RM9A 3MTNB 2AYOB 1S1QB 3RYTA 4FADA 4DK5A 1WGGA 2AL6A 3RULA 2ZVOA 5E6NA 2CHXA 5BO4B 4NJ7A 3DDCB 2N1WA 3ZNZB 1C1YB 1E7UA 4M0WB 1WR6E 4A3OA 1UH6A 2KVRA 2BWES 3H7PA 2JRIB 2I1KA 5CX3A 3OJ3A 3QX1A 5DCNA 4IM2A 1P0RA 2KQ7A 2Z0DB 2JZZA 2WX1A 1M94A 2LD9A 3CSFA 4HJKA 1Y8RC 2J0MA 4K1RB 2N4FA 3CF6E 2KN5A 3IHPC 2OJRA 1TBEA 3PRPB 4IG7B 4CO7A 2LASA 1WXSA 3V6EB 2WX0A 2C5LC 4KZ0A 4MGYE 5E6OA 4FJZA 3NHEB 1WJUA 1TGZB 3A9KA 3LJ3A 3NZUA 4RM8A 1MG8A 3VH3B 3UF8A 2LRUA 1E5WA 3PTFC 2HTHA 3WAPA 1D3ZA 2L05A 2LXCA 2LRWA 3H6NA 3UGBB 4MH0E 1WE7A 3V61A 1WM3A 1V49A 4FULA 3DQVA 5J18A 2MBHA 2KWVB 3DBLI 1RLFA 2EKEC 2KDIA 4PYZA 3M95A 4WQOB 4FHJA 3L13A 1ZW7A 4ZDVA 2KC1A 2LJ5A 1U4AA 3ENEA 4FJYA 3ZNGC 4LDTD 3ZRCA 4A3PA 5D2MB 4LJPB 2XK5A 4ASWC 3PRZA 4BKSD 1WR1A 2KX3A 4W9JA 1P9DU 2NBUA 2MBEA 3D32A 2PJHA 1ISNA 2JUOA 1G6JA 2FCSA 2KLCA 4X57B 4F1SA 4LCDE 4NAWB 2O6VA 5J17A 4AWJA 1VCBA 3PS6A 4BFRA 3KUZA 3TBLD 3ZW3A 4ZYNA 2EMTA 1WJNA 4IM3A 3DBHI 2IZVB 4FHKA 4WWPA 2ZZPB 1V6EA 2K39A 2LXAA 3A9KB 2ZPYA 1NBFC 4JQWC 1I42A 2UYZB 4NY0A 4PS3A 2RGFA 3PLVA 4DWFA 3W1SC 2CHZA 2KHWB 4EUTA 1P1AA 2BKFA 4K7WA 2LI5A 2C7NB 1K8RB 2Z0EB 4GU2A 4ANXA 1IPGA 2AL3A 1YX5B 3NZSA 3IFWB 3QQ8B 2C7MB 2NVUI 3VTVA 1SGHA 2M1MA 4NQKE 4GXBA 3C0RB 2M0XA 4F7ZA 3JW0X 3PLUA 3W1SA 2WYQA 2KQSA 2KXJA 2JY6A 4IWPA 3ZKJC 4KIKA 3UQAA 3CMMB 5CHVC 2DAFA 2K8HA 3PHXB 1VD2A 3ZLZA 4HVBA 5AZFA 2IY1B 4W9KA 2EMSA 3SDLC 2MBOA 2MP2A 2KWUB 2MLBA 3U8ZA 4BOZB 2KMCA 2G4DB 4ZRIA 2KTRB 2J0KA 4K7SA 3TCAA 2KC2A 2LUEA 3T8MA 3PGEA 1KJTA 2LGDA 1OEYJ 2JPHA 5D7GA 4K81A 2JWZA 1WMHB 2MRPA 1V81A 3APCA 2KJ6A 1UELA 3ZIMA 1AARA 2FCQA 4P7IA 1E8YA 2FCNA 1GNUA 2M4NA 3RZWC 1CMXB 2FCMA 2REXA 4KZCA 1RRBA 4G11A 2PEAA 2NS5A 2G4SA 1YX6B 1Z2MA 2K6QA 1GJZA 5CHFA 3ZNHB 3Q3FA 1LFDA 2I1JA 3VQIA 3L16A 4II3B 5LXHA 2UWQA 1SE9A 2Z59B 1OTRB 4KDLB 1L7YA 3NOBA 2KOXA 3OLMD 4KVGB 3HM6X 2L0TA 4EEWA 5LXIB 1A5RA 2ZVNA 3OAWA 3AI5A 3M62B 1E8XA 1Z5SB 3A33B 1I35A 2IY0B 3H9DA 4ICVA 4EOYA 3SD5A 2KWCA 3W1YA 3A9JB 2C60A 4XC2A 3QK0A 1WX7A 5AZHA 3DVGY 3VFKA 2JRHA 2MQJA 3VTWA 4NNJB 3QAQA 3MHSD 1GG3A 4DXAB 4MJSB 3DBSA 3Q3JA 2IYDB 4FN2A 3ONSA 4ZRJA 3DPDA 1ZGUB 2GBNA 3JVZX 4EZKA 2VRRB 4AJYB 1LM8B 3KYCD 2D07B 1WIAA 1E8ZA 2O2VA 3A4RA 2KANA 3QARA 5IAAC 3VHTC 2Y5BB 5AEKB 5G2NA 5C23A 5EDSA 4HK2A 2NCNA 3HM3A 2DYBA 4OVVA 5HKHA 2B3AA 1Q5WB 3PV1A 2GBJA 3A4SC 3TIXA 3N30A 2BYVE 4RMAA 3L17A 1TZ1A 3PREA 1WXAA 4IWQA 2O6VD 2FAZA 4M8NA 3B0AA 4MGKE 4NQLB 2GBRA 1T0YA 2J7QB 3B1LX 4WJQA 2LVQA 5G55A 1IYFA 3PZDA 3VDZA 2NR2A 4IUMB 1YJ1A 3KYDD 3U7DA 2KD0A 2ASQA 3ZRFA 4J6IA 5TR5A 3DVNV 1OEYA 3PRMB 1WYWB 1JRUA 1WH3A 3GZNI 4W9GA 4KSLC 3A1QB 4GDKA 4IC7B 2FNJB 2DX5B 3VAWA 3VXWA 5KHOA 2KTRA 2C9WB 4NJ6A 2MSED 4TUUA 4G3XB 1WXMA 5DPRA 2QHOA 1KOTA 1V80A 3QCAA 4HCNB 2NPTB 2G45B 4BKGA 3AULA 1YIWA 4WJNA 2XK5B 2LGYA 2KJRA 2V1YA 2ZCBA 2HD5B 5CTRC 2V3SA 4BKTA 2LVPA 4ZRKA 3NS8A 1GC7A 3V60A 3IG3A 3JSVB 3OJ4B 4CHKA 2K6DB 3ALBA 3QIJA 2HE7A 1Q0WB 4IM0A 4HXDA 2LWPA 4LDTB 4TQ0A 2MBQA 2MX2A 4PYUA 1WGHA 2WWZA 4HDQA 3PHWB 2NPTA 3VVWB 4ANVA 3A1QA 4GDKB 4TKNA 2KFKA 4W9EA 3QC8B 4DDID 3UIPB 2MCNB 4EFOA 3L10B 4B9KA 2GMIC 3ML9A 1H8CA 3ZDTA 3KVFB 2N9EB 1IP9A 2MA9B 5C1ZA 2MWSB 2NBVB 3I3TB 3RT3B 1WGDA 4XX5A 3H7SA 1V9JA 2G3QB 2LZ6A 2XBBC 2YLMA 4JL9A 4W9FA 3S2AA 4MEMA 2KZRA 4URKA 3ZTCA 4BKSA 1WY8A 4PS8A 5AZGA 2NBWB 2KNBA 3WALA 1ZKHA 3ZO5B 3M63B 4DDGD 2BF8B 1UD7A 4MSQB 1F9JA 4WJOA 2ZJDA 1NI2A 5KHQA 1QZEA 2L0FA 1WJ4A 1YD8U 4GMVA 2PE9A 5E6PA 1PQSA 4W9IA 4BBNC 4W9DA 1LXDA 3H7PB 3RD2A 4GDLB 5LLIA 3H1UA 3WAMA 3LDZE 4BVUC 2MW5A 3EFUA 2W9NA 5J2RA 2CKHB 1WE6A 4AUQC 2PPHA 4W9LA 2KX0A 3VH4B 2MBBB 3WIMA 3M3JA 2M8SA 3SU8X 1WI0A 2DYOA 3IVFA 4I6LB 5GMVA 4MSMB 5JHBA 1WGYA 2N9PC 2BKRB 2JZ3B 1UBIA 3X23A 2FIDA 3ZVVA 4WWOA 2BGFA 2C7HA 2K8CA 4MDKE 3HK0A 2ZEQA 3VUYA 1WM2A 4E71A 1E7VA 3U30A 1WX9A 1UBQA 2DZJA 1S3SG 3ZNID 1WRDB 3V62A 3AXCA 4E74A 1EUVB 4M8MA 3ECIA 1Q1OA 2DYMA
chains in the Genus database with same CATH superfamily
3TMPB 1TKGA 2D5GA 2O6VB 2OOBB 4ANUA 4BOSC 2RSUA 1EU3A 2AQ1B 3ZDMC 3KQ4A 3ZXRA 1L0VB 5IN7A 2DHZA 2PLPA 1JWSD 2WXNA 2WU5B 4MH8A 4MM3B 4JIOU 1CJEA 3DBRI 5H8YE 1P3QU 3B08A 2CJOA 1P7FA 3BYYB 4OVUA 3HIZA 4MGZE 2L7RA 3URYA 1OFFA 4AOFA 5GXGB 3RI7C 3AU5A 2BWFA 4OZBA 1JWMD 1TTNA 1XQQA 2JT4B 1ZDXA 2L76A 4P16A 2KFJA 2RMMA 1UGMA 4A55A 2BVCA 4P1CC 4EKUA 3L0WB 1WZ3A 4LNKA 3KUDB 2RDBC 3QWZB 4YSYB 1KH0A 2LGXA 2WDQB 1UZXB 4CQNA 1L6UA 4GSWA 2TSSA 1YMHE 3MC8A 1VJKA 2KYWA 3TEXA 1WMHA 1YN5A 3VUWA 1OQYA 2L52A 4GDLA 4TSSA 4BAXA 2ZPNA 1V1OA 2OEDA 3NY5A 3GOEA 2KJHB 3K9PB 4GN1A 1WWTA 3RNGC 2KFKB 3JYUA 4HPLB 4C7ZA 3T9LA 3BK1A 4TQ1A 2GBKA 3ZYYX 1V86A 3N1ZC 2PW9A 2KKCA 4WQMA 2KDEB 1DGJA 2QMTA 3Q69A 1KFYB 3L08A 1WGKA 3I57A 1C77A 2V0GA 2W3RA 1HQRD 2MH7A 4PK1A 3APFA 3EC8A 3P1MA 3P2BA 3Q3MC 5FR3A 1V5OA 4MM3A 5L95C 4LLGM 4RM9A 3MTNB 2JX5A 1K51A 2AYOB 5HG2A 4FADA 1IGCA 4DK5A 3RULA 4YXDB 5E6NA 1I7HA 4NJ7A 3DHHC 1MI0A 3ZNZB 2VZKB 1E7UA 3QX1A 1P0RA 2KQ7A 3CSFA 2OJWA 2J42A 1L0XB 2KN5A 1TBEA 4IG7B 3AV8A 4KZ0A 4MGYE 1N6ZA 4ZHOA 2KDMA 4FJZA 3NHEB 1TGZB 1MG8A 2WLBA 1R4NB 1NI3A 1A70A 1SJED 3PTFC 2EELA 2L05A 4HEA1 3UGBB 1WE7A 1WM3A 1V49A 4L2YA 4P6VF 2AQ3B 1FRRA 1RLFA 2W54A 2KDIA 3TEZA 4PYZA 4C00A 4ZDVA 4FHJA 3L13A 4ZRQA 1ET6A 1YQ3B 3H8HA 4LJPB 4BKSD 2KX3A 2N9KA 1P9DU 2MBEA 2WXLA 1ISNA 1UF0A 2KLCA 4AWJA 4BFRA 3ZW3A 3U7ZA 2BS4B 5EE9A 2IZVB 1FM0D 1NBFC 4OHJA 2KHWB 4K7WA 3ABVB 1VLBA 4ANXA 2AL3A 1YX5B 2IJ0A 3VTVA 3C0RB 2KAJA 2L32A 3W1SA 1C4AA 3RN9C 4IWPA 3ZKJC 2KWDA 5CHVC 4B0EA 2IY1B 2MJ3A 3SDLC 2MLBA 5T8IA 2KTRB 2J0KA 4OW0A 2LGDA 1OEYJ 4EE2A 2KJ6A 4K3CA 4JX1C 4P7IA 2FCNA 3IT6B 4G11A 2NS5A 3EA6A 1YOVB 3N1YC 3VQIA 1SEBD 4II3B 5LXHA 2UWQA 1OTRB 2KOXA 3EGRA 2WXHA 3A33B 2IPKD 3A9JB 4XC2A 2W55A 3QK0A 3SEBA 2JRHA 1VDVA 3MHSD 4HKQA 1GB4A 3DPDA 1ZGUB 1FO4A 1D5XC 2HJ1A 3JVZX 3SFDB 2VRRB 1TIFA 5IAAC 3VHTC 3AEBB 5EDSA 5H92C 4HK2A 2NCNA 3HM3A 4S17A 3A4SC 3TIXA 2BYVE 4RMAA 3WCQA 3Q8AA 3RFZB 2GBRA 2J7QB 4WJQA 2NR2A 3U7DA 5TR5A 1OEYA 1E7PB 4W9GA 1WH3A 3VXWA 2KTRA 2C9WB 2MSED 2GB1A 4TUUA 2N0SB 3TEWA 5EE3A 4BKGA 1I4XA 1T0SC 2LGYA 3LB8C 2KJRA 2HD5B 3Q14C 2V3SA 2N9LA 1ZXIA 3N1XC 4ZRKA 3OJ4B 1Q0WB 4XWTA 5I4DA 2KACA 4PYUA 4DXFA 4HDQA 3VVWB 1LO5D 2PVOD 1MJDA 1P7EA 3QC8B 3UIPB 2LHDA 4B0MA 1ACCA 2GMIC 1H8CA 2N9EB 2MA9B 2MWSB 1L5PA 4W9FA 1V9JA 2LZ6A 3R2IA 2KZRA 4URKA 2IGGA 1WY8A 1TZOA 4AQ7A 2NBWB 2BF8B 3FC4A 1ZPSA 4WJOA 2L0FA 1HZ5A 2QCZA 3BIID 3BK2A 2PE9A 2WQYB 3VR8B 1PQSA 4W9IA 3H7PB 5LLIA 3WAMA 3Q8BA 2DBYA 3AEGB 2GI9A 2CKHB 1WE6A 1ZXHA 5EE0A 3VH4B 2I38A 3M3JA 3AH7A 5JHBA 1WGYA 2N9PC 2ZEQA 1E7VA 3U30A 1S3SG 3AXCA 1EUVB 4AP4C 3ECIA 3VTUA 1WJ6A 3R3MA 3KW5B 2ZNVB 4K7UA 1WZ0A 4JWSC 2VH1A 3AEAB 2KMMA 3N20C 3FILA 3R66C 3T3NA 2KDBA 3RUIB 2CU1A 2IO2B 2N7EA 3AEEB 2WXIA 3KWLA 1J19A 3ZJVA 3PVLA 1LQBA 3UIOB 2KMAA 3ML8A 3Q8EA 4MJSA 4IWOA 3UINB 1QOGA 3OWEB 2WXQA 4BBNF 2BS2B 1PFDA 2JXXA 4W9HA 1HTQA 4YL8A 1YN3A 4AS1A 1V5TA 3ETRA 1STEA 4ARIA 2FUHB 3DVGX 4N59A 2INNE 3PT2B 4HPPA 2PE6B 2YEPB 2BTEA 1TY2A 2D2QA 3SHQA 2QDFA 1J8CA 1H4RA 4GOCA 4NJCA 3UQBA 2AWTA 3BINA 3EECA 4O1NA 2K25A 2CS4A 1OGWA 2Z8LA 4ANWA 3AECB 1WXVA 2KLGA 1KLVA 2JVCA 1GB1A 2LVOA 2DZIA 4DHJD 4ICUA 1SB3C 3N32A 4II2B 2CR5A 2HTME 2GBMA 4YSXB 1T0QC 2IO1B 3PPAA 3APDA 1N60A 2DZMA 4K3BA 5L83A 3RZFA 4WAAA 5D6JB 4M01A 4GB9A 4EZLA 3EHVA 1BMLC 4PS7A 2KO3A 5CHWA 1FD6A 2V3NA 1NDDA 1XD3B 2R2QA 2E6XA 2RDHA 3NZ3A 1GUAB 5DPWA 2INCC 1MHHE 3BVZA 4ITKA 3I5JC 1DOXA 3UI3A 2BYEA 2HJ8A 3L54A 1FXTB 1N63A 3IT4B 1SIFA 4M00A 1E8WA 2ZNVC 1I4QA 3RNEC 2AL6A 4LK0M 2ZVOA 3Q8FA 5D3IB 5BO4B 1UWXA 2INDC 1NYQA 1DOYA 4Q2JA 4OVZA 3ZJUA 2I1KA 1T3QA 2WX1A 4HJKA 2D3AA 2AQ2B 1B1ZA 2LASA 4XGAB 1M4VA 5IO9A 1WXSA 2C5LC 1KF6B 1QILA 4OZCA 1WJUA 3LJ3A 3UF8A 2HTHA 2IGHA 3WAPA 1D3ZA 2JZPA 2LRWA 2NTTA 3FKYA 1HTOA 4LTUA 1Q10A 1SE4A 3AB5A 3ENEA 3ZNGC 2RDGA 5D2MB 2XK5A 4W9JA 4GLSC 1HXYD 1NVID 4FXCA 1TJEA 3P4QB 1G6JA 2FCSA 4X57B 1JCKB 2O6VA 5J17A 1WJNA 4IM3A 1FCLA 2ZZPB 1V6EA 3A9KB 1N5XA 4JQWC 4NY0A 4DWFA 4EUTA 1K8RB 2FE8A 3IFWB 1EM7A 3QQ8B 2NVUI 1SGHA 4WAFA 4F7ZA 4BZAA 1BXTA 2KQSA 4USAA 5HHDG 3UQAA 2DAFA 1EU4A 1VD2A 3PHXB 2WXFA 5AZFA 4W9KA 1FXAA 2MBOA 3U8ZA 1OQRA 3T8MA 4K7SA 2ZW1A 5D7GA 2MRPA 1V81A 3APCA 2Y3AA 2FCQA 3T3OA 2B76B 1PGXA 2M4NA 2REXA 4LNNA 2PEAA 2G4SA 1YX6B 2K6QA 5CHFA 3ZNHB 3Q3FA 1FCCC 1V1PB 1LFDA 2MJDA 3L16A 1YQ4B 1L7YA 4KVGB 3O13A 2L0TA 1Z5SB 4ICVA 2JQRB 1K53A 5AZHA 3DVGY 4NNJB 1GG3A 4DXAB 3Q3JA 1ZUD2 2IYDB 1WYGA 4A90A 1ZOYB 3BYTB 3DHGC 3OG5A 4AJYB 1XLOA 2D07B 3C19A 4RF0A 3A4RA 3P63A 2JYTA 4P1BC 2Y5BB 5AEKB 5G2NA 2QIEB 4OVVA 2B3AA 3PV1A 2GBJA 4HROA 4QAYA 2G9HD 5LNK1 1WXAA 2FAZA 3B0AA 1IYFA 2LVQA 1JROA 3PZDA 3VDZA 1IGDA 4IUMB 1BUIC 1YJ1A 2ASQA 3ZRFA 2SEBD 3W5VB 2CJNA 1VZ6A 3NS1A 1WYWB 3MHZA 2V4IB 3A1QB 4GDKA 1R7SA 2PVGC 4IC7B 4XWWA 4HJGE 1ET9A 4NJ6A 1V80A 3QCAA 3AULA 4WJNA 2WXOA 2V1YA 2ZCBA 2HDEA 4BKTA 3NS8A 3P42A 5HI1A 4D2KA 1CK1A 3ALBA 1SF0A 4IM0A 3HVDA 3W2DA 5BYSA 2Y5PA 3GE8C 3NVYA 2MX2A 1WGHA 2IDYA 1E0ZA 2NPTA 4RGNA 5JXVA 1SJHD 2WXKA 2JXTA 4DQOC 2KFKA 4W9EA 4DDID 3V3XA 3L10B 1PDXA 1K52A 3KVFB 3W9CB 1IP9A 1F52A 4XX5A 3H7SA 2YLMA 2XBBC 4RH6A 1DOIA 1RM6C 3ZTCA 1WSPA 3WALA 4DDGD 1JWUD 1L4DB 1UD7A 2BB6A 4MSQB 4S0RA 3SR6A 4JWUC 4WIPA 1NI2A 1QZEA 4ZOHC 4W9DA 4XDCA 1LXDA 1C79A 1ESFA 3EFUA 2WHIA 4W9LA 3WIMA 2M56B 2MJEA 2J4XA 5GMVA 4I6LB 4MSMB 3X23A 3HK0A 3VUYA 4HKZE 3ZNID 4E74A 2Q5WD 1MVKA 4M8MA 2R2OA 2DYMA 4US9A 4GIVA 3ZUNA 5FK9C 3U52E 2V3PA 3NVWA 4HCPB 1V2YA 5AUIA 4JLCA 1XF5L 3Q8CA 2FUG1 2IO0B 3AU4A 2ZCCA 1QF6A 4KV2A 2M17A 3JSVA 1B9RA 4JGHB 1CQVA 2KDFB 4IDIA 1WFYA 2VH2A 3NRZA 3DCGA 4KIKB 2D10A 1WGRA 1XXGA 2V4LA 1SE3A 2AX5A 4N6EB 4XDDA 1UGJA 1EO6A 4LJOB 2KK8A 1EF1A 3PSEB 1F2RC 3CSTA 3BY4B 2A4ZA 5DPSA 1HE8A 3N3KB 1L0YB 4MGIE 4DHZE 2XEWA 4G50A 1FNWA 2N7DA 1P98A 3RNBC 3AEDB 3QA8A 2L8JA 3K9OB 4DBGA 2RPQA 3KLSX 1ZE3D 1J0GA 1L2NA 5DPTA 2V9HA 2IO3B 1I4GA 2GOWA 4GGQA 4RGMA 2ACZB 1WF9A 3DOWA 4FLHA 1RWSA 4G0NB 3LXFA 1V1PA 1BT0A 1XT9B 4KDIC 1VRAB 4WWMA 3L4PA 3WANA 2BPSA 3NJTA 5JHAA 2JF5A 1PYWD 3QHTA 1EF5A 4IOIE 4NAWA 3A9JA 2RD0A 3ZTDA 4LNOA 3X0WA 4A6QA 2JWUA 1GOZA 1YQBA 1T6BX 2MEKA 3LYYA 2AEHA 2JSVX 3TEYA 1IBXB 2IBIB 4B95A 2YVCA 4A9AA 2CHWA 2QSDA 1GC6A 4F8CB 2N1VA 3R8BA 3B9JA 1S1QB 3RYTA 1WGGA 4RF1A 2LJIA 2CHXA 3DDCB 2FBWB 2N1WA 3DWGC 1QOAA 4C4VB 1C1YB 1WR6E 3EUB2 1UH6A 3H7PA 2BWES 4A3OA 2JRIB 2WNMA 1F77A 3EFCA 3OJ3A 5DCNA 2J52A 4MACA 2Z0DB 2J53A 2LD9A 2J0MA 4K1RB 2N4FA 3CF6E 2OJRA 1KRHA 1JWBD 4CO7A 3V6EB 2WX0A 4R3DA 1SSNA 3AMZA 5E6OA 3MJ5A 2QC8A 3NZUA 2LRUA 4XYCA 4MH0E 3V61A 3DQVA 2MBHA 1QT9A 3DBLI 2EKEC 4J3OD 2K22A 5TSSA 4WQOB 1ZW7A 3GS2A 4FJYA 2LJ5A 1U4AA 4LDTD 4A3PA 1WR1A 4XE0A 4M02A 2PJHA 2JUOA 1N5WA 1VCBA 1AYFA 3FILB 3AE6B 2EMTA 4ZYNA 1SBBB 3RNFC 4ARCA 3DBHI 4FHKA 4WWPA 2K39A 2LXAA 2PMVA 1I42A 2NMQA 2RGFA 3PLVA 3W1SC 1TS5A 3AE7B 2C7NB 2Z0EB 4GU2A 5C3JB 3NZSA 3JW0X 4YTPB 3AN1A 2GLSA 2KXJA 2JY6A 4C56C 5G5GA 3CMMB 2K8HA 3ZLZA 2WXRA 2KWUB 3U2SC 1KLGD 4WURA 3RNCC 2G4DB 4ZRIA 3TCAA 2LUEA 2BW2A 3ZXVA 3Q3OC 2JWZA 1FXIA 1WMHB 2VZKD 2KN4A 1CMXB 1UWMA 4KZCA 4L1BA 2LGSA 1RRBA 1FPYA 1GJZA 2XN9C 3DBRB 2Z59B 3E56A 4KDLB 2LGIA 3NOBA 5LXIB 4EEWA 3HM6X 3V05A 5E6JA 3OAWA 2WXGA 3M62B 4UDUC 5IP4D 2IY0B 4EOYA 2KWCA 3IAS1 2INPE 3C8YA 4KGRA 1EWYC 1EWCA 1QQRA 3QAQA 1DYQA 4MJSB 4FN2A 4ZRJA 2GBNA 1FMAD 2K0PA 3KYCD 1LM8B 1WIAA 2O2VA 1LGRA 3QARA 4JPSA 2EKIA 5C23A 2WXMA 5HKHA 1QOFA 2DNFA 1TZ1A 3RPFC 3Q3NC 4NQLB 3B1LX 2WGSA 2JYEA 2KD0A 1MPEA 1JRUA 3GZNI 4KSLC 2R61A 2WDRB 2DX5B 3VAWA 5KHOA 1HA5A 2QHOA 3P4SB 2PTLA 4HCNB 1C78A 2NPTB 2G45B 1UNSA 2M0AA 2LHEA 2H88B 4ZYSA 2LVPA 3GE3C 3V60A 3IG3A 1XCTL 3JSVB 2K6DB 1IBXA 3DWMA 2HE7A 4HXDA 2LWPA 4TQ0A 3NG0A 2LMCA 4ANVA 1SXTA 2DLBA 3A1QA 4GDKB 2QEJC 4TKNA 1T5XD 3VR9B 2MCNB 4EFOA 1J7BA 2WXJA 3ZDTA 3GP7A 4A8XC 4LNFA 3I3TB 1WGDA 2G3QB 4YTNB 1XCQL 1C76A 3I63C 1E10A 1I4HA 1ZKHA 4LNIA 1F9JA 3VRAB 3VRBB 5KHQA 3ZQ4A 1WJ4A 4YT0B 5E6PA 1J7CA 1HEZE 1JWAD 1K50A 2PKOA 3H1UA 1D6EC 2ON8A 3LDZE 2MW5A 2W9NA 5J2RA 1N62A 2CU3A 2Y5CA 2PPHA 4NZLB 2MBBB 5FKAC 1WI0A 2DYOA 3IVFA 4NAMA 3ZVVA 2BKRB 3E9SA 1UBIA 4WWOA 2BGFA 1XLNA 2C7HA 4MDKE 1L4ZB 1WX9A 1UBQA 2DZJA 1WRDB 3V62A 1Q1OA 1D4BA 4FBJB 5JH5C 1FRDA 3TJPA 3B2GA 3P4RB 4MELA 3V6CB 2K8BA 5FR6A 5AUKA 4N9F4 3WAOA 3KH0A 4AJWA 2PIAA 2FIFA 4KX6B 4I6NB 4TV3A 3RNAC 4FA6A 2DENB 3MC9A 4I6PA 4WWNA 1NEKB 1GPXA 1QLBB 4KSKC 5G5HA 3CWIA 3Q6BA 1CZPA 4C80A 2GRIA 2N9XA 5D94A 1JMLA 4TMAB 2O2VB 1TS4A 4IW0A 2DWQA 4DHJB 3TUOA 1I4RA 3R7QA 1KM7A 2LUMA 2X38A 2XNAC 1QKZA 2N7JA 1VR9A 4A20A 1WRIA 3DVNU 1C3TA 3AE9B 2L3ZA 4RFBA 3MC0B 2D3GA 1RAXA 3GB1A 3W5UB 1E90A 3IBEA 2DZKA 5JZEB 3R7RA 3RCZA 2WDTB 1WX8A 2W82A 1RFAA 2IGDA 3KWVA 1ENFA 3AE3B 1XLQA 4DXGA 4EZJA 4B6WA 1OQQA 3KUCB 3IAM1 3HHMA 2K1FA 5IA7A 2MP2B 4FJVB 2L00B 1X1MA 4DHZB 1MG4A 1FNUA 2BYFA 3DBHB 3SFEB 3WA0A 4CYEA 2H89B 2QILA 4HPMB 4HLEA 1V97A 3B2FA 4NPNA 3MJWA 3O65B 2DAJA 4PT5A 2RR9A 5MPOA 3BZDB 2J0JA 2D11A 3TL5A 1UUPA 2D3CA 4KKJA 4XZ4A 2KTFA 4YWGG 4RGTA 3QJZA 1ZP0B 2L1AA 1WXQA 3DBLB 3FAHA 4HDOA 2A5UA 3PZ7A 4HWIB 4WJPA 4RGOS 4ZHPA 3VUXA 3AE2B 1R4NI 1FNVA 3CIRB 1ZDVA 4W9CA 4E3CA 1FFVA 1R4MI 1TT5B 1C4PA 1RFKA 2OHFA 3TSSA 1VZ8A 1L6VA 5BYQA 2KT7A 4M0WB 3NUHB 1F1HA 2KVRA 5CX3A 1XEEA 4IKGA 4IM2A 2JZZA 1M94A 1Y8RC 4ZRPA 2BT6A 2BQQA 3IHPC 3PRPB 2NTSA 2KQ4X 1N61A 1R4MB 1MFWA 3A9KA 4RM8A 3VH3B 1E5WA 2LXCA 3H6NA 3HUIA 4N58A 4FULA 5J18A 4REZA 2KWVB 1ROEA 4WH4A 3M95A 2WU2B 2KC1A 3ZRCA 5BMHA 2YEPF 2ONQA 4ASWC 3PRZA 2NBUA 3BVGA 4YTMB 1YJIA 3D32A 5BYRA 1JW9D 4F1SA 3AE4B 4LCDE 4NAWB 2WS3B 3PS6A 1JRPA 3KUZA 3TBLD 2ZW0A 1PGBA 1D5MC 1JQ4A 1D5ZC 2ZPYA 2UYZB 1XO3A 4PS3A 5BMIA 2CHZA 1P1AA 2BKFA 1J7AA 2KVZA 2LI5A 2WDVB 1IPGA 2G1EA 4MT5A 4L23A 2C7MB 2M1MA 4NQKE 4GXBA 2M0XA 3AM9A 3PLUA 3Q2AC 2SAKA 5C2TB 2LEKA 2WYQA 1FEHA 1SE2A 4C4VA 4KIKA 4HVBA 2EMSA 2MP2A 4BOZB 2KMCA 2KC2A 3PGEA 1KJTA 1HZ6A 3IXSA 1TS2A 2UU7A 2JPHA 3PO0A 4K81A 1RYJA 3I9V1 1Y56A 1UELA 3RMKC 3ZIMA 1AARA 3AE5B 3PZ8A 1E8YA 1GNUA 3J9CA 3RZWC 2FCMA 1E9MA 3HVZA 5IOIA 2WP9B 1Z2MA 4KGTA 2I1JA 2I2YA 5BMGA 1KTKA 1AWDA 3ZGZA 1SE9A 3OLMD 1A5RA 1YN4A 4YSZB 2ZVNA 3ZJTA 3AI5A 1E6EB 1E8XA 1I35A 3NVVA 3H9DA 4JE3B 3SD5A 3W1YA 1AW7A 2C60A 3BVMA 4C7YA 1WX7A 2K3UA 3VFKA 1VZ7A 2MQJA 3VTWA 1NENB 3DBSA 3ONSA 2WXPA 1XLPA 4EZKA 2BYTA 1F0ZA 1E8ZA 1FIQA 1FFUA 2KANA 1F2RI 1T0RC 2K9XA 2DYBA 2RPVA 1Q5WB 4KGSA 3N30A 1JALA 3BWUD 3L17A 3PREA 4IWQA 2O6VD 4M8NA 4MGKE 1TKYA 1T0YA 5G55A 1YNTE 2MHJA 2L83A 3KYDD 5IKCM 4J6IA 2K5PA 1TS3A 3DVNV 1TKEA 3PRMB 4HRSA 2FNJB 2D3BA 3MP9A 3R2TA 4G3XB 1WXMA 5DPRA 5D3DA 1KOTA 1GAQB 4M0WA 1YIWA 2XK5B 1V8CA 4KKIA 5CTRC 3U4EG 1PGAA 3AE1B 5EE1A 1GC7A 4CHKA 5HFYA 3AE8B 3QIJA 1I4PA 4US8A 4H2AA 4LDTB 1MHXA 2MBQA 2WWZA 3PHWB 2E3TA 1KLUD 1NYRA 4B9KA 3ML9A 3AEFB 1IUEA 5C1ZA 2NBVB 1QOBA 3RT3B 4ACFA 4JL9A 3S2AA 1SIJA 4MEMA 1C4CA 1TYGB 4BKSA 4PS8A 5AZGA 1YJJA 2X8XX 2KNBA 3ZO5B 3M63B 2LFIA 4RCOA 2ZJDA 3GZNB 1YD8U 4GMVA 1TY0A 3HRDD 2JU6X 4RNAA 4BBNC 2BS3B 2BB5A 3RD2A 4GDLB 1AN8A 4BVUC 4AUQC 3DHIC 2M19A 3NVZA 2KX0A 3MFGA 2QJLA 3N9YC 2M8SA 3SU8X 2JZ3B 2FIDA 3P4PB 2K8CA 1C9FA 4OZAA 2ICIA 4E71A 1WM2A 2W3SA 1PUTA 2BBCA
chains in the Genus database with same CATH topology
3TMPB 3VTUA 1WJ6A 3R3MA 3KW5B 2O6VB 2OOBB 2ZNVB 4GIVA 4K7UA 2RSUA 4ANUA 3ZUNA 4BOSC 3TJPA 5JH5C 1WZ0A 4AP4C 4MELA 3V6CB 2K8BA 3R66C 5FR6A 3ZDMC 2KDBA 3RUIB 4N9F4 3WAOA 4HCPB 2CU1A 3KH0A 2IO2B 1V2YA 2N7EA 4AJWA 2DHZA 4JLCA 1J19A 2FIFA 2IO0B 3AU4A 2ZCCA 4JIOU 4TV3A 4I6NB 4FA6A 3DBRI 3PVLA 1LQBA 1P3QU 2DENB 2M17A 3B08A 4KV2A 3UIOB 2KMAA 4I6PA 3JSVA 4WWNA 3ML8A 4JGHB 4MJSA 4IWOA 4KSKC 4OVUA 3HIZA 4MGZE 2L7RA 3UINB 4BBNF 2KDFB 5D94A 2JXXA 2N9XA 4W9HA 4YL8A 1WFYA 2O2VB 1V5TA 4AOFA 4IW0A 4DHJB 3AU5A 2BWFA 3DCGA 4KIKB 1TTNA 1WGRA 1XQQA 2D10A 2JT4B 1KM7A 2V4LA 2L76A 3R7QA 2FUHB 3DVGX 1EO6A 4LJOB 2KK8A 1EF1A 3PT2B 2KFJA 1UGMA 3PSEB 2PE6B 4A20A 3CSTA 3DVNU 1C3TA 2L3ZA 3BY4B 2A4ZA 4EKUA 2D2QA 5DPSA 2D3GA 1HE8A 3L0WB 3SHQA 1RAXA 4FBJB 1WZ3A 1J8CA 1H4RA 4GOCA 3UQBA 3N3KB 4MGIE 2AWTA 3BINA 3KUDB 3EECA 1E90A 4DHZE 2XEWA 3QWZB 4G50A 2K25A 2CS4A 3IBEA 2LGXA 2DZKA 5JZEB 2N7DA 1UZXB 1P98A 3R7RA 3RCZA 1OGWA 4GSWA 2WDTB 1WX8A 1RFAA 4ANWA 3QA8A 2L8JA 1WXVA 2KLGA 3K9OB 4DBGA 2RPQA 4EZJA 1KLVA 2JVCA 2LVOA 1J0GA 4B6WA 1L2NA 1WMHA 3KUCB 2DZIA 3HHMA 5DPTA 3VUWA 2K1FA 4DHJD 1OQYA 4GDLA 5IA7A 4ICUA 2MP2B 2R2OA 4FJVB 2IO3B 2ZPNA 3N32A 2L00B 4II2B 1X1MA 2GOWA 4GGQA 4DHZB 2CR5A 1WF9A 2BYFA 3DOWA 3NY5A 4FLHA 3GOEA 2KJHB 3K9PB 4G0NB 4GN1A 3WA0A 4CYEA 2GBMA 4HPMB 4HLEA 3PPAA 2IO1B 4NPNA 3APDA 2DZMA 5L83A 1BT0A 1XT9B 3MJWA 3RZFA 4KDIC 2KFKB 3O65B 4WAAA 3JYUA 5D6JB 2DAJA 4HPLB 2RR9A 3T9LA 3WANA 4GB9A 2BPSA 2J0JA 4EZLA 3EHVA 5JHAA 2D11A 2JF5A 4PS7A 3TL5A 4TQ1A 3QHTA 2KO3A 1EF5A 5CHWA 2GBKA 4XZ4A 2KTFA 4NAWA 1V86A 1NDDA 1XD3B 3A9JA 2KKCA 2RD0A 3X0WA 3ZTDA 2R2QA 3QJZA 4HWIB 4HDOA 1GUAB 1YQBA 2A5UA 5DPWA 2KDEB 4WJPA 2AEHA 3VUXA 3L08A 2IBIB 4B95A 2YVCA 2BYEA 2HJ8A 3L54A 3APFA 1R4NI 1FXTB 3EC8A 1SIFA 2CHWA 1E8WA 3P2BA 1GC6A 4W9CA 4E3CA 1V5OA 2ZNVC 4MM3A 5L95C 4F8CB 1R4MI 2N1VA 4RM9A 3MTNB 2AYOB 1S1QB 3RYTA 4FADA 4DK5A 1WGGA 2AL6A 3RULA 2ZVOA 5E6NA 2CHXA 5BO4B 4NJ7A 3DDCB 2N1WA 3ZNZB 1C1YB 1E7UA 4M0WB 1WR6E 4A3OA 1UH6A 2KVRA 2BWES 3H7PA 2JRIB 2I1KA 5CX3A 3OJ3A 3QX1A 5DCNA 4IM2A 1P0RA 2KQ7A 2Z0DB 2JZZA 2WX1A 1M94A 2LD9A 3CSFA 4HJKA 1Y8RC 2J0MA 4K1RB 2N4FA 3CF6E 2KN5A 3IHPC 2OJRA 1TBEA 3PRPB 4IG7B 4CO7A 2LASA 1WXSA 3V6EB 2WX0A 2C5LC 4KZ0A 4MGYE 5E6OA 4FJZA 3NHEB 1WJUA 1TGZB 3A9KA 3LJ3A 3NZUA 4RM8A 1MG8A 3VH3B 3UF8A 2LRUA 1E5WA 3PTFC 2HTHA 3WAPA 1D3ZA 2L05A 2LXCA 2LRWA 3H6NA 3UGBB 4MH0E 1WE7A 3V61A 1WM3A 1V49A 4FULA 3DQVA 5J18A 2MBHA 2KWVB 3DBLI 1RLFA 2EKEC 2KDIA 4PYZA 3M95A 4WQOB 4FHJA 3L13A 1ZW7A 4ZDVA 2KC1A 2LJ5A 1U4AA 3ENEA 4FJYA 3ZNGC 4LDTD 3ZRCA 4A3PA 5D2MB 4LJPB 2XK5A 4ASWC 3PRZA 4BKSD 1WR1A 2KX3A 4W9JA 1P9DU 2NBUA 2MBEA 3D32A 2PJHA 1ISNA 2JUOA 1G6JA 2FCSA 2KLCA 4X57B 4F1SA 4LCDE 4NAWB 2O6VA 5J17A 4AWJA 1VCBA 3PS6A 4BFRA 3KUZA 3TBLD 3ZW3A 4ZYNA 2EMTA 1WJNA 4IM3A 3DBHI 2IZVB 4FHKA 4WWPA 2ZZPB 1V6EA 2K39A 2LXAA 3A9KB 2ZPYA 1NBFC 4JQWC 1I42A 2UYZB 4NY0A 4PS3A 2RGFA 3PLVA 4DWFA 3W1SC 2CHZA 2KHWB 4EUTA 1P1AA 2BKFA 4K7WA 2LI5A 2C7NB 1K8RB 2Z0EB 4GU2A 4ANXA 1IPGA 2AL3A 1YX5B 3NZSA 3IFWB 3QQ8B 2C7MB 2NVUI 3VTVA 1SGHA 2M1MA 4NQKE 4GXBA 3C0RB 2M0XA 4F7ZA 3JW0X 3PLUA 3W1SA 2WYQA 2KQSA 2KXJA 2JY6A 4IWPA 3ZKJC 4KIKA 3UQAA 3CMMB 5CHVC 2DAFA 2K8HA 3PHXB 1VD2A 3ZLZA 4HVBA 5AZFA 2IY1B 4W9KA 2EMSA 3SDLC 2MBOA 2MP2A 2KWUB 2MLBA 3U8ZA 4BOZB 2KMCA 2G4DB 4ZRIA 2KTRB 2J0KA 4K7SA 3TCAA 2KC2A 2LUEA 3T8MA 3PGEA 1KJTA 2LGDA 1OEYJ 2JPHA 5D7GA 4K81A 2JWZA 1WMHB 2MRPA 1V81A 3APCA 2KJ6A 1UELA 3ZIMA 1AARA 2FCQA 4P7IA 1E8YA 2FCNA 1GNUA 2M4NA 3RZWC 1CMXB 2FCMA 2REXA 4KZCA 1RRBA 4G11A 2PEAA 2NS5A 2G4SA 1YX6B 1Z2MA 2K6QA 1GJZA 5CHFA 3ZNHB 3Q3FA 1LFDA 2I1JA 3VQIA 3L16A 4II3B 5LXHA 2UWQA 1SE9A 2Z59B 1OTRB 4KDLB 1L7YA 3NOBA 2KOXA 3OLMD 4KVGB 3HM6X 2L0TA 4EEWA 5LXIB 1A5RA 2ZVNA 3OAWA 3AI5A 3M62B 1E8XA 1Z5SB 3A33B 1I35A 2IY0B 3H9DA 4ICVA 4EOYA 3SD5A 2KWCA 3W1YA 3A9JB 2C60A 4XC2A 3QK0A 1WX7A 5AZHA 3DVGY 3VFKA 2JRHA 2MQJA 3VTWA 4NNJB 3QAQA 3MHSD 1GG3A 4DXAB 4MJSB 3DBSA 3Q3JA 2IYDB 4FN2A 3ONSA 4ZRJA 3DPDA 1ZGUB 2GBNA 3JVZX 4EZKA 2VRRB 4AJYB 1LM8B 3KYCD 2D07B 1WIAA 1E8ZA 2O2VA 3A4RA 2KANA 3QARA 5IAAC 3VHTC 2Y5BB 5AEKB 5G2NA 5C23A 5EDSA 4HK2A 2NCNA 3HM3A 2DYBA 4OVVA 5HKHA 2B3AA 1Q5WB 3PV1A 2GBJA 3A4SC 3TIXA 3N30A 2BYVE 4RMAA 3L17A 1TZ1A 3PREA 1WXAA 4IWQA 2O6VD 2FAZA 4M8NA 3B0AA 4MGKE 4NQLB 2GBRA 1T0YA 2J7QB 3B1LX 4WJQA 2LVQA 5G55A 1IYFA 3PZDA 3VDZA 2NR2A 4IUMB 1YJ1A 3KYDD 3U7DA 2KD0A 2ASQA 3ZRFA 4J6IA 5TR5A 3DVNV 1OEYA 3PRMB 1WYWB 1JRUA 1WH3A 3GZNI 4W9GA 4KSLC 3A1QB 4GDKA 4IC7B 2FNJB 2DX5B 3VAWA 3VXWA 5KHOA 2KTRA 2C9WB 4NJ6A 2MSED 4TUUA 4G3XB 1WXMA 5DPRA 2QHOA 1KOTA 1V80A 3QCAA 4HCNB 2NPTB 2G45B 4BKGA 3AULA 1YIWA 4WJNA 2XK5B 2LGYA 2KJRA 2V1YA 2ZCBA 2HD5B 5CTRC 2V3SA 4BKTA 2LVPA 4ZRKA 3NS8A 1GC7A 3V60A 3IG3A 3JSVB 3OJ4B 4CHKA 2K6DB 3ALBA 3QIJA 2HE7A 1Q0WB 4IM0A 4HXDA 2LWPA 4LDTB 4TQ0A 2MBQA 2MX2A 4PYUA 1WGHA 2WWZA 4HDQA 3PHWB 2NPTA 3VVWB 4ANVA 3A1QA 4GDKB 4TKNA 2KFKA 4W9EA 3QC8B 4DDID 3UIPB 2MCNB 4EFOA 3L10B 4B9KA 2GMIC 3ML9A 1H8CA 3ZDTA 3KVFB 2N9EB 1IP9A 2MA9B 5C1ZA 2MWSB 2NBVB 3I3TB 3RT3B 1WGDA 4XX5A 3H7SA 1V9JA 2G3QB 2LZ6A 2XBBC 2YLMA 4JL9A 4W9FA 3S2AA 4MEMA 2KZRA 4URKA 3ZTCA 4BKSA 1WY8A 4PS8A 5AZGA 2NBWB 2KNBA 3WALA 1ZKHA 3ZO5B 3M63B 4DDGD 2BF8B 1UD7A 4MSQB 1F9JA 4WJOA 2ZJDA 1NI2A 5KHQA 1QZEA 2L0FA 1WJ4A 1YD8U 4GMVA 2PE9A 5E6PA 1PQSA 4W9IA 4BBNC 4W9DA 1LXDA 3H7PB 3RD2A 4GDLB 5LLIA 3H1UA 3WAMA 3LDZE 4BVUC 2MW5A 3EFUA 2W9NA 5J2RA 2CKHB 1WE6A 4AUQC 2PPHA 4W9LA 2KX0A 3VH4B 2MBBB 3WIMA 3M3JA 2M8SA 3SU8X 1WI0A 2DYOA 3IVFA 4I6LB 5GMVA 4MSMB 5JHBA 1WGYA 2N9PC 2BKRB 2JZ3B 1UBIA 3X23A 2FIDA 3ZVVA 4WWOA 2BGFA 2C7HA 2K8CA 4MDKE 3HK0A 2ZEQA 3VUYA 1WM2A 4E71A 1E7VA 3U30A 1WX9A 1UBQA 2DZJA 1S3SG 3ZNID 1WRDB 3V62A 3AXCA 4E74A 1EUVB 4M8MA 3ECIA 1Q1OA 2DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMP B;  3VTU A;  1WJ6 A;  3R3M A;  3KW5 B;  2O6V B;  2OOB B;  2ZNV B;  4GIV A;  4K7U A;  2RSU A;  4ANU A;  3ZUN A;  4BOS C;  3TJP A;  5JH5 C;  1WZ0 A;  4AP4 C;  4MEL A;  3V6C B;  2K8B A;  3R66 C;  5FR6 A;  3ZDM C;  2KDB A;  3RUI B;  4N9F 4;  3WAO A;  4HCP B;  2CU1 A;  3KH0 A;  2IO2 B;  1V2Y A;  2N7E A;  4AJW A;  2DHZ A;  4JLC A;  1J19 A;  2FIF A;  2IO0 B;  3AU4 A;  2ZCC A;  4JIO U;  4TV3 A;  4I6N B;  4FA6 A;  3DBR I;  3PVL A;  1LQB A;  1P3Q U;  2DEN B;  2M17 A;  3B08 A;  4KV2 A;  3UIO B;  2KMA A;  4I6P A;  3JSV A;  4WWN A;  3ML8 A;  4JGH B;  4MJS A;  4IWO A;  4KSK C;  4OVU A;  3HIZ A;  4MGZ E;  2L7R A;  3UIN B;  4BBN F;  2KDF B;  5D94 A;  2JXX A;  2N9X A;  4W9H A;  4YL8 A;  1WFY A;  2O2V B;  1V5T A;  4AOF A;  4IW0 A;  4DHJ B;  3AU5 A;  2BWF A;  3DCG A;  4KIK B;  1TTN A;  1WGR A;  1XQQ A;  2D10 A;  2JT4 B;  1KM7 A;  2V4L A;  2L76 A;  3R7Q A;  2FUH B;  3DVG X;  1EO6 A;  4LJO B;  2KK8 A;  1EF1 A;  3PT2 B;  2KFJ A;  1UGM A;  3PSE B;  2PE6 B;  4A20 A;  3CST A;  3DVN U;  1C3T A;  2L3Z A;  3BY4 B;  2A4Z A;  4EKU A;  2D2Q A;  5DPS A;  2D3G A;  1HE8 A;  3L0W B;  3SHQ A;  1RAX A;  4FBJ B;  1WZ3 A;  1J8C A;  1H4R A;  4GOC A;  3UQB A;  3N3K B;  4MGI E;  2AWT A;  3BIN A;  3KUD B;  3EEC A;  1E90 A;  4DHZ E;  2XEW A;  3QWZ B;  4G50 A;  2K25 A;  2CS4 A;  3IBE A;  2LGX A;  2DZK A;  5JZE B;  2N7D A;  1UZX B;  1P98 A;  3R7R A;  3RCZ A;  1OGW A;  4GSW A;  2WDT B;  1WX8 A;  1RFA A;  4ANW A;  3QA8 A;  2L8J A;  1WXV A;  2KLG A;  3K9O B;  4DBG A;  2RPQ A;  4EZJ A;  1KLV A;  2JVC A;  2LVO A;  1J0G A;  4B6W A;  1L2N A;  1WMH A;  3KUC B;  2DZI A;  3HHM A;  5DPT A;  3VUW A;  2K1F A;  4DHJ D;  1OQY A;  4GDL A;  5IA7 A;  4ICU A;  2MP2 B;  2R2O A;  4FJV B;  2IO3 B;  2ZPN A;  3N32 A;  2L00 B;  4II2 B;  1X1M A;  2GOW A;  4GGQ A;  4DHZ B;  2CR5 A;  1WF9 A;  2BYF A;  3DOW A;  3NY5 A;  4FLH A;  3GOE A;  2KJH B;  3K9P B;  4G0N B;  4GN1 A;  3WA0 A;  4CYE A;  2GBM A;  4HPM B;  4HLE A;  3PPA A;  2IO1 B;  4NPN A;  3APD A;  2DZM A;  5L83 A;  1BT0 A;  1XT9 B;  3MJW A;  3RZF A;  4KDI C;  2KFK B;  3O65 B;  4WAA A;  3JYU A;  5D6J B;  2DAJ A;  4HPL B;  2RR9 A;  3T9L A;  3WAN A;  4GB9 A;  2BPS A;  2J0J A;  4EZL A;  3EHV A;  5JHA A;  2D11 A;  2JF5 A;  4PS7 A;  3TL5 A;  4TQ1 A;  3QHT A;  2KO3 A;  1EF5 A;  5CHW A;  2GBK A;  4XZ4 A;  2KTF A;  4NAW A;  1V86 A;  1NDD A;  1XD3 B;  3A9J A;  2KKC A;  2RD0 A;  3X0W A;  3ZTD A;  2R2Q A;  3QJZ A;  4HWI B;  4HDO A;  1GUA B;  1YQB A;  2A5U A;  5DPW A;  2KDE B;  4WJP A;  2AEH A;  3VUX A;  3L08 A;  2IBI B;  4B95 A;  2YVC A;  2BYE A;  2HJ8 A;  3L54 A;  3APF A;  1R4N I;  1FXT B;  3EC8 A;  1SIF A;  2CHW A;  1E8W A;  3P2B A;  1GC6 A;  4W9C A;  4E3C A;  1V5O A;  2ZNV C;  4MM3 A;  5L95 C;  4F8C B;  1R4M I;  2N1V A;  4RM9 A;  3MTN B;  2AYO B;  1S1Q B;  3RYT A;  4FAD A;  4DK5 A;  1WGG A;  2AL6 A;  3RUL A;  2ZVO A;  5E6N A;  2CHX A;  5BO4 B;  4NJ7 A;  3DDC B;  2N1W A;  3ZNZ B;  1C1Y B;  1E7U A;  4M0W B;  1WR6 E;  4A3O A;  1UH6 A;  2KVR A;  2BWE S;  3H7P A;  2JRI B;  2I1K A;  5CX3 A;  3OJ3 A;  3QX1 A;  5DCN A;  4IM2 A;  1P0R A;  2KQ7 A;  2Z0D B;  2JZZ A;  2WX1 A;  1M94 A;  2LD9 A;  3CSF A;  4HJK A;  1Y8R C;  2J0M A;  4K1R B;  2N4F A;  3CF6 E;  2KN5 A;  3IHP C;  2OJR A;  1TBE A;  3PRP B;  4IG7 B;  4CO7 A;  2LAS A;  1WXS A;  3V6E B;  2WX0 A;  2C5L C;  4KZ0 A;  4MGY E;  5E6O A;  4FJZ A;  3NHE B;  1WJU A;  1TGZ B;  3A9K A;  3LJ3 A;  3NZU A;  4RM8 A;  1MG8 A;  3VH3 B;  3UF8 A;  2LRU A;  1E5W A;  3PTF C;  2HTH A;  3WAP A;  1D3Z A;  2L05 A;  2LXC A;  2LRW A;  3H6N A;  3UGB B;  4MH0 E;  1WE7 A;  3V61 A;  1WM3 A;  1V49 A;  4FUL A;  3DQV A;  5J18 A;  2MBH A;  2KWV B;  3DBL I;  1RLF A;  2EKE C;  2KDI A;  4PYZ A;  3M95 A;  4WQO B;  4FHJ A;  3L13 A;  1ZW7 A;  4ZDV A;  2KC1 A;  2LJ5 A;  1U4A A;  3ENE A;  4FJY A;  3ZNG C;  4LDT D;  3ZRC A;  4A3P A;  5D2M B;  4LJP B;  2XK5 A;  4ASW C;  3PRZ A;  4BKS D;  1WR1 A;  2KX3 A;  4W9J A;  1P9D U;  2NBU A;  2MBE A;  3D32 A;  2PJH A;  1ISN A;  2JUO A;  1G6J A;  2FCS A;  2KLC A;  4X57 B;  4F1S A;  4LCD E;  4NAW B;  2O6V A;  5J17 A;  4AWJ A;  1VCB A;  3PS6 A;  4BFR A;  3KUZ A;  3TBL D;  3ZW3 A;  4ZYN A;  2EMT A;  1WJN A;  4IM3 A;  3DBH I;  2IZV B;  4FHK A;  4WWP A;  2ZZP B;  1V6E A;  2K39 A;  2LXA A;  3A9K B;  2ZPY A;  1NBF C;  4JQW C;  1I42 A;  2UYZ B;  4NY0 A;  4PS3 A;  2RGF A;  3PLV A;  4DWF A;  3W1S C;  2CHZ A;  2KHW B;  4EUT A;  1P1A A;  2BKF A;  4K7W A;  2LI5 A;  2C7N B;  1K8R B;  2Z0E B;  4GU2 A;  4ANX A;  1IPG A;  2AL3 A;  1YX5 B;  3NZS A;  3IFW B;  3QQ8 B;  2C7M B;  2NVU I;  3VTV A;  1SGH A;  2M1M A;  4NQK E;  4GXB A;  3C0R B;  2M0X A;  4F7Z A;  3JW0 X;  3PLU A;  3W1S A;  2WYQ A;  2KQS A;  2KXJ A;  2JY6 A;  4IWP A;  3ZKJ C;  4KIK A;  3UQA A;  3CMM B;  5CHV C;  2DAF A;  2K8H A;  3PHX B;  1VD2 A;  3ZLZ A;  4HVB A;  5AZF A;  2IY1 B;  4W9K A;  2EMS A;  3SDL C;  2MBO A;  2MP2 A;  2KWU B;  2MLB A;  3U8Z A;  4BOZ B;  2KMC A;  2G4D B;  4ZRI A;  2KTR B;  2J0K A;  4K7S A;  3TCA A;  2KC2 A;  2LUE A;  3T8M A;  3PGE A;  1KJT A;  2LGD A;  1OEY J;  2JPH A;  5D7G A;  4K81 A;  2JWZ A;  1WMH B;  2MRP A;  1V81 A;  3APC A;  2KJ6 A;  1UEL A;  3ZIM A;  1AAR A;  2FCQ A;  4P7I A;  1E8Y A;  2FCN A;  1GNU A;  2M4N A;  3RZW C;  1CMX B;  2FCM A;  2REX A;  4KZC A;  1RRB A;  4G11 A;  2PEA A;  2NS5 A;  2G4S A;  1YX6 B;  1Z2M A;  2K6Q A;  1GJZ A;  5CHF A;  3ZNH B;  3Q3F A;  1LFD A;  2I1J A;  3VQI A;  3L16 A;  4II3 B;  5LXH A;  2UWQ A;  1SE9 A;  2Z59 B;  1OTR B;  4KDL B;  1L7Y A;  3NOB A;  2KOX A;  3OLM D;  4KVG B;  3HM6 X;  2L0T A;  4EEW A;  5LXI B;  1A5R A;  2ZVN A;  3OAW A;  3AI5 A;  3M62 B;  1E8X A;  1Z5S B;  3A33 B;  1I35 A;  2IY0 B;  3H9D A;  4ICV A;  4EOY A;  3SD5 A;  2KWC A;  3W1Y A;  3A9J B;  2C60 A;  4XC2 A;  3QK0 A;  1WX7 A;  5AZH A;  3DVG Y;  3VFK A;  2JRH A;  2MQJ A;  3VTW A;  4NNJ B;  3QAQ A;  3MHS D;  1GG3 A;  4DXA B;  4MJS B;  3DBS A;  3Q3J A;  2IYD B;  4FN2 A;  3ONS A;  4ZRJ A;  3DPD A;  1ZGU B;  2GBN A;  3JVZ X;  4EZK A;  2VRR B;  4AJY B;  1LM8 B;  3KYC D;  2D07 B;  1WIA A;  1E8Z A;  2O2V A;  3A4R A;  2KAN A;  3QAR A;  5IAA C;  3VHT C;  2Y5B B;  5AEK B;  5G2N A;  5C23 A;  5EDS A;  4HK2 A;  2NCN A;  3HM3 A;  2DYB A;  4OVV A;  5HKH A;  2B3A A;  1Q5W B;  3PV1 A;  2GBJ A;  3A4S C;  3TIX A;  3N30 A;  2BYV E;  4RMA A;  3L17 A;  1TZ1 A;  3PRE A;  1WXA A;  4IWQ A;  2O6V D;  2FAZ A;  4M8N A;  3B0A A;  4MGK E;  4NQL B;  2GBR A;  1T0Y A;  2J7Q B;  3B1L X;  4WJQ A;  2LVQ A;  5G55 A;  1IYF A;  3PZD A;  3VDZ A;  2NR2 A;  4IUM B;  1YJ1 A;  3KYD D;  3U7D A;  2KD0 A;  2ASQ A;  3ZRF A;  4J6I A;  5TR5 A;  3DVN V;  1OEY A;  3PRM B;  1WYW B;  1JRU A;  1WH3 A;  3GZN I;  4W9G A;  4KSL C;  3A1Q B;  4GDK A;  4IC7 B;  2FNJ B;  2DX5 B;  3VAW A;  3VXW A;  5KHO A;  2KTR A;  2C9W B;  4NJ6 A;  2MSE D;  4TUU A;  4G3X B;  1WXM A;  5DPR A;  2QHO A;  1KOT A;  1V80 A;  3QCA A;  4HCN B;  2NPT B;  2G45 B;  4BKG A;  3AUL A;  1YIW A;  4WJN A;  2XK5 B;  2LGY A;  2KJR A;  2V1Y A;  2ZCB A;  2HD5 B;  5CTR C;  2V3S A;  4BKT A;  2LVP A;  4ZRK A;  3NS8 A;  1GC7 A;  3V60 A;  3IG3 A;  3JSV B;  3OJ4 B;  4CHK A;  2K6D B;  3ALB A;  3QIJ A;  2HE7 A;  1Q0W B;  4IM0 A;  4HXD A;  2LWP A;  4LDT B;  4TQ0 A;  2MBQ A;  2MX2 A;  4PYU A;  1WGH A;  2WWZ A;  4HDQ A;  3PHW B;  2NPT A;  3VVW B;  4ANV A;  3A1Q A;  4GDK B;  4TKN A;  2KFK A;  4W9E A;  3QC8 B;  4DDI D;  3UIP B;  2MCN B;  4EFO A;  3L10 B;  4B9K A;  2GMI C;  3ML9 A;  1H8C A;  3ZDT A;  3KVF B;  2N9E B;  1IP9 A;  2MA9 B;  5C1Z A;  2MWS B;  2NBV B;  3I3T B;  3RT3 B;  1WGD A;  4XX5 A;  3H7S A;  1V9J A;  2G3Q B;  2LZ6 A;  2XBB C;  2YLM A;  4JL9 A;  4W9F A;  3S2A A;  4MEM A;  2KZR A;  4URK A;  3ZTC A;  4BKS A;  1WY8 A;  4PS8 A;  5AZG A;  2NBW B;  2KNB A;  3WAL A;  1ZKH A;  3ZO5 B;  3M63 B;  4DDG D;  2BF8 B;  1UD7 A;  4MSQ B;  1F9J A;  4WJO A;  2ZJD A;  1NI2 A;  5KHQ A;  1QZE A;  2L0F A;  1WJ4 A;  1YD8 U;  4GMV A;  2PE9 A;  5E6P A;  1PQS A;  4W9I A;  4BBN C;  4W9D A;  1LXD A;  3H7P B;  3RD2 A;  4GDL B;  5LLI A;  3H1U A;  3WAM A;  3LDZ E;  4BVU C;  2MW5 A;  3EFU A;  2W9N A;  5J2R A;  2CKH B;  1WE6 A;  4AUQ C;  2PPH A;  4W9L A;  2KX0 A;  3VH4 B;  2MBB B;  3WIM A;  3M3J A;  2M8S A;  3SU8 X;  1WI0 A;  2DYO A;  3IVF A;  4I6L B;  5GMV A;  4MSM B;  5JHB A;  1WGY A;  2N9P C;  2BKR B;  2JZ3 B;  1UBI A;  3X23 A;  2FID A;  3ZVV A;  4WWO A;  2BGF A;  2C7H A;  2K8C A;  4MDK E;  3HK0 A;  2ZEQ A;  3VUY A;  1WM2 A;  4E71 A;  1E7V A;  3U30 A;  1WX9 A;  1UBQ A;  2DZJ A;  1S3S G;  3ZNI D;  1WRD B;  3V62 A;  3AXC A;  4E74 A;  1EUV B;  4M8M A;  3ECI A;  1Q1O A;  2DYM A; 
#chains in the Genus database with same CATH topology
 3TMP B;  1TKG A;  2D5G A;  2O6V B;  2OOB B;  4ANU A;  4BOS C;  2RSU A;  1EU3 A;  2AQ1 B;  3ZDM C;  3KQ4 A;  3ZXR A;  1L0V B;  5IN7 A;  2DHZ A;  2PLP A;  1JWS D;  2WXN A;  2WU5 B;  4MH8 A;  4MM3 B;  4JIO U;  1CJE A;  3DBR I;  5H8Y E;  1P3Q U;  3B08 A;  2CJO A;  1P7F A;  3BYY B;  4OVU A;  3HIZ A;  4MGZ E;  2L7R A;  3URY A;  1OFF A;  4AOF A;  5GXG B;  3RI7 C;  3AU5 A;  2BWF A;  4OZB A;  1JWM D;  1TTN A;  1XQQ A;  2JT4 B;  1ZDX A;  2L76 A;  4P16 A;  2KFJ A;  2RMM A;  1UGM A;  4A55 A;  2BVC A;  4P1C C;  4EKU A;  3L0W B;  1WZ3 A;  4LNK A;  3KUD B;  2RDB C;  3QWZ B;  4YSY B;  1KH0 A;  2LGX A;  2WDQ B;  1UZX B;  4CQN A;  1L6U A;  4GSW A;  2TSS A;  1YMH E;  3MC8 A;  1VJK A;  2KYW A;  3TEX A;  1WMH A;  1YN5 A;  3VUW A;  1OQY A;  2L52 A;  4GDL A;  4TSS A;  4BAX A;  2ZPN A;  1V1O A;  2OED A;  3NY5 A;  3GOE A;  2KJH B;  3K9P B;  4GN1 A;  1WWT A;  3RNG C;  2KFK B;  3JYU A;  4HPL B;  4C7Z A;  3T9L A;  3BK1 A;  4TQ1 A;  2GBK A;  3ZYY X;  1V86 A;  3N1Z C;  2PW9 A;  2KKC A;  4WQM A;  2KDE B;  1DGJ A;  2QMT A;  3Q69 A;  1KFY B;  3L08 A;  1WGK A;  3I57 A;  1C77 A;  2V0G A;  2W3R A;  1HQR D;  2MH7 A;  4PK1 A;  3APF A;  3EC8 A;  3P1M A;  3P2B A;  3Q3M C;  5FR3 A;  1V5O A;  4MM3 A;  5L95 C;  4LLG M;  4RM9 A;  3MTN B;  2JX5 A;  1K51 A;  2AYO B;  5HG2 A;  4FAD A;  1IGC A;  4DK5 A;  3RUL A;  4YXD B;  5E6N A;  1I7H A;  4NJ7 A;  3DHH C;  1MI0 A;  3ZNZ B;  2VZK B;  1E7U A;  3QX1 A;  1P0R A;  2KQ7 A;  3CSF A;  2OJW A;  2J42 A;  1L0X B;  2KN5 A;  1TBE A;  4IG7 B;  3AV8 A;  4KZ0 A;  4MGY E;  1N6Z A;  4ZHO A;  2KDM A;  4FJZ A;  3NHE B;  1TGZ B;  1MG8 A;  2WLB A;  1R4N B;  1NI3 A;  1A70 A;  1SJE D;  3PTF C;  2EEL A;  2L05 A;  4HEA 1;  3UGB B;  1WE7 A;  1WM3 A;  1V49 A;  4L2Y A;  4P6V F;  2AQ3 B;  1FRR A;  1RLF A;  2W54 A;  2KDI A;  3TEZ A;  4PYZ A;  4C00 A;  4ZDV A;  4FHJ A;  3L13 A;  4ZRQ A;  1ET6 A;  1YQ3 B;  3H8H A;  4LJP B;  4BKS D;  2KX3 A;  2N9K A;  1P9D U;  2MBE A;  2WXL A;  1ISN A;  1UF0 A;  2KLC A;  4AWJ A;  4BFR A;  3ZW3 A;  3U7Z A;  2BS4 B;  5EE9 A;  2IZV B;  1FM0 D;  1NBF C;  4OHJ A;  2KHW B;  4K7W A;  3ABV B;  1VLB A;  4ANX A;  2AL3 A;  1YX5 B;  2IJ0 A;  3VTV A;  3C0R B;  2KAJ A;  2L32 A;  3W1S A;  1C4A A;  3RN9 C;  4IWP A;  3ZKJ C;  2KWD A;  5CHV C;  4B0E A;  2IY1 B;  2MJ3 A;  3SDL C;  2MLB A;  5T8I A;  2KTR B;  2J0K A;  4OW0 A;  2LGD A;  1OEY J;  4EE2 A;  2KJ6 A;  4K3C A;  4JX1 C;  4P7I A;  2FCN A;  3IT6 B;  4G11 A;  2NS5 A;  3EA6 A;  1YOV B;  3N1Y C;  3VQI A;  1SEB D;  4II3 B;  5LXH A;  2UWQ A;  1OTR B;  2KOX A;  3EGR A;  2WXH A;  3A33 B;  2IPK D;  3A9J B;  4XC2 A;  2W55 A;  3QK0 A;  3SEB A;  2JRH A;  1VDV A;  3MHS D;  4HKQ A;  1GB4 A;  3DPD A;  1ZGU B;  1FO4 A;  1D5X C;  2HJ1 A;  3JVZ X;  3SFD B;  2VRR B;  1TIF A;  5IAA C;  3VHT C;  3AEB B;  5EDS A;  5H92 C;  4HK2 A;  2NCN A;  3HM3 A;  4S17 A;  3A4S C;  3TIX A;  2BYV E;  4RMA A;  3WCQ A;  3Q8A A;  3RFZ B;  2GBR A;  2J7Q B;  4WJQ A;  2NR2 A;  3U7D A;  5TR5 A;  1OEY A;  1E7P B;  4W9G A;  1WH3 A;  3VXW A;  2KTR A;  2C9W B;  2MSE D;  2GB1 A;  4TUU A;  2N0S B;  3TEW A;  5EE3 A;  4BKG A;  1I4X A;  1T0S C;  2LGY A;  3LB8 C;  2KJR A;  2HD5 B;  3Q14 C;  2V3S A;  2N9L A;  1ZXI A;  3N1X C;  4ZRK A;  3OJ4 B;  1Q0W B;  4XWT A;  5I4D A;  2KAC A;  4PYU A;  4DXF A;  4HDQ A;  3VVW B;  1LO5 D;  2PVO D;  1MJD A;  1P7E A;  3QC8 B;  3UIP B;  2LHD A;  4B0M A;  1ACC A;  2GMI C;  1H8C A;  2N9E B;  2MA9 B;  2MWS B;  1L5P A;  4W9F A;  1V9J A;  2LZ6 A;  3R2I A;  2KZR A;  4URK A;  2IGG A;  1WY8 A;  1TZO A;  4AQ7 A;  2NBW B;  2BF8 B;  3FC4 A;  1ZPS A;  4WJO A;  2L0F A;  1HZ5 A;  2QCZ A;  3BII D;  3BK2 A;  2PE9 A;  2WQY B;  3VR8 B;  1PQS A;  4W9I A;  3H7P B;  5LLI A;  3WAM A;  3Q8B A;  2DBY A;  3AEG B;  2GI9 A;  2CKH B;  1WE6 A;  1ZXH A;  5EE0 A;  3VH4 B;  2I38 A;  3M3J A;  3AH7 A;  5JHB A;  1WGY A;  2N9P C;  2ZEQ A;  1E7V A;  3U30 A;  1S3S G;  3AXC A;  1EUV B;  4AP4 C;  3ECI A;  3VTU A;  1WJ6 A;  3R3M A;  3KW5 B;  2ZNV B;  4K7U A;  1WZ0 A;  4JWS C;  2VH1 A;  3AEA B;  2KMM A;  3N20 C;  3FIL A;  3R66 C;  3T3N A;  2KDB A;  3RUI B;  2CU1 A;  2IO2 B;  2N7E A;  3AEE B;  2WXI A;  3KWL A;  1J19 A;  3ZJV A;  3PVL A;  1LQB A;  3UIO B;  2KMA A;  3ML8 A;  3Q8E A;  4MJS A;  4IWO A;  3UIN B;  1QOG A;  3OWE B;  2WXQ A;  4BBN F;  2BS2 B;  1PFD A;  2JXX A;  4W9H A;  1HTQ A;  4YL8 A;  1YN3 A;  4AS1 A;  1V5T A;  3ETR A;  1STE A;  4ARI A;  2FUH B;  3DVG X;  4N59 A;  2INN E;  3PT2 B;  4HPP A;  2PE6 B;  2YEP B;  2BTE A;  1TY2 A;  2D2Q A;  3SHQ A;  2QDF A;  1J8C A;  1H4R A;  4GOC A;  4NJC A;  3UQB A;  2AWT A;  3BIN A;  3EEC A;  4O1N A;  2K25 A;  2CS4 A;  1OGW A;  2Z8L A;  4ANW A;  3AEC B;  1WXV A;  2KLG A;  1KLV A;  2JVC A;  1GB1 A;  2LVO A;  2DZI A;  4DHJ D;  4ICU A;  1SB3 C;  3N32 A;  4II2 B;  2CR5 A;  2HTM E;  2GBM A;  4YSX B;  1T0Q C;  2IO1 B;  3PPA A;  3APD A;  1N60 A;  2DZM A;  4K3B A;  5L83 A;  3RZF A;  4WAA A;  5D6J B;  4M01 A;  4GB9 A;  4EZL A;  3EHV A;  1BML C;  4PS7 A;  2KO3 A;  5CHW A;  1FD6 A;  2V3N A;  1NDD A;  1XD3 B;  2R2Q A;  2E6X A;  2RDH A;  3NZ3 A;  1GUA B;  5DPW A;  2INC C;  1MHH E;  3BVZ A;  4ITK A;  3I5J C;  1DOX A;  3UI3 A;  2BYE A;  2HJ8 A;  3L54 A;  1FXT B;  1N63 A;  3IT4 B;  1SIF A;  4M00 A;  1E8W A;  2ZNV C;  1I4Q A;  3RNE C;  2AL6 A;  4LK0 M;  2ZVO A;  3Q8F A;  5D3I B;  5BO4 B;  1UWX A;  2IND C;  1NYQ A;  1DOY A;  4Q2J A;  4OVZ A;  3ZJU A;  2I1K A;  1T3Q A;  2WX1 A;  4HJK A;  2D3A A;  2AQ2 B;  1B1Z A;  2LAS A;  4XGA B;  1M4V A;  5IO9 A;  1WXS A;  2C5L C;  1KF6 B;  1QIL A;  4OZC A;  1WJU A;  3LJ3 A;  3UF8 A;  2HTH A;  2IGH A;  3WAP A;  1D3Z A;  2JZP A;  2LRW A;  2NTT A;  3FKY A;  1HTO A;  4LTU A;  1Q10 A;  1SE4 A;  3AB5 A;  3ENE A;  3ZNG C;  2RDG A;  5D2M B;  2XK5 A;  4W9J A;  4GLS C;  1HXY D;  1NVI D;  4FXC A;  1TJE A;  3P4Q B;  1G6J A;  2FCS A;  4X57 B;  1JCK B;  2O6V A;  5J17 A;  1WJN A;  4IM3 A;  1FCL A;  2ZZP B;  1V6E A;  3A9K B;  1N5X A;  4JQW C;  4NY0 A;  4DWF A;  4EUT A;  1K8R B;  2FE8 A;  3IFW B;  1EM7 A;  3QQ8 B;  2NVU I;  1SGH A;  4WAF A;  4F7Z A;  4BZA A;  1BXT A;  2KQS A;  4USA A;  5HHD G;  3UQA A;  2DAF A;  1EU4 A;  1VD2 A;  3PHX B;  2WXF A;  5AZF A;  4W9K A;  1FXA A;  2MBO A;  3U8Z A;  1OQR A;  3T8M A;  4K7S A;  2ZW1 A;  5D7G A;  2MRP A;  1V81 A;  3APC A;  2Y3A A;  2FCQ A;  3T3O A;  2B76 B;  1PGX A;  2M4N A;  2REX A;  4LNN A;  2PEA A;  2G4S A;  1YX6 B;  2K6Q A;  5CHF A;  3ZNH B;  3Q3F A;  1FCC C;  1V1P B;  1LFD A;  2MJD A;  3L16 A;  1YQ4 B;  1L7Y A;  4KVG B;  3O13 A;  2L0T A;  1Z5S B;  4ICV A;  2JQR B;  1K53 A;  5AZH A;  3DVG Y;  4NNJ B;  1GG3 A;  4DXA B;  3Q3J A;  1ZUD 2;  2IYD B;  1WYG A;  4A90 A;  1ZOY B;  3BYT B;  3DHG C;  3OG5 A;  4AJY B;  1XLO A;  2D07 B;  3C19 A;  4RF0 A;  3A4R A;  3P63 A;  2JYT A;  4P1B C;  2Y5B B;  5AEK B;  5G2N A;  2QIE B;  4OVV A;  2B3A A;  3PV1 A;  2GBJ A;  4HRO A;  4QAY A;  2G9H D;  5LNK 1;  1WXA A;  2FAZ A;  3B0A A;  1IYF A;  2LVQ A;  1JRO A;  3PZD A;  3VDZ A;  1IGD A;  4IUM B;  1BUI C;  1YJ1 A;  2ASQ A;  3ZRF A;  2SEB D;  3W5V B;  2CJN A;  1VZ6 A;  3NS1 A;  1WYW B;  3MHZ A;  2V4I B;  3A1Q B;  4GDK A;  1R7S A;  2PVG C;  4IC7 B;  4XWW A;  4HJG E;  1ET9 A;  4NJ6 A;  1V80 A;  3QCA A;  3AUL A;  4WJN A;  2WXO A;  2V1Y A;  2ZCB A;  2HDE A;  4BKT A;  3NS8 A;  3P42 A;  5HI1 A;  4D2K A;  1CK1 A;  3ALB A;  1SF0 A;  4IM0 A;  3HVD A;  3W2D A;  5BYS A;  2Y5P A;  3GE8 C;  3NVY A;  2MX2 A;  1WGH A;  2IDY A;  1E0Z A;  2NPT A;  4RGN A;  5JXV A;  1SJH D;  2WXK A;  2JXT A;  4DQO C;  2KFK A;  4W9E A;  4DDI D;  3V3X A;  3L10 B;  1PDX A;  1K52 A;  3KVF B;  3W9C B;  1IP9 A;  1F52 A;  4XX5 A;  3H7S A;  2YLM A;  2XBB C;  4RH6 A;  1DOI A;  1RM6 C;  3ZTC A;  1WSP A;  3WAL A;  4DDG D;  1JWU D;  1L4D B;  1UD7 A;  2BB6 A;  4MSQ B;  4S0R A;  3SR6 A;  4JWU C;  4WIP A;  1NI2 A;  1QZE A;  4ZOH C;  4W9D A;  4XDC A;  1LXD A;  1C79 A;  1ESF A;  3EFU A;  2WHI A;  4W9L A;  3WIM A;  2M56 B;  2MJE A;  2J4X A;  5GMV A;  4I6L B;  4MSM B;  3X23 A;  3HK0 A;  3VUY A;  4HKZ E;  3ZNI D;  4E74 A;  2Q5W D;  1MVK A;  4M8M A;  2R2O A;  2DYM A;  4US9 A;  4GIV A;  3ZUN A;  5FK9 C;  3U52 E;  2V3P A;  3NVW A;  4HCP B;  1V2Y A;  5AUI A;  4JLC A;  1XF5 L;  3Q8C A;  2FUG 1;  2IO0 B;  3AU4 A;  2ZCC A;  1QF6 A;  4KV2 A;  2M17 A;  3JSV A;  1B9R A;  4JGH B;  1CQV A;  2KDF B;  4IDI A;  1WFY A;  2VH2 A;  3NRZ A;  3DCG A;  4KIK B;  2D10 A;  1WGR A;  1XXG A;  2V4L A;  1SE3 A;  2AX5 A;  4N6E B;  4XDD A;  1UGJ A;  1EO6 A;  4LJO B;  2KK8 A;  1EF1 A;  3PSE B;  1F2R C;  3CST A;  3BY4 B;  2A4Z A;  5DPS A;  1HE8 A;  3N3K B;  1L0Y B;  4MGI E;  4DHZ E;  2XEW A;  4G50 A;  1FNW A;  2N7D A;  1P98 A;  3RNB C;  3AED B;  3QA8 A;  2L8J A;  3K9O B;  4DBG A;  2RPQ A;  3KLS X;  1ZE3 D;  1J0G A;  1L2N A;  5DPT A;  2V9H A;  2IO3 B;  1I4G A;  2GOW A;  4GGQ A;  4RGM A;  2ACZ B;  1WF9 A;  3DOW A;  4FLH A;  1RWS A;  4G0N B;  3LXF A;  1V1P A;  1BT0 A;  1XT9 B;  4KDI C;  1VRA B;  4WWM A;  3L4P A;  3WAN A;  2BPS A;  3NJT A;  5JHA A;  2JF5 A;  1PYW D;  3QHT A;  1EF5 A;  4IOI E;  4NAW A;  3A9J A;  2RD0 A;  3ZTD A;  4LNO A;  3X0W A;  4A6Q A;  2JWU A;  1GOZ A;  1YQB A;  1T6B X;  2MEK A;  3LYY A;  2AEH A;  2JSV X;  3TEY A;  1IBX B;  2IBI B;  4B95 A;  2YVC A;  4A9A A;  2CHW A;  2QSD A;  1GC6 A;  4F8C B;  2N1V A;  3R8B A;  3B9J A;  1S1Q B;  3RYT A;  1WGG A;  4RF1 A;  2LJI A;  2CHX A;  3DDC B;  2FBW B;  2N1W A;  3DWG C;  1QOA A;  4C4V B;  1C1Y B;  1WR6 E;  3EUB 2;  1UH6 A;  3H7P A;  2BWE S;  4A3O A;  2JRI B;  2WNM A;  1F77 A;  3EFC A;  3OJ3 A;  5DCN A;  2J52 A;  4MAC A;  2Z0D B;  2J53 A;  2LD9 A;  2J0M A;  4K1R B;  2N4F A;  3CF6 E;  2OJR A;  1KRH A;  1JWB D;  4CO7 A;  3V6E B;  2WX0 A;  4R3D A;  1SSN A;  3AMZ A;  5E6O A;  3MJ5 A;  2QC8 A;  3NZU A;  2LRU A;  4XYC A;  4MH0 E;  3V61 A;  3DQV A;  2MBH A;  1QT9 A;  3DBL I;  2EKE C;  4J3O D;  2K22 A;  5TSS A;  4WQO B;  1ZW7 A;  3GS2 A;  4FJY A;  2LJ5 A;  1U4A A;  4LDT D;  4A3P A;  1WR1 A;  4XE0 A;  4M02 A;  2PJH A;  2JUO A;  1N5W A;  1VCB A;  1AYF A;  3FIL B;  3AE6 B;  2EMT A;  4ZYN A;  1SBB B;  3RNF C;  4ARC A;  3DBH I;  4FHK A;  4WWP A;  2K39 A;  2LXA A;  2PMV A;  1I42 A;  2NMQ A;  2RGF A;  3PLV A;  3W1S C;  1TS5 A;  3AE7 B;  2C7N B;  2Z0E B;  4GU2 A;  5C3J B;  3NZS A;  3JW0 X;  4YTP B;  3AN1 A;  2GLS A;  2KXJ A;  2JY6 A;  4C56 C;  5G5G A;  3CMM B;  2K8H A;  3ZLZ A;  2WXR A;  2KWU B;  3U2S C;  1KLG D;  4WUR A;  3RNC C;  2G4D B;  4ZRI A;  3TCA A;  2LUE A;  2BW2 A;  3ZXV A;  3Q3O C;  2JWZ A;  1FXI A;  1WMH B;  2VZK D;  2KN4 A;  1CMX B;  1UWM A;  4KZC A;  4L1B A;  2LGS A;  1RRB A;  1FPY A;  1GJZ A;  2XN9 C;  3DBR B;  2Z59 B;  3E56 A;  4KDL B;  2LGI A;  3NOB A;  5LXI B;  4EEW A;  3HM6 X;  3V05 A;  5E6J A;  3OAW A;  2WXG A;  3M62 B;  4UDU C;  5IP4 D;  2IY0 B;  4EOY A;  2KWC A;  3IAS 1;  2INP E;  3C8Y A;  4KGR A;  1EWY C;  1EWC A;  1QQR A;  3QAQ A;  1DYQ A;  4MJS B;  4FN2 A;  4ZRJ A;  2GBN A;  1FMA D;  2K0P A;  3KYC D;  1LM8 B;  1WIA A;  2O2V A;  1LGR A;  3QAR A;  4JPS A;  2EKI A;  5C23 A;  2WXM A;  5HKH A;  1QOF A;  2DNF A;  1TZ1 A;  3RPF C;  3Q3N C;  4NQL B;  3B1L X;  2WGS A;  2JYE A;  2KD0 A;  1MPE A;  1JRU A;  3GZN I;  4KSL C;  2R61 A;  2WDR B;  2DX5 B;  3VAW A;  5KHO A;  1HA5 A;  2QHO A;  3P4S B;  2PTL A;  4HCN B;  1C78 A;  2NPT B;  2G45 B;  1UNS A;  2M0A A;  2LHE A;  2H88 B;  4ZYS A;  2LVP A;  3GE3 C;  3V60 A;  3IG3 A;  1XCT L;  3JSV B;  2K6D B;  1IBX A;  3DWM A;  2HE7 A;  4HXD A;  2LWP A;  4TQ0 A;  3NG0 A;  2LMC A;  4ANV A;  1SXT A;  2DLB A;  3A1Q A;  4GDK B;  2QEJ C;  4TKN A;  1T5X D;  3VR9 B;  2MCN B;  4EFO A;  1J7B A;  2WXJ A;  3ZDT A;  3GP7 A;  4A8X C;  4LNF A;  3I3T B;  1WGD A;  2G3Q B;  4YTN B;  1XCQ L;  1C76 A;  3I63 C;  1E10 A;  1I4H A;  1ZKH A;  4LNI A;  1F9J A;  3VRA B;  3VRB B;  5KHQ A;  3ZQ4 A;  1WJ4 A;  4YT0 B;  5E6P A;  1J7C A;  1HEZ E;  1JWA D;  1K50 A;  2PKO A;  3H1U A;  1D6E C;  2ON8 A;  3LDZ E;  2MW5 A;  2W9N A;  5J2R A;  1N62 A;  2CU3 A;  2Y5C A;  2PPH A;  4NZL B;  2MBB B;  5FKA C;  1WI0 A;  2DYO A;  3IVF A;  4NAM A;  3ZVV A;  2BKR B;  3E9S A;  1UBI A;  4WWO A;  2BGF A;  1XLN A;  2C7H A;  4MDK E;  1L4Z B;  1WX9 A;  1UBQ A;  2DZJ A;  1WRD B;  3V62 A;  1Q1O A;  1D4B A;  4FBJ B;  5JH5 C;  1FRD A;  3TJP A;  3B2G A;  3P4R B;  4MEL A;  3V6C B;  2K8B A;  5FR6 A;  5AUK A;  4N9F 4;  3WAO A;  3KH0 A;  4AJW A;  2PIA A;  2FIF A;  4KX6 B;  4I6N B;  4TV3 A;  3RNA C;  4FA6 A;  2DEN B;  3MC9 A;  4I6P A;  4WWN A;  1NEK B;  1GPX A;  1QLB B;  4KSK C;  5G5H A;  3CWI A;  3Q6B A;  1CZP A;  4C80 A;  2GRI A;  2N9X A;  5D94 A;  1JML A;  4TMA B;  2O2V B;  1TS4 A;  4IW0 A;  2DWQ A;  4DHJ B;  3TUO A;  1I4R A;  3R7Q A;  1KM7 A;  2LUM A;  2X38 A;  2XNA C;  1QKZ A;  2N7J A;  1VR9 A;  4A20 A;  1WRI A;  3DVN U;  1C3T A;  3AE9 B;  2L3Z A;  4RFB A;  3MC0 B;  2D3G A;  1RAX A;  3GB1 A;  3W5U B;  1E90 A;  3IBE A;  2DZK A;  5JZE B;  3R7R A;  3RCZ A;  2WDT B;  1WX8 A;  2W82 A;  1RFA A;  2IGD A;  3KWV A;  1ENF A;  3AE3 B;  1XLQ A;  4DXG A;  4EZJ A;  4B6W A;  1OQQ A;  3KUC B;  3IAM 1;  3HHM A;  2K1F A;  5IA7 A;  2MP2 B;  4FJV B;  2L00 B;  1X1M A;  4DHZ B;  1MG4 A;  1FNU A;  2BYF A;  3DBH B;  3SFE B;  3WA0 A;  4CYE A;  2H89 B;  2QIL A;  4HPM B;  4HLE A;  1V97 A;  3B2F A;  4NPN A;  3MJW A;  3O65 B;  2DAJ A;  4PT5 A;  2RR9 A;  5MPO A;  3BZD B;  2J0J A;  2D11 A;  3TL5 A;  1UUP A;  2D3C A;  4KKJ A;  4XZ4 A;  2KTF A;  4YWG G;  4RGT A;  3QJZ A;  1ZP0 B;  2L1A A;  1WXQ A;  3DBL B;  3FAH A;  4HDO A;  2A5U A;  3PZ7 A;  4HWI B;  4WJP A;  4RGO S;  4ZHP A;  3VUX A;  3AE2 B;  1R4N I;  1FNV A;  3CIR B;  1ZDV A;  4W9C A;  4E3C A;  1FFV A;  1R4M I;  1TT5 B;  1C4P A;  1RFK A;  2OHF A;  3TSS A;  1VZ8 A;  1L6V A;  5BYQ A;  2KT7 A;  4M0W B;  3NUH B;  1F1H A;  2KVR A;  5CX3 A;  1XEE A;  4IKG A;  4IM2 A;  2JZZ A;  1M94 A;  1Y8R C;  4ZRP A;  2BT6 A;  2BQQ A;  3IHP C;  3PRP B;  2NTS A;  2KQ4 X;  1N61 A;  1R4M B;  1MFW A;  3A9K A;  4RM8 A;  3VH3 B;  1E5W A;  2LXC A;  3H6N A;  3HUI A;  4N58 A;  4FUL A;  5J18 A;  4REZ A;  2KWV B;  1ROE A;  4WH4 A;  3M95 A;  2WU2 B;  2KC1 A;  3ZRC A;  5BMH A;  2YEP F;  2ONQ A;  4ASW C;  3PRZ A;  2NBU A;  3BVG A;  4YTM B;  1YJI A;  3D32 A;  5BYR A;  1JW9 D;  4F1S A;  3AE4 B;  4LCD E;  4NAW B;  2WS3 B;  3PS6 A;  1JRP A;  3KUZ A;  3TBL D;  2ZW0 A;  1PGB A;  1D5M C;  1JQ4 A;  1D5Z C;  2ZPY A;  2UYZ B;  1XO3 A;  4PS3 A;  5BMI A;  2CHZ A;  1P1A A;  2BKF A;  1J7A A;  2KVZ A;  2LI5 A;  2WDV B;  1IPG A;  2G1E A;  4MT5 A;  4L23 A;  2C7M B;  2M1M A;  4NQK E;  4GXB A;  2M0X A;  3AM9 A;  3PLU A;  3Q2A C;  2SAK A;  5C2T B;  2LEK A;  2WYQ A;  1FEH A;  1SE2 A;  4C4V A;  4KIK A;  4HVB A;  2EMS A;  2MP2 A;  4BOZ B;  2KMC A;  2KC2 A;  3PGE A;  1KJT A;  1HZ6 A;  3IXS A;  1TS2 A;  2UU7 A;  2JPH A;  3PO0 A;  4K81 A;  1RYJ A;  3I9V 1;  1Y56 A;  1UEL A;  3RMK C;  3ZIM A;  1AAR A;  3AE5 B;  3PZ8 A;  1E8Y A;  1GNU A;  3J9C A;  3RZW C;  2FCM A;  1E9M A;  3HVZ A;  5IOI A;  2WP9 B;  1Z2M A;  4KGT A;  2I1J A;  2I2Y A;  5BMG A;  1KTK A;  1AWD A;  3ZGZ A;  1SE9 A;  3OLM D;  1A5R A;  1YN4 A;  4YSZ B;  2ZVN A;  3ZJT A;  3AI5 A;  1E6E B;  1E8X A;  1I35 A;  3NVV A;  3H9D A;  4JE3 B;  3SD5 A;  3W1Y A;  1AW7 A;  2C60 A;  3BVM A;  4C7Y A;  1WX7 A;  2K3U A;  3VFK A;  1VZ7 A;  2MQJ A;  3VTW A;  1NEN B;  3DBS A;  3ONS A;  2WXP A;  1XLP A;  4EZK A;  2BYT A;  1F0Z A;  1E8Z A;  1FIQ A;  1FFU A;  2KAN A;  1F2R I;  1T0R C;  2K9X A;  2DYB A;  2RPV A;  1Q5W B;  4KGS A;  3N30 A;  1JAL A;  3BWU D;  3L17 A;  3PRE A;  4IWQ A;  2O6V D;  4M8N A;  4MGK E;  1TKY A;  1T0Y A;  5G55 A;  1YNT E;  2MHJ A;  2L83 A;  3KYD D;  5IKC M;  4J6I A;  2K5P A;  1TS3 A;  3DVN V;  1TKE A;  3PRM B;  4HRS A;  2FNJ B;  2D3B A;  3MP9 A;  3R2T A;  4G3X B;  1WXM A;  5DPR A;  5D3D A;  1KOT A;  1GAQ B;  4M0W A;  1YIW A;  2XK5 B;  1V8C A;  4KKI A;  5CTR C;  3U4E G;  1PGA A;  3AE1 B;  5EE1 A;  1GC7 A;  4CHK A;  5HFY A;  3AE8 B;  3QIJ A;  1I4P A;  4US8 A;  4H2A A;  4LDT B;  1MHX A;  2MBQ A;  2WWZ A;  3PHW B;  2E3T A;  1KLU D;  1NYR A;  4B9K A;  3ML9 A;  3AEF B;  1IUE A;  5C1Z A;  2NBV B;  1QOB A;  3RT3 B;  4ACF A;  4JL9 A;  3S2A A;  1SIJ A;  4MEM A;  1C4C A;  1TYG B;  4BKS A;  4PS8 A;  5AZG A;  1YJJ A;  2X8X X;  2KNB A;  3ZO5 B;  3M63 B;  2LFI A;  4RCO A;  2ZJD A;  3GZN B;  1YD8 U;  4GMV A;  1TY0 A;  3HRD D;  2JU6 X;  4RNA A;  4BBN C;  2BS3 B;  2BB5 A;  3RD2 A;  4GDL B;  1AN8 A;  4BVU C;  4AUQ C;  3DHI C;  2M19 A;  3NVZ A;  2KX0 A;  3MFG A;  2QJL A;  3N9Y C;  2M8S A;  3SU8 X;  2JZ3 B;  2FID A;  3P4P B;  2K8C A;  1C9F A;  4OZA A;  2ICI A;  4E71 A;  1WM2 A;  2W3S A;  1PUT A;  2BBC A; 
#chains in the Genus database with same CATH homology
 3TMP B;  3VTU A;  1WJ6 A;  3R3M A;  3KW5 B;  2O6V B;  2OOB B;  2ZNV B;  4GIV A;  4K7U A;  2RSU A;  4ANU A;  3ZUN A;  4BOS C;  3TJP A;  5JH5 C;  1WZ0 A;  4AP4 C;  4MEL A;  3V6C B;  2K8B A;  3R66 C;  5FR6 A;  3ZDM C;  2KDB A;  3RUI B;  4N9F 4;  3WAO A;  4HCP B;  2CU1 A;  3KH0 A;  2IO2 B;  1V2Y A;  2N7E A;  4AJW A;  2DHZ A;  4JLC A;  1J19 A;  2FIF A;  2IO0 B;  3AU4 A;  2ZCC A;  4JIO U;  4TV3 A;  4I6N B;  4FA6 A;  3DBR I;  3PVL A;  1LQB A;  1P3Q U;  2DEN B;  2M17 A;  3B08 A;  4KV2 A;  3UIO B;  2KMA A;  4I6P A;  3JSV A;  4WWN A;  3ML8 A;  4JGH B;  4MJS A;  4IWO A;  4KSK C;  4OVU A;  3HIZ A;  4MGZ E;  2L7R A;  3UIN B;  4BBN F;  2KDF B;  5D94 A;  2JXX A;  2N9X A;  4W9H A;  4YL8 A;  1WFY A;  2O2V B;  1V5T A;  4AOF A;  4IW0 A;  4DHJ B;  3AU5 A;  2BWF A;  3DCG A;  4KIK B;  1TTN A;  1WGR A;  1XQQ A;  2D10 A;  2JT4 B;  1KM7 A;  2V4L A;  2L76 A;  3R7Q A;  2FUH B;  3DVG X;  1EO6 A;  4LJO B;  2KK8 A;  1EF1 A;  3PT2 B;  2KFJ A;  1UGM A;  3PSE B;  2PE6 B;  4A20 A;  3CST A;  3DVN U;  1C3T A;  2L3Z A;  3BY4 B;  2A4Z A;  4EKU A;  2D2Q A;  5DPS A;  2D3G A;  1HE8 A;  3L0W B;  3SHQ A;  1RAX A;  4FBJ B;  1WZ3 A;  1J8C A;  1H4R A;  4GOC A;  3UQB A;  3N3K B;  4MGI E;  2AWT A;  3BIN A;  3KUD B;  3EEC A;  1E90 A;  4DHZ E;  2XEW A;  3QWZ B;  4G50 A;  2K25 A;  2CS4 A;  3IBE A;  2LGX A;  2DZK A;  5JZE B;  2N7D A;  1UZX B;  1P98 A;  3R7R A;  3RCZ A;  1OGW A;  4GSW A;  2WDT B;  1WX8 A;  1RFA A;  4ANW A;  3QA8 A;  2L8J A;  1WXV A;  2KLG A;  3K9O B;  4DBG A;  2RPQ A;  4EZJ A;  1KLV A;  2JVC A;  2LVO A;  1J0G A;  4B6W A;  1L2N A;  1WMH A;  3KUC B;  2DZI A;  3HHM A;  5DPT A;  3VUW A;  2K1F A;  4DHJ D;  1OQY A;  4GDL A;  5IA7 A;  4ICU A;  2MP2 B;  2R2O A;  4FJV B;  2IO3 B;  2ZPN A;  3N32 A;  2L00 B;  4II2 B;  1X1M A;  2GOW A;  4GGQ A;  4DHZ B;  2CR5 A;  1WF9 A;  2BYF A;  3DOW A;  3NY5 A;  4FLH A;  3GOE A;  2KJH B;  3K9P B;  4G0N B;  4GN1 A;  3WA0 A;  4CYE A;  2GBM A;  4HPM B;  4HLE A;  3PPA A;  2IO1 B;  4NPN A;  3APD A;  2DZM A;  5L83 A;  1BT0 A;  1XT9 B;  3MJW A;  3RZF A;  4KDI C;  2KFK B;  3O65 B;  4WAA A;  3JYU A;  5D6J B;  2DAJ A;  4HPL B;  2RR9 A;  3T9L A;  3WAN A;  4GB9 A;  2BPS A;  2J0J A;  4EZL A;  3EHV A;  5JHA A;  2D11 A;  2JF5 A;  4PS7 A;  3TL5 A;  4TQ1 A;  3QHT A;  2KO3 A;  1EF5 A;  5CHW A;  2GBK A;  4XZ4 A;  2KTF A;  4NAW A;  1V86 A;  1NDD A;  1XD3 B;  3A9J A;  2KKC A;  2RD0 A;  3X0W A;  3ZTD A;  2R2Q A;  3QJZ A;  4HWI B;  4HDO A;  1GUA B;  1YQB A;  2A5U A;  5DPW A;  2KDE B;  4WJP A;  2AEH A;  3VUX A;  3L08 A;  2IBI B;  4B95 A;  2YVC A;  2BYE A;  2HJ8 A;  3L54 A;  3APF A;  1R4N I;  1FXT B;  3EC8 A;  1SIF A;  2CHW A;  1E8W A;  3P2B A;  1GC6 A;  4W9C A;  4E3C A;  1V5O A;  2ZNV C;  4MM3 A;  5L95 C;  4F8C B;  1R4M I;  2N1V A;  4RM9 A;  3MTN B;  2AYO B;  1S1Q B;  3RYT A;  4FAD A;  4DK5 A;  1WGG A;  2AL6 A;  3RUL A;  2ZVO A;  5E6N A;  2CHX A;  5BO4 B;  4NJ7 A;  3DDC B;  2N1W A;  3ZNZ B;  1C1Y B;  1E7U A;  4M0W B;  1WR6 E;  4A3O A;  1UH6 A;  2KVR A;  2BWE S;  3H7P A;  2JRI B;  2I1K A;  5CX3 A;  3OJ3 A;  3QX1 A;  5DCN A;  4IM2 A;  1P0R A;  2KQ7 A;  2Z0D B;  2JZZ A;  2WX1 A;  1M94 A;  2LD9 A;  3CSF A;  4HJK A;  1Y8R C;  2J0M A;  4K1R B;  2N4F A;  3CF6 E;  2KN5 A;  3IHP C;  2OJR A;  1TBE A;  3PRP B;  4IG7 B;  4CO7 A;  2LAS A;  1WXS A;  3V6E B;  2WX0 A;  2C5L C;  4KZ0 A;  4MGY E;  5E6O A;  4FJZ A;  3NHE B;  1WJU A;  1TGZ B;  3A9K A;  3LJ3 A;  3NZU A;  4RM8 A;  1MG8 A;  3VH3 B;  3UF8 A;  2LRU A;  1E5W A;  3PTF C;  2HTH A;  3WAP A;  1D3Z A;  2L05 A;  2LXC A;  2LRW A;  3H6N A;  3UGB B;  4MH0 E;  1WE7 A;  3V61 A;  1WM3 A;  1V49 A;  4FUL A;  3DQV A;  5J18 A;  2MBH A;  2KWV B;  3DBL I;  1RLF A;  2EKE C;  2KDI A;  4PYZ A;  3M95 A;  4WQO B;  4FHJ A;  3L13 A;  1ZW7 A;  4ZDV A;  2KC1 A;  2LJ5 A;  1U4A A;  3ENE A;  4FJY A;  3ZNG C;  4LDT D;  3ZRC A;  4A3P A;  5D2M B;  4LJP B;  2XK5 A;  4ASW C;  3PRZ A;  4BKS D;  1WR1 A;  2KX3 A;  4W9J A;  1P9D U;  2NBU A;  2MBE A;  3D32 A;  2PJH A;  1ISN A;  2JUO A;  1G6J A;  2FCS A;  2KLC A;  4X57 B;  4F1S A;  4LCD E;  4NAW B;  2O6V A;  5J17 A;  4AWJ A;  1VCB A;  3PS6 A;  4BFR A;  3KUZ A;  3TBL D;  3ZW3 A;  4ZYN A;  2EMT A;  1WJN A;  4IM3 A;  3DBH I;  2IZV B;  4FHK A;  4WWP A;  2ZZP B;  1V6E A;  2K39 A;  2LXA A;  3A9K B;  2ZPY A;  1NBF C;  4JQW C;  1I42 A;  2UYZ B;  4NY0 A;  4PS3 A;  2RGF A;  3PLV A;  4DWF A;  3W1S C;  2CHZ A;  2KHW B;  4EUT A;  1P1A A;  2BKF A;  4K7W A;  2LI5 A;  2C7N B;  1K8R B;  2Z0E B;  4GU2 A;  4ANX A;  1IPG A;  2AL3 A;  1YX5 B;  3NZS A;  3IFW B;  3QQ8 B;  2C7M B;  2NVU I;  3VTV A;  1SGH A;  2M1M A;  4NQK E;  4GXB A;  3C0R B;  2M0X A;  4F7Z A;  3JW0 X;  3PLU A;  3W1S A;  2WYQ A;  2KQS A;  2KXJ A;  2JY6 A;  4IWP A;  3ZKJ C;  4KIK A;  3UQA A;  3CMM B;  5CHV C;  2DAF A;  2K8H A;  3PHX B;  1VD2 A;  3ZLZ A;  4HVB A;  5AZF A;  2IY1 B;  4W9K A;  2EMS A;  3SDL C;  2MBO A;  2MP2 A;  2KWU B;  2MLB A;  3U8Z A;  4BOZ B;  2KMC A;  2G4D B;  4ZRI A;  2KTR B;  2J0K A;  4K7S A;  3TCA A;  2KC2 A;  2LUE A;  3T8M A;  3PGE A;  1KJT A;  2LGD A;  1OEY J;  2JPH A;  5D7G A;  4K81 A;  2JWZ A;  1WMH B;  2MRP A;  1V81 A;  3APC A;  2KJ6 A;  1UEL A;  3ZIM A;  1AAR A;  2FCQ A;  4P7I A;  1E8Y A;  2FCN A;  1GNU A;  2M4N A;  3RZW C;  1CMX B;  2FCM A;  2REX A;  4KZC A;  1RRB A;  4G11 A;  2PEA A;  2NS5 A;  2G4S A;  1YX6 B;  1Z2M A;  2K6Q A;  1GJZ A;  5CHF A;  3ZNH B;  3Q3F A;  1LFD A;  2I1J A;  3VQI A;  3L16 A;  4II3 B;  5LXH A;  2UWQ A;  1SE9 A;  2Z59 B;  1OTR B;  4KDL B;  1L7Y A;  3NOB A;  2KOX A;  3OLM D;  4KVG B;  3HM6 X;  2L0T A;  4EEW A;  5LXI B;  1A5R A;  2ZVN A;  3OAW A;  3AI5 A;  3M62 B;  1E8X A;  1Z5S B;  3A33 B;  1I35 A;  2IY0 B;  3H9D A;  4ICV A;  4EOY A;  3SD5 A;  2KWC A;  3W1Y A;  3A9J B;  2C60 A;  4XC2 A;  3QK0 A;  1WX7 A;  5AZH A;  3DVG Y;  3VFK A;  2JRH A;  2MQJ A;  3VTW A;  4NNJ B;  3QAQ A;  3MHS D;  1GG3 A;  4DXA B;  4MJS B;  3DBS A;  3Q3J A;  2IYD B;  4FN2 A;  3ONS A;  4ZRJ A;  3DPD A;  1ZGU B;  2GBN A;  3JVZ X;  4EZK A;  2VRR B;  4AJY B;  1LM8 B;  3KYC D;  2D07 B;  1WIA A;  1E8Z A;  2O2V A;  3A4R A;  2KAN A;  3QAR A;  5IAA C;  3VHT C;  2Y5B B;  5AEK B;  5G2N A;  5C23 A;  5EDS A;  4HK2 A;  2NCN A;  3HM3 A;  2DYB A;  4OVV A;  5HKH A;  2B3A A;  1Q5W B;  3PV1 A;  2GBJ A;  3A4S C;  3TIX A;  3N30 A;  2BYV E;  4RMA A;  3L17 A;  1TZ1 A;  3PRE A;  1WXA A;  4IWQ A;  2O6V D;  2FAZ A;  4M8N A;  3B0A A;  4MGK E;  4NQL B;  2GBR A;  1T0Y A;  2J7Q B;  3B1L X;  4WJQ A;  2LVQ A;  5G55 A;  1IYF A;  3PZD A;  3VDZ A;  2NR2 A;  4IUM B;  1YJ1 A;  3KYD D;  3U7D A;  2KD0 A;  2ASQ A;  3ZRF A;  4J6I A;  5TR5 A;  3DVN V;  1OEY A;  3PRM B;  1WYW B;  1JRU A;  1WH3 A;  3GZN I;  4W9G A;  4KSL C;  3A1Q B;  4GDK A;  4IC7 B;  2FNJ B;  2DX5 B;  3VAW A;  3VXW A;  5KHO A;  2KTR A;  2C9W B;  4NJ6 A;  2MSE D;  4TUU A;  4G3X B;  1WXM A;  5DPR A;  2QHO A;  1KOT A;  1V80 A;  3QCA A;  4HCN B;  2NPT B;  2G45 B;  4BKG A;  3AUL A;  1YIW A;  4WJN A;  2XK5 B;  2LGY A;  2KJR A;  2V1Y A;  2ZCB A;  2HD5 B;  5CTR C;  2V3S A;  4BKT A;  2LVP A;  4ZRK A;  3NS8 A;  1GC7 A;  3V60 A;  3IG3 A;  3JSV B;  3OJ4 B;  4CHK A;  2K6D B;  3ALB A;  3QIJ A;  2HE7 A;  1Q0W B;  4IM0 A;  4HXD A;  2LWP A;  4LDT B;  4TQ0 A;  2MBQ A;  2MX2 A;  4PYU A;  1WGH A;  2WWZ A;  4HDQ A;  3PHW B;  2NPT A;  3VVW B;  4ANV A;  3A1Q A;  4GDK B;  4TKN A;  2KFK A;  4W9E A;  3QC8 B;  4DDI D;  3UIP B;  2MCN B;  4EFO A;  3L10 B;  4B9K A;  2GMI C;  3ML9 A;  1H8C A;  3ZDT A;  3KVF B;  2N9E B;  1IP9 A;  2MA9 B;  5C1Z A;  2MWS B;  2NBV B;  3I3T B;  3RT3 B;  1WGD A;  4XX5 A;  3H7S A;  1V9J A;  2G3Q B;  2LZ6 A;  2XBB C;  2YLM A;  4JL9 A;  4W9F A;  3S2A A;  4MEM A;  2KZR A;  4URK A;  3ZTC A;  4BKS A;  1WY8 A;  4PS8 A;  5AZG A;  2NBW B;  2KNB A;  3WAL A;  1ZKH A;  3ZO5 B;  3M63 B;  4DDG D;  2BF8 B;  1UD7 A;  4MSQ B;  1F9J A;  4WJO A;  2ZJD A;  1NI2 A;  5KHQ A;  1QZE A;  2L0F A;  1WJ4 A;  1YD8 U;  4GMV A;  2PE9 A;  5E6P A;  1PQS A;  4W9I A;  4BBN C;  4W9D A;  1LXD A;  3H7P B;  3RD2 A;  4GDL B;  5LLI A;  3H1U A;  3WAM A;  3LDZ E;  4BVU C;  2MW5 A;  3EFU A;  2W9N A;  5J2R A;  2CKH B;  1WE6 A;  4AUQ C;  2PPH A;  4W9L A;  2KX0 A;  3VH4 B;  2MBB B;  3WIM A;  3M3J A;  2M8S A;  3SU8 X;  1WI0 A;  2DYO A;  3IVF A;  4I6L B;  5GMV A;  4MSM B;  5JHB A;  1WGY A;  2N9P C;  2BKR B;  2JZ3 B;  1UBI A;  3X23 A;  2FID A;  3ZVV A;  4WWO A;  2BGF A;  2C7H A;  2K8C A;  4MDK E;  3HK0 A;  2ZEQ A;  3VUY A;  1WM2 A;  4E71 A;  1E7V A;  3U30 A;  1WX9 A;  1UBQ A;  2DZJ A;  1S3S G;  3ZNI D;  1WRD B;  3V62 A;  3AXC A;  4E74 A;  1EUV B;  4M8M A;  3ECI A;  1Q1O A;  2DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...