3ZNZB

Crystal structure of otulin otu domain (c129a) in complex with met1- di ubiquitin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
146
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FAM105B
publication title Otulin Antagonizes Lubac Signaling by Specifically Hydrolyzing met1-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3znzB01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3znzB02
2CHZA 4GU2A 2WYQA 4EZJA 1WFYA 3OJ3A 1YIWA 3VUWA 3L17A 2LD9A 2LGDA 5JZEB 1WM2A 1RAXA 2J7QB 2M8SA 4DDGD 2CHXA 2LWPA 4WJQA 5JH5C 2KD0A 4MJSA 1CMXB 1E5WA 4ANWA 4IUMB 1E8XA 3UIOB 3DBSA 4ZRIA 2CKHB 3ZTDA 2NS5A 5JHAA 3DCGA 3D32A 4FJVB 2DYBA 2N1VA 2C7HA 4JL9A 4MGZE 1E8WA 2BGFA 4RM9A 4TKNA 4ANXA 4KSLC 2AWTA 1SIFA 2C7NB 2YVCA 5D2MB 3VVWB 4IM0A 3ZUNA 4WJOA 2MP2B 1HE8A 2MA9B 4WAAA 4HLEA 2I1KA 2KNBA 4AJWA 1V6EA 4HPMB 5FR6A 4NY0A 1EF1A 3JW0X 2YLMA 5G2NA 4G3XB 2GMIC 2PE6B 3GZNI 3U8ZA 3KYDD 1WYWB 2KK8A 2FCMA 3N32A 4ZDVA 2M17A 2RD0A 1BT0A 1EF5A 2EMTA 4F8CB 4EFOA 2I1JA 1WY8A 4ZRKA 2GBRA 3VTWA 5LXHA 3CF6E 2AL6A 3QAQA 4GB9A 2KHWB 3H1UA 2O6VB 4HXDA 3PZDA 4W9JA 3WAMA 4TV3A 2MBOA 1WX9A 3VXWA 2LXAA 2NCNA 4A3PA 3TBLD 3U7DA 3DOWA 2DAJA 1TZ1A 1F9JA 2R2QA 3MHSD 4URKA 2IZVB 2V3SA 2K8CA 3VTUA 3W1SC 3R7QA 4NQKE 3M62B 2LGXA 2EKEC 2JUOA 5BO4B 1E7VA 1UGMA 2UYZB 3X23A 3ZVVA 2AEHA 2BYVE 4PYUA 1P9DU 3X0WA 2N9XA 2Z0DB 2AL3A 3NY5A 3PREA 2ZNVB 4WQOB 1WX7A 2DX5B 4IW0A 3IFWB 3V6EB 3EC8A 2JRHA 1NI2A 2KFKB 3ONSA 1P1AA 3R66C 4KZCA 2WDTB 1U4AA 2L0FA 2LJ5A 1YD8U 2JZ3B 2LASA 3ZIMA 4BKSD 5J18A 4NAWA 2LUEA 4AWJA 3A9KA 1GG3A 1WI0A 2C9WB 3JYUA 1WMHB 3QWZB 4LDTD 3WA0A 2N4FA 3ZDMC 5D6JB 1RLFA 1J19A 2L00B 1P0RA 4DHZB 2LVQA 3AU5A 3EFUA 3QARA 1V81A 3ZKJC 2Z59B 1UD7A 2BWFA 2KQ7A 4GMVA 2GBMA 2DZIA 2VRRB 2KN5A 3H7PA 4NJ7A 3T8MA 3ZNID 4BBNC 1WXSA 4X57B 3PT2B 4E74A 4W9KA 4W9CA 2N7EA 2KWVB 1VD2A 2D2QA 1VCBA 2LGYA 1IPGA 3EHVA 4PS3A 5DPTA 3L16A 3UIPB 2FIDA 5IA7A 5E6OA 4MJSB 2BKRB 1Y8RC 4HDQA 3VFKA 4LJOB 3PRMB 1I42A 4G50A 3ENEA 3PHXB 2L76A 2KQSA 3DVGY 2BYFA 2PEAA 3PSEB 4DK5A 3APFA 3PLUA 3V60A 2KDIA 1AARA 3HIZA 1SE9A 2LRWA 2FCSA 3QC8B 4IM2A 2HJ8A 3B0AA 1JRUA 5C1ZA 2DZKA 2KO3A 1WJNA 2KLCA 2L8JA 3A1QA 4KSKC 3ZRCA 5AEKB 3V62A 3A4RA 3NOBA 1UZXB 2IO2B 2O6VD 2KDFB 2D3GA 2L7RA 3HM6X 3CSFA 5DPWA 1V5TA 2N1WA 3PLVA 4W9GA 2ASQA 4W9DA 1R4NI 1WGHA 3R3MA 1D3ZA 1WJ4A 4E71A 2XBBC 3OLMD 1R4MI 4MSQB 4RM8A 2NPTA 4B95A 3NS8A 3QA8A 3TMPB 2MBEA 3RYTA 2GBJA 2L0TA 2NVUI 3RT3B 3PRZA 1H4RA 5EDSA 4MDKE 2ZCBA 3CSTA 2MCNB 4AUQC 2MW5A 2ZJDA 1WZ3A 1P3QU 3ZRFA 2D11A 1XQQA 2N9EB 4CYEA 3ZTCA 3AXCA 4IG7B 2RGFA 3JSVA 4MGYE 3ZNZB 2FCQA 2A4ZA 3K9PB 3L08A 1A5RA 2KJ6A 2OJRA 1T0YA 1V9JA 2G4SA 5D7GA 3M3JA 4CHKA 3V6CB 4ASWC 2FCNA 4E3CA 1WM3A 4MELA 2XEWA 1WXMA 1WX8A 3PTFC 4XC2A 1TGZB 3APDA 2L3ZA 2KDEB 2M1MA 3KUCB 1Z2MA 3WAOA 3SHQA 1OGWA 1WE7A 5C23A 1ZKHA 4NPNA 3SDLC 3TIXA 2ZPNA 3K9OB 2KLGA 3HHMA 3ML9A 2KXJA 1WF9A 4IWPA 4M8MA 2JY6A 1I35A 2GBKA 4W9EA 3A9KB 3UINB 1S3SG 1ZGUB 2CHWA 2KC2A 2IO3B 1V80A 3Q3JA 1P98A 2DZJA 1G6JA 2Y5BB 1J0GA 3P2BA 2N9PC 4BKSA 2JPHA 2AYOB 4EKUA 2LXCA 3UF8A 2C5LC 4K81A 3OAWA 3PVLA 3ALBA 3KH0A 3IBEA 4RMAA 3QCAA 1C1YB 2JWZA 2ZPYA 1WIAA 4DXAB 2K25A 3UGBB 1KLVA 3APCA 1UH6A 2XK5A 4F7ZA 4MH0E 4TQ0A 4A3OA 2KMCA 1EO6A 3B1LX 5DCNA 4DHJD 2K8HA 4BBNF 4HJKA 4FHJA 1WE6A 4NQLB 1OQYA 4DWFA 1WR6E 2A5UA 3ZLZA 4WJNA 3PRPB 1WRDB 4KIKB 4WJPA 3A1QB 3M95A 4K1RB 4HVBA 1ISNA 1IYFA 4DDID 3PGEA 2D10A 3VAWA 2HTHA 2O2VB 2JXXA 4MSMB 5J2RA 2FAZA 4MGIE 4LJPB 2LVPA 3TJPA 1KJTA 3ECIA 2LI5A 2JVCA 3DBHI 5E6NA 1GC7A 2MRPA 5AZFA 2J0JA 3KUZA 1NBFC 1YJ1A 3BINA 3OJ4B 4FHKA 3VH3B 1LFDA 3QQ8B 5D94A 4BOZB 4FULA 4PS8A 2WX1A 3R7RA 2LRUA 1E8YA 2W9NA 4ZRJA 2DYOA 2O6VA 2QHOA 1KM7A 1K8RB 1OEYA 2NPTB 4DBGA 3A9JA 3ML8A 1C3TA 1WGGA 1TBEA 1WJ6A 3QJZA 4FBJB 4TUUA 2RPQA 3AI5A 2NBWB 1RRBA 3NZSA 4JIOU 4K7SA 4BKTA 3WIMA 4AP4C 1RFAA 2REXA 3IVFA 5KHQA 2KOXA 4XX5A 2DHZA 2UWQA 4G0NB 4ANUA 3H9DA 3AU4A 4I6PA 4TQ1A 4II3B 2KANA 4HDOA 2JZZA 4N9F4 1L7YA 2G4DB 2IO1B 2MQJA 3WANA 4K7UA 4HPLB 4PYZA 1E90A 2Z0EB 3SD5A 2IBIB 2KTFA 3H6NA 3JSVB 2J0MA 1WH3A 3RUIB 2R2OA 2IY1B 4WWNA 4GDLA 4KDLB 2BKFA 2BWES 2KTRA 5G55A 3KW5B 4BFRA 1ZW7A 3CMMB 3L13A 4JGHB 2G3QB 2J0KA 1GNUA 1UBQA 2NBVB 2KKCA 2RR9A 4GOCA 1YX6B 4II2B 2DZMA 3MTNB 4NNJB 4W9IA 3SU8X 2OOBB 3DVNU 2JRIB 4IWOA 4MGKE 4GIVA 1H8CA 3PHWB 4GDKA 3L0WB 2JT4B 4JLCA 3RD2A 3VHTC 4EUTA 2MSED 2D07B 2ZVOA 3QX1A 4ANVA 1YQBA 4BKGA 4FA6A 1S1QB 2C60A 4HCPB 1V86A 2DENB 1LM8B 3NZUA 2CU1A 4IM3A 4KDIC 1V5OA 4JQWC 5CHWA 2FNJB 2ZVNA 3A4SC 4HK2A 1X1MA 3KVFB 2B3AA 2V1YA 4ICUA 1FXTB 4LDTB 1WGYA 2PPHA 1E7UA 2ZZPB 4GGQA 2PJHA 2JF5A 3VH4B 4I6NB 2KX3A 2XK5B 1WR1A 1XD3B 3H7SA 5J17A 4B9KA 1WXAA 2HE7A 2CS4A 5KHOA 3LJ3A 4I6LB 2M0XA 1WXVA 4M0WB 5DPRA 4AOFA 2WWZA 4EZLA 2IO0B 1YX5B 4FJYA 4HCNB 3QHTA 2KFJA 3IG3A 4NAWB 4GN1A 3W1YA 4XZ4A 3RULA 3TCAA 5E6PA 1KOTA 1UBIA 2IYDB 3KUDB 4YL8A 4F1SA 5GMVA 3VTVA 5AZHA 3VUXA 3H7PB 3WAPA 4MEMA 1PQSA 1L2NA 2MX2A 3I3TB 2KDBA 4FADA 3AULA 1OEYJ 3DDCB 3DBRI 1GC6A 2KVRA 2L05A 3DPDA 4W9LA 4GXBA 2MBBB 3W1SA 2MWSB 5L83A 1WZ0A 3RCZA 3WALA 2IY0B 3N30A 4PS7A 4EZKA 4OVVA 1EUVB 2EMSA 2KX0A 3A9JB 3GOEA 2CR5A 1Z5SB 3TL5A 3O65B 3ZNHB 2KMAA 1OTRB 4IWQA 2RSUA 1V2YA 2MP2A 3BY4B 4LCDE 1SGHA 1Q1OA 2K1FA 5TR5A 3T9LA 3ZNGC 2KZRA 1LQBA 1V49A 5AZGA 3PV1A 2BF8B 3VQIA 3QIJA 4A20A 3B08A 4WWOA 2GOWA 3EECA 1GJZA 1QZEA 1WJUA 4FLHA 4GDLB 2BYEA 2KTRB 1WGRA 5CTRC 3IHPC 5DPSA 1GUAB 1NDDA 3C0RB 4MM3A 3UQBA 3M63B 4ZYNA 4ICVA 3NHEB 4FN2A 4BOSC 5LXIB 4NJ6A 2DYMA 4W9FA 1E8ZA 2NR2A 3RZFA 3VDZA 3VUYA 2KWCA 3DVNV 1TTNA 2MLBA 2V4LA 4DHZE 4P7IA 4IC7B 1XT9B 3S2AA 3DQVA 4BVUC 5CX3A 3V61A 3PPAA 4EOYA 2G45B 3ZW3A 2KJRA 2K6DB 3DBLI 4GDKB 2KJHB 3A33B 3LDZE 3Q3FA 2K6QA 3N3KB 5IAAC 3DVGX 3JVZX 4AJYB 4M8NA 2FIFA 1IP9A 2K8BA 2LZ6A 2KC1A 3QK0A 4EEWA 1WGDA 4CO7A 5L95C 4K7WA 4KVGB 3MJWA 3HK0A 5CHFA 2GBNA 2MBQA 4FJZA 4KZ0A 1Q0WB 1MG8A 2ZCCA 2KWUB 2NBUA 5JHBA 1UELA 2LVOA 4G11A 4B6WA 3UQAA 2K39A 2KFKA 5LLIA 1J8CA 2HD5B 3KYCD 5CHVC 4GSWA 4J6IA 4KV2A 4W9HA 2ZEQA 2FUHB 3U30A 2WX0A 2C7MB 1M94A 3HM3A 4OVUA 5HKHA 3ZO5B 3PS6A 4HWIB 4KIKA 2BPSA 1WMHA 3ZDTA 2PE9A 2MBHA 4WWPA 2M4NA 3L54A 1Q5WB 2O2VA 3L10B 2DAFA 1LXDA 2ZNVC 3RZWC 2N7DA 4DHJB
chains in the Genus database with same CATH superfamily
2CHZA 4MACA 4EZJA 3KWVA 3L17A 5BMHA 1RAXA 2M56B 2J7QB 2M8SA 4MJSA 2HTME 4ANWA 4IUMB 3DBSA 2LJIA 2NS5A 1SE3A 4FJVB 2DYBA 1T3QA 3U2SC 2BGFA 4TKNA 4IKGA 1FCCC 4IM0A 1XCTL 2VH1A 3TSSA 2I38A 4C4VA 2KNBA 2WQYB 1V6EA 4G3XB 1VZ8A 1I7HA 1T0SC 3U4EG 3U8ZA 1WYWB 2KK8A 3EFCA 4ZDVA 2M17A 2RD0A 4OVZA 1NYQA 3MP9A 3P63A 1SE4A 3BK2A 3QAQA 4GB9A 3P4PB 4HXDA 3PZDA 4ACFA 3WAMA 2MBOA 2H88B 4A3PA 1PUTA 2IZVB 2GI9A 3R7QA 4OW0A 3M62B 3EUB2 1E7VA 3X23A 1NYRA 1KH0A 1P9DU 2Z0DB 4WQOB 2WXRA 1WX7A 2DX5B 4IW0A 3IFWB 1NI2A 1D5MC 4DXFA 4GLSC 1FNUA 2LJ5A 4UDUC 2JZ3B 3R2IA 2LUEA 1WI0A 2GLSA 4RF0A 3Q8FA 2N4FA 3AM9A 1RLFA 4DHZB 1MPEA 2LVQA 2WXHA 3QARA 1V81A 1UD7A 3T8MA 2INNE 2WXOA 3FAHA 1QILA 1ET9A 4E74A 2X38A 2IGDA 4W9CA 2KWVB 2AX5A 5E6OA 1HA5A 3BIID 3PRMB 1PGBA 1I42A 4XYCA 2L76A 4RH6A 2E6XA 2EELA 3HIZA 2X8XX 2PLPA 3ZRCA 5AEKB 3V62A 1UZXB 1DGJA 1TT5B 2XNAC 3AE7B 1TS5A 4E71A 3NG0A 2NPTA 3QA8A 2L0TA 3AV8A 4MDKE 4AUQC 2JYTA 1FRRA 1WZ3A 3ZRFA 4P16A 1XQQA 3ZTCA 3JSVA 1I4PA 2H89B 1T0YA 1V9JA 2G4SA 3GE8C 4CHKA 1T0QC 3EGRA 1WX8A 1HEZE 3IT6B 1TGZB 4XC2A 5D3DA 2KDEB 2M19A 1PGXA 3SHQA 1WE7A 3SDLC 3TIXA 1UF0A 3K9OB 2KLGA 3LB8C 1WF9A 4M8MA 2GBKA 1FXIA 1S3SG 1SXTA 3SFDB 4ZYSA 1HTQA 2KC2A 1ENFA 5IO9A 1G6JA 2N9PC 4EKUA 2LXCA 3UF8A 2WDVB 4YTNB 1TKGA 4LNFA 4HKZE 3LYYA 4DXAB 2K25A 4EE2A 3APCA 4A3OA 5DCNA 2D3CA 2CJNA 4M0WA 1WE6A 4NQLB 3C8YA 3Q8AA 2JXTA 2QMTA 2A5UA 4WJNA 1CJEA 4KIKB 2BTEA 3A1QB 3M95A 4K1RB 1ISNA 4IDIA 2GRIA 1IYFA 4LLGM 4MGIE 3TJPA 2LI5A 5E6NA 4YTPB 1NBFC 3ZXRA 1XLNA 3OJ4B 2DNFA 4RCOA 2O6VA 1Y56A 1KM7A 4PK1A 1TBEA 1WJ6A 5IOIA 1RRBA 3WIMA 1RFAA 2BQQA 4G0NB 3H9DA 1AW7A 4II3B 4YSZB 4TMAB 2K22A 1L7YA 2G4DB 2IO1B 3GZNB 1E90A 2IBIB 2IY1B 5IN7A 2FUG1 4GDLA 1N5WA 2LGSA 1P7FA 3KW5B 4BFRA 1ZW7A 2WU5B 1YN5A 2G3QB 2J0KA 5E6JA 1UBQA 2KKCA 3N20C 1ZOYB 4GOCA 2DZMA 4NNJB 4W9IA 3DVNU 2I2YA 2W3RA 4EUTA 4LNOA 2MSED 1YQBA 4WH4A 1FRDA 1IGCA 4HCPB 5HG2A 1LM8B 2GB1A 3NZUA 4IM3A 4KDIC 2KMMA 2ZVNA 1FXTB 2D3AA 2PPHA 3Q69A 2ZZPB 4GGQA 2LEKA 1V1OA 4I6NB 5KHOA 5DPRA 4EZLA 4GN1A 4YTMB 3OG5A 1ZXIA 2OEDA 3RULA 3TCAA 3KUDB 3H7PB 1WWTA 1GC6A 2L05A 4GXBA 2MBBB 2MWSB 5L83A 1IBXB 2CR5A 4USAA 1V1PB 4L2YA 3ZNHB 2KMAA 1OTRB 4C7YA 3BY4B 1Q1OA 1QQRA 1WYGA 3MJ5A 4S17A 1V49A 3BWUD 3QIJA 4WWOA 1HQRD 1QZEA 4FLHA 2WDQB 2W3SA 2KTRB 3IHPC 4YWGG 1FM0D 1OFFA 4MM3A 4ZYNA 2IGGA 1XEEA 4W9FA 3VDZA 2MLBA 4P7IA 4YXDB 1NEKB 5C3JB 2KJRA 2RPVA 2DWQA 1ROEA 4M8NA 2LZ6A 2KC1A 2IPKD 3Q8EA 4CO7A 1FCLA 3HK0A 2MBQA 4FJZA 2ZCCA 2BW2A 3RNCC 2J52A 5LLIA 4J6IA 2ZEQA 1UGJA 2BT6A 1M94A 2IJ0A 2WXPA 5HFYA 2D5GA 3P1MA 2BPSA 3ZDTA 2M4NA 2O2VA 3L10B 1SJHD 1LXDA 2N7DA 1C79A 4GU2A 2WYQA 1RFKA 1WFYA 1QKZA 2G9HD 4M01A 2YEPB 2AQ1B 4DQOC 4WJQA 1CMXB 4ZRIA 3NUHB 3ZTDA 3SEBA 3DCGA 3D32A 2N1VA 4JL9A 4MGZE 1E8WA 4RM9A 1VR9A 1D6EC 1SIFA 2C7NB 4WJOA 5TSSA 4A9AA 1MFWA 4WAAA 4HLEA 4ZHPA 4AJWA 4HPMB 5G2NA 3JW0X 1NI3A 3P4QB 2JQRB 2FCMA 3N32A 1EF5A 2EMTA 1C9FA 4F8CB 2I1JA 5I4DA 3AE8B 3OWEB 2AL6A 1T0RC 2KHWB 2KACA 1DYQA 3GB1A 1MVKA 3VXWA 3DHIC 1K53A 2NCNA 2MJEA 3ZJTA 5FKAC 2K8CA 1E6EB 2KAJA 3Q3OC 2LGXA 5BO4B 1QOFA 2WXKA 2PKOA 1P7EA 1CZPA 2JRHA 2KFKB 4EFOA 4KZCA 1U4AA 1E7PB 1UUPA 5BYQA 3E56A 4BKSD 4AWJA 3A9KA 3JYUA 3WA0A 1WMHB 2NTSA 3B2GA 1L6VA 1SE2A 2L00B 3AU5A 3EFUA 2KN5A 4BBNC 4W9KA 1VD2A 3BYYB 2D2QA 2LGYA 2E3TA 2QDFA 2BKRB 4MJSB 3VFKA 1YMHE 1TY2A 4FXCA 1N62A 4OZBA 1ESFA 2BYFA 2PEAA 2Y5PA 3V60A 1AARA 1SE9A 3QC8B 4IM2A 1JQ4A 2INCC 2DZKA 1OQQA 1FO4A 4C4VB 3A4RA 3DBRB 2KDFB 2D3GA 1UWMA 1UWXA 2L7RA 4ITKA 4CQNA 1QLBB 3PLVA 4W9DA 4JPSA 2XBBC 3OLMD 4MSQB 3TMPB 2GBJA 1L0YB 3LXFA 5EDSA 2ZCBA 3CSTA 2MCNB 1N5XA 1P3QU 1E0ZA 2W82A 3KQ4A 1KLUD 2RGFA 3WCQA 1A5RA 2KJ6A 5D7GA 1CK1A 3V6CB 2JYEA 1JWSD 1WXMA 3PTFC 1OGWA 5C23A 1ZKHA 1OQRA 2YEPF 4NPNA 3I5JC 1XLPA 3ML9A 4IWPA 1UNSA 2CHWA 1V80A 1P98A 2DZJA 2HDEA 1WXQA 1FMAD 4PT5A 4K81A 3VRBB 1XCQL 3VR9B 2QEJC 4RMAA 3QCAA 1F0ZA 2JWZA 1KLVA 4MH0E 2KMCA 3B1LX 2QC8A 4DHJD 2K8HA 2ZW0A 2K9XA 3O13A 4DWFA 1ZP0B 4JWSC 3RNFC 1L5PA 4DDID 1XF5L 2FE8A 2UU7A 2ONQA 2LVPA 1KLGD 2JVCA 2WXFA 1YQ3B 3KUZA 2CJOA 2KVZA 4FHKA 2JWUA 1GPXA 4PS8A 3BK1A 2WX1A 2W9NA 1GOZA 2NPTB 1K8RB 3A9JA 2VH2A 1WGGA 4TUUA 1YN3A 2REXA 3AE6B 5KHQA 2KOXA 3SR6A 4TQ1A 4HDOA 2JZZA 1QOBA 4M02A 3H6NA 3JSVB 1V8CA 2J0MA 3RUIB 1F77A 3AB5A 4WWNA 3Q8BA 1F2RI 3CMMB 4JGHB 3SFEB 1PYWD 1HZ6A 1I4HA 1H8CA 3PHWB 2WP9B 3L0WB 2JT4B 3RD2A 1MHHE 3I57A 3MC9A 2L32A 3TEWA 3RNBC 4JQWC 5CHWA 2JZPA 2FNJB 4HK2A 2BVCA 4O1NA 4ZRPA 2V1YA 4ICUA 4LDTB 3N1XC 4HKQA 3V3XA 2WS3B 1R7SA 2QJLA 2LUMA 2FBWB 4A90A 3GP7A 2PJHA 2IGHA 1TKYA 4HEA1 2KX3A 2MEKA 1XD3B 4P6VF 1HXYD 3L4PA 2L1AA 3LJ3A 3Q14C 4M0WB 4AOFA 4HCNB 3QHTA 4NAWB 4XZ4A 1SBBB 4ARIA 1EU4A 3IAS1 4JX1C 5E6PA 2QSDA 1JWMD 1ZE3D 1JALA 1K51A 3MFGA 5AZHA 1QOAA 3I3TB 3DDCB 3RCZA 1A70A 3RNGC 4N6EB 5IKCM 1EUVB 3GOEA 2KX0A 3TL5A 3O65B 4JWUC 2MP2A 2SEBD 4LCDE 1SGHA 2K1FA 3BYTB 1LQBA 2BF8B 3HVDA 2GOWA 1ZDXA 1L0VB 2BYEA 4GDLB 3P42A 1NDDA 5EE1A 3M63B 3P4RB 3NHEB 1TJEA 4BOSC 1E8ZA 3DVNV 4LNIA 2V4LA 3DQVA 3PPAA 4EOYA 3DBLI 3ZXVA 3LDZE 2PVGC 1SJED 1M4VA 3MC0B 4KVGB 1E9MA 5CHFA 4KZ0A 1Q0WB 3RN9C 3ZYYX 3P4SB 1UELA 1J8CA 4XDCA 5CHVC 5T8IA 2N0SB 2WX0A 2C7MB 3ZGZA 1JMLA 3PS6A 3C19A 4KIKA 4DXGA 1MHXA 2PE9A 4KX6B 2KT7A 1Q5WB 2WXNA 2LD9A 1Q10A 1PGAA 2CHXA 2KD0A 1E5WA 3AEFB 1E8XA 4A8XC 1C77A 2CKHB 1HZ5A 2Y5CA 1VLBA 4ANXA 1WRIA 4KSLC 2YVCA 5D2MB 3VVWB 3ZUNA 1HE8A 2L52A 3AEAB 2I1KA 2GMIC 2PE6B 3KYDD 3GE3C 3B2FA 1SEBD 1WY8A 5EE3A 3H1UA 4W9JA 2Q5WD 1T5XD 4TSSA 1FPYA 2LXAA 3TBLD 3U7DA 1TZ1A 1F9JA 4WIPA 2BBCA 3TEZA 3W1SC 1C4CA 2UYZB 2AEHA 2BYVE 4PYUA 4US9A 3X0WA 2AL3A 3NY5A 3N9YC 1JROA 1JW9D 3R66C 1P1AA 2WDTB 3UI3A 1YD8U 2LASA 3ZIMA 5J18A 2V0GA 4KKJA 3FKYA 2V3PA 5D6JB 1J19A 1P0RA 2GBMA 2DZIA 2VRRB 2V4IB 3H7PA 4NJ7A 2J42A 4XWWA 2V9HA 5C2TB 3TEXA 1IPGA 4PS3A 3L16A 3PO0A 2WLBA 4NJCA 2BS4B 1Y8RC 4HDQA 1V1PA 4LJOB 4A6QA 1FD6A 3PSEB 4DK5A 3APFA 3PLUA 2KDIA 2VZKB 2LRWA 2FCSA 2NMQA 5C1ZA 2KO3A 1WJNA 2L8JA 4KSKC 2PVOD 3AE2B 2BB6A 2LFIA 3CSFA 3NVYA 1ZUD2 2N1WA 3NJTA 4YT0B 1R4NI 1WGHA 4L1BA 3R3MA 1WJ4A 1R4MI 1L4ZB 4OZAA 4B95A 3NS8A 1SSNA 3H8HA 4RNAA 2KWDA 2MBEA 3RYTA 4WWMA 3RT3B 4ZHOA 2MJ3A 2K5PA 2D11A 4M00A 1PFDA 4CYEA 5BYSA 2MJDA 3AXCA 4IG7B 3RNAC 1JWAD 3N1YC 2FCQA 3HRDD 1ZPSA 3M3JA 1C76A 2FCNA 4B0MA 1WM3A 3KLSX 3NS1A 3AEBB 5LNK1 2RMMA 3RI7C 1VZ7A 3APDA 3KUCB 1Z2MA 1F52A 3WAOA 1N61A 2WXMA 2ZPNA 3B9JA 3ZJUA 2JY6A 2INPE 3N1ZC 3A9KB 3UINB 1ZGUB 1HTOA 1WGKA 2IO3B 3HVZA 3AEDB 3P2BA 4BKSA 2JPHA 2W55A 4KGRA 2VZKD 2C5LC 4N58A 4LNNA 1D4BA 2K0PA 3KH0A 2IDYA 1PDXA 3AE5B 1C1YB 1WIAA 1NVID 3UGBB 1UH6A 1XLQA 2XK5A 1B9RA 4WURA 4TQ0A 1EO6A 3HUIA 4HJKA 1GAQB 4H2AA 4S0RA 3ZLZA 1WRDB 1R4NB 1XXGA 3NVZA 1JWBD 3VAWA 2HTHA 1FEHA 1KJTA 1GC7A 2MRPA 4YSXB 2J0JA 1STEA 1YJ1A 4N59A 2BYTA 1XO3A 3VH3B 3QQ8B 5D94A 4FULA 1E8YA 4ZRJA 4DBGA 4OZCA 1C3TA 3QJZA 2RPQA 2NBWB 3NZSA 4AP4C 1FNWA 4XX5A 4ANUA 4MH8A 5G5GA 3WANA 4K7UA 4HPLB 4PYZA 3SD5A 2KTFA 1WH3A 2R2OA 3AE1B 4KDLB 5G55A 3L13A 3AEGB 4XE0A 2BB5A 3BZDB 1IUEA 2RR9A 3FILA 3MTNB 2OOBB 2WXQA 1N60A 4GIVA 4J3OD 4GDKA 4JLCA 3VHTC 2D07B 4QAYA 4FA6A 1YJJA 1S1QB 3T3NA 2KYWA 1JCKB 2DENB 4P1BC 2CU1A 3EA6A 1V5OA 1DOYA 4ZOHC 2WXLA 3ZJVA 1J7BA 1WGYA 3VH4B 2JF5A 2TSSA 3W2DA 1WXAA 1F1HA 2CS4A 2K3UA 4I6LB 2M0XA 2Z8LA 2IO0B 4FJYA 2D3BA 3BVMA 3W1YA 3CWIA 2RDBC 1BXTA 1KOTA 4YL8A 1XLOA 3VUXA 2XN9C 3WAPA 4MEMA 1PQSA 2W54A 5BMIA 2N7JA 2KDBA 4FADA 2KVRA 3DPDA 3W1SA 1WZ0A 2IY0B 5IP4D 4PS7A 4EZKA 4OHJA 4OVVA 3A9JB 1I4GA 2N9KA 4HROA 1TIFA 4LK0M 3TUOA 4IWQA 2RSUA 4KKIA 3T9LA 1I4RA 5AZGA 4ZRQA 4A20A 2CU3A 3EECA 1GJZA 1WJUA 3GS2A 5FR3A 1WGRA 2QIEB 1I4XA 3VR8B 1GUAB 4KGSA 3UQBA 2DYMA 1KTKA 3RZFA 2NR2A 1TTNA 4IC7B 1XT9B 3S2AA 4YSYB 3V61A 3A33B 2ZW1A 4K3CA 3V05A 3JVZX 4AJYB 1L4DB 1C4PA 2FIFA 1IP9A 4AS1A 5G5HA 1WGDA 2ICIA 3DWMA 4K7WA 2GBNA 1MG8A 2WDRB 1V97A 2EKIA 1AN8A 2KWUB 3MHZA 2G1EA 3MC8A 2LVOA 4G11A 1YOVB 3UQAA 1T6BX 2HD5B 3DWGC 4GSWA 4W9HA 2FUHB 3U30A 3HM3A 3KWLA 2LHEA 3U52E 3ZO5B 2RDHA 2ACZB 2WXJA 4RGOS 4WWPA 3RZWC 3NVWA 5FK9C 1GB4A 3VUWA 3OJ3A 1YIWA 2LGDA 5JZEB 1WM2A 2LGIA 3ZQ4A 4DDGD 3Q6BA 2LWPA 2B76B 5JH5C 1ACCA 3UIOB 2JSVX 5JHAA 2WNMA 2C7HA 4L23A 1SB3C 2AWTA 2MP2B 2MA9B 1SF0A 2PMVA 5FR6A 4NY0A 1EF1A 3URYA 2YLMA 1DOIA 3W5UB 3GZNI 4C56C 2PIAA 1N63A 1BT0A 2DBYA 2ON8A 2NTTA 2OHFA 5LXHA 4ZRKA 3VTWA 2GBRA 3CF6E 2O6VB 3BVZA 1GB1A 1TS3A 4TV3A 4RF1A 1VRAB 1CQVA 1WX9A 3AN1A 4R3DA 1VZ6A 1BUIC 3DOWA 2DAJA 2R2QA 1EWCA 3MHSD 4URKA 2V3SA 1TZOA 3VTUA 4B0EA 1YJIA 4NQKE 2EKEC 2JUOA 1UGMA 3ZVVA 1C78A 2AQ2B 2N9XA 5EE0A 3PREA 2ZNVB 3V6EB 1B1ZA 3EC8A 1TS2A 3ONSA 1J7CA 2L0FA 4NAWA 1GG3A 1EM7A 2C9WB 3QWZB 4LNKA 1YNTE 4LDTD 3ZDMC 3AH7A 1DOXA 3ZKJC 2Z59B 4RFBA 2BWFA 2KQ7A 4GMVA 1QF6A 1D5XC 3ZNID 1WXSA 4X57B 3PT2B 3ABVB 2N7EA 4XWTA 1VCBA 3EHVA 5DPTA 3UIPB 1TS4A 2FIDA 5IA7A 2WXGA 1L6UA 4US8A 1KRHA 3IXSA 4G50A 3ENEA 2PTLA 3PHXB 2WHIA 2KQSA 5JXVA 3DVGY 1K52A 5H92C 4C80A 2HJ8A 3B0AA 1JRUA 2KLCA 3A1QA 1FNVA 3BVGA 3ETRA 1KFYB 2BS2B 3NOBA 2IO2B 2O6VD 2LMCA 3IAM1 3HM6X 2KDMA 1YN4A 5DPWA 3NZ3A 1V5TA 4W9GA 2ASQA 3T3OA 1D3ZA 4RM8A 1LO5D 2KQ4X 2NVUI 3PRZA 3PZ7A 1H4RA 2MH7A 1FFUA 2MW5A 2ZJDA 3RNEC 5H8YE 2INDC 2N9EB 4P1CC 3I63C 4MGYE 3ZNZB 3L08A 2A4ZA 3K9PB 1ZDVA 2BS3B 2OJRA 3R8BA 3E9SA 4ASWC 4E3CA 3AEEB 4MELA 2XEWA 2N9LA 2L3ZA 2M1MA 3DBLB 4MM3B 5GXGB 3VRAB 3HHMA 2KXJA 1I35A 4BAXA 1FXAA 4W9EA 1JWUD 3U7ZA 5AUKA 3Q3JA 2Y5BB 1J0GA 4RGTA 2QCZA 1WSPA 2AYOB 1J7AA 3OAWA 1LGRA 3PVLA 3IT4B 3ALBA 3IBEA 3Q3NC 4C7ZA 2ZPYA 3RFZB 4F7ZA 4BBNF 4FHJA 4BZAA 1OQYA 1WR6E 3AE4B 3PRPB 4WJPA 1AYFA 4NAMA 3DHGC 4HVBA 4JE3B 3PGEA 2D10A 2O2VB 2JXXA 1MI0A 4MSMB 5J2RA 2FAZA 4LJPB 1RYJA 1VDVA 3ECIA 1NENB 3DBHI 5AZFA 4C00A 4XGAB 3BINA 1LFDA 4BOZB 2JX5A 3R7RA 2LRUA 2DYOA 2QHOA 1OEYA 3ML8A 1IBXA 4FBJB 3AI5A 3DHHC 3Q8CA 4K7SA 4JIOU 4ARCA 4BKTA 1TY0A 3IVFA 2DHZA 2UWQA 1N6ZA 3AU4A 4I6PA 2KANA 4N9F4 1D5ZC 2MQJA 2Z0EB 2J53A 2LHDA 4HRSA 1E10A 2BKFA 2BWES 2KTRA 1MG4A 1GNUA 2NBVB 2L83A 1YX6B 4II2B 4MT5A 2Y3AA 1I4QA 2KN4A 4RGMA 3SU8X 3FC4A 2JRIB 4IWOA 4K3BA 4MGKE 3J9CA 4WAFA 3QX1A 2ZVOA 4ANVA 4BKGA 2C60A 1V86A 3AMZA 2SAKA 2JU6X 1TKEA 3RMKC 5HI1A 3Q3MC 3A4SC 1X1MA 3KVFB 4A55A 2B3AA 4WQMA 4Q2JA 2MHJA 1TYGB 1EWYC 5MPOA 1E7UA 2XK5B 1WR1A 3H7SA 5J17A 2DLBA 4B9KA 2HE7A 2V3NA 1IGDA 1SIJA 1WXVA 2AQ3B 2WWZA 3DBHB 4IOIE 1YX5B 2KFJA 3IG3A 1VJKA 1RM6C 1QOGA 1UBIA 2IYDB 4F1SA 3AE3B 2OJWA 3NVVA 2WU2B 5GMVA 3VTVA 1EU3A 3Q2AC 5AUIA 1L2NA 2MX2A 3AULA 1OEYJ 1C4AA 3DBRI 1ZXHA 4NZLB 4W9LA 3WALA 3N30A 5BMGA 5BYRA 4AQ7A 1FFVA 2EMSA 2RDGA 1Z5SB 4D2KA 1MJDA 1JRPA 3W9CB 1FIQA 1V2YA 5TR5A 3ZNGC 2KZRA 3VQIA 3PV1A 3AECB 3B08A 2WGSA 2HJ1A 1BMLC 5EE9A 1R4MB 5CTRC 4REZA 1L0XB 5DPSA 1QT9A 3C0RB 1RWSA 5LXIB 4ICVA 4FN2A 3FILB 4NJ6A 3VUYA 4HJGE 3R2TA 2KWCA 4DHZE 4RGNA 1AWDA 4HPPA 4BVUC 5CX3A 4KGTA 2G45B 3ZW3A 2K6DB 4GDKB 2KJHB 5D3IB 3TEYA 1KF6B 3Q3FA 2K6QA 3N3KB 5IAAC 3DVGX 1K50A 3RPFC 3AE9B 2K8BA 3NRZA 3QK0A 4EEWA 5L95C 3MJWA 3PZ8A 2QILA 3I9V1 2NBUA 5JHBA 1ET6A 2M0AA 4B6WA 3W5VB 2K39A 1F2RC 2KFKA 2PW9A 2R61A 3KYCD 4KV2A 5HHDG 2J4XA 4OVUA 4LTUA 4XDDA 5HKHA 3CIRB 4HWIB 1WMHA 2MBHA 3L54A 1YQ4B 2DAFA 2WXIA 2ZNVC 4DHJB
chains in the Genus database with same CATH topology
2CHZA 4GU2A 2WYQA 4EZJA 1WFYA 3OJ3A 1YIWA 3VUWA 3L17A 2LD9A 2LGDA 5JZEB 1WM2A 1RAXA 2J7QB 2M8SA 4DDGD 2CHXA 2LWPA 4WJQA 5JH5C 2KD0A 4MJSA 1CMXB 1E5WA 4ANWA 4IUMB 1E8XA 3UIOB 3DBSA 4ZRIA 2CKHB 3ZTDA 2NS5A 5JHAA 3DCGA 3D32A 4FJVB 2DYBA 2N1VA 2C7HA 4JL9A 4MGZE 1E8WA 2BGFA 4RM9A 4TKNA 4ANXA 4KSLC 2AWTA 1SIFA 2C7NB 2YVCA 5D2MB 3VVWB 4IM0A 3ZUNA 4WJOA 2MP2B 1HE8A 2MA9B 4WAAA 4HLEA 2I1KA 2KNBA 4AJWA 1V6EA 4HPMB 5FR6A 4NY0A 1EF1A 3JW0X 2YLMA 5G2NA 4G3XB 2GMIC 2PE6B 3GZNI 3U8ZA 3KYDD 1WYWB 2KK8A 2FCMA 3N32A 4ZDVA 2M17A 2RD0A 1BT0A 1EF5A 2EMTA 4F8CB 4EFOA 2I1JA 1WY8A 4ZRKA 2GBRA 3VTWA 5LXHA 3CF6E 2AL6A 3QAQA 4GB9A 2KHWB 3H1UA 2O6VB 4HXDA 3PZDA 4W9JA 3WAMA 4TV3A 2MBOA 1WX9A 3VXWA 2LXAA 2NCNA 4A3PA 3TBLD 3U7DA 3DOWA 2DAJA 1TZ1A 1F9JA 2R2QA 3MHSD 4URKA 2IZVB 2V3SA 2K8CA 3VTUA 3W1SC 3R7QA 4NQKE 3M62B 2LGXA 2EKEC 2JUOA 5BO4B 1E7VA 1UGMA 2UYZB 3X23A 3ZVVA 2AEHA 2BYVE 4PYUA 1P9DU 3X0WA 2N9XA 2Z0DB 2AL3A 3NY5A 3PREA 2ZNVB 4WQOB 1WX7A 2DX5B 4IW0A 3IFWB 3V6EB 3EC8A 2JRHA 1NI2A 2KFKB 3ONSA 1P1AA 3R66C 4KZCA 2WDTB 1U4AA 2L0FA 2LJ5A 1YD8U 2JZ3B 2LASA 3ZIMA 4BKSD 5J18A 4NAWA 2LUEA 4AWJA 3A9KA 1GG3A 1WI0A 2C9WB 3JYUA 1WMHB 3QWZB 4LDTD 3WA0A 2N4FA 3ZDMC 5D6JB 1RLFA 1J19A 2L00B 1P0RA 4DHZB 2LVQA 3AU5A 3EFUA 3QARA 1V81A 3ZKJC 2Z59B 1UD7A 2BWFA 2KQ7A 4GMVA 2GBMA 2DZIA 2VRRB 2KN5A 3H7PA 4NJ7A 3T8MA 3ZNID 4BBNC 1WXSA 4X57B 3PT2B 4E74A 4W9KA 4W9CA 2N7EA 2KWVB 1VD2A 2D2QA 1VCBA 2LGYA 1IPGA 3EHVA 4PS3A 5DPTA 3L16A 3UIPB 2FIDA 5IA7A 5E6OA 4MJSB 2BKRB 1Y8RC 4HDQA 3VFKA 4LJOB 3PRMB 1I42A 4G50A 3ENEA 3PHXB 2L76A 2KQSA 3DVGY 2BYFA 2PEAA 3PSEB 4DK5A 3APFA 3PLUA 3V60A 2KDIA 1AARA 3HIZA 1SE9A 2LRWA 2FCSA 3QC8B 4IM2A 2HJ8A 3B0AA 1JRUA 5C1ZA 2DZKA 2KO3A 1WJNA 2KLCA 2L8JA 3A1QA 4KSKC 3ZRCA 5AEKB 3V62A 3A4RA 3NOBA 1UZXB 2IO2B 2O6VD 2KDFB 2D3GA 2L7RA 3HM6X 3CSFA 5DPWA 1V5TA 2N1WA 3PLVA 4W9GA 2ASQA 4W9DA 1R4NI 1WGHA 3R3MA 1D3ZA 1WJ4A 4E71A 2XBBC 3OLMD 1R4MI 4MSQB 4RM8A 2NPTA 4B95A 3NS8A 3QA8A 3TMPB 2MBEA 3RYTA 2GBJA 2L0TA 2NVUI 3RT3B 3PRZA 1H4RA 5EDSA 4MDKE 2ZCBA 3CSTA 2MCNB 4AUQC 2MW5A 2ZJDA 1WZ3A 1P3QU 3ZRFA 2D11A 1XQQA 2N9EB 4CYEA 3ZTCA 3AXCA 4IG7B 2RGFA 3JSVA 4MGYE 3ZNZB 2FCQA 2A4ZA 3K9PB 3L08A 1A5RA 2KJ6A 2OJRA 1T0YA 1V9JA 2G4SA 5D7GA 3M3JA 4CHKA 3V6CB 4ASWC 2FCNA 4E3CA 1WM3A 4MELA 2XEWA 1WXMA 1WX8A 3PTFC 4XC2A 1TGZB 3APDA 2L3ZA 2KDEB 2M1MA 3KUCB 1Z2MA 3WAOA 3SHQA 1OGWA 1WE7A 5C23A 1ZKHA 4NPNA 3SDLC 3TIXA 2ZPNA 3K9OB 2KLGA 3HHMA 3ML9A 2KXJA 1WF9A 4IWPA 4M8MA 2JY6A 1I35A 2GBKA 4W9EA 3A9KB 3UINB 1S3SG 1ZGUB 2CHWA 2KC2A 2IO3B 1V80A 3Q3JA 1P98A 2DZJA 1G6JA 2Y5BB 1J0GA 3P2BA 2N9PC 4BKSA 2JPHA 2AYOB 4EKUA 2LXCA 3UF8A 2C5LC 4K81A 3OAWA 3PVLA 3ALBA 3KH0A 3IBEA 4RMAA 3QCAA 1C1YB 2JWZA 2ZPYA 1WIAA 4DXAB 2K25A 3UGBB 1KLVA 3APCA 1UH6A 2XK5A 4F7ZA 4MH0E 4TQ0A 4A3OA 2KMCA 1EO6A 3B1LX 5DCNA 4DHJD 2K8HA 4BBNF 4HJKA 4FHJA 1WE6A 4NQLB 1OQYA 4DWFA 1WR6E 2A5UA 3ZLZA 4WJNA 3PRPB 1WRDB 4KIKB 4WJPA 3A1QB 3M95A 4K1RB 4HVBA 1ISNA 1IYFA 4DDID 3PGEA 2D10A 3VAWA 2HTHA 2O2VB 2JXXA 4MSMB 5J2RA 2FAZA 4MGIE 4LJPB 2LVPA 3TJPA 1KJTA 3ECIA 2LI5A 2JVCA 3DBHI 5E6NA 1GC7A 2MRPA 5AZFA 2J0JA 3KUZA 1NBFC 1YJ1A 3BINA 3OJ4B 4FHKA 3VH3B 1LFDA 3QQ8B 5D94A 4BOZB 4FULA 4PS8A 2WX1A 3R7RA 2LRUA 1E8YA 2W9NA 4ZRJA 2DYOA 2O6VA 2QHOA 1KM7A 1K8RB 1OEYA 2NPTB 4DBGA 3A9JA 3ML8A 1C3TA 1WGGA 1TBEA 1WJ6A 3QJZA 4FBJB 4TUUA 2RPQA 3AI5A 2NBWB 1RRBA 3NZSA 4JIOU 4K7SA 4BKTA 3WIMA 4AP4C 1RFAA 2REXA 3IVFA 5KHQA 2KOXA 4XX5A 2DHZA 2UWQA 4G0NB 4ANUA 3H9DA 3AU4A 4I6PA 4TQ1A 4II3B 2KANA 4HDOA 2JZZA 4N9F4 1L7YA 2G4DB 2IO1B 2MQJA 3WANA 4K7UA 4HPLB 4PYZA 1E90A 2Z0EB 3SD5A 2IBIB 2KTFA 3H6NA 3JSVB 2J0MA 1WH3A 3RUIB 2R2OA 2IY1B 4WWNA 4GDLA 4KDLB 2BKFA 2BWES 2KTRA 5G55A 3KW5B 4BFRA 1ZW7A 3CMMB 3L13A 4JGHB 2G3QB 2J0KA 1GNUA 1UBQA 2NBVB 2KKCA 2RR9A 4GOCA 1YX6B 4II2B 2DZMA 3MTNB 4NNJB 4W9IA 3SU8X 2OOBB 3DVNU 2JRIB 4IWOA 4MGKE 4GIVA 1H8CA 3PHWB 4GDKA 3L0WB 2JT4B 4JLCA 3RD2A 3VHTC 4EUTA 2MSED 2D07B 2ZVOA 3QX1A 4ANVA 1YQBA 4BKGA 4FA6A 1S1QB 2C60A 4HCPB 1V86A 2DENB 1LM8B 3NZUA 2CU1A 4IM3A 4KDIC 1V5OA 4JQWC 5CHWA 2FNJB 2ZVNA 3A4SC 4HK2A 1X1MA 3KVFB 2B3AA 2V1YA 4ICUA 1FXTB 4LDTB 1WGYA 2PPHA 1E7UA 2ZZPB 4GGQA 2PJHA 2JF5A 3VH4B 4I6NB 2KX3A 2XK5B 1WR1A 1XD3B 3H7SA 5J17A 4B9KA 1WXAA 2HE7A 2CS4A 5KHOA 3LJ3A 4I6LB 2M0XA 1WXVA 4M0WB 5DPRA 4AOFA 2WWZA 4EZLA 2IO0B 1YX5B 4FJYA 4HCNB 3QHTA 2KFJA 3IG3A 4NAWB 4GN1A 3W1YA 4XZ4A 3RULA 3TCAA 5E6PA 1KOTA 1UBIA 2IYDB 3KUDB 4YL8A 4F1SA 5GMVA 3VTVA 5AZHA 3VUXA 3H7PB 3WAPA 4MEMA 1PQSA 1L2NA 2MX2A 3I3TB 2KDBA 4FADA 3AULA 1OEYJ 3DDCB 3DBRI 1GC6A 2KVRA 2L05A 3DPDA 4W9LA 4GXBA 2MBBB 3W1SA 2MWSB 5L83A 1WZ0A 3RCZA 3WALA 2IY0B 3N30A 4PS7A 4EZKA 4OVVA 1EUVB 2EMSA 2KX0A 3A9JB 3GOEA 2CR5A 1Z5SB 3TL5A 3O65B 3ZNHB 2KMAA 1OTRB 4IWQA 2RSUA 1V2YA 2MP2A 3BY4B 4LCDE 1SGHA 1Q1OA 2K1FA 5TR5A 3T9LA 3ZNGC 2KZRA 1LQBA 1V49A 5AZGA 3PV1A 2BF8B 3VQIA 3QIJA 4A20A 3B08A 4WWOA 2GOWA 3EECA 1GJZA 1QZEA 1WJUA 4FLHA 4GDLB 2BYEA 2KTRB 1WGRA 5CTRC 3IHPC 5DPSA 1GUAB 1NDDA 3C0RB 4MM3A 3UQBA 3M63B 4ZYNA 4ICVA 3NHEB 4FN2A 4BOSC 5LXIB 4NJ6A 2DYMA 4W9FA 1E8ZA 2NR2A 3RZFA 3VDZA 3VUYA 2KWCA 3DVNV 1TTNA 2MLBA 2V4LA 4DHZE 4P7IA 4IC7B 1XT9B 3S2AA 3DQVA 4BVUC 5CX3A 3V61A 3PPAA 4EOYA 2G45B 3ZW3A 2KJRA 2K6DB 3DBLI 4GDKB 2KJHB 3A33B 3LDZE 3Q3FA 2K6QA 3N3KB 5IAAC 3DVGX 3JVZX 4AJYB 4M8NA 2FIFA 1IP9A 2K8BA 2LZ6A 2KC1A 3QK0A 4EEWA 1WGDA 4CO7A 5L95C 4K7WA 4KVGB 3MJWA 3HK0A 5CHFA 2GBNA 2MBQA 4FJZA 4KZ0A 1Q0WB 1MG8A 2ZCCA 2KWUB 2NBUA 5JHBA 1UELA 2LVOA 4G11A 4B6WA 3UQAA 2K39A 2KFKA 5LLIA 1J8CA 2HD5B 3KYCD 5CHVC 4GSWA 4J6IA 4KV2A 4W9HA 2ZEQA 2FUHB 3U30A 2WX0A 2C7MB 1M94A 3HM3A 4OVUA 5HKHA 3ZO5B 3PS6A 4HWIB 4KIKA 2BPSA 1WMHA 3ZDTA 2PE9A 2MBHA 4WWPA 2M4NA 3L54A 1Q5WB 2O2VA 3L10B 2DAFA 1LXDA 2ZNVC 3RZWC 2N7DA 4DHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHZ A;  4GU2 A;  2WYQ A;  4EZJ A;  1WFY A;  3OJ3 A;  1YIW A;  3VUW A;  3L17 A;  2LD9 A;  2LGD A;  5JZE B;  1WM2 A;  1RAX A;  2J7Q B;  2M8S A;  4DDG D;  2CHX A;  2LWP A;  4WJQ A;  5JH5 C;  2KD0 A;  4MJS A;  1CMX B;  1E5W A;  4ANW A;  4IUM B;  1E8X A;  3UIO B;  3DBS A;  4ZRI A;  2CKH B;  3ZTD A;  2NS5 A;  5JHA A;  3DCG A;  3D32 A;  4FJV B;  2DYB A;  2N1V A;  2C7H A;  4JL9 A;  4MGZ E;  1E8W A;  2BGF A;  4RM9 A;  4TKN A;  4ANX A;  4KSL C;  2AWT A;  1SIF A;  2C7N B;  2YVC A;  5D2M B;  3VVW B;  4IM0 A;  3ZUN A;  4WJO A;  2MP2 B;  1HE8 A;  2MA9 B;  4WAA A;  4HLE A;  2I1K A;  2KNB A;  4AJW A;  1V6E A;  4HPM B;  5FR6 A;  4NY0 A;  1EF1 A;  3JW0 X;  2YLM A;  5G2N A;  4G3X B;  2GMI C;  2PE6 B;  3GZN I;  3U8Z A;  3KYD D;  1WYW B;  2KK8 A;  2FCM A;  3N32 A;  4ZDV A;  2M17 A;  2RD0 A;  1BT0 A;  1EF5 A;  2EMT A;  4F8C B;  4EFO A;  2I1J A;  1WY8 A;  4ZRK A;  2GBR A;  3VTW A;  5LXH A;  3CF6 E;  2AL6 A;  3QAQ A;  4GB9 A;  2KHW B;  3H1U A;  2O6V B;  4HXD A;  3PZD A;  4W9J A;  3WAM A;  4TV3 A;  2MBO A;  1WX9 A;  3VXW A;  2LXA A;  2NCN A;  4A3P A;  3TBL D;  3U7D A;  3DOW A;  2DAJ A;  1TZ1 A;  1F9J A;  2R2Q A;  3MHS D;  4URK A;  2IZV B;  2V3S A;  2K8C A;  3VTU A;  3W1S C;  3R7Q A;  4NQK E;  3M62 B;  2LGX A;  2EKE C;  2JUO A;  5BO4 B;  1E7V A;  1UGM A;  2UYZ B;  3X23 A;  3ZVV A;  2AEH A;  2BYV E;  4PYU A;  1P9D U;  3X0W A;  2N9X A;  2Z0D B;  2AL3 A;  3NY5 A;  3PRE A;  2ZNV B;  4WQO B;  1WX7 A;  2DX5 B;  4IW0 A;  3IFW B;  3V6E B;  3EC8 A;  2JRH A;  1NI2 A;  2KFK B;  3ONS A;  1P1A A;  3R66 C;  4KZC A;  2WDT B;  1U4A A;  2L0F A;  2LJ5 A;  1YD8 U;  2JZ3 B;  2LAS A;  3ZIM A;  4BKS D;  5J18 A;  4NAW A;  2LUE A;  4AWJ A;  3A9K A;  1GG3 A;  1WI0 A;  2C9W B;  3JYU A;  1WMH B;  3QWZ B;  4LDT D;  3WA0 A;  2N4F A;  3ZDM C;  5D6J B;  1RLF A;  1J19 A;  2L00 B;  1P0R A;  4DHZ B;  2LVQ A;  3AU5 A;  3EFU A;  3QAR A;  1V81 A;  3ZKJ C;  2Z59 B;  1UD7 A;  2BWF A;  2KQ7 A;  4GMV A;  2GBM A;  2DZI A;  2VRR B;  2KN5 A;  3H7P A;  4NJ7 A;  3T8M A;  3ZNI D;  4BBN C;  1WXS A;  4X57 B;  3PT2 B;  4E74 A;  4W9K A;  4W9C A;  2N7E A;  2KWV B;  1VD2 A;  2D2Q A;  1VCB A;  2LGY A;  1IPG A;  3EHV A;  4PS3 A;  5DPT A;  3L16 A;  3UIP B;  2FID A;  5IA7 A;  5E6O A;  4MJS B;  2BKR B;  1Y8R C;  4HDQ A;  3VFK A;  4LJO B;  3PRM B;  1I42 A;  4G50 A;  3ENE A;  3PHX B;  2L76 A;  2KQS A;  3DVG Y;  2BYF A;  2PEA A;  3PSE B;  4DK5 A;  3APF A;  3PLU A;  3V60 A;  2KDI A;  1AAR A;  3HIZ A;  1SE9 A;  2LRW A;  2FCS A;  3QC8 B;  4IM2 A;  2HJ8 A;  3B0A A;  1JRU A;  5C1Z A;  2DZK A;  2KO3 A;  1WJN A;  2KLC A;  2L8J A;  3A1Q A;  4KSK C;  3ZRC A;  5AEK B;  3V62 A;  3A4R A;  3NOB A;  1UZX B;  2IO2 B;  2O6V D;  2KDF B;  2D3G A;  2L7R A;  3HM6 X;  3CSF A;  5DPW A;  1V5T A;  2N1W A;  3PLV A;  4W9G A;  2ASQ A;  4W9D A;  1R4N I;  1WGH A;  3R3M A;  1D3Z A;  1WJ4 A;  4E71 A;  2XBB C;  3OLM D;  1R4M I;  4MSQ B;  4RM8 A;  2NPT A;  4B95 A;  3NS8 A;  3QA8 A;  3TMP B;  2MBE A;  3RYT A;  2GBJ A;  2L0T A;  2NVU I;  3RT3 B;  3PRZ A;  1H4R A;  5EDS A;  4MDK E;  2ZCB A;  3CST A;  2MCN B;  4AUQ C;  2MW5 A;  2ZJD A;  1WZ3 A;  1P3Q U;  3ZRF A;  2D11 A;  1XQQ A;  2N9E B;  4CYE A;  3ZTC A;  3AXC A;  4IG7 B;  2RGF A;  3JSV A;  4MGY E;  3ZNZ B;  2FCQ A;  2A4Z A;  3K9P B;  3L08 A;  1A5R A;  2KJ6 A;  2OJR A;  1T0Y A;  1V9J A;  2G4S A;  5D7G A;  3M3J A;  4CHK A;  3V6C B;  4ASW C;  2FCN A;  4E3C A;  1WM3 A;  4MEL A;  2XEW A;  1WXM A;  1WX8 A;  3PTF C;  4XC2 A;  1TGZ B;  3APD A;  2L3Z A;  2KDE B;  2M1M A;  3KUC B;  1Z2M A;  3WAO A;  3SHQ A;  1OGW A;  1WE7 A;  5C23 A;  1ZKH A;  4NPN A;  3SDL C;  3TIX A;  2ZPN A;  3K9O B;  2KLG A;  3HHM A;  3ML9 A;  2KXJ A;  1WF9 A;  4IWP A;  4M8M A;  2JY6 A;  1I35 A;  2GBK A;  4W9E A;  3A9K B;  3UIN B;  1S3S G;  1ZGU B;  2CHW A;  2KC2 A;  2IO3 B;  1V80 A;  3Q3J A;  1P98 A;  2DZJ A;  1G6J A;  2Y5B B;  1J0G A;  3P2B A;  2N9P C;  4BKS A;  2JPH A;  2AYO B;  4EKU A;  2LXC A;  3UF8 A;  2C5L C;  4K81 A;  3OAW A;  3PVL A;  3ALB A;  3KH0 A;  3IBE A;  4RMA A;  3QCA A;  1C1Y B;  2JWZ A;  2ZPY A;  1WIA A;  4DXA B;  2K25 A;  3UGB B;  1KLV A;  3APC A;  1UH6 A;  2XK5 A;  4F7Z A;  4MH0 E;  4TQ0 A;  4A3O A;  2KMC A;  1EO6 A;  3B1L X;  5DCN A;  4DHJ D;  2K8H A;  4BBN F;  4HJK A;  4FHJ A;  1WE6 A;  4NQL B;  1OQY A;  4DWF A;  1WR6 E;  2A5U A;  3ZLZ A;  4WJN A;  3PRP B;  1WRD B;  4KIK B;  4WJP A;  3A1Q B;  3M95 A;  4K1R B;  4HVB A;  1ISN A;  1IYF A;  4DDI D;  3PGE A;  2D10 A;  3VAW A;  2HTH A;  2O2V B;  2JXX A;  4MSM B;  5J2R A;  2FAZ A;  4MGI E;  4LJP B;  2LVP A;  3TJP A;  1KJT A;  3ECI A;  2LI5 A;  2JVC A;  3DBH I;  5E6N A;  1GC7 A;  2MRP A;  5AZF A;  2J0J A;  3KUZ A;  1NBF C;  1YJ1 A;  3BIN A;  3OJ4 B;  4FHK A;  3VH3 B;  1LFD A;  3QQ8 B;  5D94 A;  4BOZ B;  4FUL A;  4PS8 A;  2WX1 A;  3R7R A;  2LRU A;  1E8Y A;  2W9N A;  4ZRJ A;  2DYO A;  2O6V A;  2QHO A;  1KM7 A;  1K8R B;  1OEY A;  2NPT B;  4DBG A;  3A9J A;  3ML8 A;  1C3T A;  1WGG A;  1TBE A;  1WJ6 A;  3QJZ A;  4FBJ B;  4TUU A;  2RPQ A;  3AI5 A;  2NBW B;  1RRB A;  3NZS A;  4JIO U;  4K7S A;  4BKT A;  3WIM A;  4AP4 C;  1RFA A;  2REX A;  3IVF A;  5KHQ A;  2KOX A;  4XX5 A;  2DHZ A;  2UWQ A;  4G0N B;  4ANU A;  3H9D A;  3AU4 A;  4I6P A;  4TQ1 A;  4II3 B;  2KAN A;  4HDO A;  2JZZ A;  4N9F 4;  1L7Y A;  2G4D B;  2IO1 B;  2MQJ A;  3WAN A;  4K7U A;  4HPL B;  4PYZ A;  1E90 A;  2Z0E B;  3SD5 A;  2IBI B;  2KTF A;  3H6N A;  3JSV B;  2J0M A;  1WH3 A;  3RUI B;  2R2O A;  2IY1 B;  4WWN A;  4GDL A;  4KDL B;  2BKF A;  2BWE S;  2KTR A;  5G55 A;  3KW5 B;  4BFR A;  1ZW7 A;  3CMM B;  3L13 A;  4JGH B;  2G3Q B;  2J0K A;  1GNU A;  1UBQ A;  2NBV B;  2KKC A;  2RR9 A;  4GOC A;  1YX6 B;  4II2 B;  2DZM A;  3MTN B;  4NNJ B;  4W9I A;  3SU8 X;  2OOB B;  3DVN U;  2JRI B;  4IWO A;  4MGK E;  4GIV A;  1H8C A;  3PHW B;  4GDK A;  3L0W B;  2JT4 B;  4JLC A;  3RD2 A;  3VHT C;  4EUT A;  2MSE D;  2D07 B;  2ZVO A;  3QX1 A;  4ANV A;  1YQB A;  4BKG A;  4FA6 A;  1S1Q B;  2C60 A;  4HCP B;  1V86 A;  2DEN B;  1LM8 B;  3NZU A;  2CU1 A;  4IM3 A;  4KDI C;  1V5O A;  4JQW C;  5CHW A;  2FNJ B;  2ZVN A;  3A4S C;  4HK2 A;  1X1M A;  3KVF B;  2B3A A;  2V1Y A;  4ICU A;  1FXT B;  4LDT B;  1WGY A;  2PPH A;  1E7U A;  2ZZP B;  4GGQ A;  2PJH A;  2JF5 A;  3VH4 B;  4I6N B;  2KX3 A;  2XK5 B;  1WR1 A;  1XD3 B;  3H7S A;  5J17 A;  4B9K A;  1WXA A;  2HE7 A;  2CS4 A;  5KHO A;  3LJ3 A;  4I6L B;  2M0X A;  1WXV A;  4M0W B;  5DPR A;  4AOF A;  2WWZ A;  4EZL A;  2IO0 B;  1YX5 B;  4FJY A;  4HCN B;  3QHT A;  2KFJ A;  3IG3 A;  4NAW B;  4GN1 A;  3W1Y A;  4XZ4 A;  3RUL A;  3TCA A;  5E6P A;  1KOT A;  1UBI A;  2IYD B;  3KUD B;  4YL8 A;  4F1S A;  5GMV A;  3VTV A;  5AZH A;  3VUX A;  3H7P B;  3WAP A;  4MEM A;  1PQS A;  1L2N A;  2MX2 A;  3I3T B;  2KDB A;  4FAD A;  3AUL A;  1OEY J;  3DDC B;  3DBR I;  1GC6 A;  2KVR A;  2L05 A;  3DPD A;  4W9L A;  4GXB A;  2MBB B;  3W1S A;  2MWS B;  5L83 A;  1WZ0 A;  3RCZ A;  3WAL A;  2IY0 B;  3N30 A;  4PS7 A;  4EZK A;  4OVV A;  1EUV B;  2EMS A;  2KX0 A;  3A9J B;  3GOE A;  2CR5 A;  1Z5S B;  3TL5 A;  3O65 B;  3ZNH B;  2KMA A;  1OTR B;  4IWQ A;  2RSU A;  1V2Y A;  2MP2 A;  3BY4 B;  4LCD E;  1SGH A;  1Q1O A;  2K1F A;  5TR5 A;  3T9L A;  3ZNG C;  2KZR A;  1LQB A;  1V49 A;  5AZG A;  3PV1 A;  2BF8 B;  3VQI A;  3QIJ A;  4A20 A;  3B08 A;  4WWO A;  2GOW A;  3EEC A;  1GJZ A;  1QZE A;  1WJU A;  4FLH A;  4GDL B;  2BYE A;  2KTR B;  1WGR A;  5CTR C;  3IHP C;  5DPS A;  1GUA B;  1NDD A;  3C0R B;  4MM3 A;  3UQB A;  3M63 B;  4ZYN A;  4ICV A;  3NHE B;  4FN2 A;  4BOS C;  5LXI B;  4NJ6 A;  2DYM A;  4W9F A;  1E8Z A;  2NR2 A;  3RZF A;  3VDZ A;  3VUY A;  2KWC A;  3DVN V;  1TTN A;  2MLB A;  2V4L A;  4DHZ E;  4P7I A;  4IC7 B;  1XT9 B;  3S2A A;  3DQV A;  4BVU C;  5CX3 A;  3V61 A;  3PPA A;  4EOY A;  2G45 B;  3ZW3 A;  2KJR A;  2K6D B;  3DBL I;  4GDK B;  2KJH B;  3A33 B;  3LDZ E;  3Q3F A;  2K6Q A;  3N3K B;  5IAA C;  3DVG X;  3JVZ X;  4AJY B;  4M8N A;  2FIF A;  1IP9 A;  2K8B A;  2LZ6 A;  2KC1 A;  3QK0 A;  4EEW A;  1WGD A;  4CO7 A;  5L95 C;  4K7W A;  4KVG B;  3MJW A;  3HK0 A;  5CHF A;  2GBN A;  2MBQ A;  4FJZ A;  4KZ0 A;  1Q0W B;  1MG8 A;  2ZCC A;  2KWU B;  2NBU A;  5JHB A;  1UEL A;  2LVO A;  4G11 A;  4B6W A;  3UQA A;  2K39 A;  2KFK A;  5LLI A;  1J8C A;  2HD5 B;  3KYC D;  5CHV C;  4GSW A;  4J6I A;  4KV2 A;  4W9H A;  2ZEQ A;  2FUH B;  3U30 A;  2WX0 A;  2C7M B;  1M94 A;  3HM3 A;  4OVU A;  5HKH A;  3ZO5 B;  3PS6 A;  4HWI B;  4KIK A;  2BPS A;  1WMH A;  3ZDT A;  2PE9 A;  2MBH A;  4WWP A;  2M4N A;  3L54 A;  1Q5W B;  2O2V A;  3L10 B;  2DAF A;  1LXD A;  2ZNV C;  3RZW C;  2N7D A;  4DHJ B; 
#chains in the Genus database with same CATH topology
 2CHZ A;  4MAC A;  4EZJ A;  3KWV A;  3L17 A;  5BMH A;  1RAX A;  2M56 B;  2J7Q B;  2M8S A;  4MJS A;  2HTM E;  4ANW A;  4IUM B;  3DBS A;  2LJI A;  2NS5 A;  1SE3 A;  4FJV B;  2DYB A;  1T3Q A;  3U2S C;  2BGF A;  4TKN A;  4IKG A;  1FCC C;  4IM0 A;  1XCT L;  2VH1 A;  3TSS A;  2I38 A;  4C4V A;  2KNB A;  2WQY B;  1V6E A;  4G3X B;  1VZ8 A;  1I7H A;  1T0S C;  3U4E G;  3U8Z A;  1WYW B;  2KK8 A;  3EFC A;  4ZDV A;  2M17 A;  2RD0 A;  4OVZ A;  1NYQ A;  3MP9 A;  3P63 A;  1SE4 A;  3BK2 A;  3QAQ A;  4GB9 A;  3P4P B;  4HXD A;  3PZD A;  4ACF A;  3WAM A;  2MBO A;  2H88 B;  4A3P A;  1PUT A;  2IZV B;  2GI9 A;  3R7Q A;  4OW0 A;  3M62 B;  3EUB 2;  1E7V A;  3X23 A;  1NYR A;  1KH0 A;  1P9D U;  2Z0D B;  4WQO B;  2WXR A;  1WX7 A;  2DX5 B;  4IW0 A;  3IFW B;  1NI2 A;  1D5M C;  4DXF A;  4GLS C;  1FNU A;  2LJ5 A;  4UDU C;  2JZ3 B;  3R2I A;  2LUE A;  1WI0 A;  2GLS A;  4RF0 A;  3Q8F A;  2N4F A;  3AM9 A;  1RLF A;  4DHZ B;  1MPE A;  2LVQ A;  2WXH A;  3QAR A;  1V81 A;  1UD7 A;  3T8M A;  2INN E;  2WXO A;  3FAH A;  1QIL A;  1ET9 A;  4E74 A;  2X38 A;  2IGD A;  4W9C A;  2KWV B;  2AX5 A;  5E6O A;  1HA5 A;  3BII D;  3PRM B;  1PGB A;  1I42 A;  4XYC A;  2L76 A;  4RH6 A;  2E6X A;  2EEL A;  3HIZ A;  2X8X X;  2PLP A;  3ZRC A;  5AEK B;  3V62 A;  1UZX B;  1DGJ A;  1TT5 B;  2XNA C;  3AE7 B;  1TS5 A;  4E71 A;  3NG0 A;  2NPT A;  3QA8 A;  2L0T A;  3AV8 A;  4MDK E;  4AUQ C;  2JYT A;  1FRR A;  1WZ3 A;  3ZRF A;  4P16 A;  1XQQ A;  3ZTC A;  3JSV A;  1I4P A;  2H89 B;  1T0Y A;  1V9J A;  2G4S A;  3GE8 C;  4CHK A;  1T0Q C;  3EGR A;  1WX8 A;  1HEZ E;  3IT6 B;  1TGZ B;  4XC2 A;  5D3D A;  2KDE B;  2M19 A;  1PGX A;  3SHQ A;  1WE7 A;  3SDL C;  3TIX A;  1UF0 A;  3K9O B;  2KLG A;  3LB8 C;  1WF9 A;  4M8M A;  2GBK A;  1FXI A;  1S3S G;  1SXT A;  3SFD B;  4ZYS A;  1HTQ A;  2KC2 A;  1ENF A;  5IO9 A;  1G6J A;  2N9P C;  4EKU A;  2LXC A;  3UF8 A;  2WDV B;  4YTN B;  1TKG A;  4LNF A;  4HKZ E;  3LYY A;  4DXA B;  2K25 A;  4EE2 A;  3APC A;  4A3O A;  5DCN A;  2D3C A;  2CJN A;  4M0W A;  1WE6 A;  4NQL B;  3C8Y A;  3Q8A A;  2JXT A;  2QMT A;  2A5U A;  4WJN A;  1CJE A;  4KIK B;  2BTE A;  3A1Q B;  3M95 A;  4K1R B;  1ISN A;  4IDI A;  2GRI A;  1IYF A;  4LLG M;  4MGI E;  3TJP A;  2LI5 A;  5E6N A;  4YTP B;  1NBF C;  3ZXR A;  1XLN A;  3OJ4 B;  2DNF A;  4RCO A;  2O6V A;  1Y56 A;  1KM7 A;  4PK1 A;  1TBE A;  1WJ6 A;  5IOI A;  1RRB A;  3WIM A;  1RFA A;  2BQQ A;  4G0N B;  3H9D A;  1AW7 A;  4II3 B;  4YSZ B;  4TMA B;  2K22 A;  1L7Y A;  2G4D B;  2IO1 B;  3GZN B;  1E90 A;  2IBI B;  2IY1 B;  5IN7 A;  2FUG 1;  4GDL A;  1N5W A;  2LGS A;  1P7F A;  3KW5 B;  4BFR A;  1ZW7 A;  2WU5 B;  1YN5 A;  2G3Q B;  2J0K A;  5E6J A;  1UBQ A;  2KKC A;  3N20 C;  1ZOY B;  4GOC A;  2DZM A;  4NNJ B;  4W9I A;  3DVN U;  2I2Y A;  2W3R A;  4EUT A;  4LNO A;  2MSE D;  1YQB A;  4WH4 A;  1FRD A;  1IGC A;  4HCP B;  5HG2 A;  1LM8 B;  2GB1 A;  3NZU A;  4IM3 A;  4KDI C;  2KMM A;  2ZVN A;  1FXT B;  2D3A A;  2PPH A;  3Q69 A;  2ZZP B;  4GGQ A;  2LEK A;  1V1O A;  4I6N B;  5KHO A;  5DPR A;  4EZL A;  4GN1 A;  4YTM B;  3OG5 A;  1ZXI A;  2OED A;  3RUL A;  3TCA A;  3KUD B;  3H7P B;  1WWT A;  1GC6 A;  2L05 A;  4GXB A;  2MBB B;  2MWS B;  5L83 A;  1IBX B;  2CR5 A;  4USA A;  1V1P B;  4L2Y A;  3ZNH B;  2KMA A;  1OTR B;  4C7Y A;  3BY4 B;  1Q1O A;  1QQR A;  1WYG A;  3MJ5 A;  4S17 A;  1V49 A;  3BWU D;  3QIJ A;  4WWO A;  1HQR D;  1QZE A;  4FLH A;  2WDQ B;  2W3S A;  2KTR B;  3IHP C;  4YWG G;  1FM0 D;  1OFF A;  4MM3 A;  4ZYN A;  2IGG A;  1XEE A;  4W9F A;  3VDZ A;  2MLB A;  4P7I A;  4YXD B;  1NEK B;  5C3J B;  2KJR A;  2RPV A;  2DWQ A;  1ROE A;  4M8N A;  2LZ6 A;  2KC1 A;  2IPK D;  3Q8E A;  4CO7 A;  1FCL A;  3HK0 A;  2MBQ A;  4FJZ A;  2ZCC A;  2BW2 A;  3RNC C;  2J52 A;  5LLI A;  4J6I A;  2ZEQ A;  1UGJ A;  2BT6 A;  1M94 A;  2IJ0 A;  2WXP A;  5HFY A;  2D5G A;  3P1M A;  2BPS A;  3ZDT A;  2M4N A;  2O2V A;  3L10 B;  1SJH D;  1LXD A;  2N7D A;  1C79 A;  4GU2 A;  2WYQ A;  1RFK A;  1WFY A;  1QKZ A;  2G9H D;  4M01 A;  2YEP B;  2AQ1 B;  4DQO C;  4WJQ A;  1CMX B;  4ZRI A;  3NUH B;  3ZTD A;  3SEB A;  3DCG A;  3D32 A;  2N1V A;  4JL9 A;  4MGZ E;  1E8W A;  4RM9 A;  1VR9 A;  1D6E C;  1SIF A;  2C7N B;  4WJO A;  5TSS A;  4A9A A;  1MFW A;  4WAA A;  4HLE A;  4ZHP A;  4AJW A;  4HPM B;  5G2N A;  3JW0 X;  1NI3 A;  3P4Q B;  2JQR B;  2FCM A;  3N32 A;  1EF5 A;  2EMT A;  1C9F A;  4F8C B;  2I1J A;  5I4D A;  3AE8 B;  3OWE B;  2AL6 A;  1T0R C;  2KHW B;  2KAC A;  1DYQ A;  3GB1 A;  1MVK A;  3VXW A;  3DHI C;  1K53 A;  2NCN A;  2MJE A;  3ZJT A;  5FKA C;  2K8C A;  1E6E B;  2KAJ A;  3Q3O C;  2LGX A;  5BO4 B;  1QOF A;  2WXK A;  2PKO A;  1P7E A;  1CZP A;  2JRH A;  2KFK B;  4EFO A;  4KZC A;  1U4A A;  1E7P B;  1UUP A;  5BYQ A;  3E56 A;  4BKS D;  4AWJ A;  3A9K A;  3JYU A;  3WA0 A;  1WMH B;  2NTS A;  3B2G A;  1L6V A;  1SE2 A;  2L00 B;  3AU5 A;  3EFU A;  2KN5 A;  4BBN C;  4W9K A;  1VD2 A;  3BYY B;  2D2Q A;  2LGY A;  2E3T A;  2QDF A;  2BKR B;  4MJS B;  3VFK A;  1YMH E;  1TY2 A;  4FXC A;  1N62 A;  4OZB A;  1ESF A;  2BYF A;  2PEA A;  2Y5P A;  3V60 A;  1AAR A;  1SE9 A;  3QC8 B;  4IM2 A;  1JQ4 A;  2INC C;  2DZK A;  1OQQ A;  1FO4 A;  4C4V B;  3A4R A;  3DBR B;  2KDF B;  2D3G A;  1UWM A;  1UWX A;  2L7R A;  4ITK A;  4CQN A;  1QLB B;  3PLV A;  4W9D A;  4JPS A;  2XBB C;  3OLM D;  4MSQ B;  3TMP B;  2GBJ A;  1L0Y B;  3LXF A;  5EDS A;  2ZCB A;  3CST A;  2MCN B;  1N5X A;  1P3Q U;  1E0Z A;  2W82 A;  3KQ4 A;  1KLU D;  2RGF A;  3WCQ A;  1A5R A;  2KJ6 A;  5D7G A;  1CK1 A;  3V6C B;  2JYE A;  1JWS D;  1WXM A;  3PTF C;  1OGW A;  5C23 A;  1ZKH A;  1OQR A;  2YEP F;  4NPN A;  3I5J C;  1XLP A;  3ML9 A;  4IWP A;  1UNS A;  2CHW A;  1V80 A;  1P98 A;  2DZJ A;  2HDE A;  1WXQ A;  1FMA D;  4PT5 A;  4K81 A;  3VRB B;  1XCQ L;  3VR9 B;  2QEJ C;  4RMA A;  3QCA A;  1F0Z A;  2JWZ A;  1KLV A;  4MH0 E;  2KMC A;  3B1L X;  2QC8 A;  4DHJ D;  2K8H A;  2ZW0 A;  2K9X A;  3O13 A;  4DWF A;  1ZP0 B;  4JWS C;  3RNF C;  1L5P A;  4DDI D;  1XF5 L;  2FE8 A;  2UU7 A;  2ONQ A;  2LVP A;  1KLG D;  2JVC A;  2WXF A;  1YQ3 B;  3KUZ A;  2CJO A;  2KVZ A;  4FHK A;  2JWU A;  1GPX A;  4PS8 A;  3BK1 A;  2WX1 A;  2W9N A;  1GOZ A;  2NPT B;  1K8R B;  3A9J A;  2VH2 A;  1WGG A;  4TUU A;  1YN3 A;  2REX A;  3AE6 B;  5KHQ A;  2KOX A;  3SR6 A;  4TQ1 A;  4HDO A;  2JZZ A;  1QOB A;  4M02 A;  3H6N A;  3JSV B;  1V8C A;  2J0M A;  3RUI B;  1F77 A;  3AB5 A;  4WWN A;  3Q8B A;  1F2R I;  3CMM B;  4JGH B;  3SFE B;  1PYW D;  1HZ6 A;  1I4H A;  1H8C A;  3PHW B;  2WP9 B;  3L0W B;  2JT4 B;  3RD2 A;  1MHH E;  3I57 A;  3MC9 A;  2L32 A;  3TEW A;  3RNB C;  4JQW C;  5CHW A;  2JZP A;  2FNJ B;  4HK2 A;  2BVC A;  4O1N A;  4ZRP A;  2V1Y A;  4ICU A;  4LDT B;  3N1X C;  4HKQ A;  3V3X A;  2WS3 B;  1R7S A;  2QJL A;  2LUM A;  2FBW B;  4A90 A;  3GP7 A;  2PJH A;  2IGH A;  1TKY A;  4HEA 1;  2KX3 A;  2MEK A;  1XD3 B;  4P6V F;  1HXY D;  3L4P A;  2L1A A;  3LJ3 A;  3Q14 C;  4M0W B;  4AOF A;  4HCN B;  3QHT A;  4NAW B;  4XZ4 A;  1SBB B;  4ARI A;  1EU4 A;  3IAS 1;  4JX1 C;  5E6P A;  2QSD A;  1JWM D;  1ZE3 D;  1JAL A;  1K51 A;  3MFG A;  5AZH A;  1QOA A;  3I3T B;  3DDC B;  3RCZ A;  1A70 A;  3RNG C;  4N6E B;  5IKC M;  1EUV B;  3GOE A;  2KX0 A;  3TL5 A;  3O65 B;  4JWU C;  2MP2 A;  2SEB D;  4LCD E;  1SGH A;  2K1F A;  3BYT B;  1LQB A;  2BF8 B;  3HVD A;  2GOW A;  1ZDX A;  1L0V B;  2BYE A;  4GDL B;  3P42 A;  1NDD A;  5EE1 A;  3M63 B;  3P4R B;  3NHE B;  1TJE A;  4BOS C;  1E8Z A;  3DVN V;  4LNI A;  2V4L A;  3DQV A;  3PPA A;  4EOY A;  3DBL I;  3ZXV A;  3LDZ E;  2PVG C;  1SJE D;  1M4V A;  3MC0 B;  4KVG B;  1E9M A;  5CHF A;  4KZ0 A;  1Q0W B;  3RN9 C;  3ZYY X;  3P4S B;  1UEL A;  1J8C A;  4XDC A;  5CHV C;  5T8I A;  2N0S B;  2WX0 A;  2C7M B;  3ZGZ A;  1JML A;  3PS6 A;  3C19 A;  4KIK A;  4DXG A;  1MHX A;  2PE9 A;  4KX6 B;  2KT7 A;  1Q5W B;  2WXN A;  2LD9 A;  1Q10 A;  1PGA A;  2CHX A;  2KD0 A;  1E5W A;  3AEF B;  1E8X A;  4A8X C;  1C77 A;  2CKH B;  1HZ5 A;  2Y5C A;  1VLB A;  4ANX A;  1WRI A;  4KSL C;  2YVC A;  5D2M B;  3VVW B;  3ZUN A;  1HE8 A;  2L52 A;  3AEA B;  2I1K A;  2GMI C;  2PE6 B;  3KYD D;  3GE3 C;  3B2F A;  1SEB D;  1WY8 A;  5EE3 A;  3H1U A;  4W9J A;  2Q5W D;  1T5X D;  4TSS A;  1FPY A;  2LXA A;  3TBL D;  3U7D A;  1TZ1 A;  1F9J A;  4WIP A;  2BBC A;  3TEZ A;  3W1S C;  1C4C A;  2UYZ B;  2AEH A;  2BYV E;  4PYU A;  4US9 A;  3X0W A;  2AL3 A;  3NY5 A;  3N9Y C;  1JRO A;  1JW9 D;  3R66 C;  1P1A A;  2WDT B;  3UI3 A;  1YD8 U;  2LAS A;  3ZIM A;  5J18 A;  2V0G A;  4KKJ A;  3FKY A;  2V3P A;  5D6J B;  1J19 A;  1P0R A;  2GBM A;  2DZI A;  2VRR B;  2V4I B;  3H7P A;  4NJ7 A;  2J42 A;  4XWW A;  2V9H A;  5C2T B;  3TEX A;  1IPG A;  4PS3 A;  3L16 A;  3PO0 A;  2WLB A;  4NJC A;  2BS4 B;  1Y8R C;  4HDQ A;  1V1P A;  4LJO B;  4A6Q A;  1FD6 A;  3PSE B;  4DK5 A;  3APF A;  3PLU A;  2KDI A;  2VZK B;  2LRW A;  2FCS A;  2NMQ A;  5C1Z A;  2KO3 A;  1WJN A;  2L8J A;  4KSK C;  2PVO D;  3AE2 B;  2BB6 A;  2LFI A;  3CSF A;  3NVY A;  1ZUD 2;  2N1W A;  3NJT A;  4YT0 B;  1R4N I;  1WGH A;  4L1B A;  3R3M A;  1WJ4 A;  1R4M I;  1L4Z B;  4OZA A;  4B95 A;  3NS8 A;  1SSN A;  3H8H A;  4RNA A;  2KWD A;  2MBE A;  3RYT A;  4WWM A;  3RT3 B;  4ZHO A;  2MJ3 A;  2K5P A;  2D11 A;  4M00 A;  1PFD A;  4CYE A;  5BYS A;  2MJD A;  3AXC A;  4IG7 B;  3RNA C;  1JWA D;  3N1Y C;  2FCQ A;  3HRD D;  1ZPS A;  3M3J A;  1C76 A;  2FCN A;  4B0M A;  1WM3 A;  3KLS X;  3NS1 A;  3AEB B;  5LNK 1;  2RMM A;  3RI7 C;  1VZ7 A;  3APD A;  3KUC B;  1Z2M A;  1F52 A;  3WAO A;  1N61 A;  2WXM A;  2ZPN A;  3B9J A;  3ZJU A;  2JY6 A;  2INP E;  3N1Z C;  3A9K B;  3UIN B;  1ZGU B;  1HTO A;  1WGK A;  2IO3 B;  3HVZ A;  3AED B;  3P2B A;  4BKS A;  2JPH A;  2W55 A;  4KGR A;  2VZK D;  2C5L C;  4N58 A;  4LNN A;  1D4B A;  2K0P A;  3KH0 A;  2IDY A;  1PDX A;  3AE5 B;  1C1Y B;  1WIA A;  1NVI D;  3UGB B;  1UH6 A;  1XLQ A;  2XK5 A;  1B9R A;  4WUR A;  4TQ0 A;  1EO6 A;  3HUI A;  4HJK A;  1GAQ B;  4H2A A;  4S0R A;  3ZLZ A;  1WRD B;  1R4N B;  1XXG A;  3NVZ A;  1JWB D;  3VAW A;  2HTH A;  1FEH A;  1KJT A;  1GC7 A;  2MRP A;  4YSX B;  2J0J A;  1STE A;  1YJ1 A;  4N59 A;  2BYT A;  1XO3 A;  3VH3 B;  3QQ8 B;  5D94 A;  4FUL A;  1E8Y A;  4ZRJ A;  4DBG A;  4OZC A;  1C3T A;  3QJZ A;  2RPQ A;  2NBW B;  3NZS A;  4AP4 C;  1FNW A;  4XX5 A;  4ANU A;  4MH8 A;  5G5G A;  3WAN A;  4K7U A;  4HPL B;  4PYZ A;  3SD5 A;  2KTF A;  1WH3 A;  2R2O A;  3AE1 B;  4KDL B;  5G55 A;  3L13 A;  3AEG B;  4XE0 A;  2BB5 A;  3BZD B;  1IUE A;  2RR9 A;  3FIL A;  3MTN B;  2OOB B;  2WXQ A;  1N60 A;  4GIV A;  4J3O D;  4GDK A;  4JLC A;  3VHT C;  2D07 B;  4QAY A;  4FA6 A;  1YJJ A;  1S1Q B;  3T3N A;  2KYW A;  1JCK B;  2DEN B;  4P1B C;  2CU1 A;  3EA6 A;  1V5O A;  1DOY A;  4ZOH C;  2WXL A;  3ZJV A;  1J7B A;  1WGY A;  3VH4 B;  2JF5 A;  2TSS A;  3W2D A;  1WXA A;  1F1H A;  2CS4 A;  2K3U A;  4I6L B;  2M0X A;  2Z8L A;  2IO0 B;  4FJY A;  2D3B A;  3BVM A;  3W1Y A;  3CWI A;  2RDB C;  1BXT A;  1KOT A;  4YL8 A;  1XLO A;  3VUX A;  2XN9 C;  3WAP A;  4MEM A;  1PQS A;  2W54 A;  5BMI A;  2N7J A;  2KDB A;  4FAD A;  2KVR A;  3DPD A;  3W1S A;  1WZ0 A;  2IY0 B;  5IP4 D;  4PS7 A;  4EZK A;  4OHJ A;  4OVV A;  3A9J B;  1I4G A;  2N9K A;  4HRO A;  1TIF A;  4LK0 M;  3TUO A;  4IWQ A;  2RSU A;  4KKI A;  3T9L A;  1I4R A;  5AZG A;  4ZRQ A;  4A20 A;  2CU3 A;  3EEC A;  1GJZ A;  1WJU A;  3GS2 A;  5FR3 A;  1WGR A;  2QIE B;  1I4X A;  3VR8 B;  1GUA B;  4KGS A;  3UQB A;  2DYM A;  1KTK A;  3RZF A;  2NR2 A;  1TTN A;  4IC7 B;  1XT9 B;  3S2A A;  4YSY B;  3V61 A;  3A33 B;  2ZW1 A;  4K3C A;  3V05 A;  3JVZ X;  4AJY B;  1L4D B;  1C4P A;  2FIF A;  1IP9 A;  4AS1 A;  5G5H A;  1WGD A;  2ICI A;  3DWM A;  4K7W A;  2GBN A;  1MG8 A;  2WDR B;  1V97 A;  2EKI A;  1AN8 A;  2KWU B;  3MHZ A;  2G1E A;  3MC8 A;  2LVO A;  4G11 A;  1YOV B;  3UQA A;  1T6B X;  2HD5 B;  3DWG C;  4GSW A;  4W9H A;  2FUH B;  3U30 A;  3HM3 A;  3KWL A;  2LHE A;  3U52 E;  3ZO5 B;  2RDH A;  2ACZ B;  2WXJ A;  4RGO S;  4WWP A;  3RZW C;  3NVW A;  5FK9 C;  1GB4 A;  3VUW A;  3OJ3 A;  1YIW A;  2LGD A;  5JZE B;  1WM2 A;  2LGI A;  3ZQ4 A;  4DDG D;  3Q6B A;  2LWP A;  2B76 B;  5JH5 C;  1ACC A;  3UIO B;  2JSV X;  5JHA A;  2WNM A;  2C7H A;  4L23 A;  1SB3 C;  2AWT A;  2MP2 B;  2MA9 B;  1SF0 A;  2PMV A;  5FR6 A;  4NY0 A;  1EF1 A;  3URY A;  2YLM A;  1DOI A;  3W5U B;  3GZN I;  4C56 C;  2PIA A;  1N63 A;  1BT0 A;  2DBY A;  2ON8 A;  2NTT A;  2OHF A;  5LXH A;  4ZRK A;  3VTW A;  2GBR A;  3CF6 E;  2O6V B;  3BVZ A;  1GB1 A;  1TS3 A;  4TV3 A;  4RF1 A;  1VRA B;  1CQV A;  1WX9 A;  3AN1 A;  4R3D A;  1VZ6 A;  1BUI C;  3DOW A;  2DAJ A;  2R2Q A;  1EWC A;  3MHS D;  4URK A;  2V3S A;  1TZO A;  3VTU A;  4B0E A;  1YJI A;  4NQK E;  2EKE C;  2JUO A;  1UGM A;  3ZVV A;  1C78 A;  2AQ2 B;  2N9X A;  5EE0 A;  3PRE A;  2ZNV B;  3V6E B;  1B1Z A;  3EC8 A;  1TS2 A;  3ONS A;  1J7C A;  2L0F A;  4NAW A;  1GG3 A;  1EM7 A;  2C9W B;  3QWZ B;  4LNK A;  1YNT E;  4LDT D;  3ZDM C;  3AH7 A;  1DOX A;  3ZKJ C;  2Z59 B;  4RFB A;  2BWF A;  2KQ7 A;  4GMV A;  1QF6 A;  1D5X C;  3ZNI D;  1WXS A;  4X57 B;  3PT2 B;  3ABV B;  2N7E A;  4XWT A;  1VCB A;  3EHV A;  5DPT A;  3UIP B;  1TS4 A;  2FID A;  5IA7 A;  2WXG A;  1L6U A;  4US8 A;  1KRH A;  3IXS A;  4G50 A;  3ENE A;  2PTL A;  3PHX B;  2WHI A;  2KQS A;  5JXV A;  3DVG Y;  1K52 A;  5H92 C;  4C80 A;  2HJ8 A;  3B0A A;  1JRU A;  2KLC A;  3A1Q A;  1FNV A;  3BVG A;  3ETR A;  1KFY B;  2BS2 B;  3NOB A;  2IO2 B;  2O6V D;  2LMC A;  3IAM 1;  3HM6 X;  2KDM A;  1YN4 A;  5DPW A;  3NZ3 A;  1V5T A;  4W9G A;  2ASQ A;  3T3O A;  1D3Z A;  4RM8 A;  1LO5 D;  2KQ4 X;  2NVU I;  3PRZ A;  3PZ7 A;  1H4R A;  2MH7 A;  1FFU A;  2MW5 A;  2ZJD A;  3RNE C;  5H8Y E;  2IND C;  2N9E B;  4P1C C;  3I63 C;  4MGY E;  3ZNZ B;  3L08 A;  2A4Z A;  3K9P B;  1ZDV A;  2BS3 B;  2OJR A;  3R8B A;  3E9S A;  4ASW C;  4E3C A;  3AEE B;  4MEL A;  2XEW A;  2N9L A;  2L3Z A;  2M1M A;  3DBL B;  4MM3 B;  5GXG B;  3VRA B;  3HHM A;  2KXJ A;  1I35 A;  4BAX A;  1FXA A;  4W9E A;  1JWU D;  3U7Z A;  5AUK A;  3Q3J A;  2Y5B B;  1J0G A;  4RGT A;  2QCZ A;  1WSP A;  2AYO B;  1J7A A;  3OAW A;  1LGR A;  3PVL A;  3IT4 B;  3ALB A;  3IBE A;  3Q3N C;  4C7Z A;  2ZPY A;  3RFZ B;  4F7Z A;  4BBN F;  4FHJ A;  4BZA A;  1OQY A;  1WR6 E;  3AE4 B;  3PRP B;  4WJP A;  1AYF A;  4NAM A;  3DHG C;  4HVB A;  4JE3 B;  3PGE A;  2D10 A;  2O2V B;  2JXX A;  1MI0 A;  4MSM B;  5J2R A;  2FAZ A;  4LJP B;  1RYJ A;  1VDV A;  3ECI A;  1NEN B;  3DBH I;  5AZF A;  4C00 A;  4XGA B;  3BIN A;  1LFD A;  4BOZ B;  2JX5 A;  3R7R A;  2LRU A;  2DYO A;  2QHO A;  1OEY A;  3ML8 A;  1IBX A;  4FBJ B;  3AI5 A;  3DHH C;  3Q8C A;  4K7S A;  4JIO U;  4ARC A;  4BKT A;  1TY0 A;  3IVF A;  2DHZ A;  2UWQ A;  1N6Z A;  3AU4 A;  4I6P A;  2KAN A;  4N9F 4;  1D5Z C;  2MQJ A;  2Z0E B;  2J53 A;  2LHD A;  4HRS A;  1E10 A;  2BKF A;  2BWE S;  2KTR A;  1MG4 A;  1GNU A;  2NBV B;  2L83 A;  1YX6 B;  4II2 B;  4MT5 A;  2Y3A A;  1I4Q A;  2KN4 A;  4RGM A;  3SU8 X;  3FC4 A;  2JRI B;  4IWO A;  4K3B A;  4MGK E;  3J9C A;  4WAF A;  3QX1 A;  2ZVO A;  4ANV A;  4BKG A;  2C60 A;  1V86 A;  3AMZ A;  2SAK A;  2JU6 X;  1TKE A;  3RMK C;  5HI1 A;  3Q3M C;  3A4S C;  1X1M A;  3KVF B;  4A55 A;  2B3A A;  4WQM A;  4Q2J A;  2MHJ A;  1TYG B;  1EWY C;  5MPO A;  1E7U A;  2XK5 B;  1WR1 A;  3H7S A;  5J17 A;  2DLB A;  4B9K A;  2HE7 A;  2V3N A;  1IGD A;  1SIJ A;  1WXV A;  2AQ3 B;  2WWZ A;  3DBH B;  4IOI E;  1YX5 B;  2KFJ A;  3IG3 A;  1VJK A;  1RM6 C;  1QOG A;  1UBI A;  2IYD B;  4F1S A;  3AE3 B;  2OJW A;  3NVV A;  2WU2 B;  5GMV A;  3VTV A;  1EU3 A;  3Q2A C;  5AUI A;  1L2N A;  2MX2 A;  3AUL A;  1OEY J;  1C4A A;  3DBR I;  1ZXH A;  4NZL B;  4W9L A;  3WAL A;  3N30 A;  5BMG A;  5BYR A;  4AQ7 A;  1FFV A;  2EMS A;  2RDG A;  1Z5S B;  4D2K A;  1MJD A;  1JRP A;  3W9C B;  1FIQ A;  1V2Y A;  5TR5 A;  3ZNG C;  2KZR A;  3VQI A;  3PV1 A;  3AEC B;  3B08 A;  2WGS A;  2HJ1 A;  1BML C;  5EE9 A;  1R4M B;  5CTR C;  4REZ A;  1L0X B;  5DPS A;  1QT9 A;  3C0R B;  1RWS A;  5LXI B;  4ICV A;  4FN2 A;  3FIL B;  4NJ6 A;  3VUY A;  4HJG E;  3R2T A;  2KWC A;  4DHZ E;  4RGN A;  1AWD A;  4HPP A;  4BVU C;  5CX3 A;  4KGT A;  2G45 B;  3ZW3 A;  2K6D B;  4GDK B;  2KJH B;  5D3I B;  3TEY A;  1KF6 B;  3Q3F A;  2K6Q A;  3N3K B;  5IAA C;  3DVG X;  1K50 A;  3RPF C;  3AE9 B;  2K8B A;  3NRZ A;  3QK0 A;  4EEW A;  5L95 C;  3MJW A;  3PZ8 A;  2QIL A;  3I9V 1;  2NBU A;  5JHB A;  1ET6 A;  2M0A A;  4B6W A;  3W5V B;  2K39 A;  1F2R C;  2KFK A;  2PW9 A;  2R61 A;  3KYC D;  4KV2 A;  5HHD G;  2J4X A;  4OVU A;  4LTU A;  4XDD A;  5HKH A;  3CIR B;  4HWI B;  1WMH A;  2MBH A;  3L54 A;  1YQ4 B;  2DAF A;  2WXI A;  2ZNV C;  4DHJ B; 
#chains in the Genus database with same CATH homology
 2CHZ A;  4GU2 A;  2WYQ A;  4EZJ A;  1WFY A;  3OJ3 A;  1YIW A;  3VUW A;  3L17 A;  2LD9 A;  2LGD A;  5JZE B;  1WM2 A;  1RAX A;  2J7Q B;  2M8S A;  4DDG D;  2CHX A;  2LWP A;  4WJQ A;  5JH5 C;  2KD0 A;  4MJS A;  1CMX B;  1E5W A;  4ANW A;  4IUM B;  1E8X A;  3UIO B;  3DBS A;  4ZRI A;  2CKH B;  3ZTD A;  2NS5 A;  5JHA A;  3DCG A;  3D32 A;  4FJV B;  2DYB A;  2N1V A;  2C7H A;  4JL9 A;  4MGZ E;  1E8W A;  2BGF A;  4RM9 A;  4TKN A;  4ANX A;  4KSL C;  2AWT A;  1SIF A;  2C7N B;  2YVC A;  5D2M B;  3VVW B;  4IM0 A;  3ZUN A;  4WJO A;  2MP2 B;  1HE8 A;  2MA9 B;  4WAA A;  4HLE A;  2I1K A;  2KNB A;  4AJW A;  1V6E A;  4HPM B;  5FR6 A;  4NY0 A;  1EF1 A;  3JW0 X;  2YLM A;  5G2N A;  4G3X B;  2GMI C;  2PE6 B;  3GZN I;  3U8Z A;  3KYD D;  1WYW B;  2KK8 A;  2FCM A;  3N32 A;  4ZDV A;  2M17 A;  2RD0 A;  1BT0 A;  1EF5 A;  2EMT A;  4F8C B;  4EFO A;  2I1J A;  1WY8 A;  4ZRK A;  2GBR A;  3VTW A;  5LXH A;  3CF6 E;  2AL6 A;  3QAQ A;  4GB9 A;  2KHW B;  3H1U A;  2O6V B;  4HXD A;  3PZD A;  4W9J A;  3WAM A;  4TV3 A;  2MBO A;  1WX9 A;  3VXW A;  2LXA A;  2NCN A;  4A3P A;  3TBL D;  3U7D A;  3DOW A;  2DAJ A;  1TZ1 A;  1F9J A;  2R2Q A;  3MHS D;  4URK A;  2IZV B;  2V3S A;  2K8C A;  3VTU A;  3W1S C;  3R7Q A;  4NQK E;  3M62 B;  2LGX A;  2EKE C;  2JUO A;  5BO4 B;  1E7V A;  1UGM A;  2UYZ B;  3X23 A;  3ZVV A;  2AEH A;  2BYV E;  4PYU A;  1P9D U;  3X0W A;  2N9X A;  2Z0D B;  2AL3 A;  3NY5 A;  3PRE A;  2ZNV B;  4WQO B;  1WX7 A;  2DX5 B;  4IW0 A;  3IFW B;  3V6E B;  3EC8 A;  2JRH A;  1NI2 A;  2KFK B;  3ONS A;  1P1A A;  3R66 C;  4KZC A;  2WDT B;  1U4A A;  2L0F A;  2LJ5 A;  1YD8 U;  2JZ3 B;  2LAS A;  3ZIM A;  4BKS D;  5J18 A;  4NAW A;  2LUE A;  4AWJ A;  3A9K A;  1GG3 A;  1WI0 A;  2C9W B;  3JYU A;  1WMH B;  3QWZ B;  4LDT D;  3WA0 A;  2N4F A;  3ZDM C;  5D6J B;  1RLF A;  1J19 A;  2L00 B;  1P0R A;  4DHZ B;  2LVQ A;  3AU5 A;  3EFU A;  3QAR A;  1V81 A;  3ZKJ C;  2Z59 B;  1UD7 A;  2BWF A;  2KQ7 A;  4GMV A;  2GBM A;  2DZI A;  2VRR B;  2KN5 A;  3H7P A;  4NJ7 A;  3T8M A;  3ZNI D;  4BBN C;  1WXS A;  4X57 B;  3PT2 B;  4E74 A;  4W9K A;  4W9C A;  2N7E A;  2KWV B;  1VD2 A;  2D2Q A;  1VCB A;  2LGY A;  1IPG A;  3EHV A;  4PS3 A;  5DPT A;  3L16 A;  3UIP B;  2FID A;  5IA7 A;  5E6O A;  4MJS B;  2BKR B;  1Y8R C;  4HDQ A;  3VFK A;  4LJO B;  3PRM B;  1I42 A;  4G50 A;  3ENE A;  3PHX B;  2L76 A;  2KQS A;  3DVG Y;  2BYF A;  2PEA A;  3PSE B;  4DK5 A;  3APF A;  3PLU A;  3V60 A;  2KDI A;  1AAR A;  3HIZ A;  1SE9 A;  2LRW A;  2FCS A;  3QC8 B;  4IM2 A;  2HJ8 A;  3B0A A;  1JRU A;  5C1Z A;  2DZK A;  2KO3 A;  1WJN A;  2KLC A;  2L8J A;  3A1Q A;  4KSK C;  3ZRC A;  5AEK B;  3V62 A;  3A4R A;  3NOB A;  1UZX B;  2IO2 B;  2O6V D;  2KDF B;  2D3G A;  2L7R A;  3HM6 X;  3CSF A;  5DPW A;  1V5T A;  2N1W A;  3PLV A;  4W9G A;  2ASQ A;  4W9D A;  1R4N I;  1WGH A;  3R3M A;  1D3Z A;  1WJ4 A;  4E71 A;  2XBB C;  3OLM D;  1R4M I;  4MSQ B;  4RM8 A;  2NPT A;  4B95 A;  3NS8 A;  3QA8 A;  3TMP B;  2MBE A;  3RYT A;  2GBJ A;  2L0T A;  2NVU I;  3RT3 B;  3PRZ A;  1H4R A;  5EDS A;  4MDK E;  2ZCB A;  3CST A;  2MCN B;  4AUQ C;  2MW5 A;  2ZJD A;  1WZ3 A;  1P3Q U;  3ZRF A;  2D11 A;  1XQQ A;  2N9E B;  4CYE A;  3ZTC A;  3AXC A;  4IG7 B;  2RGF A;  3JSV A;  4MGY E;  3ZNZ B;  2FCQ A;  2A4Z A;  3K9P B;  3L08 A;  1A5R A;  2KJ6 A;  2OJR A;  1T0Y A;  1V9J A;  2G4S A;  5D7G A;  3M3J A;  4CHK A;  3V6C B;  4ASW C;  2FCN A;  4E3C A;  1WM3 A;  4MEL A;  2XEW A;  1WXM A;  1WX8 A;  3PTF C;  4XC2 A;  1TGZ B;  3APD A;  2L3Z A;  2KDE B;  2M1M A;  3KUC B;  1Z2M A;  3WAO A;  3SHQ A;  1OGW A;  1WE7 A;  5C23 A;  1ZKH A;  4NPN A;  3SDL C;  3TIX A;  2ZPN A;  3K9O B;  2KLG A;  3HHM A;  3ML9 A;  2KXJ A;  1WF9 A;  4IWP A;  4M8M A;  2JY6 A;  1I35 A;  2GBK A;  4W9E A;  3A9K B;  3UIN B;  1S3S G;  1ZGU B;  2CHW A;  2KC2 A;  2IO3 B;  1V80 A;  3Q3J A;  1P98 A;  2DZJ A;  1G6J A;  2Y5B B;  1J0G A;  3P2B A;  2N9P C;  4BKS A;  2JPH A;  2AYO B;  4EKU A;  2LXC A;  3UF8 A;  2C5L C;  4K81 A;  3OAW A;  3PVL A;  3ALB A;  3KH0 A;  3IBE A;  4RMA A;  3QCA A;  1C1Y B;  2JWZ A;  2ZPY A;  1WIA A;  4DXA B;  2K25 A;  3UGB B;  1KLV A;  3APC A;  1UH6 A;  2XK5 A;  4F7Z A;  4MH0 E;  4TQ0 A;  4A3O A;  2KMC A;  1EO6 A;  3B1L X;  5DCN A;  4DHJ D;  2K8H A;  4BBN F;  4HJK A;  4FHJ A;  1WE6 A;  4NQL B;  1OQY A;  4DWF A;  1WR6 E;  2A5U A;  3ZLZ A;  4WJN A;  3PRP B;  1WRD B;  4KIK B;  4WJP A;  3A1Q B;  3M95 A;  4K1R B;  4HVB A;  1ISN A;  1IYF A;  4DDI D;  3PGE A;  2D10 A;  3VAW A;  2HTH A;  2O2V B;  2JXX A;  4MSM B;  5J2R A;  2FAZ A;  4MGI E;  4LJP B;  2LVP A;  3TJP A;  1KJT A;  3ECI A;  2LI5 A;  2JVC A;  3DBH I;  5E6N A;  1GC7 A;  2MRP A;  5AZF A;  2J0J A;  3KUZ A;  1NBF C;  1YJ1 A;  3BIN A;  3OJ4 B;  4FHK A;  3VH3 B;  1LFD A;  3QQ8 B;  5D94 A;  4BOZ B;  4FUL A;  4PS8 A;  2WX1 A;  3R7R A;  2LRU A;  1E8Y A;  2W9N A;  4ZRJ A;  2DYO A;  2O6V A;  2QHO A;  1KM7 A;  1K8R B;  1OEY A;  2NPT B;  4DBG A;  3A9J A;  3ML8 A;  1C3T A;  1WGG A;  1TBE A;  1WJ6 A;  3QJZ A;  4FBJ B;  4TUU A;  2RPQ A;  3AI5 A;  2NBW B;  1RRB A;  3NZS A;  4JIO U;  4K7S A;  4BKT A;  3WIM A;  4AP4 C;  1RFA A;  2REX A;  3IVF A;  5KHQ A;  2KOX A;  4XX5 A;  2DHZ A;  2UWQ A;  4G0N B;  4ANU A;  3H9D A;  3AU4 A;  4I6P A;  4TQ1 A;  4II3 B;  2KAN A;  4HDO A;  2JZZ A;  4N9F 4;  1L7Y A;  2G4D B;  2IO1 B;  2MQJ A;  3WAN A;  4K7U A;  4HPL B;  4PYZ A;  1E90 A;  2Z0E B;  3SD5 A;  2IBI B;  2KTF A;  3H6N A;  3JSV B;  2J0M A;  1WH3 A;  3RUI B;  2R2O A;  2IY1 B;  4WWN A;  4GDL A;  4KDL B;  2BKF A;  2BWE S;  2KTR A;  5G55 A;  3KW5 B;  4BFR A;  1ZW7 A;  3CMM B;  3L13 A;  4JGH B;  2G3Q B;  2J0K A;  1GNU A;  1UBQ A;  2NBV B;  2KKC A;  2RR9 A;  4GOC A;  1YX6 B;  4II2 B;  2DZM A;  3MTN B;  4NNJ B;  4W9I A;  3SU8 X;  2OOB B;  3DVN U;  2JRI B;  4IWO A;  4MGK E;  4GIV A;  1H8C A;  3PHW B;  4GDK A;  3L0W B;  2JT4 B;  4JLC A;  3RD2 A;  3VHT C;  4EUT A;  2MSE D;  2D07 B;  2ZVO A;  3QX1 A;  4ANV A;  1YQB A;  4BKG A;  4FA6 A;  1S1Q B;  2C60 A;  4HCP B;  1V86 A;  2DEN B;  1LM8 B;  3NZU A;  2CU1 A;  4IM3 A;  4KDI C;  1V5O A;  4JQW C;  5CHW A;  2FNJ B;  2ZVN A;  3A4S C;  4HK2 A;  1X1M A;  3KVF B;  2B3A A;  2V1Y A;  4ICU A;  1FXT B;  4LDT B;  1WGY A;  2PPH A;  1E7U A;  2ZZP B;  4GGQ A;  2PJH A;  2JF5 A;  3VH4 B;  4I6N B;  2KX3 A;  2XK5 B;  1WR1 A;  1XD3 B;  3H7S A;  5J17 A;  4B9K A;  1WXA A;  2HE7 A;  2CS4 A;  5KHO A;  3LJ3 A;  4I6L B;  2M0X A;  1WXV A;  4M0W B;  5DPR A;  4AOF A;  2WWZ A;  4EZL A;  2IO0 B;  1YX5 B;  4FJY A;  4HCN B;  3QHT A;  2KFJ A;  3IG3 A;  4NAW B;  4GN1 A;  3W1Y A;  4XZ4 A;  3RUL A;  3TCA A;  5E6P A;  1KOT A;  1UBI A;  2IYD B;  3KUD B;  4YL8 A;  4F1S A;  5GMV A;  3VTV A;  5AZH A;  3VUX A;  3H7P B;  3WAP A;  4MEM A;  1PQS A;  1L2N A;  2MX2 A;  3I3T B;  2KDB A;  4FAD A;  3AUL A;  1OEY J;  3DDC B;  3DBR I;  1GC6 A;  2KVR A;  2L05 A;  3DPD A;  4W9L A;  4GXB A;  2MBB B;  3W1S A;  2MWS B;  5L83 A;  1WZ0 A;  3RCZ A;  3WAL A;  2IY0 B;  3N30 A;  4PS7 A;  4EZK A;  4OVV A;  1EUV B;  2EMS A;  2KX0 A;  3A9J B;  3GOE A;  2CR5 A;  1Z5S B;  3TL5 A;  3O65 B;  3ZNH B;  2KMA A;  1OTR B;  4IWQ A;  2RSU A;  1V2Y A;  2MP2 A;  3BY4 B;  4LCD E;  1SGH A;  1Q1O A;  2K1F A;  5TR5 A;  3T9L A;  3ZNG C;  2KZR A;  1LQB A;  1V49 A;  5AZG A;  3PV1 A;  2BF8 B;  3VQI A;  3QIJ A;  4A20 A;  3B08 A;  4WWO A;  2GOW A;  3EEC A;  1GJZ A;  1QZE A;  1WJU A;  4FLH A;  4GDL B;  2BYE A;  2KTR B;  1WGR A;  5CTR C;  3IHP C;  5DPS A;  1GUA B;  1NDD A;  3C0R B;  4MM3 A;  3UQB A;  3M63 B;  4ZYN A;  4ICV A;  3NHE B;  4FN2 A;  4BOS C;  5LXI B;  4NJ6 A;  2DYM A;  4W9F A;  1E8Z A;  2NR2 A;  3RZF A;  3VDZ A;  3VUY A;  2KWC A;  3DVN V;  1TTN A;  2MLB A;  2V4L A;  4DHZ E;  4P7I A;  4IC7 B;  1XT9 B;  3S2A A;  3DQV A;  4BVU C;  5CX3 A;  3V61 A;  3PPA A;  4EOY A;  2G45 B;  3ZW3 A;  2KJR A;  2K6D B;  3DBL I;  4GDK B;  2KJH B;  3A33 B;  3LDZ E;  3Q3F A;  2K6Q A;  3N3K B;  5IAA C;  3DVG X;  3JVZ X;  4AJY B;  4M8N A;  2FIF A;  1IP9 A;  2K8B A;  2LZ6 A;  2KC1 A;  3QK0 A;  4EEW A;  1WGD A;  4CO7 A;  5L95 C;  4K7W A;  4KVG B;  3MJW A;  3HK0 A;  5CHF A;  2GBN A;  2MBQ A;  4FJZ A;  4KZ0 A;  1Q0W B;  1MG8 A;  2ZCC A;  2KWU B;  2NBU A;  5JHB A;  1UEL A;  2LVO A;  4G11 A;  4B6W A;  3UQA A;  2K39 A;  2KFK A;  5LLI A;  1J8C A;  2HD5 B;  3KYC D;  5CHV C;  4GSW A;  4J6I A;  4KV2 A;  4W9H A;  2ZEQ A;  2FUH B;  3U30 A;  2WX0 A;  2C7M B;  1M94 A;  3HM3 A;  4OVU A;  5HKH A;  3ZO5 B;  3PS6 A;  4HWI B;  4KIK A;  2BPS A;  1WMH A;  3ZDT A;  2PE9 A;  2MBH A;  4WWP A;  2M4N A;  3L54 A;  1Q5W B;  2O2V A;  3L10 B;  2DAF A;  1LXD A;  2ZNV C;  3RZW C;  2N7D A;  4DHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...