3ZO5B

Structure of senp2-loop1 in complex with presumo-2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Structural Insights Into the Senp6 Loop1 Structure in Complex with Sumo2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zo5B00
2KLCA 2M1MA 4E71A 2QHOA 2C9WB 3VH3B 3KVFB 4KVGB 2DHZA 3RZFA 4MELA 4BOSC 3RUIB 1WXSA 2J0JA 4BKSA 4OVVA 1VD2A 1LFDA 3H7SA 4IWPA 2LWPA 4OVUA 3VQIA 2FAZA 2UWQA 5FR6A 4E3CA 2KTRB 2D10A 2LD9A 2YLMA 2GMIC 1GC7A 2WX1A 3WANA 1K8RB 2MQJA 2RPQA 4IWQA 4M0WB 4W9FA 3APFA 5E6PA 4A3OA 4B9KA 2FNJB 2WX0A 2D3GA 5JHAA 4JIOU 3UF8A 4EZJA 1YQBA 2ZVNA 3QK0A 1WR6E 3MJWA 4BBNC 4MGYE 1WE6A 3K9PB 1NI2A 3U8ZA 4NJ6A 3ENEA 1V5OA 4ZRIA 1OGWA 3WAPA 2EMSA 4G11A 3R7QA 4CHKA 1BT0A 2BKFA 5TR5A 3TL5A 3ZLZA 1M94A 2CR5A 2O6VB 3UIOB 3ONSA 1Y8RC 5L83A 3UGBB 4GDLB 1GC6A 3C0RB 2D07B 2KFKB 3GZNI 3L17A 3O65B 4EZLA 1L2NA 2MBHA 1V81A 4DBGA 4GSWA 2MWSB 3KW5B 5E6NA 1WZ3A 2FUHB 3L16A 2CKHB 3X23A 4CO7A 2LVQA 4NJ7A 1IP9A 1V2YA 3PPAA 2AWTA 3WAMA 5AZGA 5DPRA 3HK0A 3UQBA 4ANVA 4NQLB 3VH4B 1WM2A 1Q0WB 2ZNVC 4RM9A 3ZDMC 2FCMA 4DHZB 3ZDTA 5GMVA 3TJPA 1UBIA 4W9LA 4DHJB 1S1QB 1XQQA 1MG8A 2NPTB 4ZYNA 3KH0A 1WF9A 3V6CB 1E8ZA 1OQYA 4MGKE 1WGYA 4MSMB 3WA0A 2LGDA 2BGFA 2BWFA 3PVLA 2BYFA 4CYEA 1TTNA 2IBIB 2IZVB 2KJ6A 1E90A 2LASA 2GBJA 2DAJA 2MBEA 2MBOA 5JH5C 4IM0A 2L7RA 3NS8A 4KSKC 4IM2A 2KC2A 2XK5B 4GU2A 1UGMA 2KHWB 3K9OB 4K7WA 4HWIB 4FHJA 4JLCA 3NHEB 5J18A 1E7VA 3HIZA 4TQ0A 4NNJB 2RR9A 2KMCA 2JRIB 2Z0EB 4GGQA 2JPHA 3VTVA 3ZTCA 4A20A 5JHBA 1V6EA 1WGHA 1XD3B 3NZSA 4W9HA 5C1ZA 2DENB 1AARA 4KIKB 2JZZA 4IC7B 3AU5A 2MP2B 4DHJD 2K8CA 5EDSA 5HKHA 2WWZA 3U30A 5J17A 2KOXA 3APDA 2KX3A 3QX1A 4FHKA 4LCDE 2NBWB 4HVBA 4GXBA 3ML8A 3QA8A 1QZEA 2MLBA 1S3SG 2LVPA 1KOTA 1IPGA 2NR2A 3N30A 3DOWA 3A4SC 3MTNB 4NAWA 2PJHA 2KTRA 3B0AA 5LXHA 2K6DB 2FIFA 4IWOA 3PZDA 1XT9B 3IHPC 4AJYB 2C7MB 2IY0B 3PSEB 4ICVA 4K81A 4KDLB 2PEAA 4FULA 3VTWA 2PPHA 4NPNA 3QJZA 2KWCA 4G0NB 4GMVA 2BF8B 3DBRI 1P98A 3PRZA 5JZEB 2NVUI 2M8SA 3RYTA 3EC8A 4IUMB 2KMAA 3ZO5B 2KDIA 2G4DB 1GUAB 1WRDB 1OTRB 1WJ6A 3QARA 2AYOB 4IW0A 1TZ1A 3QIJA 2IO3B 2ZPNA 4RMAA 1EUVB 5IAAC 3M3JA 2GBMA 2V3SA 2W9NA 1WXVA 3KUDB 2LRWA 3H7PA 3QWZB 4NQKE 4AOFA 4GDLA 2KC1A 1ZKHA 2KFKA 1R4MI 3ML9A 2CHXA 4RM8A 2DZMA 2HD5B 3M95A 1WE7A 3B08A 3ALBA 4PS8A 5IA7A 5G55A 4WJPA 3RD2A 3VUWA 1OEYJ 2K39A 5DPTA 3AU4A 4W9JA 3L10B 1KM7A 4GN1A 5LLIA 1I42A 5CX3A 4F7ZA 3PS6A 2N4FA 4KV2A 2O2VA 2DZJA 4PYUA 2L05A 4PS7A 2NPTA 1RLFA 4DHZE 4HDOA 4K1RB 2ZPYA 4DK5A 2NS5A 4F1SA 4PYZA 1LXDA 1WGGA 2IY1B 2DYBA 4IM3A 1WGRA 3T8MA 3CSFA 2MBQA 3M63B 4BFRA 1EO6A 1RRBA 2BYEA 4K7UA 4EEWA 2XEWA 2ZVOA 4HCNB 4TKNA 4DXAB 1WXAA 2Z59B 1HE8A 1V86A 2KD0A 2KNBA 2KX0A 3A9KB 2XK5A 3PGEA 2VRRB 2K8BA 2R2OA 2LGXA 2G4SA 4FJZA 4HDQA 4W9IA 4XZ4A 4MSQB 4EFOA 2ASQA 4BKGA 3UINB 3AXCA 2FCNA 2MCNB 2KZRA 1J8CA 1WX7A 2LI5A 2DZKA 2AL3A 2MBBB 3H9DA 3ZRFA 4EUTA 2KXJA 2JZ3B 4BVUC 2ZZPB 1NDDA 1P9DU 3QAQA 4WWOA 4PS3A 1V80A 1WI0A 2LUEA 2CS4A 2JF5A 2ZEQA 2J0KA 2NBUA 3A9JB 3SHQA 3JSVA 3L08A 1PQSA 3TMPB 4I6LB 1Z5SB 2CHZA 3CMMB 4W9CA 1A5RA 3ZRCA 4WAAA 3OAWA 4MM3A 4ANXA 2KQ7A 2L3ZA 2KQSA 2O6VD 2KDFB 3DVGY 1GG3A 2WYQA 3DVNU 3PREA 1FXTB 4P7IA 1YX6B 2I1KA 4WJOA 2DYOA 3UIPB 2K1FA 4AJWA 1Q1OA 3RT3B 2KFJA 3TBLD 3ZNHB 1WJ4A 4M8MA 2OJRA 4TUUA 3ZNGC 5CHVC 1WMHA 3PRMB 2BYVE 4KZ0A 1UH6A 2NCNA 3HHMA 1GJZA 3RCZA 4HJKA 1SIFA 1LM8B 4MDKE 1V49A 2DAFA 3SU8X 1Q5WB 1T0YA 2RSUA 2KDBA 2NBVB 2ZCBA 1EF1A 2G3QB 1P0RA 3V62A 2GBKA 4II3B 2K6QA 3OJ4B 3VAWA 2N7DA 3ZW3A 1OEYA 1H8CA 2A5UA 2KWUB 2KVRA 5AZHA 5L95C 1ZW7A 2KTFA 2GBNA 5D94A 2DYMA 2V1YA 1C1YB 1E7UA 4BBNF 1C3TA 3M62B 2EMTA 1SGHA 3N32A 3R7RA 3QHTA 2LVOA 4B6WA 4FADA 2B3AA 1UZXB 3BY4B 2HTHA 2N9XA 4N9F4 1P3QU 3HM3A 4HXDA 4AUQC 1EF5A 3ZNZB 1WH3A 4I6NB 3PHXB 3PT2B 5DPWA 1F9JA 5DCNA 3VXWA 4HLEA 3SD5A 4DDID 1E8WA 2PE9A 3PLVA 2IO1B 3IBEA 2CU1A 4EKUA 3Q3FA 5CTRC 2J0MA 1TBEA 5AEKB 4ICUA 3ZKJC 2K25A 2O6VA 2PE6B 5CHWA 2N1WA 2KJHB 2MA9B 2J7QB 4W9DA 3A9KA 3BINA 5BO4B 1E8XA 1WJNA 1UBQA 2Z0DB 3KUCB 3RULA 4ZRJA 2KANA 2JVCA 4WQOB 2RGFA 1WX9A 3Q3JA 1ZGUB 3TCAA 3VFKA 3A1QB 3PHWB 3PLUA 3VHTC 4HCPB 1TGZB 1G6JA 3VVWB 2KDEB 2IO0B 4G3XB 2RD0A 4FA6A 4BOZB 3EECA 4II2B 2IYDB 3WIMA 3I3TB 1RAXA 4FJYA 3H1UA 4FJVB 4NY0A 3LJ3A 3PRPB 3V61A 3ZUNA 1KJTA 2JUOA 3A9JA 5C23A 2LXAA 1V5TA 5D6JB 2MW5A 3DBLI 2KLGA 3ECIA 4GDKB 1E8YA 1YIWA 1UELA 2CHWA 1JRUA 2REXA 2D2QA 4NAWB 2R2QA 1IYFA 3DBHI 4J6IA 2AL6A 3KUZA 3DVGX 1SE9A 3LDZE 3KYCD 1LQBA 3IVFA 4I6PA 4HPMB 3AULA 4FBJB 4MJSB 4EZKA 4YL8A 2M0XA 2MSED 1ISNA 2LZ6A 4ANWA 3DVNV 2L0TA 2UYZB 4G50A 4JQWC 5E6OA 1R4NI 3DDCB 2M4NA 1WYWB 4TV3A 2N7EA 2FIDA 2Y5BB 3UQAA 2I1JA 4AWJA 4MH0E 1J0GA 3QC8B 3VUXA 3X0WA 2N9EB 4KIKA 3QQ8B 2EKEC 2MP2A 2HE7A 3H7PB 1KLVA 2AEHA 2C7NB 1WX8A 2JT4B 2L00B 5D7GA 3DQVA 4GOCA 3DBSA 3ZNID 3APCA 3AI5A 2ZCCA 3JVZX 4ZRKA 3CF6E 2XBBC 3VUYA 4JL9A 1D3ZA 3PV1A 2KN5A 3H6NA 2OOBB 4MGZE 4W9GA 1WJUA 2N9PC 1RFAA 2V4LA 1I35A 4WWNA 4MEMA 3NZUA 4F8CB 1NBFC 5J2RA 2FCSA 2BKRB 3W1YA 2MRPA 4W9EA 5D2MB 2IO2B 4X57B 4ZDVA 4BKTA 2O2VB 2GOWA 4XX5A 1CMXB 4MGIE 1YJ1A 3V60A 2MX2A 3MHSD 3V6EB 1WZ0A 3L13A 3PTFC 2ZJDA 3EFUA 2N1VA 4LJOB 3GOEA 3R66C 4GIVA 5CHFA 2K8HA 3NY5A 2FCQA 3ZIMA 4KZCA 1J19A 4AP4C 4KSLC 3WALA 4W9KA 2G45B 1GNUA 2LRUA 3JYUA 3VDZA 3S2AA 1H4RA 2LJ5A 4BKSD 3KYDD 4XC2A 3ZVVA 3A4RA 2L8JA 3SDLC 3EHVA 2WDTB 4FLHA 3OLMD 1L7YA 1WFYA 2KO3A 2M17A 3A33B 1WXMA 3A1QA 4URKA 5LXIB 1WR1A 5KHQA 2LGYA 4DWFA 4KDIC 1U4AA 5KHOA 4ASWC 2C60A 1VCBA 4LDTB 2DX5B 3JW0X 2JRHA 2D11A 1UD7A 2L76A 3W1SC 5G2NA 2KJRA 3HM6X 1Z2MA 2LXCA 4HK2A 4WJNA 3WAOA 2ZNVB 2JXXA 3P2BA 3JSVB 2KWVB 4GDKA 4HPLB 4EOYA 2GBRA 3CSTA 2YVCA 3B1LX 3OJ3A 4JGHB 3N3KB 4GB9A 3W1SA 2KKCA 3ZTDA 2BWES 4A3PA 3R3MA 4TQ1A 2L0FA 2JY6A 2A4ZA 1E5WA 4M8NA 4MJSA 4WWPA 3L0WB 1WGDA 2BPSA 3DPDA 1WMHB 4B95A 1WIAA 4WJQA 3RZWC 1YD8U 1YX5B 4DDGD 1V9JA 3T9LA 3D32A 2C5LC 4K7SA 3U7DA 4ANUA 2C7HA 2JWZA 4IG7B 4FN2A 3L54A 4LJPB 1P1AA 3TIXA 4E74A 3QCAA 2DZIA 3VTUA 3IFWB 5AZFA 5DPSA 1WM3A 3DCGA 4LDTD 3NOBA 1X1MA 2KK8A 1WY8A 2HJ8A 3IG3A
chains in the Genus database with same CATH superfamily
4XWTA 4K3CA 1WXSA 1XCQL 3AE8B 3W9CB 1UWMA 3N1ZC 4TSSA 2LWPA 3VQIA 1P7EA 3BWUD 2E6XA 3WANA 3UI3A 1K8RB 1TT5B 4A3OA 1J7AA 5JHAA 1YN5A 4EZJA 1YQBA 3QK0A 4TMAB 1WE6A 2PTLA 1NI2A 2NTTA 1EWCA 3R7QA 4CHKA 4A55A 1M94A 2CR5A 1FXIA 3UGBB 1CQVA 3C0RB 2D07B 2KFKB 3L17A 4EZLA 1XEEA 1V81A 2VZKD 1WWTA 4GSWA 4IDIA 2N0SB 3T3OA 4WWMA 3X23A 2INPE 1FM0D 3UQBA 4YXDB 2WXLA 3VH4B 3TEYA 2ZNVC 4RM9A 3ZDTA 1L4ZB 3TJPA 1MG8A 3KH0A 1WF9A 2CU3A 1E8ZA 1IBXA 2BGFA 2QCZA 3BK1A 2BB5A 4LNFA 1LO5D 2PVGC 3BK2A 2MBEA 2MBOA 2L7RA 4L1BA 4KSKC 4IM2A 4GU2A 3K9OB 2V4IB 1PGAA 5J18A 1E7VA 1MHHE 2JRIB 2KMCA 5H8YE 2KVZA 1FD6A 2WXJA 1HXYD 5JHBA 3H8HA 1WGHA 2HTME 4P6VF 2K8CA 1DOXA 2KOXA 4MACA 2KX3A 4FHKA 1RFKA 2JQRB 3AN1A 2INCC 1S3SG 1KOTA 2DNFA 1IPGA 3N30A 3A4SC 4NAWA 3B0AA 1SB3C 1UNSA 4AJYB 2IY0B 4MT5A 2QDFA 2ZW0A 4KDLB 4KGSA 3AE3B 1UGJA 5BYRA 4G0NB 1VR9A 1ZOYB 2JX5A 1I4PA 2RDGA 1GUAB 1I4XA 2OJWA 1TZ1A 3QIJA 2IO3B 4RMAA 5IAAC 3M3JA 4NQKE 2WS3B 4WURA 4AOFA 1N60A 1ZKHA 2GRIA 2KFKA 3TEXA 2HD5B 1C4PA 1TS5A 3M95A 1WE7A 3DBHB 4KKJA 5IA7A 2PKOA 1F2RI 4WJPA 3AECB 3U52E 2AQ2B 4W9JA 2XN9C 1AW7A 4KV2A 2O2VA 4PS7A 4AQ7A 2GI9A 4F1SA 2NS5A 2Z8LA 2AX5A 2BB6A 3T8MA 1VLBA 1RRBA 4K7UA 2XEWA 2ZVOA 4DXAB 1WXAA 3W2DA 1HE8A 3ZQ4A 2KNBA 2KX0A 3J9CA 2K8BA 4M02A 2V3NA 1SBBB 2W54A 3RPFC 1YOVB 4XZ4A 2AQ1B 3AXCA 2KZRA 1J8CA 1R7SA 3QAQA 5EE0A 1WI0A 1SJED 2J0KA 2JXTA 3JSVA 3L08A 1Z5SB 4W9CA 1KTKA 2L3ZA 2KDFB 1GG3A 1FXTB 4WJOA 1YX6B 2I1KA 5FKAC 3UIPB 2K1FA 3ZNHB 3TBLD 5HFYA 1CJEA 1Y56A 3RNAC 4REZA 3SEBA 1GJZA 2NCNA 1SIFA 1D5ZC 3BYTB 3KWLA 2GBKA 1WXQA 2A5UA 1T5XD 2KVRA 5L95C 4CQNA 1C3TA 1SE2A 3N32A 4S17A 3P4RB 3R2IA 2LVOA 2HTHA 3RMKC 1JW9D 1FRDA 1QOAA 3PT2B 5DPWA 1F9JA 5DCNA 2W55A 1GOZA 1E8WA 2KACA 2LUMA 2PE9A 3IBEA 2CU1A 5CTRC 1TBEA 5AEKB 2PE6B 5CHWA 4O1NA 3MC0B 1UBQA 2Z0DB 4ZRJA 5T8IA 2JVCA 3AMZA 4WQOB 2RGFA 1WX9A 2K0PA 3WCQA 1ZGUB 3TCAA 3VFKA 3A1QB 1FO4A 4HRSA 2KDEB 4KKIA 3I57A 1BXTA 1XLQA 1RAXA 1Q10A 3V61A 2LXAA 2MW5A 3DBLI 3GP7A 3ZGZA 4GDKB 1YIWA 2CHWA 3AV8A 2BVCA 5BYSA 3EFCA 4LNNA 3AULA 4FBJB 2WXIA 4MJSB 2I38A 4G50A 4ZRPA 1P7FA 1WYWB 1OFFA 2N7EA 3EGRA 1YN3A 1ACCA 2I1JA 1UUPA 4DXFA 3X0WA 1TZOA 4KIKA 4L2YA 1I4QA 1ZE3D 2EKEC 2H89B 1WRIA 1TJEA 3DQVA 3AI5A 4LNKA 4ZRKA 1HA5A 3VR9B 2KN5A 4W9GA 4MGZE 1WJUA 2N9PC 2V4LA 5J2RA 3NZ3A 2FCSA 4W9EA 5D2MB 1J7BA 4XX5A 2JSVX 1PGBA 2MX2A 3MHSD 3V6EB 2Q5WD 3L13A 2QC8A 4ARIA 3WALA 1TKGA 3Q8BA 4HROA 1K51A 4XC2A 3ZVVA 3DHHC 1ZP0B 3W5UB 4N58A 3A1QA 3VRAB 1FRRA 1U4AA 5KHOA 2DX5B 3JW0X 1UD7A 2L76A 3DBRB 3HM6X 2LXCA 2JXXA 3P2BA 1FPYA 4GDKA 5I4DA 3FC4A 2YVCA 3N3KB 1MPEA 2BWES 4NAMA 2L0FA 4MJSA 5FR3A 3L0WB 1B1ZA 3DPDA 1WMHB 4B95A 1WIAA 4WJQA 2KDMA 2C7HA 2JWZA 3FAHA 3TIXA 3IFWB 2WP9B 2B76B 4P1CC 2WDQB 2HJ8A 2M1MA 2QHOA 3VH3B 4KVGB 3L4PA 1HZ5A 4MELA 2J0JA 4BKSA 4OVVA 1VD2A 1KLUD 3PO0A 1LFDA 4IWPA 4P16A 1FXAA 2WDRB 3N1YC 2LD9A 2GMIC 2WX1A 1DGJA 3TEWA 2MQJA 2RPQA 3APFA 2WX0A 4JIOU 3SFEB 1VDVA 2ZVNA 4C00A 4BBNC 3K9PB 1DYQA 3P1MA 3TL5A 2O6VB 3ABVB 3ONSA 3C19A 3LB8C 3GZNI 3O65B 2KWDA 1EM7A 2L52A 4DBGA 1E9MA 2LVQA 1IP9A 2AWTA 1ZUD2 4KGTA 2WXOA 2IGDA 3ZDMC 1UBIA 1XQQA 1FFUA 4C80A 4MGKE 2LGDA 1XLPA 2BWFA 2D3CA 4DQOC 2BYFA 2LASA 5JH5C 2KC2A 2XK5B 3Q8EA 1QKZA 2K22A 1SXTA 2N7JA 3AEFB 2LFIA 4K7WA 3RNCC 2WDVB 2Z0EB 2JPHA 3VTVA 1E0ZA 1JROA 1V6EA 5IKCM 1JQ4A 2DENB 3PZ7A 3SFDB 4DHJD 4IC7B 1FEHA 5EDSA 2WWZA 5J17A 3APDA 3QX1A 4LCDE 3U7ZA 4HVBA 3B2GA 4D2KA 1QZEA 2MLBA 1I7HA 3MFGA 3MTNB 4OHJA 3NVZA 1JALA 2K6DB 2FIFA 1OQQA 1XT9B 3IHPC 2ONQA 1V1PA 1SEBD 1SSNA 3QJZA 4XE0A 4US9A 2PVOD 3PRZA 1KRHA 2M8SA 3RYTA 3EC8A 4IUMB 3ZO5B 2X8XX 2KDIA 4YSZB 3C8YA 1L0VB 1OTRB 1WJ6A 2AYOB 3AB5A 2LGSA 2ZPNA 2GBMA 3QWZB 1WXVA 3H7PA 4EE2A 1NVID 4XWWA 3B08A 2YEPF 3VUWA 1OEYJ 2K39A 5DPTA 1I42A 5CX3A 4F7ZA 2KT7A 4DHZE 4NJCA 3RNFC 4A90A 2IY1B 1ET9A 1WGRA 1E10A 3CSFA 2MBQA 1TS3A 2BYEA 4RF1A 2Z59B 2N9KA 2XK5A 1XF5L 4W9IA 2G4SA 4HDQA 3HVDA 3P4PB 4WH4A 3I9V1 2FCNA 2MCNB 1IGCA 4BZAA 1WX7A 2G1EA 1T0QC 2UU7A 2JZ3B 3Q3MC 3V3XA 4WWOA 1F77A 2LUEA 3SHQA 3TEZA 3TMPB 1A5RA 1JWAD 1SIJA 4WAAA 2O6VD 3DVGY 2L32A 1RWSA 3RT3B 2KFJA 3PRMB 2BYVE 3Q14C 4M00A 3HHMA 3RCZA 1V49A 4YWGG 1Q5WB 2KDBA 1EF1A 3AM9A 3V62A 2G9HD 3OJ4B 3VAWA 3ZW3A 5AZHA 1ZW7A 2KTFA 2GBNA 5D94A 2V1YA 5GXGB 3Q8CA 1SGHA 4P1BC 4C7ZA 2PW9A 3QHTA 2B3AA 3BY4B 2N9XA 4N9F4 1V97A 3HM3A 4AUQC 3ZNZB 4OZAA 2QJLA 4DDID 1E6EB 3PLVA 2IO1B 2JYTA 3ZKJC 1HQRD 1RM6C 2YEPB 2J7QB 1ET6A 3BINA 1WJNA 3RULA 1YJJA 2WXGA 3R8BA 2KMMA 3VHTC 1TGZB 4G3XB 1N5XA 2RD0A 1N62A 2IYDB 3WIMA 3I3TB 4FJYA 3H1UA 4NY0A 3ZUNA 3AE5B 5C23A 3B9JA 1V5TA 5D6JB 4YTNB 3AE9B 1UELA 3HUIA 1JRUA 2BS2B 2D2QA 1CK1A 2ON8A 2R2QA 2JYEA 1IYFA 4RFBA 3DVGX 4PT5A 1SE9A 3LDZE 1L5PA 5JXVA 2WXMA 4YL8A 5IOIA 2J53A 4UDUC 4ANWA 4ARCA 4JQWC 1R4NI 3OWEB 4RGNA 1L0XB 2Y5BB 1HTQA 4MH0E 4XYCA 3VUXA 2N9EB 4XDCA 1M4VA 1KLVA 2C7NB 5C2TB 4ZYSA 2M0AA 1WX8A 5D7GA 3DBSA 4M01A 2XBBC 4JL9A 5IN7A 2Y5CA 3IT4B 2WXPA 4WWNA 3NZUA 1UF0A 1XCTL 3NVYA 2MRPA 1C4CA 4BKTA 1TY2A 1WZ0A 2L1AA 2ZJDA 3EFUA 2N1VA 5HHDG 2K8HA 2V9HA 2FCQA 3R2TA 1V8CA 4KZCA 1FNWA 1TY0A 4W9KA 2G45B 1GNUA 3LXFA 2LEKA 3EA6A 2FBWB 4WAFA 2WLBA 4YT0B 3EHVA 2WDTB 4URKA 4DWFA 3FILB 1VCBA 4A8XC 1VRAB 2LMCA 2JRHA 2D11A 5G2NA 2KJRA 1Z2MA 4YTMB 1QOGA 1SE4A 4S0RA 3OJ3A 3W1SA 3V05A 1QT9A 2JY6A 3NVWA 1ZDVA 4XGAB 4B0EA 4OZCA 1YX5B 3BYYB 3U7DA 3L54A 2DZIA 3VTUA 5DPSA 1WM3A 4HJGE 4LDTD 3NOBA 1MJDA 1NEKB 2KLCA 2C9WB 3RZFA 1T3QA 2DBYA 3H7SA 4US8A 4OVUA 2BQQA 2FAZA 1JWSD 2KTRB 2D10A 2YLMA 4IWQA 2I2YA 5E6PA 2FNJB 3UF8A 1WR6E 3LYYA 1R4NB 1QF6A 2XNAC 4USAA 4NJ6A 3ENEA 2IDYA 2LHEA 2EMSA 4G11A 1BT0A 2BKFA 5TR5A 3ZLZA 4Q2JA 1PDXA 1EU4A 2IJ0A 1GC6A 4A6QA 3E9SA 1L2NA 5E6NA 2MWSB 1WZ3A 2FUHB 3L16A 4NJ7A 3NUHB 1V2YA 1C4AA 5AZGA 5DPRA 3AE1B 1NI3A 3HK0A 4NQLB 3Q3NC 1WM2A 1Q0WB 2SEBD 4XDDA 3PZ8A 4DHJB 1S1QB 3KQ4A 2D3AA 3WA0A 1TKEA 4AS1A 2QILA 1TTNA 3TUOA 1VZ7A 2IBIB 2KJ6A 2BW2A 3VRBB 4IM0A 2J52A 1JWUD 2DLBA 3P42A 2KHWB 4HWIB 1QQRA 4TQ0A 4NNJB 4GGQA 3ZTCA 1XD3B 3NZSA 4W9HA 5C1ZA 1TS2A 1HTOA 2QEJC 4LK0M 1D6EC 3AU5A 2MP2B 5HKHA 5BMGA 2NBWB 1I4RA 1I4GA 4GXBA 2BBCA 2LVPA 3B2FA 2W3SA 2NR2A 3NRZA 4MM3B 3HRDD 2KTRA 2PLPA 2LJIA 3PZDA 2DWQA 1ENFA 4K81A 3PSEB 3VTWA 2PPHA 4NPNA 4NZLB 4C56C 3SR6A 4R3DA 2KWCA 4GMVA 3AEEB 2RMMA 5JZEB 1OQRA 1YQ3B 2KMAA 5EE1A 1DOYA 4OZBA 3ZJUA 1EUVB 2V3SA 3KUDB 2LRWA 1PGXA 1R4MI 3ML9A 2CHXA 2DZMA 3DBLB 3BZDB 4B0MA 2MJ3A 3N9YC 2WU5B 3RD2A 4GLSC 1YNTE 2Y3AA 5AUKA 3MHZA 4GN1A 5LLIA 2K5PA 3PS6A 2N4FA 2DZJA 2OHFA 4HDOA 4K1RB 4DK5A 1LXDA 2DYBA 1JMLA 2QMTA 4HCNB 1AN8A 4TKNA 3P4SB 3DHIC 1V86A 3PGEA 2KD0A 3A9KB 2INDC 2R2OA 4FJZA 2L83A 2DZKA 2KAJA 1ZXIA 2AL3A 2MBBB 3H9DA 4EUTA 1P9DU 3CWIA 3MP9A 4PS3A 2CS4A 3A9JB 3KWVA 2JWUA 1PQSA 4I6LB 2CHZA 2MEKA 3ZRCA 2PMVA 4MM3A 2KQ7A 1TYGB 2WYQA 2EELA 1DOIA 2J4XA 1BUIC 4AJWA 1Q1OA 4M8MA 2OJRA 3ZNGC 1FMAD 1WMHA 1UWXA 4KZ0A 1UH6A 4HJKA 2HJ1A 3SU8X 1C9FA 1T0YA 2RSUA 2NBVB 2G3QB 3GB1A 1P0RA 1C77A 2W3RA 4II3B 2K6QA 3N1XC 2N7DA 1ZPSA 1OEYA 1H8CA 3BVGA 1C1YB 2LGIA 1E7UA 1QOBA 2EMTA 1GAQB 2M19A 4B6WA 4RF0A 4C7YA 4L23A 4FADA 1UZXB 4HXDA 2BYTA 1WH3A 2NMQA 4I6NB 2D5GA 3PHXB 4YSXB 3VXWA 4HLEA 3SD5A 1IBXB 4C4VB 4EKUA 5H92C 3BVZA 4YSYB 3Q3FA 2J0MA 4ICUA 2RDHA 1JWMD 3T3NA 2O6VA 2N1WA 5FK9C 2WXHA 3RNGC 2MJDA 3A9KA 5BO4B 1R4MB 1AYFA 2KANA 5IP4D 3BIID 3AE6B 4ZRQA 3Q3JA 1V1OA 3PLUA 1G6JA 1TS4A 2PIAA 4BOZB 3EECA 2MH7A 3LJ3A 3A9JA 3MC8A 2KLGA 3ECIA 1GB1A 4WQMA 1E8YA 2V0GA 2REXA 4NAWB 4PK1A 3DBHI 4J6IA 3KUZA 2Y5PA 1YJIA 4I6PA 3IVFA 4HPMB 1N63A 1L4DB 3GZNB 3AE4B 4EZKA 1ROEA 1ISNA 1E7PB 1F52A 3DDCB 4TV3A 1N61A 1J0GA 3P4QB 4QAYA 2AEHA 1F0ZA 5IO9A 2JT4B 1MFWA 4GOCA 3JVZX 2MJEA 3CF6E 3I5JC 3U2SC 3EUB2 3AEDB 3H6NA 2OOBB 1FCLA 4MEMA 5BMIA 1K53A 4X57B 1ZXHA 2H88B 2O2VB 2GOWA 1CMXB 1JWBD 3V60A 3PTFC 3DWMA 3R66C 1VJKA 4GIVA 3NY5A 5CHFA 4C4VA 2QIEB 1SF0A 1J19A 1VZ8A 3N20C 2LRUA 4IKGA 3VDZA 1H4RA 2LJ5A 3ZJTA 1PFDA 2WNMA 1XLNA 3KYDD 2L8JA 3SDLC 2GLSA 2JU6X 2R61A 3A33B 1WFYA 2M17A 4LLGM 1WXMA 5LXIB 1WR1A 2WXFA 2LGYA 4KDIC 4ASWC 2SAKA 1I4HA 3GE8C 4LDTB 5LNK1 3W1SC 4HK2A 3WAOA 2ZNVB 3JSVB 3CIRB 2GBRA 3CSTA 1CZPA 2WGSA 3ZTDA 1FFVA 4A3PA 4HPPA 4LNIA 1NYRA 3R3MA 2MHJA 4HKQA 2D3BA 4WWPA 2BPSA 2QSDA 2KQ4X 2JZPA 3RZWC 1YD8U 4OVZA 3T9LA 2C5LC 3IAS1 4IG7B 4FN2A 1P1AA 3QCAA 5AZFA 1QLBB 3DCGA 3GE3C 4LTUA 1X1MA 2KK8A 1D5XC 3NG0A 4E71A 3KVFB 2DHZA 4BOSC 3RUIB 2K9XA 1FNVA 1VZ6A 1WYGA 3I63C 2UWQA 5FR6A 1K52A 4E3CA 4DXGA 2WXKA 3TSSA 1GC7A 4M0WB 4W9FA 4B9KA 1AWDA 2D3GA 2GB1A 3MJWA 4MGYE 3U8ZA 1V5OA 4ZRIA 1OGWA 4YTPB 4FXCA 3WAPA 1C78A 4RGOS 5D3IB 3UIOB 3BVMA 1MHXA 1Y8RC 1ESFA 5L83A 4GDLB 2MBHA 2BS4B 3KW5B 1QOFA 2CKHB 5EE3A 4CO7A 2VH1A 3PPAA 1J7CA 3WAMA 3ZXVA 2NTSA 5BMHA 2TSSA 4ANVA 4RGTA 2IGHA 1D4BA 2BS3B 2FCMA 4DHZB 3U4EG 2BT6A 5GMVA 4W9LA 2NPTB 4ZYNA 4KX6B 1MVKA 3V6CB 1OQYA 1WGYA 4MSMB 3NVVA 2AQ3B 2J42A 3Q8AA 3PVLA 4CYEA 3IXSA 2IZVB 1YQ4B 1E90A 2CJOA 2GBJA 2DAJA 3NS8A 1F2RC 1UGMA 4ITKA 4FHJA 4JLCA 3NHEB 3AE2B 3HIZA 2RR9A 3MC9A 1T6BX 4A20A 1AARA 1KLGD 3Q69A 1TKYA 4KIKB 2JZZA 4ZOHC 3U30A 4JWUC 3RI7C 3ML8A 3QA8A 1YMHE 3DOWA 2PJHA 5MPOA 5LXHA 2WXNA 4IWOA 2HDEA 4M0WA 2C7MB 4ICVA 2PEAA 4FULA 1A70A 1T0RC 1WGKA 2BF8B 3O13A 3DBRI 1P98A 2NVUI 1FCCC 2G4DB 1WRDB 1ZDXA 1JCKB 3QARA 4IW0A 3NJTA 3RNBC 5C3JB 1PUTA 1EWYC 4RH6A 2W9NA 4JPSA 4GDLA 2KC1A 1L6VA 4RM8A 3AE7B 3ALBA 4PS8A 1WSPA 5G55A 2OEDA 1N5WA 2CJNA 3AU4A 4HEA1 3AEGB 3L10B 1KM7A 5D3DA 3MJ5A 1B9RA 3Q2AC 4PYUA 2L05A 3ZYYX 2NPTA 1RLFA 2ZPYA 5BYQA 1GB4A 4PYZA 1WGGA 5EE9A 4IM3A 3DHGC 1HEZE 3M63B 4BFRA 1K50A 3HVZA 1EO6A 4EEWA 2EKIA 4IOIE 2VRRB 2LGXA 4KGRA 1LGRA 4MSQB 4EFOA 2ASQA 4BKGA 3UINB 4N59A 2LI5A 2RDBC 3FILA 3ZRFA 2KXJA 4BVUC 1BMLC 2ZZPB 1NDDA 2WHIA 1T0SC 1L0YB 2INNE 3ZJVA 1V80A 2JF5A 2ZEQA 2NBUA 1XLOA 3CMMB 1SE3A 3OAWA 4ANXA 2KQSA 3OG5A 2BTEA 3DVNU 4P7IA 3PREA 2DYOA 2RPVA 4RGMA 5HG2A 1WJ4A 4TUUA 5CHVC 5AUIA 2KN4A 2WXQA 4MDKE 1LM8B 2DAFA 4BAXA 2ZCBA 1TIFA 3RN9C 4JE3B 3RFZB 1PYWD 3AEAB 2KWUB 2V3PA 2W82A 1MI0A 2DYMA 4BBNF 3M62B 2ICIA 3R7RA 3P63A 1YN4A 5G5GA 1P3QU 1EF5A 4JWSC 1FNUA 3KLSX 3Q8FA 2VH2A 3E56A 2IPKD 5G5HA 2K25A 2KJHB 2MA9B 4W9DA 1XO3A 4K3BA 1E8XA 3KUCB 2KYWA 2M56B 2ZW1A 3PHWB 4HCPB 3VVWB 2IO0B 1D5MC 1QILA 4ACFA 4FA6A 1L6UA 2WXRA 4II2B 4FJVB 4HKZE 3PRPB 1KJTA 2JUOA 2ACZB 2VZKB 4RCOA 2AL6A 3URYA 3KYCD 1LQBA 1V1PB 2N9LA 2M0XA 2MSED 2LZ6A 3DVNV 2L0TA 2UYZB 4A9AA 5E6OA 2M4NA 3NS1A 1SJHD 2FIDA 1F1HA 3UQAA 4AWJA 3QC8B 3AH7A 3AEBB 3RNEC 2E3TA 3QQ8B 2MP2A 2HE7A 3H7PB 3ZXRA 2L00B 3ZNID 3APCA 2ZCCA 3FKYA 3VUYA 4J3OD 1D3ZA 1NENB 3PV1A 4ZHPA 1RFAA 2IGGA 3ETRA 4RNAA 1I35A 1IUEA 1JRPA 2X38A 1NBFC 4F8CB 1FIQA 2BKRB 4H2AA 3W1YA 1HZ6A 2IO2B 4ZDVA 5HI1A 3IT6B 4MGIE 1YJ1A 2WU2B 4ZHOA 2K3UA 4LJOB 3GOEA 4LNOA 3ZIMA 4AP4C 4KSLC 1RYJA 5E6JA 5TSSA 3JYUA 3Q6BA 3S2AA 1STEA 3VR8B 4BKSD 1XXGA 3A4RA 4FLHA 3OLMD 1L7YA 2KO3A 2WQYB 5KHQA 1NYQA 2C60A 4WIPA 1KFYB 3Q3OC 4MH8A 1EU3A 3DWGC 1IGDA 4WJNA 1C76A 2KWVB 4HPLB 4EOYA 1N6ZA 4JGHB 3B1LX 4GB9A 2KKCA 4OW0A 2LHDA 4TQ1A 4N6EB 2A4ZA 1E5WA 4M8NA 1WGDA 2FUG1 4JX1C 2FE8A 4DDGD 3GS2A 1V9JA 3W5VB 3D32A 4K7SA 1GPXA 1C79A 4ANUA 3IAM1 4LJPB 1MG4A 4E74A 1KF6B 1WY8A 1KH0A 3IG3A
chains in the Genus database with same CATH topology
2KLCA 2M1MA 4E71A 2QHOA 2C9WB 3VH3B 3KVFB 4KVGB 2DHZA 3RZFA 4MELA 4BOSC 3RUIB 1WXSA 2J0JA 4BKSA 4OVVA 1VD2A 1LFDA 3H7SA 4IWPA 2LWPA 4OVUA 3VQIA 2FAZA 2UWQA 5FR6A 4E3CA 2KTRB 2D10A 2LD9A 2YLMA 2GMIC 1GC7A 2WX1A 3WANA 1K8RB 2MQJA 2RPQA 4IWQA 4M0WB 4W9FA 3APFA 5E6PA 4A3OA 4B9KA 2FNJB 2WX0A 2D3GA 5JHAA 4JIOU 3UF8A 4EZJA 1YQBA 2ZVNA 3QK0A 1WR6E 3MJWA 4BBNC 4MGYE 1WE6A 3K9PB 1NI2A 3U8ZA 4NJ6A 3ENEA 1V5OA 4ZRIA 1OGWA 3WAPA 2EMSA 4G11A 3R7QA 4CHKA 1BT0A 2BKFA 5TR5A 3TL5A 3ZLZA 1M94A 2CR5A 2O6VB 3UIOB 3ONSA 1Y8RC 5L83A 3UGBB 4GDLB 1GC6A 3C0RB 2D07B 2KFKB 3GZNI 3L17A 3O65B 4EZLA 1L2NA 2MBHA 1V81A 4DBGA 4GSWA 2MWSB 3KW5B 5E6NA 1WZ3A 2FUHB 3L16A 2CKHB 3X23A 4CO7A 2LVQA 4NJ7A 1IP9A 1V2YA 3PPAA 2AWTA 3WAMA 5AZGA 5DPRA 3HK0A 3UQBA 4ANVA 4NQLB 3VH4B 1WM2A 1Q0WB 2ZNVC 4RM9A 3ZDMC 2FCMA 4DHZB 3ZDTA 5GMVA 3TJPA 1UBIA 4W9LA 4DHJB 1S1QB 1XQQA 1MG8A 2NPTB 4ZYNA 3KH0A 1WF9A 3V6CB 1E8ZA 1OQYA 4MGKE 1WGYA 4MSMB 3WA0A 2LGDA 2BGFA 2BWFA 3PVLA 2BYFA 4CYEA 1TTNA 2IBIB 2IZVB 2KJ6A 1E90A 2LASA 2GBJA 2DAJA 2MBEA 2MBOA 5JH5C 4IM0A 2L7RA 3NS8A 4KSKC 4IM2A 2KC2A 2XK5B 4GU2A 1UGMA 2KHWB 3K9OB 4K7WA 4HWIB 4FHJA 4JLCA 3NHEB 5J18A 1E7VA 3HIZA 4TQ0A 4NNJB 2RR9A 2KMCA 2JRIB 2Z0EB 4GGQA 2JPHA 3VTVA 3ZTCA 4A20A 5JHBA 1V6EA 1WGHA 1XD3B 3NZSA 4W9HA 5C1ZA 2DENB 1AARA 4KIKB 2JZZA 4IC7B 3AU5A 2MP2B 4DHJD 2K8CA 5EDSA 5HKHA 2WWZA 3U30A 5J17A 2KOXA 3APDA 2KX3A 3QX1A 4FHKA 4LCDE 2NBWB 4HVBA 4GXBA 3ML8A 3QA8A 1QZEA 2MLBA 1S3SG 2LVPA 1KOTA 1IPGA 2NR2A 3N30A 3DOWA 3A4SC 3MTNB 4NAWA 2PJHA 2KTRA 3B0AA 5LXHA 2K6DB 2FIFA 4IWOA 3PZDA 1XT9B 3IHPC 4AJYB 2C7MB 2IY0B 3PSEB 4ICVA 4K81A 4KDLB 2PEAA 4FULA 3VTWA 2PPHA 4NPNA 3QJZA 2KWCA 4G0NB 4GMVA 2BF8B 3DBRI 1P98A 3PRZA 5JZEB 2NVUI 2M8SA 3RYTA 3EC8A 4IUMB 2KMAA 3ZO5B 2KDIA 2G4DB 1GUAB 1WRDB 1OTRB 1WJ6A 3QARA 2AYOB 4IW0A 1TZ1A 3QIJA 2IO3B 2ZPNA 4RMAA 1EUVB 5IAAC 3M3JA 2GBMA 2V3SA 2W9NA 1WXVA 3KUDB 2LRWA 3H7PA 3QWZB 4NQKE 4AOFA 4GDLA 2KC1A 1ZKHA 2KFKA 1R4MI 3ML9A 2CHXA 4RM8A 2DZMA 2HD5B 3M95A 1WE7A 3B08A 3ALBA 4PS8A 5IA7A 5G55A 4WJPA 3RD2A 3VUWA 1OEYJ 2K39A 5DPTA 3AU4A 4W9JA 3L10B 1KM7A 4GN1A 5LLIA 1I42A 5CX3A 4F7ZA 3PS6A 2N4FA 4KV2A 2O2VA 2DZJA 4PYUA 2L05A 4PS7A 2NPTA 1RLFA 4DHZE 4HDOA 4K1RB 2ZPYA 4DK5A 2NS5A 4F1SA 4PYZA 1LXDA 1WGGA 2IY1B 2DYBA 4IM3A 1WGRA 3T8MA 3CSFA 2MBQA 3M63B 4BFRA 1EO6A 1RRBA 2BYEA 4K7UA 4EEWA 2XEWA 2ZVOA 4HCNB 4TKNA 4DXAB 1WXAA 2Z59B 1HE8A 1V86A 2KD0A 2KNBA 2KX0A 3A9KB 2XK5A 3PGEA 2VRRB 2K8BA 2R2OA 2LGXA 2G4SA 4FJZA 4HDQA 4W9IA 4XZ4A 4MSQB 4EFOA 2ASQA 4BKGA 3UINB 3AXCA 2FCNA 2MCNB 2KZRA 1J8CA 1WX7A 2LI5A 2DZKA 2AL3A 2MBBB 3H9DA 3ZRFA 4EUTA 2KXJA 2JZ3B 4BVUC 2ZZPB 1NDDA 1P9DU 3QAQA 4WWOA 4PS3A 1V80A 1WI0A 2LUEA 2CS4A 2JF5A 2ZEQA 2J0KA 2NBUA 3A9JB 3SHQA 3JSVA 3L08A 1PQSA 3TMPB 4I6LB 1Z5SB 2CHZA 3CMMB 4W9CA 1A5RA 3ZRCA 4WAAA 3OAWA 4MM3A 4ANXA 2KQ7A 2L3ZA 2KQSA 2O6VD 2KDFB 3DVGY 1GG3A 2WYQA 3DVNU 3PREA 1FXTB 4P7IA 1YX6B 2I1KA 4WJOA 2DYOA 3UIPB 2K1FA 4AJWA 1Q1OA 3RT3B 2KFJA 3TBLD 3ZNHB 1WJ4A 4M8MA 2OJRA 4TUUA 3ZNGC 5CHVC 1WMHA 3PRMB 2BYVE 4KZ0A 1UH6A 2NCNA 3HHMA 1GJZA 3RCZA 4HJKA 1SIFA 1LM8B 4MDKE 1V49A 2DAFA 3SU8X 1Q5WB 1T0YA 2RSUA 2KDBA 2NBVB 2ZCBA 1EF1A 2G3QB 1P0RA 3V62A 2GBKA 4II3B 2K6QA 3OJ4B 3VAWA 2N7DA 3ZW3A 1OEYA 1H8CA 2A5UA 2KWUB 2KVRA 5AZHA 5L95C 1ZW7A 2KTFA 2GBNA 5D94A 2DYMA 2V1YA 1C1YB 1E7UA 4BBNF 1C3TA 3M62B 2EMTA 1SGHA 3N32A 3R7RA 3QHTA 2LVOA 4B6WA 4FADA 2B3AA 1UZXB 3BY4B 2HTHA 2N9XA 4N9F4 1P3QU 3HM3A 4HXDA 4AUQC 1EF5A 3ZNZB 1WH3A 4I6NB 3PHXB 3PT2B 5DPWA 1F9JA 5DCNA 3VXWA 4HLEA 3SD5A 4DDID 1E8WA 2PE9A 3PLVA 2IO1B 3IBEA 2CU1A 4EKUA 3Q3FA 5CTRC 2J0MA 1TBEA 5AEKB 4ICUA 3ZKJC 2K25A 2O6VA 2PE6B 5CHWA 2N1WA 2KJHB 2MA9B 2J7QB 4W9DA 3A9KA 3BINA 5BO4B 1E8XA 1WJNA 1UBQA 2Z0DB 3KUCB 3RULA 4ZRJA 2KANA 2JVCA 4WQOB 2RGFA 1WX9A 3Q3JA 1ZGUB 3TCAA 3VFKA 3A1QB 3PHWB 3PLUA 3VHTC 4HCPB 1TGZB 1G6JA 3VVWB 2KDEB 2IO0B 4G3XB 2RD0A 4FA6A 4BOZB 3EECA 4II2B 2IYDB 3WIMA 3I3TB 1RAXA 4FJYA 3H1UA 4FJVB 4NY0A 3LJ3A 3PRPB 3V61A 3ZUNA 1KJTA 2JUOA 3A9JA 5C23A 2LXAA 1V5TA 5D6JB 2MW5A 3DBLI 2KLGA 3ECIA 4GDKB 1E8YA 1YIWA 1UELA 2CHWA 1JRUA 2REXA 2D2QA 4NAWB 2R2QA 1IYFA 3DBHI 4J6IA 2AL6A 3KUZA 3DVGX 1SE9A 3LDZE 3KYCD 1LQBA 3IVFA 4I6PA 4HPMB 3AULA 4FBJB 4MJSB 4EZKA 4YL8A 2M0XA 2MSED 1ISNA 2LZ6A 4ANWA 3DVNV 2L0TA 2UYZB 4G50A 4JQWC 5E6OA 1R4NI 3DDCB 2M4NA 1WYWB 4TV3A 2N7EA 2FIDA 2Y5BB 3UQAA 2I1JA 4AWJA 4MH0E 1J0GA 3QC8B 3VUXA 3X0WA 2N9EB 4KIKA 3QQ8B 2EKEC 2MP2A 2HE7A 3H7PB 1KLVA 2AEHA 2C7NB 1WX8A 2JT4B 2L00B 5D7GA 3DQVA 4GOCA 3DBSA 3ZNID 3APCA 3AI5A 2ZCCA 3JVZX 4ZRKA 3CF6E 2XBBC 3VUYA 4JL9A 1D3ZA 3PV1A 2KN5A 3H6NA 2OOBB 4MGZE 4W9GA 1WJUA 2N9PC 1RFAA 2V4LA 1I35A 4WWNA 4MEMA 3NZUA 4F8CB 1NBFC 5J2RA 2FCSA 2BKRB 3W1YA 2MRPA 4W9EA 5D2MB 2IO2B 4X57B 4ZDVA 4BKTA 2O2VB 2GOWA 4XX5A 1CMXB 4MGIE 1YJ1A 3V60A 2MX2A 3MHSD 3V6EB 1WZ0A 3L13A 3PTFC 2ZJDA 3EFUA 2N1VA 4LJOB 3GOEA 3R66C 4GIVA 5CHFA 2K8HA 3NY5A 2FCQA 3ZIMA 4KZCA 1J19A 4AP4C 4KSLC 3WALA 4W9KA 2G45B 1GNUA 2LRUA 3JYUA 3VDZA 3S2AA 1H4RA 2LJ5A 4BKSD 3KYDD 4XC2A 3ZVVA 3A4RA 2L8JA 3SDLC 3EHVA 2WDTB 4FLHA 3OLMD 1L7YA 1WFYA 2KO3A 2M17A 3A33B 1WXMA 3A1QA 4URKA 5LXIB 1WR1A 5KHQA 2LGYA 4DWFA 4KDIC 1U4AA 5KHOA 4ASWC 2C60A 1VCBA 4LDTB 2DX5B 3JW0X 2JRHA 2D11A 1UD7A 2L76A 3W1SC 5G2NA 2KJRA 3HM6X 1Z2MA 2LXCA 4HK2A 4WJNA 3WAOA 2ZNVB 2JXXA 3P2BA 3JSVB 2KWVB 4GDKA 4HPLB 4EOYA 2GBRA 3CSTA 2YVCA 3B1LX 3OJ3A 4JGHB 3N3KB 4GB9A 3W1SA 2KKCA 3ZTDA 2BWES 4A3PA 3R3MA 4TQ1A 2L0FA 2JY6A 2A4ZA 1E5WA 4M8NA 4MJSA 4WWPA 3L0WB 1WGDA 2BPSA 3DPDA 1WMHB 4B95A 1WIAA 4WJQA 3RZWC 1YD8U 1YX5B 4DDGD 1V9JA 3T9LA 3D32A 2C5LC 4K7SA 3U7DA 4ANUA 2C7HA 2JWZA 4IG7B 4FN2A 3L54A 4LJPB 1P1AA 3TIXA 4E74A 3QCAA 2DZIA 3VTUA 3IFWB 5AZFA 5DPSA 1WM3A 3DCGA 4LDTD 3NOBA 1X1MA 2KK8A 1WY8A 2HJ8A 3IG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLC A;  2M1M A;  4E71 A;  2QHO A;  2C9W B;  3VH3 B;  3KVF B;  4KVG B;  2DHZ A;  3RZF A;  4MEL A;  4BOS C;  3RUI B;  1WXS A;  2J0J A;  4BKS A;  4OVV A;  1VD2 A;  1LFD A;  3H7S A;  4IWP A;  2LWP A;  4OVU A;  3VQI A;  2FAZ A;  2UWQ A;  5FR6 A;  4E3C A;  2KTR B;  2D10 A;  2LD9 A;  2YLM A;  2GMI C;  1GC7 A;  2WX1 A;  3WAN A;  1K8R B;  2MQJ A;  2RPQ A;  4IWQ A;  4M0W B;  4W9F A;  3APF A;  5E6P A;  4A3O A;  4B9K A;  2FNJ B;  2WX0 A;  2D3G A;  5JHA A;  4JIO U;  3UF8 A;  4EZJ A;  1YQB A;  2ZVN A;  3QK0 A;  1WR6 E;  3MJW A;  4BBN C;  4MGY E;  1WE6 A;  3K9P B;  1NI2 A;  3U8Z A;  4NJ6 A;  3ENE A;  1V5O A;  4ZRI A;  1OGW A;  3WAP A;  2EMS A;  4G11 A;  3R7Q A;  4CHK A;  1BT0 A;  2BKF A;  5TR5 A;  3TL5 A;  3ZLZ A;  1M94 A;  2CR5 A;  2O6V B;  3UIO B;  3ONS A;  1Y8R C;  5L83 A;  3UGB B;  4GDL B;  1GC6 A;  3C0R B;  2D07 B;  2KFK B;  3GZN I;  3L17 A;  3O65 B;  4EZL A;  1L2N A;  2MBH A;  1V81 A;  4DBG A;  4GSW A;  2MWS B;  3KW5 B;  5E6N A;  1WZ3 A;  2FUH B;  3L16 A;  2CKH B;  3X23 A;  4CO7 A;  2LVQ A;  4NJ7 A;  1IP9 A;  1V2Y A;  3PPA A;  2AWT A;  3WAM A;  5AZG A;  5DPR A;  3HK0 A;  3UQB A;  4ANV A;  4NQL B;  3VH4 B;  1WM2 A;  1Q0W B;  2ZNV C;  4RM9 A;  3ZDM C;  2FCM A;  4DHZ B;  3ZDT A;  5GMV A;  3TJP A;  1UBI A;  4W9L A;  4DHJ B;  1S1Q B;  1XQQ A;  1MG8 A;  2NPT B;  4ZYN A;  3KH0 A;  1WF9 A;  3V6C B;  1E8Z A;  1OQY A;  4MGK E;  1WGY A;  4MSM B;  3WA0 A;  2LGD A;  2BGF A;  2BWF A;  3PVL A;  2BYF A;  4CYE A;  1TTN A;  2IBI B;  2IZV B;  2KJ6 A;  1E90 A;  2LAS A;  2GBJ A;  2DAJ A;  2MBE A;  2MBO A;  5JH5 C;  4IM0 A;  2L7R A;  3NS8 A;  4KSK C;  4IM2 A;  2KC2 A;  2XK5 B;  4GU2 A;  1UGM A;  2KHW B;  3K9O B;  4K7W A;  4HWI B;  4FHJ A;  4JLC A;  3NHE B;  5J18 A;  1E7V A;  3HIZ A;  4TQ0 A;  4NNJ B;  2RR9 A;  2KMC A;  2JRI B;  2Z0E B;  4GGQ A;  2JPH A;  3VTV A;  3ZTC A;  4A20 A;  5JHB A;  1V6E A;  1WGH A;  1XD3 B;  3NZS A;  4W9H A;  5C1Z A;  2DEN B;  1AAR A;  4KIK B;  2JZZ A;  4IC7 B;  3AU5 A;  2MP2 B;  4DHJ D;  2K8C A;  5EDS A;  5HKH A;  2WWZ A;  3U30 A;  5J17 A;  2KOX A;  3APD A;  2KX3 A;  3QX1 A;  4FHK A;  4LCD E;  2NBW B;  4HVB A;  4GXB A;  3ML8 A;  3QA8 A;  1QZE A;  2MLB A;  1S3S G;  2LVP A;  1KOT A;  1IPG A;  2NR2 A;  3N30 A;  3DOW A;  3A4S C;  3MTN B;  4NAW A;  2PJH A;  2KTR A;  3B0A A;  5LXH A;  2K6D B;  2FIF A;  4IWO A;  3PZD A;  1XT9 B;  3IHP C;  4AJY B;  2C7M B;  2IY0 B;  3PSE B;  4ICV A;  4K81 A;  4KDL B;  2PEA A;  4FUL A;  3VTW A;  2PPH A;  4NPN A;  3QJZ A;  2KWC A;  4G0N B;  4GMV A;  2BF8 B;  3DBR I;  1P98 A;  3PRZ A;  5JZE B;  2NVU I;  2M8S A;  3RYT A;  3EC8 A;  4IUM B;  2KMA A;  3ZO5 B;  2KDI A;  2G4D B;  1GUA B;  1WRD B;  1OTR B;  1WJ6 A;  3QAR A;  2AYO B;  4IW0 A;  1TZ1 A;  3QIJ A;  2IO3 B;  2ZPN A;  4RMA A;  1EUV B;  5IAA C;  3M3J A;  2GBM A;  2V3S A;  2W9N A;  1WXV A;  3KUD B;  2LRW A;  3H7P A;  3QWZ B;  4NQK E;  4AOF A;  4GDL A;  2KC1 A;  1ZKH A;  2KFK A;  1R4M I;  3ML9 A;  2CHX A;  4RM8 A;  2DZM A;  2HD5 B;  3M95 A;  1WE7 A;  3B08 A;  3ALB A;  4PS8 A;  5IA7 A;  5G55 A;  4WJP A;  3RD2 A;  3VUW A;  1OEY J;  2K39 A;  5DPT A;  3AU4 A;  4W9J A;  3L10 B;  1KM7 A;  4GN1 A;  5LLI A;  1I42 A;  5CX3 A;  4F7Z A;  3PS6 A;  2N4F A;  4KV2 A;  2O2V A;  2DZJ A;  4PYU A;  2L05 A;  4PS7 A;  2NPT A;  1RLF A;  4DHZ E;  4HDO A;  4K1R B;  2ZPY A;  4DK5 A;  2NS5 A;  4F1S A;  4PYZ A;  1LXD A;  1WGG A;  2IY1 B;  2DYB A;  4IM3 A;  1WGR A;  3T8M A;  3CSF A;  2MBQ A;  3M63 B;  4BFR A;  1EO6 A;  1RRB A;  2BYE A;  4K7U A;  4EEW A;  2XEW A;  2ZVO A;  4HCN B;  4TKN A;  4DXA B;  1WXA A;  2Z59 B;  1HE8 A;  1V86 A;  2KD0 A;  2KNB A;  2KX0 A;  3A9K B;  2XK5 A;  3PGE A;  2VRR B;  2K8B A;  2R2O A;  2LGX A;  2G4S A;  4FJZ A;  4HDQ A;  4W9I A;  4XZ4 A;  4MSQ B;  4EFO A;  2ASQ A;  4BKG A;  3UIN B;  3AXC A;  2FCN A;  2MCN B;  2KZR A;  1J8C A;  1WX7 A;  2LI5 A;  2DZK A;  2AL3 A;  2MBB B;  3H9D A;  3ZRF A;  4EUT A;  2KXJ A;  2JZ3 B;  4BVU C;  2ZZP B;  1NDD A;  1P9D U;  3QAQ A;  4WWO A;  4PS3 A;  1V80 A;  1WI0 A;  2LUE A;  2CS4 A;  2JF5 A;  2ZEQ A;  2J0K A;  2NBU A;  3A9J B;  3SHQ A;  3JSV A;  3L08 A;  1PQS A;  3TMP B;  4I6L B;  1Z5S B;  2CHZ A;  3CMM B;  4W9C A;  1A5R A;  3ZRC A;  4WAA A;  3OAW A;  4MM3 A;  4ANX A;  2KQ7 A;  2L3Z A;  2KQS A;  2O6V D;  2KDF B;  3DVG Y;  1GG3 A;  2WYQ A;  3DVN U;  3PRE A;  1FXT B;  4P7I A;  1YX6 B;  2I1K A;  4WJO A;  2DYO A;  3UIP B;  2K1F A;  4AJW A;  1Q1O A;  3RT3 B;  2KFJ A;  3TBL D;  3ZNH B;  1WJ4 A;  4M8M A;  2OJR A;  4TUU A;  3ZNG C;  5CHV C;  1WMH A;  3PRM B;  2BYV E;  4KZ0 A;  1UH6 A;  2NCN A;  3HHM A;  1GJZ A;  3RCZ A;  4HJK A;  1SIF A;  1LM8 B;  4MDK E;  1V49 A;  2DAF A;  3SU8 X;  1Q5W B;  1T0Y A;  2RSU A;  2KDB A;  2NBV B;  2ZCB A;  1EF1 A;  2G3Q B;  1P0R A;  3V62 A;  2GBK A;  4II3 B;  2K6Q A;  3OJ4 B;  3VAW A;  2N7D A;  3ZW3 A;  1OEY A;  1H8C A;  2A5U A;  2KWU B;  2KVR A;  5AZH A;  5L95 C;  1ZW7 A;  2KTF A;  2GBN A;  5D94 A;  2DYM A;  2V1Y A;  1C1Y B;  1E7U A;  4BBN F;  1C3T A;  3M62 B;  2EMT A;  1SGH A;  3N32 A;  3R7R A;  3QHT A;  2LVO A;  4B6W A;  4FAD A;  2B3A A;  1UZX B;  3BY4 B;  2HTH A;  2N9X A;  4N9F 4;  1P3Q U;  3HM3 A;  4HXD A;  4AUQ C;  1EF5 A;  3ZNZ B;  1WH3 A;  4I6N B;  3PHX B;  3PT2 B;  5DPW A;  1F9J A;  5DCN A;  3VXW A;  4HLE A;  3SD5 A;  4DDI D;  1E8W A;  2PE9 A;  3PLV A;  2IO1 B;  3IBE A;  2CU1 A;  4EKU A;  3Q3F A;  5CTR C;  2J0M A;  1TBE A;  5AEK B;  4ICU A;  3ZKJ C;  2K25 A;  2O6V A;  2PE6 B;  5CHW A;  2N1W A;  2KJH B;  2MA9 B;  2J7Q B;  4W9D A;  3A9K A;  3BIN A;  5BO4 B;  1E8X A;  1WJN A;  1UBQ A;  2Z0D B;  3KUC B;  3RUL A;  4ZRJ A;  2KAN A;  2JVC A;  4WQO B;  2RGF A;  1WX9 A;  3Q3J A;  1ZGU B;  3TCA A;  3VFK A;  3A1Q B;  3PHW B;  3PLU A;  3VHT C;  4HCP B;  1TGZ B;  1G6J A;  3VVW B;  2KDE B;  2IO0 B;  4G3X B;  2RD0 A;  4FA6 A;  4BOZ B;  3EEC A;  4II2 B;  2IYD B;  3WIM A;  3I3T B;  1RAX A;  4FJY A;  3H1U A;  4FJV B;  4NY0 A;  3LJ3 A;  3PRP B;  3V61 A;  3ZUN A;  1KJT A;  2JUO A;  3A9J A;  5C23 A;  2LXA A;  1V5T A;  5D6J B;  2MW5 A;  3DBL I;  2KLG A;  3ECI A;  4GDK B;  1E8Y A;  1YIW A;  1UEL A;  2CHW A;  1JRU A;  2REX A;  2D2Q A;  4NAW B;  2R2Q A;  1IYF A;  3DBH I;  4J6I A;  2AL6 A;  3KUZ A;  3DVG X;  1SE9 A;  3LDZ E;  3KYC D;  1LQB A;  3IVF A;  4I6P A;  4HPM B;  3AUL A;  4FBJ B;  4MJS B;  4EZK A;  4YL8 A;  2M0X A;  2MSE D;  1ISN A;  2LZ6 A;  4ANW A;  3DVN V;  2L0T A;  2UYZ B;  4G50 A;  4JQW C;  5E6O A;  1R4N I;  3DDC B;  2M4N A;  1WYW B;  4TV3 A;  2N7E A;  2FID A;  2Y5B B;  3UQA A;  2I1J A;  4AWJ A;  4MH0 E;  1J0G A;  3QC8 B;  3VUX A;  3X0W A;  2N9E B;  4KIK A;  3QQ8 B;  2EKE C;  2MP2 A;  2HE7 A;  3H7P B;  1KLV A;  2AEH A;  2C7N B;  1WX8 A;  2JT4 B;  2L00 B;  5D7G A;  3DQV A;  4GOC A;  3DBS A;  3ZNI D;  3APC A;  3AI5 A;  2ZCC A;  3JVZ X;  4ZRK A;  3CF6 E;  2XBB C;  3VUY A;  4JL9 A;  1D3Z A;  3PV1 A;  2KN5 A;  3H6N A;  2OOB B;  4MGZ E;  4W9G A;  1WJU A;  2N9P C;  1RFA A;  2V4L A;  1I35 A;  4WWN A;  4MEM A;  3NZU A;  4F8C B;  1NBF C;  5J2R A;  2FCS A;  2BKR B;  3W1Y A;  2MRP A;  4W9E A;  5D2M B;  2IO2 B;  4X57 B;  4ZDV A;  4BKT A;  2O2V B;  2GOW A;  4XX5 A;  1CMX B;  4MGI E;  1YJ1 A;  3V60 A;  2MX2 A;  3MHS D;  3V6E B;  1WZ0 A;  3L13 A;  3PTF C;  2ZJD A;  3EFU A;  2N1V A;  4LJO B;  3GOE A;  3R66 C;  4GIV A;  5CHF A;  2K8H A;  3NY5 A;  2FCQ A;  3ZIM A;  4KZC A;  1J19 A;  4AP4 C;  4KSL C;  3WAL A;  4W9K A;  2G45 B;  1GNU A;  2LRU A;  3JYU A;  3VDZ A;  3S2A A;  1H4R A;  2LJ5 A;  4BKS D;  3KYD D;  4XC2 A;  3ZVV A;  3A4R A;  2L8J A;  3SDL C;  3EHV A;  2WDT B;  4FLH A;  3OLM D;  1L7Y A;  1WFY A;  2KO3 A;  2M17 A;  3A33 B;  1WXM A;  3A1Q A;  4URK A;  5LXI B;  1WR1 A;  5KHQ A;  2LGY A;  4DWF A;  4KDI C;  1U4A A;  5KHO A;  4ASW C;  2C60 A;  1VCB A;  4LDT B;  2DX5 B;  3JW0 X;  2JRH A;  2D11 A;  1UD7 A;  2L76 A;  3W1S C;  5G2N A;  2KJR A;  3HM6 X;  1Z2M A;  2LXC A;  4HK2 A;  4WJN A;  3WAO A;  2ZNV B;  2JXX A;  3P2B A;  3JSV B;  2KWV B;  4GDK A;  4HPL B;  4EOY A;  2GBR A;  3CST A;  2YVC A;  3B1L X;  3OJ3 A;  4JGH B;  3N3K B;  4GB9 A;  3W1S A;  2KKC A;  3ZTD A;  2BWE S;  4A3P A;  3R3M A;  4TQ1 A;  2L0F A;  2JY6 A;  2A4Z A;  1E5W A;  4M8N A;  4MJS A;  4WWP A;  3L0W B;  1WGD A;  2BPS A;  3DPD A;  1WMH B;  4B95 A;  1WIA A;  4WJQ A;  3RZW C;  1YD8 U;  1YX5 B;  4DDG D;  1V9J A;  3T9L A;  3D32 A;  2C5L C;  4K7S A;  3U7D A;  4ANU A;  2C7H A;  2JWZ A;  4IG7 B;  4FN2 A;  3L54 A;  4LJP B;  1P1A A;  3TIX A;  4E74 A;  3QCA A;  2DZI A;  3VTU A;  3IFW B;  5AZF A;  5DPS A;  1WM3 A;  3DCG A;  4LDT D;  3NOB A;  1X1M A;  2KK8 A;  1WY8 A;  2HJ8 A;  3IG3 A; 
#chains in the Genus database with same CATH topology
 4XWT A;  4K3C A;  1WXS A;  1XCQ L;  3AE8 B;  3W9C B;  1UWM A;  3N1Z C;  4TSS A;  2LWP A;  3VQI A;  1P7E A;  3BWU D;  2E6X A;  3WAN A;  3UI3 A;  1K8R B;  1TT5 B;  4A3O A;  1J7A A;  5JHA A;  1YN5 A;  4EZJ A;  1YQB A;  3QK0 A;  4TMA B;  1WE6 A;  2PTL A;  1NI2 A;  2NTT A;  1EWC A;  3R7Q A;  4CHK A;  4A55 A;  1M94 A;  2CR5 A;  1FXI A;  3UGB B;  1CQV A;  3C0R B;  2D07 B;  2KFK B;  3L17 A;  4EZL A;  1XEE A;  1V81 A;  2VZK D;  1WWT A;  4GSW A;  4IDI A;  2N0S B;  3T3O A;  4WWM A;  3X23 A;  2INP E;  1FM0 D;  3UQB A;  4YXD B;  2WXL A;  3VH4 B;  3TEY A;  2ZNV C;  4RM9 A;  3ZDT A;  1L4Z B;  3TJP A;  1MG8 A;  3KH0 A;  1WF9 A;  2CU3 A;  1E8Z A;  1IBX A;  2BGF A;  2QCZ A;  3BK1 A;  2BB5 A;  4LNF A;  1LO5 D;  2PVG C;  3BK2 A;  2MBE A;  2MBO A;  2L7R A;  4L1B A;  4KSK C;  4IM2 A;  4GU2 A;  3K9O B;  2V4I B;  1PGA A;  5J18 A;  1E7V A;  1MHH E;  2JRI B;  2KMC A;  5H8Y E;  2KVZ A;  1FD6 A;  2WXJ A;  1HXY D;  5JHB A;  3H8H A;  1WGH A;  2HTM E;  4P6V F;  2K8C A;  1DOX A;  2KOX A;  4MAC A;  2KX3 A;  4FHK A;  1RFK A;  2JQR B;  3AN1 A;  2INC C;  1S3S G;  1KOT A;  2DNF A;  1IPG A;  3N30 A;  3A4S C;  4NAW A;  3B0A A;  1SB3 C;  1UNS A;  4AJY B;  2IY0 B;  4MT5 A;  2QDF A;  2ZW0 A;  4KDL B;  4KGS A;  3AE3 B;  1UGJ A;  5BYR A;  4G0N B;  1VR9 A;  1ZOY B;  2JX5 A;  1I4P A;  2RDG A;  1GUA B;  1I4X A;  2OJW A;  1TZ1 A;  3QIJ A;  2IO3 B;  4RMA A;  5IAA C;  3M3J A;  4NQK E;  2WS3 B;  4WUR A;  4AOF A;  1N60 A;  1ZKH A;  2GRI A;  2KFK A;  3TEX A;  2HD5 B;  1C4P A;  1TS5 A;  3M95 A;  1WE7 A;  3DBH B;  4KKJ A;  5IA7 A;  2PKO A;  1F2R I;  4WJP A;  3AEC B;  3U52 E;  2AQ2 B;  4W9J A;  2XN9 C;  1AW7 A;  4KV2 A;  2O2V A;  4PS7 A;  4AQ7 A;  2GI9 A;  4F1S A;  2NS5 A;  2Z8L A;  2AX5 A;  2BB6 A;  3T8M A;  1VLB A;  1RRB A;  4K7U A;  2XEW A;  2ZVO A;  4DXA B;  1WXA A;  3W2D A;  1HE8 A;  3ZQ4 A;  2KNB A;  2KX0 A;  3J9C A;  2K8B A;  4M02 A;  2V3N A;  1SBB B;  2W54 A;  3RPF C;  1YOV B;  4XZ4 A;  2AQ1 B;  3AXC A;  2KZR A;  1J8C A;  1R7S A;  3QAQ A;  5EE0 A;  1WI0 A;  1SJE D;  2J0K A;  2JXT A;  3JSV A;  3L08 A;  1Z5S B;  4W9C A;  1KTK A;  2L3Z A;  2KDF B;  1GG3 A;  1FXT B;  4WJO A;  1YX6 B;  2I1K A;  5FKA C;  3UIP B;  2K1F A;  3ZNH B;  3TBL D;  5HFY A;  1CJE A;  1Y56 A;  3RNA C;  4REZ A;  3SEB A;  1GJZ A;  2NCN A;  1SIF A;  1D5Z C;  3BYT B;  3KWL A;  2GBK A;  1WXQ A;  2A5U A;  1T5X D;  2KVR A;  5L95 C;  4CQN A;  1C3T A;  1SE2 A;  3N32 A;  4S17 A;  3P4R B;  3R2I A;  2LVO A;  2HTH A;  3RMK C;  1JW9 D;  1FRD A;  1QOA A;  3PT2 B;  5DPW A;  1F9J A;  5DCN A;  2W55 A;  1GOZ A;  1E8W A;  2KAC A;  2LUM A;  2PE9 A;  3IBE A;  2CU1 A;  5CTR C;  1TBE A;  5AEK B;  2PE6 B;  5CHW A;  4O1N A;  3MC0 B;  1UBQ A;  2Z0D B;  4ZRJ A;  5T8I A;  2JVC A;  3AMZ A;  4WQO B;  2RGF A;  1WX9 A;  2K0P A;  3WCQ A;  1ZGU B;  3TCA A;  3VFK A;  3A1Q B;  1FO4 A;  4HRS A;  2KDE B;  4KKI A;  3I57 A;  1BXT A;  1XLQ A;  1RAX A;  1Q10 A;  3V61 A;  2LXA A;  2MW5 A;  3DBL I;  3GP7 A;  3ZGZ A;  4GDK B;  1YIW A;  2CHW A;  3AV8 A;  2BVC A;  5BYS A;  3EFC A;  4LNN A;  3AUL A;  4FBJ B;  2WXI A;  4MJS B;  2I38 A;  4G50 A;  4ZRP A;  1P7F A;  1WYW B;  1OFF A;  2N7E A;  3EGR A;  1YN3 A;  1ACC A;  2I1J A;  1UUP A;  4DXF A;  3X0W A;  1TZO A;  4KIK A;  4L2Y A;  1I4Q A;  1ZE3 D;  2EKE C;  2H89 B;  1WRI A;  1TJE A;  3DQV A;  3AI5 A;  4LNK A;  4ZRK A;  1HA5 A;  3VR9 B;  2KN5 A;  4W9G A;  4MGZ E;  1WJU A;  2N9P C;  2V4L A;  5J2R A;  3NZ3 A;  2FCS A;  4W9E A;  5D2M B;  1J7B A;  4XX5 A;  2JSV X;  1PGB A;  2MX2 A;  3MHS D;  3V6E B;  2Q5W D;  3L13 A;  2QC8 A;  4ARI A;  3WAL A;  1TKG A;  3Q8B A;  4HRO A;  1K51 A;  4XC2 A;  3ZVV A;  3DHH C;  1ZP0 B;  3W5U B;  4N58 A;  3A1Q A;  3VRA B;  1FRR A;  1U4A A;  5KHO A;  2DX5 B;  3JW0 X;  1UD7 A;  2L76 A;  3DBR B;  3HM6 X;  2LXC A;  2JXX A;  3P2B A;  1FPY A;  4GDK A;  5I4D A;  3FC4 A;  2YVC A;  3N3K B;  1MPE A;  2BWE S;  4NAM A;  2L0F A;  4MJS A;  5FR3 A;  3L0W B;  1B1Z A;  3DPD A;  1WMH B;  4B95 A;  1WIA A;  4WJQ A;  2KDM A;  2C7H A;  2JWZ A;  3FAH A;  3TIX A;  3IFW B;  2WP9 B;  2B76 B;  4P1C C;  2WDQ B;  2HJ8 A;  2M1M A;  2QHO A;  3VH3 B;  4KVG B;  3L4P A;  1HZ5 A;  4MEL A;  2J0J A;  4BKS A;  4OVV A;  1VD2 A;  1KLU D;  3PO0 A;  1LFD A;  4IWP A;  4P16 A;  1FXA A;  2WDR B;  3N1Y C;  2LD9 A;  2GMI C;  2WX1 A;  1DGJ A;  3TEW A;  2MQJ A;  2RPQ A;  3APF A;  2WX0 A;  4JIO U;  3SFE B;  1VDV A;  2ZVN A;  4C00 A;  4BBN C;  3K9P B;  1DYQ A;  3P1M A;  3TL5 A;  2O6V B;  3ABV B;  3ONS A;  3C19 A;  3LB8 C;  3GZN I;  3O65 B;  2KWD A;  1EM7 A;  2L52 A;  4DBG A;  1E9M A;  2LVQ A;  1IP9 A;  2AWT A;  1ZUD 2;  4KGT A;  2WXO A;  2IGD A;  3ZDM C;  1UBI A;  1XQQ A;  1FFU A;  4C80 A;  4MGK E;  2LGD A;  1XLP A;  2BWF A;  2D3C A;  4DQO C;  2BYF A;  2LAS A;  5JH5 C;  2KC2 A;  2XK5 B;  3Q8E A;  1QKZ A;  2K22 A;  1SXT A;  2N7J A;  3AEF B;  2LFI A;  4K7W A;  3RNC C;  2WDV B;  2Z0E B;  2JPH A;  3VTV A;  1E0Z A;  1JRO A;  1V6E A;  5IKC M;  1JQ4 A;  2DEN B;  3PZ7 A;  3SFD B;  4DHJ D;  4IC7 B;  1FEH A;  5EDS A;  2WWZ A;  5J17 A;  3APD A;  3QX1 A;  4LCD E;  3U7Z A;  4HVB A;  3B2G A;  4D2K A;  1QZE A;  2MLB A;  1I7H A;  3MFG A;  3MTN B;  4OHJ A;  3NVZ A;  1JAL A;  2K6D B;  2FIF A;  1OQQ A;  1XT9 B;  3IHP C;  2ONQ A;  1V1P A;  1SEB D;  1SSN A;  3QJZ A;  4XE0 A;  4US9 A;  2PVO D;  3PRZ A;  1KRH A;  2M8S A;  3RYT A;  3EC8 A;  4IUM B;  3ZO5 B;  2X8X X;  2KDI A;  4YSZ B;  3C8Y A;  1L0V B;  1OTR B;  1WJ6 A;  2AYO B;  3AB5 A;  2LGS A;  2ZPN A;  2GBM A;  3QWZ B;  1WXV A;  3H7P A;  4EE2 A;  1NVI D;  4XWW A;  3B08 A;  2YEP F;  3VUW A;  1OEY J;  2K39 A;  5DPT A;  1I42 A;  5CX3 A;  4F7Z A;  2KT7 A;  4DHZ E;  4NJC A;  3RNF C;  4A90 A;  2IY1 B;  1ET9 A;  1WGR A;  1E10 A;  3CSF A;  2MBQ A;  1TS3 A;  2BYE A;  4RF1 A;  2Z59 B;  2N9K A;  2XK5 A;  1XF5 L;  4W9I A;  2G4S A;  4HDQ A;  3HVD A;  3P4P B;  4WH4 A;  3I9V 1;  2FCN A;  2MCN B;  1IGC A;  4BZA A;  1WX7 A;  2G1E A;  1T0Q C;  2UU7 A;  2JZ3 B;  3Q3M C;  3V3X A;  4WWO A;  1F77 A;  2LUE A;  3SHQ A;  3TEZ A;  3TMP B;  1A5R A;  1JWA D;  1SIJ A;  4WAA A;  2O6V D;  3DVG Y;  2L32 A;  1RWS A;  3RT3 B;  2KFJ A;  3PRM B;  2BYV E;  3Q14 C;  4M00 A;  3HHM A;  3RCZ A;  1V49 A;  4YWG G;  1Q5W B;  2KDB A;  1EF1 A;  3AM9 A;  3V62 A;  2G9H D;  3OJ4 B;  3VAW A;  3ZW3 A;  5AZH A;  1ZW7 A;  2KTF A;  2GBN A;  5D94 A;  2V1Y A;  5GXG B;  3Q8C A;  1SGH A;  4P1B C;  4C7Z A;  2PW9 A;  3QHT A;  2B3A A;  3BY4 B;  2N9X A;  4N9F 4;  1V97 A;  3HM3 A;  4AUQ C;  3ZNZ B;  4OZA A;  2QJL A;  4DDI D;  1E6E B;  3PLV A;  2IO1 B;  2JYT A;  3ZKJ C;  1HQR D;  1RM6 C;  2YEP B;  2J7Q B;  1ET6 A;  3BIN A;  1WJN A;  3RUL A;  1YJJ A;  2WXG A;  3R8B A;  2KMM A;  3VHT C;  1TGZ B;  4G3X B;  1N5X A;  2RD0 A;  1N62 A;  2IYD B;  3WIM A;  3I3T B;  4FJY A;  3H1U A;  4NY0 A;  3ZUN A;  3AE5 B;  5C23 A;  3B9J A;  1V5T A;  5D6J B;  4YTN B;  3AE9 B;  1UEL A;  3HUI A;  1JRU A;  2BS2 B;  2D2Q A;  1CK1 A;  2ON8 A;  2R2Q A;  2JYE A;  1IYF A;  4RFB A;  3DVG X;  4PT5 A;  1SE9 A;  3LDZ E;  1L5P A;  5JXV A;  2WXM A;  4YL8 A;  5IOI A;  2J53 A;  4UDU C;  4ANW A;  4ARC A;  4JQW C;  1R4N I;  3OWE B;  4RGN A;  1L0X B;  2Y5B B;  1HTQ A;  4MH0 E;  4XYC A;  3VUX A;  2N9E B;  4XDC A;  1M4V A;  1KLV A;  2C7N B;  5C2T B;  4ZYS A;  2M0A A;  1WX8 A;  5D7G A;  3DBS A;  4M01 A;  2XBB C;  4JL9 A;  5IN7 A;  2Y5C A;  3IT4 B;  2WXP A;  4WWN A;  3NZU A;  1UF0 A;  1XCT L;  3NVY A;  2MRP A;  1C4C A;  4BKT A;  1TY2 A;  1WZ0 A;  2L1A A;  2ZJD A;  3EFU A;  2N1V A;  5HHD G;  2K8H A;  2V9H A;  2FCQ A;  3R2T A;  1V8C A;  4KZC A;  1FNW A;  1TY0 A;  4W9K A;  2G45 B;  1GNU A;  3LXF A;  2LEK A;  3EA6 A;  2FBW B;  4WAF A;  2WLB A;  4YT0 B;  3EHV A;  2WDT B;  4URK A;  4DWF A;  3FIL B;  1VCB A;  4A8X C;  1VRA B;  2LMC A;  2JRH A;  2D11 A;  5G2N A;  2KJR A;  1Z2M A;  4YTM B;  1QOG A;  1SE4 A;  4S0R A;  3OJ3 A;  3W1S A;  3V05 A;  1QT9 A;  2JY6 A;  3NVW A;  1ZDV A;  4XGA B;  4B0E A;  4OZC A;  1YX5 B;  3BYY B;  3U7D A;  3L54 A;  2DZI A;  3VTU A;  5DPS A;  1WM3 A;  4HJG E;  4LDT D;  3NOB A;  1MJD A;  1NEK B;  2KLC A;  2C9W B;  3RZF A;  1T3Q A;  2DBY A;  3H7S A;  4US8 A;  4OVU A;  2BQQ A;  2FAZ A;  1JWS D;  2KTR B;  2D10 A;  2YLM A;  4IWQ A;  2I2Y A;  5E6P A;  2FNJ B;  3UF8 A;  1WR6 E;  3LYY A;  1R4N B;  1QF6 A;  2XNA C;  4USA A;  4NJ6 A;  3ENE A;  2IDY A;  2LHE A;  2EMS A;  4G11 A;  1BT0 A;  2BKF A;  5TR5 A;  3ZLZ A;  4Q2J A;  1PDX A;  1EU4 A;  2IJ0 A;  1GC6 A;  4A6Q A;  3E9S A;  1L2N A;  5E6N A;  2MWS B;  1WZ3 A;  2FUH B;  3L16 A;  4NJ7 A;  3NUH B;  1V2Y A;  1C4A A;  5AZG A;  5DPR A;  3AE1 B;  1NI3 A;  3HK0 A;  4NQL B;  3Q3N C;  1WM2 A;  1Q0W B;  2SEB D;  4XDD A;  3PZ8 A;  4DHJ B;  1S1Q B;  3KQ4 A;  2D3A A;  3WA0 A;  1TKE A;  4AS1 A;  2QIL A;  1TTN A;  3TUO A;  1VZ7 A;  2IBI B;  2KJ6 A;  2BW2 A;  3VRB B;  4IM0 A;  2J52 A;  1JWU D;  2DLB A;  3P42 A;  2KHW B;  4HWI B;  1QQR A;  4TQ0 A;  4NNJ B;  4GGQ A;  3ZTC A;  1XD3 B;  3NZS A;  4W9H A;  5C1Z A;  1TS2 A;  1HTO A;  2QEJ C;  4LK0 M;  1D6E C;  3AU5 A;  2MP2 B;  5HKH A;  5BMG A;  2NBW B;  1I4R A;  1I4G A;  4GXB A;  2BBC A;  2LVP A;  3B2F A;  2W3S A;  2NR2 A;  3NRZ A;  4MM3 B;  3HRD D;  2KTR A;  2PLP A;  2LJI A;  3PZD A;  2DWQ A;  1ENF A;  4K81 A;  3PSE B;  3VTW A;  2PPH A;  4NPN A;  4NZL B;  4C56 C;  3SR6 A;  4R3D A;  2KWC A;  4GMV A;  3AEE B;  2RMM A;  5JZE B;  1OQR A;  1YQ3 B;  2KMA A;  5EE1 A;  1DOY A;  4OZB A;  3ZJU A;  1EUV B;  2V3S A;  3KUD B;  2LRW A;  1PGX A;  1R4M I;  3ML9 A;  2CHX A;  2DZM A;  3DBL B;  3BZD B;  4B0M A;  2MJ3 A;  3N9Y C;  2WU5 B;  3RD2 A;  4GLS C;  1YNT E;  2Y3A A;  5AUK A;  3MHZ A;  4GN1 A;  5LLI A;  2K5P A;  3PS6 A;  2N4F A;  2DZJ A;  2OHF A;  4HDO A;  4K1R B;  4DK5 A;  1LXD A;  2DYB A;  1JML A;  2QMT A;  4HCN B;  1AN8 A;  4TKN A;  3P4S B;  3DHI C;  1V86 A;  3PGE A;  2KD0 A;  3A9K B;  2IND C;  2R2O A;  4FJZ A;  2L83 A;  2DZK A;  2KAJ A;  1ZXI A;  2AL3 A;  2MBB B;  3H9D A;  4EUT A;  1P9D U;  3CWI A;  3MP9 A;  4PS3 A;  2CS4 A;  3A9J B;  3KWV A;  2JWU A;  1PQS A;  4I6L B;  2CHZ A;  2MEK A;  3ZRC A;  2PMV A;  4MM3 A;  2KQ7 A;  1TYG B;  2WYQ A;  2EEL A;  1DOI A;  2J4X A;  1BUI C;  4AJW A;  1Q1O A;  4M8M A;  2OJR A;  3ZNG C;  1FMA D;  1WMH A;  1UWX A;  4KZ0 A;  1UH6 A;  4HJK A;  2HJ1 A;  3SU8 X;  1C9F A;  1T0Y A;  2RSU A;  2NBV B;  2G3Q B;  3GB1 A;  1P0R A;  1C77 A;  2W3R A;  4II3 B;  2K6Q A;  3N1X C;  2N7D A;  1ZPS A;  1OEY A;  1H8C A;  3BVG A;  1C1Y B;  2LGI A;  1E7U A;  1QOB A;  2EMT A;  1GAQ B;  2M19 A;  4B6W A;  4RF0 A;  4C7Y A;  4L23 A;  4FAD A;  1UZX B;  4HXD A;  2BYT A;  1WH3 A;  2NMQ A;  4I6N B;  2D5G A;  3PHX B;  4YSX B;  3VXW A;  4HLE A;  3SD5 A;  1IBX B;  4C4V B;  4EKU A;  5H92 C;  3BVZ A;  4YSY B;  3Q3F A;  2J0M A;  4ICU A;  2RDH A;  1JWM D;  3T3N A;  2O6V A;  2N1W A;  5FK9 C;  2WXH A;  3RNG C;  2MJD A;  3A9K A;  5BO4 B;  1R4M B;  1AYF A;  2KAN A;  5IP4 D;  3BII D;  3AE6 B;  4ZRQ A;  3Q3J A;  1V1O A;  3PLU A;  1G6J A;  1TS4 A;  2PIA A;  4BOZ B;  3EEC A;  2MH7 A;  3LJ3 A;  3A9J A;  3MC8 A;  2KLG A;  3ECI A;  1GB1 A;  4WQM A;  1E8Y A;  2V0G A;  2REX A;  4NAW B;  4PK1 A;  3DBH I;  4J6I A;  3KUZ A;  2Y5P A;  1YJI A;  4I6P A;  3IVF A;  4HPM B;  1N63 A;  1L4D B;  3GZN B;  3AE4 B;  4EZK A;  1ROE A;  1ISN A;  1E7P B;  1F52 A;  3DDC B;  4TV3 A;  1N61 A;  1J0G A;  3P4Q B;  4QAY A;  2AEH A;  1F0Z A;  5IO9 A;  2JT4 B;  1MFW A;  4GOC A;  3JVZ X;  2MJE A;  3CF6 E;  3I5J C;  3U2S C;  3EUB 2;  3AED B;  3H6N A;  2OOB B;  1FCL A;  4MEM A;  5BMI A;  1K53 A;  4X57 B;  1ZXH A;  2H88 B;  2O2V B;  2GOW A;  1CMX B;  1JWB D;  3V60 A;  3PTF C;  3DWM A;  3R66 C;  1VJK A;  4GIV A;  3NY5 A;  5CHF A;  4C4V A;  2QIE B;  1SF0 A;  1J19 A;  1VZ8 A;  3N20 C;  2LRU A;  4IKG A;  3VDZ A;  1H4R A;  2LJ5 A;  3ZJT A;  1PFD A;  2WNM A;  1XLN A;  3KYD D;  2L8J A;  3SDL C;  2GLS A;  2JU6 X;  2R61 A;  3A33 B;  1WFY A;  2M17 A;  4LLG M;  1WXM A;  5LXI B;  1WR1 A;  2WXF A;  2LGY A;  4KDI C;  4ASW C;  2SAK A;  1I4H A;  3GE8 C;  4LDT B;  5LNK 1;  3W1S C;  4HK2 A;  3WAO A;  2ZNV B;  3JSV B;  3CIR B;  2GBR A;  3CST A;  1CZP A;  2WGS A;  3ZTD A;  1FFV A;  4A3P A;  4HPP A;  4LNI A;  1NYR A;  3R3M A;  2MHJ A;  4HKQ A;  2D3B A;  4WWP A;  2BPS A;  2QSD A;  2KQ4 X;  2JZP A;  3RZW C;  1YD8 U;  4OVZ A;  3T9L A;  2C5L C;  3IAS 1;  4IG7 B;  4FN2 A;  1P1A A;  3QCA A;  5AZF A;  1QLB B;  3DCG A;  3GE3 C;  4LTU A;  1X1M A;  2KK8 A;  1D5X C;  3NG0 A;  4E71 A;  3KVF B;  2DHZ A;  4BOS C;  3RUI B;  2K9X A;  1FNV A;  1VZ6 A;  1WYG A;  3I63 C;  2UWQ A;  5FR6 A;  1K52 A;  4E3C A;  4DXG A;  2WXK A;  3TSS A;  1GC7 A;  4M0W B;  4W9F A;  4B9K A;  1AWD A;  2D3G A;  2GB1 A;  3MJW A;  4MGY E;  3U8Z A;  1V5O A;  4ZRI A;  1OGW A;  4YTP B;  4FXC A;  3WAP A;  1C78 A;  4RGO S;  5D3I B;  3UIO B;  3BVM A;  1MHX A;  1Y8R C;  1ESF A;  5L83 A;  4GDL B;  2MBH A;  2BS4 B;  3KW5 B;  1QOF A;  2CKH B;  5EE3 A;  4CO7 A;  2VH1 A;  3PPA A;  1J7C A;  3WAM A;  3ZXV A;  2NTS A;  5BMH A;  2TSS A;  4ANV A;  4RGT A;  2IGH A;  1D4B A;  2BS3 B;  2FCM A;  4DHZ B;  3U4E G;  2BT6 A;  5GMV A;  4W9L A;  2NPT B;  4ZYN A;  4KX6 B;  1MVK A;  3V6C B;  1OQY A;  1WGY A;  4MSM B;  3NVV A;  2AQ3 B;  2J42 A;  3Q8A A;  3PVL A;  4CYE A;  3IXS A;  2IZV B;  1YQ4 B;  1E90 A;  2CJO A;  2GBJ A;  2DAJ A;  3NS8 A;  1F2R C;  1UGM A;  4ITK A;  4FHJ A;  4JLC A;  3NHE B;  3AE2 B;  3HIZ A;  2RR9 A;  3MC9 A;  1T6B X;  4A20 A;  1AAR A;  1KLG D;  3Q69 A;  1TKY A;  4KIK B;  2JZZ A;  4ZOH C;  3U30 A;  4JWU C;  3RI7 C;  3ML8 A;  3QA8 A;  1YMH E;  3DOW A;  2PJH A;  5MPO A;  5LXH A;  2WXN A;  4IWO A;  2HDE A;  4M0W A;  2C7M B;  4ICV A;  2PEA A;  4FUL A;  1A70 A;  1T0R C;  1WGK A;  2BF8 B;  3O13 A;  3DBR I;  1P98 A;  2NVU I;  1FCC C;  2G4D B;  1WRD B;  1ZDX A;  1JCK B;  3QAR A;  4IW0 A;  3NJT A;  3RNB C;  5C3J B;  1PUT A;  1EWY C;  4RH6 A;  2W9N A;  4JPS A;  4GDL A;  2KC1 A;  1L6V A;  4RM8 A;  3AE7 B;  3ALB A;  4PS8 A;  1WSP A;  5G55 A;  2OED A;  1N5W A;  2CJN A;  3AU4 A;  4HEA 1;  3AEG B;  3L10 B;  1KM7 A;  5D3D A;  3MJ5 A;  1B9R A;  3Q2A C;  4PYU A;  2L05 A;  3ZYY X;  2NPT A;  1RLF A;  2ZPY A;  5BYQ A;  1GB4 A;  4PYZ A;  1WGG A;  5EE9 A;  4IM3 A;  3DHG C;  1HEZ E;  3M63 B;  4BFR A;  1K50 A;  3HVZ A;  1EO6 A;  4EEW A;  2EKI A;  4IOI E;  2VRR B;  2LGX A;  4KGR A;  1LGR A;  4MSQ B;  4EFO A;  2ASQ A;  4BKG A;  3UIN B;  4N59 A;  2LI5 A;  2RDB C;  3FIL A;  3ZRF A;  2KXJ A;  4BVU C;  1BML C;  2ZZP B;  1NDD A;  2WHI A;  1T0S C;  1L0Y B;  2INN E;  3ZJV A;  1V80 A;  2JF5 A;  2ZEQ A;  2NBU A;  1XLO A;  3CMM B;  1SE3 A;  3OAW A;  4ANX A;  2KQS A;  3OG5 A;  2BTE A;  3DVN U;  4P7I A;  3PRE A;  2DYO A;  2RPV A;  4RGM A;  5HG2 A;  1WJ4 A;  4TUU A;  5CHV C;  5AUI A;  2KN4 A;  2WXQ A;  4MDK E;  1LM8 B;  2DAF A;  4BAX A;  2ZCB A;  1TIF A;  3RN9 C;  4JE3 B;  3RFZ B;  1PYW D;  3AEA B;  2KWU B;  2V3P A;  2W82 A;  1MI0 A;  2DYM A;  4BBN F;  3M62 B;  2ICI A;  3R7R A;  3P63 A;  1YN4 A;  5G5G A;  1P3Q U;  1EF5 A;  4JWS C;  1FNU A;  3KLS X;  3Q8F A;  2VH2 A;  3E56 A;  2IPK D;  5G5H A;  2K25 A;  2KJH B;  2MA9 B;  4W9D A;  1XO3 A;  4K3B A;  1E8X A;  3KUC B;  2KYW A;  2M56 B;  2ZW1 A;  3PHW B;  4HCP B;  3VVW B;  2IO0 B;  1D5M C;  1QIL A;  4ACF A;  4FA6 A;  1L6U A;  2WXR A;  4II2 B;  4FJV B;  4HKZ E;  3PRP B;  1KJT A;  2JUO A;  2ACZ B;  2VZK B;  4RCO A;  2AL6 A;  3URY A;  3KYC D;  1LQB A;  1V1P B;  2N9L A;  2M0X A;  2MSE D;  2LZ6 A;  3DVN V;  2L0T A;  2UYZ B;  4A9A A;  5E6O A;  2M4N A;  3NS1 A;  1SJH D;  2FID A;  1F1H A;  3UQA A;  4AWJ A;  3QC8 B;  3AH7 A;  3AEB B;  3RNE C;  2E3T A;  3QQ8 B;  2MP2 A;  2HE7 A;  3H7P B;  3ZXR A;  2L00 B;  3ZNI D;  3APC A;  2ZCC A;  3FKY A;  3VUY A;  4J3O D;  1D3Z A;  1NEN B;  3PV1 A;  4ZHP A;  1RFA A;  2IGG A;  3ETR A;  4RNA A;  1I35 A;  1IUE A;  1JRP A;  2X38 A;  1NBF C;  4F8C B;  1FIQ A;  2BKR B;  4H2A A;  3W1Y A;  1HZ6 A;  2IO2 B;  4ZDV A;  5HI1 A;  3IT6 B;  4MGI E;  1YJ1 A;  2WU2 B;  4ZHO A;  2K3U A;  4LJO B;  3GOE A;  4LNO A;  3ZIM A;  4AP4 C;  4KSL C;  1RYJ A;  5E6J A;  5TSS A;  3JYU A;  3Q6B A;  3S2A A;  1STE A;  3VR8 B;  4BKS D;  1XXG A;  3A4R A;  4FLH A;  3OLM D;  1L7Y A;  2KO3 A;  2WQY B;  5KHQ A;  1NYQ A;  2C60 A;  4WIP A;  1KFY B;  3Q3O C;  4MH8 A;  1EU3 A;  3DWG C;  1IGD A;  4WJN A;  1C76 A;  2KWV B;  4HPL B;  4EOY A;  1N6Z A;  4JGH B;  3B1L X;  4GB9 A;  2KKC A;  4OW0 A;  2LHD A;  4TQ1 A;  4N6E B;  2A4Z A;  1E5W A;  4M8N A;  1WGD A;  2FUG 1;  4JX1 C;  2FE8 A;  4DDG D;  3GS2 A;  1V9J A;  3W5V B;  3D32 A;  4K7S A;  1GPX A;  1C79 A;  4ANU A;  3IAM 1;  4LJP B;  1MG4 A;  4E74 A;  1KF6 B;  1WY8 A;  1KH0 A;  3IG3 A; 
#chains in the Genus database with same CATH homology
 2KLC A;  2M1M A;  4E71 A;  2QHO A;  2C9W B;  3VH3 B;  3KVF B;  4KVG B;  2DHZ A;  3RZF A;  4MEL A;  4BOS C;  3RUI B;  1WXS A;  2J0J A;  4BKS A;  4OVV A;  1VD2 A;  1LFD A;  3H7S A;  4IWP A;  2LWP A;  4OVU A;  3VQI A;  2FAZ A;  2UWQ A;  5FR6 A;  4E3C A;  2KTR B;  2D10 A;  2LD9 A;  2YLM A;  2GMI C;  1GC7 A;  2WX1 A;  3WAN A;  1K8R B;  2MQJ A;  2RPQ A;  4IWQ A;  4M0W B;  4W9F A;  3APF A;  5E6P A;  4A3O A;  4B9K A;  2FNJ B;  2WX0 A;  2D3G A;  5JHA A;  4JIO U;  3UF8 A;  4EZJ A;  1YQB A;  2ZVN A;  3QK0 A;  1WR6 E;  3MJW A;  4BBN C;  4MGY E;  1WE6 A;  3K9P B;  1NI2 A;  3U8Z A;  4NJ6 A;  3ENE A;  1V5O A;  4ZRI A;  1OGW A;  3WAP A;  2EMS A;  4G11 A;  3R7Q A;  4CHK A;  1BT0 A;  2BKF A;  5TR5 A;  3TL5 A;  3ZLZ A;  1M94 A;  2CR5 A;  2O6V B;  3UIO B;  3ONS A;  1Y8R C;  5L83 A;  3UGB B;  4GDL B;  1GC6 A;  3C0R B;  2D07 B;  2KFK B;  3GZN I;  3L17 A;  3O65 B;  4EZL A;  1L2N A;  2MBH A;  1V81 A;  4DBG A;  4GSW A;  2MWS B;  3KW5 B;  5E6N A;  1WZ3 A;  2FUH B;  3L16 A;  2CKH B;  3X23 A;  4CO7 A;  2LVQ A;  4NJ7 A;  1IP9 A;  1V2Y A;  3PPA A;  2AWT A;  3WAM A;  5AZG A;  5DPR A;  3HK0 A;  3UQB A;  4ANV A;  4NQL B;  3VH4 B;  1WM2 A;  1Q0W B;  2ZNV C;  4RM9 A;  3ZDM C;  2FCM A;  4DHZ B;  3ZDT A;  5GMV A;  3TJP A;  1UBI A;  4W9L A;  4DHJ B;  1S1Q B;  1XQQ A;  1MG8 A;  2NPT B;  4ZYN A;  3KH0 A;  1WF9 A;  3V6C B;  1E8Z A;  1OQY A;  4MGK E;  1WGY A;  4MSM B;  3WA0 A;  2LGD A;  2BGF A;  2BWF A;  3PVL A;  2BYF A;  4CYE A;  1TTN A;  2IBI B;  2IZV B;  2KJ6 A;  1E90 A;  2LAS A;  2GBJ A;  2DAJ A;  2MBE A;  2MBO A;  5JH5 C;  4IM0 A;  2L7R A;  3NS8 A;  4KSK C;  4IM2 A;  2KC2 A;  2XK5 B;  4GU2 A;  1UGM A;  2KHW B;  3K9O B;  4K7W A;  4HWI B;  4FHJ A;  4JLC A;  3NHE B;  5J18 A;  1E7V A;  3HIZ A;  4TQ0 A;  4NNJ B;  2RR9 A;  2KMC A;  2JRI B;  2Z0E B;  4GGQ A;  2JPH A;  3VTV A;  3ZTC A;  4A20 A;  5JHB A;  1V6E A;  1WGH A;  1XD3 B;  3NZS A;  4W9H A;  5C1Z A;  2DEN B;  1AAR A;  4KIK B;  2JZZ A;  4IC7 B;  3AU5 A;  2MP2 B;  4DHJ D;  2K8C A;  5EDS A;  5HKH A;  2WWZ A;  3U30 A;  5J17 A;  2KOX A;  3APD A;  2KX3 A;  3QX1 A;  4FHK A;  4LCD E;  2NBW B;  4HVB A;  4GXB A;  3ML8 A;  3QA8 A;  1QZE A;  2MLB A;  1S3S G;  2LVP A;  1KOT A;  1IPG A;  2NR2 A;  3N30 A;  3DOW A;  3A4S C;  3MTN B;  4NAW A;  2PJH A;  2KTR A;  3B0A A;  5LXH A;  2K6D B;  2FIF A;  4IWO A;  3PZD A;  1XT9 B;  3IHP C;  4AJY B;  2C7M B;  2IY0 B;  3PSE B;  4ICV A;  4K81 A;  4KDL B;  2PEA A;  4FUL A;  3VTW A;  2PPH A;  4NPN A;  3QJZ A;  2KWC A;  4G0N B;  4GMV A;  2BF8 B;  3DBR I;  1P98 A;  3PRZ A;  5JZE B;  2NVU I;  2M8S A;  3RYT A;  3EC8 A;  4IUM B;  2KMA A;  3ZO5 B;  2KDI A;  2G4D B;  1GUA B;  1WRD B;  1OTR B;  1WJ6 A;  3QAR A;  2AYO B;  4IW0 A;  1TZ1 A;  3QIJ A;  2IO3 B;  2ZPN A;  4RMA A;  1EUV B;  5IAA C;  3M3J A;  2GBM A;  2V3S A;  2W9N A;  1WXV A;  3KUD B;  2LRW A;  3H7P A;  3QWZ B;  4NQK E;  4AOF A;  4GDL A;  2KC1 A;  1ZKH A;  2KFK A;  1R4M I;  3ML9 A;  2CHX A;  4RM8 A;  2DZM A;  2HD5 B;  3M95 A;  1WE7 A;  3B08 A;  3ALB A;  4PS8 A;  5IA7 A;  5G55 A;  4WJP A;  3RD2 A;  3VUW A;  1OEY J;  2K39 A;  5DPT A;  3AU4 A;  4W9J A;  3L10 B;  1KM7 A;  4GN1 A;  5LLI A;  1I42 A;  5CX3 A;  4F7Z A;  3PS6 A;  2N4F A;  4KV2 A;  2O2V A;  2DZJ A;  4PYU A;  2L05 A;  4PS7 A;  2NPT A;  1RLF A;  4DHZ E;  4HDO A;  4K1R B;  2ZPY A;  4DK5 A;  2NS5 A;  4F1S A;  4PYZ A;  1LXD A;  1WGG A;  2IY1 B;  2DYB A;  4IM3 A;  1WGR A;  3T8M A;  3CSF A;  2MBQ A;  3M63 B;  4BFR A;  1EO6 A;  1RRB A;  2BYE A;  4K7U A;  4EEW A;  2XEW A;  2ZVO A;  4HCN B;  4TKN A;  4DXA B;  1WXA A;  2Z59 B;  1HE8 A;  1V86 A;  2KD0 A;  2KNB A;  2KX0 A;  3A9K B;  2XK5 A;  3PGE A;  2VRR B;  2K8B A;  2R2O A;  2LGX A;  2G4S A;  4FJZ A;  4HDQ A;  4W9I A;  4XZ4 A;  4MSQ B;  4EFO A;  2ASQ A;  4BKG A;  3UIN B;  3AXC A;  2FCN A;  2MCN B;  2KZR A;  1J8C A;  1WX7 A;  2LI5 A;  2DZK A;  2AL3 A;  2MBB B;  3H9D A;  3ZRF A;  4EUT A;  2KXJ A;  2JZ3 B;  4BVU C;  2ZZP B;  1NDD A;  1P9D U;  3QAQ A;  4WWO A;  4PS3 A;  1V80 A;  1WI0 A;  2LUE A;  2CS4 A;  2JF5 A;  2ZEQ A;  2J0K A;  2NBU A;  3A9J B;  3SHQ A;  3JSV A;  3L08 A;  1PQS A;  3TMP B;  4I6L B;  1Z5S B;  2CHZ A;  3CMM B;  4W9C A;  1A5R A;  3ZRC A;  4WAA A;  3OAW A;  4MM3 A;  4ANX A;  2KQ7 A;  2L3Z A;  2KQS A;  2O6V D;  2KDF B;  3DVG Y;  1GG3 A;  2WYQ A;  3DVN U;  3PRE A;  1FXT B;  4P7I A;  1YX6 B;  2I1K A;  4WJO A;  2DYO A;  3UIP B;  2K1F A;  4AJW A;  1Q1O A;  3RT3 B;  2KFJ A;  3TBL D;  3ZNH B;  1WJ4 A;  4M8M A;  2OJR A;  4TUU A;  3ZNG C;  5CHV C;  1WMH A;  3PRM B;  2BYV E;  4KZ0 A;  1UH6 A;  2NCN A;  3HHM A;  1GJZ A;  3RCZ A;  4HJK A;  1SIF A;  1LM8 B;  4MDK E;  1V49 A;  2DAF A;  3SU8 X;  1Q5W B;  1T0Y A;  2RSU A;  2KDB A;  2NBV B;  2ZCB A;  1EF1 A;  2G3Q B;  1P0R A;  3V62 A;  2GBK A;  4II3 B;  2K6Q A;  3OJ4 B;  3VAW A;  2N7D A;  3ZW3 A;  1OEY A;  1H8C A;  2A5U A;  2KWU B;  2KVR A;  5AZH A;  5L95 C;  1ZW7 A;  2KTF A;  2GBN A;  5D94 A;  2DYM A;  2V1Y A;  1C1Y B;  1E7U A;  4BBN F;  1C3T A;  3M62 B;  2EMT A;  1SGH A;  3N32 A;  3R7R A;  3QHT A;  2LVO A;  4B6W A;  4FAD A;  2B3A A;  1UZX B;  3BY4 B;  2HTH A;  2N9X A;  4N9F 4;  1P3Q U;  3HM3 A;  4HXD A;  4AUQ C;  1EF5 A;  3ZNZ B;  1WH3 A;  4I6N B;  3PHX B;  3PT2 B;  5DPW A;  1F9J A;  5DCN A;  3VXW A;  4HLE A;  3SD5 A;  4DDI D;  1E8W A;  2PE9 A;  3PLV A;  2IO1 B;  3IBE A;  2CU1 A;  4EKU A;  3Q3F A;  5CTR C;  2J0M A;  1TBE A;  5AEK B;  4ICU A;  3ZKJ C;  2K25 A;  2O6V A;  2PE6 B;  5CHW A;  2N1W A;  2KJH B;  2MA9 B;  2J7Q B;  4W9D A;  3A9K A;  3BIN A;  5BO4 B;  1E8X A;  1WJN A;  1UBQ A;  2Z0D B;  3KUC B;  3RUL A;  4ZRJ A;  2KAN A;  2JVC A;  4WQO B;  2RGF A;  1WX9 A;  3Q3J A;  1ZGU B;  3TCA A;  3VFK A;  3A1Q B;  3PHW B;  3PLU A;  3VHT C;  4HCP B;  1TGZ B;  1G6J A;  3VVW B;  2KDE B;  2IO0 B;  4G3X B;  2RD0 A;  4FA6 A;  4BOZ B;  3EEC A;  4II2 B;  2IYD B;  3WIM A;  3I3T B;  1RAX A;  4FJY A;  3H1U A;  4FJV B;  4NY0 A;  3LJ3 A;  3PRP B;  3V61 A;  3ZUN A;  1KJT A;  2JUO A;  3A9J A;  5C23 A;  2LXA A;  1V5T A;  5D6J B;  2MW5 A;  3DBL I;  2KLG A;  3ECI A;  4GDK B;  1E8Y A;  1YIW A;  1UEL A;  2CHW A;  1JRU A;  2REX A;  2D2Q A;  4NAW B;  2R2Q A;  1IYF A;  3DBH I;  4J6I A;  2AL6 A;  3KUZ A;  3DVG X;  1SE9 A;  3LDZ E;  3KYC D;  1LQB A;  3IVF A;  4I6P A;  4HPM B;  3AUL A;  4FBJ B;  4MJS B;  4EZK A;  4YL8 A;  2M0X A;  2MSE D;  1ISN A;  2LZ6 A;  4ANW A;  3DVN V;  2L0T A;  2UYZ B;  4G50 A;  4JQW C;  5E6O A;  1R4N I;  3DDC B;  2M4N A;  1WYW B;  4TV3 A;  2N7E A;  2FID A;  2Y5B B;  3UQA A;  2I1J A;  4AWJ A;  4MH0 E;  1J0G A;  3QC8 B;  3VUX A;  3X0W A;  2N9E B;  4KIK A;  3QQ8 B;  2EKE C;  2MP2 A;  2HE7 A;  3H7P B;  1KLV A;  2AEH A;  2C7N B;  1WX8 A;  2JT4 B;  2L00 B;  5D7G A;  3DQV A;  4GOC A;  3DBS A;  3ZNI D;  3APC A;  3AI5 A;  2ZCC A;  3JVZ X;  4ZRK A;  3CF6 E;  2XBB C;  3VUY A;  4JL9 A;  1D3Z A;  3PV1 A;  2KN5 A;  3H6N A;  2OOB B;  4MGZ E;  4W9G A;  1WJU A;  2N9P C;  1RFA A;  2V4L A;  1I35 A;  4WWN A;  4MEM A;  3NZU A;  4F8C B;  1NBF C;  5J2R A;  2FCS A;  2BKR B;  3W1Y A;  2MRP A;  4W9E A;  5D2M B;  2IO2 B;  4X57 B;  4ZDV A;  4BKT A;  2O2V B;  2GOW A;  4XX5 A;  1CMX B;  4MGI E;  1YJ1 A;  3V60 A;  2MX2 A;  3MHS D;  3V6E B;  1WZ0 A;  3L13 A;  3PTF C;  2ZJD A;  3EFU A;  2N1V A;  4LJO B;  3GOE A;  3R66 C;  4GIV A;  5CHF A;  2K8H A;  3NY5 A;  2FCQ A;  3ZIM A;  4KZC A;  1J19 A;  4AP4 C;  4KSL C;  3WAL A;  4W9K A;  2G45 B;  1GNU A;  2LRU A;  3JYU A;  3VDZ A;  3S2A A;  1H4R A;  2LJ5 A;  4BKS D;  3KYD D;  4XC2 A;  3ZVV A;  3A4R A;  2L8J A;  3SDL C;  3EHV A;  2WDT B;  4FLH A;  3OLM D;  1L7Y A;  1WFY A;  2KO3 A;  2M17 A;  3A33 B;  1WXM A;  3A1Q A;  4URK A;  5LXI B;  1WR1 A;  5KHQ A;  2LGY A;  4DWF A;  4KDI C;  1U4A A;  5KHO A;  4ASW C;  2C60 A;  1VCB A;  4LDT B;  2DX5 B;  3JW0 X;  2JRH A;  2D11 A;  1UD7 A;  2L76 A;  3W1S C;  5G2N A;  2KJR A;  3HM6 X;  1Z2M A;  2LXC A;  4HK2 A;  4WJN A;  3WAO A;  2ZNV B;  2JXX A;  3P2B A;  3JSV B;  2KWV B;  4GDK A;  4HPL B;  4EOY A;  2GBR A;  3CST A;  2YVC A;  3B1L X;  3OJ3 A;  4JGH B;  3N3K B;  4GB9 A;  3W1S A;  2KKC A;  3ZTD A;  2BWE S;  4A3P A;  3R3M A;  4TQ1 A;  2L0F A;  2JY6 A;  2A4Z A;  1E5W A;  4M8N A;  4MJS A;  4WWP A;  3L0W B;  1WGD A;  2BPS A;  3DPD A;  1WMH B;  4B95 A;  1WIA A;  4WJQ A;  3RZW C;  1YD8 U;  1YX5 B;  4DDG D;  1V9J A;  3T9L A;  3D32 A;  2C5L C;  4K7S A;  3U7D A;  4ANU A;  2C7H A;  2JWZ A;  4IG7 B;  4FN2 A;  3L54 A;  4LJP B;  1P1A A;  3TIX A;  4E74 A;  3QCA A;  2DZI A;  3VTU A;  3IFW B;  5AZF A;  5DPS A;  1WM3 A;  3DCG A;  4LDT D;  3NOB A;  1X1M A;  2KK8 A;  1WY8 A;  2HJ8 A;  3IG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...