3ZO5B

Structure of senp2-loop1 in complex with presumo-2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 2
publication title Structural Insights Into the Senp6 Loop1 Structure in Complex with Sumo2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zo5B00
2O6VB 4WQOB 4EKUA 2JPHA 4GDKB 1J8CA 2DYOA 2NPTA 2A4ZA 2L05A 4GDLA 5L95C 4NJ7A 1R4NI 3UIOB 3WIMA 3VDZA 4FHJA 3ZUNA 5J17A 4FULA 3O65B 1WXMA 1WX8A 2KWCA 2KQSA 4MSMB 3VTVA 2OOBB 5IAAC 4EFOA 2HD5B 2IO3B 5CX3A 3ZNZB 4LJOB 4MSQB 2ZVNA 2DX5B 4NAWA 2Z0EB 2AEHA 1I42A 1RRBA 1GC6A 5DPTA 3PRMB 3W1SC 3WA0A 1I35A 4ASWC 2GBKA 4KSKC 4BKTA 2DYBA 4A3PA 3MHSD 3IG3A 1LQBA 2BKRB 1FXTB 1WM2A 3NZSA 2KJ6A 2L00B 3JYUA 4IWOA 3APCA 5EDSA 4GSWA 3HIZA 3QK0A 2PE9A 2CHZA 1WZ0A 2BYFA 3EECA 2MBQA 4IM2A 2XK5A 3ZW3A 5TR5A 3NZUA 3W1SA 2KFJA 3NOBA 3PRPB 4N9F4 3A9KA 2KZRA 5J2RA 3P2BA 2R2OA 1GNUA 3SDLC 2XBBC 3ZIMA 3IFWB 2C7HA 2MW5A 4GN1A 4FA6A 4HK2A 2GBJA 2RGFA 3JSVB 1LXDA 2YVCA 3U7DA 4ZYNA 3B08A 2V1YA 1HE8A 3NY5A 4IW0A 5GMVA 2D10A 3BINA 1F9JA 5LXHA 4OVVA 3B1LX 1E7VA 4P7IA 4IM3A 2KTFA 1G6JA 1WMHA 3PHXB 4PS7A 3LDZE 4HPLB 2CHXA 1U4AA 3ZDTA 3KW5B 5CHVC 1VCBA 4EZKA 3DVGY 2MWSB 3EHVA 3WAOA 3CMMB 2KDEB 1V5TA 1ZW7A 2G45B 4MGIE 5BO4B 3VXWA 3PHWB 2J0MA 4HPMB 4EZLA 2JY6A 2M1MA 1WGRA 1WXAA 2IBIB 2Y5BB 2ZNVB 4K81A 4E74A 2GMIC 3QA8A 1C1YB 4DHZE 1EF5A 4PS8A 2K8HA 2WWZA 3N32A 2LWPA 2IY1B 2ZZPB 3ENEA 2KX0A 4WJPA 1WR1A 3AI5A 1UZXB 2LZ6A 1YD8U 2JT4B 2MLBA 2ZJDA 1EF1A 3PV1A 4EUTA 4K7WA 2MBBB 4B95A 1L2NA 2LD9A 3PREA 4G0NB 4W9DA 5G55A 1Q0WB 2WDTB 2NBVB 2NVUI 4GIVA 2N1WA 3AULA 2MQJA 5LXIB 1GG3A 3N30A 4BBNC 2O6VD 4BVUC 3CF6E 4HXDA 3DVGX 4KV2A 3PLUA 3UQAA 2ZEQA 2ZPNA 3UINB 3VH4B 3QIJA 2LGDA 3H7PA 2O2VB 2KVRA 2FAZA 3NS8A 1K8RB 4OVUA 3RZWC 3JW0X 2J7QB 4ZDVA 4W9JA 4MELA 3KUCB 2KN5A 2IO0B 4AJWA 2UYZB 2LGXA 2I1JA 3DBLI 4W9CA 3RZFA 4MGKE 3C0RB 2O6VA 2ASQA 2D11A 3GZNI 3QWZB 3BY4B 3T8MA 5HKHA 1PQSA 2XEWA 2JZZA 1NBFC 2BPSA 2CHWA 2MSED 4GDKA 4WJNA 2G3QB 2G4DB 3R66C 5C23A 3ZNGC 1NI2A 1EO6A 3RD2A 1OQYA 3M62B 1UGMA 4MGZE 1YJ1A 3V6EB 3VHTC 4B6WA 4ZRJA 4RM9A 1V86A 2N4FA 2KK8A 4W9FA 3RYTA 1YX5B 4FJZA 3KH0A 3VTWA 1E8YA 3CSFA 1ZKHA 1R4MI 2IZVB 2IO1B 2REXA 3U30A 4CYEA 3PRZA 1LFDA 2Z0DB 4FN2A 3RT3B 1P9DU 3KYDD 3GOEA 1WJNA 2DZKA 4IWQA 2BGFA 3A33B 1LM8B 2L8JA 3H1UA 3DVNU 4BKGA 4J6IA 5C1ZA 3A1QB 3UF8A 4CHKA 4MJSB 1IPGA 3UGBB 5L83A 1YQBA 3U8ZA 4IM0A 4I6PA 4JQWC 2GBNA 3I3TB 3L16A 2KLGA 3AU5A 4PYUA 4IWPA 4TQ0A 2N7EA 4DDGD 4ICVA 4LCDE 2C7MB 4AWJA 1XQQA 1TZ1A 5FR6A 4TV3A 2CU1A 4PYZA 1OEYA 3QAQA 3ZRFA 4ANXA 3AXCA 3PT2B 3JSVA 5E6OA 2D3GA 2KMCA 4K1RB 4A20A 3ZRCA 2IO2B 2D07B 3ZNID 1C3TA 1WY8A 2KTRB 2LASA 3V60A 4AP4C 3IVFA 2C9WB 3OAWA 1WYWB 1Y8RC 2NBUA 2HTHA 2L7RA 3IHPC 3L17A 3DVNV 2MBHA 4G11A 4WWOA 2BKFA 2BWES 1Q5WB 4ANVA 4KIKA 2M17A 3ZNHB 1E8WA 1J0GA 4F1SA 2KDIA 3ALBA 2FUHB 1V80A 2HJ8A 2DAFA 3SD5A 1WRDB 4AUQC 1QZEA 5DPRA 3VUYA 1A5RA 3RUIB 4HCNB 5J18A 1WM3A 4M0WB 1KLVA 1KOTA 4A3OA 2MP2B 2FCQA 1WX7A 1GJZA 1WI0A 1AARA 2LRUA 3Q3JA 1OEYJ 2JRIB 1J19A 4JGHB 4KSLC 3ML8A 3A9JB 2KXJA 3HK0A 3PZDA 3TCAA 1E5WA 3H9DA 1KJTA 3APFA 4XZ4A 4IG7B 2LXCA 3ZTCA 5IA7A 1UELA 2LVPA 1UH6A 2AYOB 2KX3A 4K7UA 1WJ4A 2KD0A 2OJRA 4KDIC 4M8MA 4X57B 4LJPB 1SE9A 2EMTA 4HCPB 3APDA 2MRPA 4XC2A 1ISNA 2JRHA 2WYQA 1XD3B 5D7GA 4HVBA 2NBWB 3H6NA 3RULA 3OLMD 3PLVA 3VUXA 1V49A 1WH3A 3LJ3A 2K25A 5E6NA 4BBNF 1WGYA 2B3AA 3KVFB 4W9LA 1E90A 1GUAB 2O2VA 4W9IA 3ZLZA 1P0RA 2WX1A 5D6JB 3VTUA 1WXSA 4AJYB 3DBHI 1S3SG 2N9EB 4FADA 1YIWA 2L76A 2FCMA 1T0YA 1Z2MA 3QQ8B 3VAWA 1L7YA 1WFYA 2KFKB 1ZGUB 3JVZX 3WAMA 3ZO5B 4DHJB 2AWTA 2M8SA 4ANWA 4TKNA 3IBEA 4BKSD 2R2QA 1RAXA 2N1VA 5AZGA 3WALA 2KMAA 5KHQA 3ECIA 3DCGA 2CR5A 2L3ZA 4NQKE 5E6PA 3UQBA 1WJ6A 4ZRKA 4K7SA 2IY0B 2KNBA 3L10B 3TMPB 3A4SC 1E8XA 2JF5A 4DDID 2DZMA 4NPNA 2DYMA 2FCNA 4BOZB 3DQVA 2LUEA 1UBQA 2BYVE 4II2B 4DHZB 3OJ3A 3UIPB 4KVGB 4W9HA 3PVLA 3KYCD 4KDLB 2DHZA 5JHBA 2MBOA 2K6DB 2V4LA 1WXVA 3A1QA 3ZKJC 4I6NB 1X1MA 4MJSA 2VRRB 1S1QB 2KC1A 3CSTA 5G2NA 2DZJA 1TBEA 2L0TA 2FNJB 4IC7B 5CTRC 2CKHB 2KJHB 3OJ4B 2LI5A 4WJQA 1P98A 4GGQA 4B9KA 3DBRI 2C7NB 2DENB 2J0JA 2JWZA 4NJ6A 2NS5A 4DK5A 3QC8B 4LDTD 1YX6B 3R7RA 4MH0E 3VH3B 3K9PB 3TBLD 4XX5A 1V6EA 4GXBA 2HE7A 4JLCA 5DCNA 2BWFA 4I6LB 1JRUA 4CO7A 3M63B 2LRWA 2KQ7A 2ZVOA 2KTRA 1RFAA 4WJOA 3L13A 2RSUA 1P1AA 2J0KA 3TJPA 3ZTDA 4FJVB 5DPSA 1KM7A 4DWFA 2NPTB 1VD2A 4GDLB 2JUOA 2IYDB 3V62A 5AZHA 2FIFA 3T9LA 1WJUA 2AL6A 2UWQA 3TIXA 4KZ0A 3Q3FA 4FLHA 2DZIA 1H8CA 4NY0A 3VVWB 1RLFA 4W9GA 2ZCCA 2K1FA 4LDTB 2ZNVC 3PTFC 4NAWB 5CHFA 1E8ZA 1WE7A 2MP2A 2N9XA 4ICUA 3RCZA 2KC2A 2LXAA 2KO3A 3AU4A 2BYEA 3A9JA 4KZCA 4EZJA 3QCAA 4DXAB 2L0FA 2GBRA 3ZVVA 1V81A 3MTNB 3D32A 2DAJA 4HDQA 2A5UA 4EOYA 3PSEB 2I1KA 2XK5B 3WAPA 4AOFA 2LGYA 1UBIA 2MX2A 2PJHA 2MBEA 3QHTA 4F7ZA 3WANA 2KWUB 3A9KB 2FCSA 2KKCA 2G4SA 1WX9A 4RM8A 3V61A 3N3KB 2C60A 2KANA 5JZEB 3VFKA 2RD0A 4WWPA 2M0XA 1WIAA 2AL3A 3B0AA 1P3QU 5CHWA 3A4RA 3L08A 2ZCBA 2PE6B 1WF9A 2QHOA 3M3JA 3KUDB 3QARA 3MJWA 4G3XB 4KIKB 2W9NA 4WAAA 1E7UA 3M95A 4FHKA 1OTRB 3ZDMC 1SIFA 4FBJB 2KLCA 2D2QA 4IUMB 1WMHB 1V5OA 2K8CA 3DPDA 2CS4A 3ML9A 3HHMA 1TTNA 2KFKA 3ONSA 3H7SA 2K39A 1SGHA 1WZ3A 1H4RA 3DDCB 2KOXA 1WGHA 2BF8B 1TGZB 1OGWA 2KWVB 4TUUA 4GB9A 2N9PC 2RR9A 4FJYA 2EKEC 2Z59B 5JHAA 4JL9A 1EUVB 2LVQA 3PPAA 4PS3A 5DPWA 5LLIA 4DBGA 1BT0A 2M4NA 5JH5C 2GOWA 2KDFB 2KDBA 2KJRA 5D94A 4JIOU 3X23A 1M94A 1Z5SB 1WGDA 3L54A 1WR6E 2NCNA 4ZRIA 2V3SA 2FIDA 2K8BA 2WX0A 3R3MA 3TL5A 2GBMA 4DHJD 1WE6A 2RPQA 3VQIA 4W9KA 2JZ3B 3QX1A 3PS6A 3R7QA 5AZFA 2JVCA 3QJZA 3VUWA 5AEKB 2MA9B 2EMSA 2PEAA 4GOCA 4MGYE 1Q1OA 3KUZA 4BKSA 1UD7A 4E3CA 1WGGA 2K6QA 2LJ5A 3K9OB 4GMVA 2LVOA 3V6CB 2C5LC 4MEMA 3X0WA 4MM3A 4E71A 5D2MB 1D3ZA 3DOWA 3EC8A 4TQ1A 4GU2A 4RMAA 4G50A 3S2AA 4YL8A 2NR2A 4BOSC 3H7PB 1XT9B 2JXXA 3L0WB 1MG8A 2YLMA 3NHEB 3HM3A 4HWIB 3HM6X 4II3B 2ZPYA 2MCNB 1IYFA 1NDDA 3SHQA 4M8NA 1GC7A 4WWNA 2KHWB 4NNJB 4W9EA 4HLEA 4EEWA 3PGEA 3DBSA 4HJKA 1CMXB 2N7DA 4BFRA 1V9JA 1V2YA 4HDOA 1IP9A 2PPHA 3W1YA 4URKA 4F8CB 4NQLB 3EFUA 5KHOA 3SU8X 4ANUA 4MDKE
chains in the Genus database with same CATH superfamily
2O6VB 1BUIC 4ZHPA 1R4MB 2H88B 2A4ZA 4GDLA 5HFYA 3ZUNA 2MHJA 3LXFA 2ON8A 2HD5B 1FNWA 4LJOB 4NAWA 3TEZA 2L83A 1GC6A 1WSPA 2QJLA 1YOVB 1I35A 4NAMA 4JX1C 1QOBA 1L4ZB 3JYUA 3HIZA 4YXDB 1L0XB 1C79A 3EECA 1VDVA 4B0EA 1QILA 3A9KA 4AQ7A 2R2OA 3O13A 2QC8A 2XBBC 3ZIMA 3IFWB 4US9A 2C7HA 1SXTA 4ZYNA 1FNVA 2V1YA 1HE8A 3MC0B 3BINA 2PTLA 2FUG1 1MHHE 4YTPB 4LNNA 3N1ZC 1G6JA 2E6XA 3PHXB 5FK9C 2CHXA 1U4AA 1VCBA 3Q2AC 1MG4A 2H89B 3PHWB 2DWQA 2J0MA 4HPMB 4EZLA 2V0GA 2IBIB 2ZNVB 4E74A 1SSNA 4CQNA 1FRDA 4PS8A 1VZ8A 2K8HA 3AEGB 4K3CA 1JRPA 1A70A 2IY1B 2RDBC 2ZZPB 4WJPA 1UZXB 3ABVB 2SAKA 2MLBA 3PV1A 1EF1A 4REZA 3NJTA 4YTMB 4W9DA 2NVUI 3FAHA 5TSSA 5LXIB 1FM0D 2INPE 1MVKA 1GG3A 4BBNC 4P1CC 1I4QA 4A55A 3DVGX 2LJIA 4FXCA 2LGDA 2O2VB 3RZWC 4OVUA 2J7QB 2KN5A 4UDUC 2QEJC 2I1JA 3GZNB 3GZNI 3N1YC 2MSED 3R66C 4LTUA 1OQYA 3M62B 1UGMA 3VHTC 4P6VF 1V86A 1AWDA 3KH0A 2DBYA 1E8YA 3ZQ4A 2IO1B 4CYEA 3RT3B 1P9DU 3NVVA 1LO5D 1WJNA 3GOEA 4IWQA 2D5GA 1L6VA 4BKGA 5C1ZA 3IAS1 2WU5B 5L83A 3U8ZA 4I6PA 2WXQA 4TQ0A 2N7EA 4DDGD 4AWJA 2X38A 2LHDA 5FR6A 3EGRA 3ZRFA 4ANXA 1EM7A 2NTTA 5E6OA 3DWGC 4A20A 2IO2B 2D07B 2L52A 2WXMA 1WY8A 2QCZA 2HTHA 2MBHA 1TS4A 5BYSA 1VZ7A 4ZRQA 2BWES 1Q5WB 4KIKA 1HZ6A 4MH8A 4C56C 1J0GA 3ALBA 3P63A 3U4EG 4YWGG 2HJ8A 4AUQC 3SD5A 1WRDB 3VUYA 4HCNB 5J18A 4M0WB 2MP2B 2V4IB 4HRSA 1WX7A 1MHXA 3Q3JA 1OEYJ 4JGHB 3A9JB 1UWMA 1E5WA 4LK0M 2LVPA 2GI9A 1WJ4A 2OJRA 3Q8EA 1FFVA 2WXOA 4LJPB 2KT7A 2WDRB 4JPSA 3APDA 2WYQA 4A8XC 1XD3B 3H6NA 3RULA 3VUXA 1V49A 3LJ3A 5E6NA 3BYTB 2B3AA 1E90A 3AN1A 1GB1A 4XDDA 3VTUA 1WXSA 3AE3B 1S3SG 2N9EB 2WXIA 1VR9A 1YIWA 2KACA 2L76A 1L7YA 3ZO5B 3JVZX 2M8SA 4BKSD 2B76B 5E6PA 3A4SC 4DDID 5BMGA 1JCKB 4KVGB 3PVLA 4KDLB 3Q8CA 1NI3A 2MBOA 2AQ3B 3A1QA 1WXVA 4I6NB 2JSVX 2VRRB 4DXFA 1S1QB 2M0AA 3CSTA 5G2NA 2DZJA 1TBEA 1JW9D 3RMKC 4MM3B 2DLBA 2NS5A 2XN9C 1D6EC 3K9PB 3VR9B 3AE4B 2HE7A 3AECB 5DCNA 2R61A 4JWSC 2BWFA 5BMHA 1JRUA 2HJ1A 3R8BA 2CJOA 2N0SB 5H8YE 2WXJA 1RFAA 2WXLA 3U52E 2LUMA 1D5XC 5D3DA 5DPSA 4K3BA 1KM7A 4DWFA 4GDLB 2JUOA 3V62A 4JE3B 1WJUA 4KZ0A 2DZIA 1H8CA 4NY0A 3VVWB 1TS5A 4W9GA 2ZCCA 2ZNVC 4A90A 4NAWB 1E8ZA 1RFKA 1FCCC 4KZCA 2RMMA 4DXAB 3RNGC 2GBRA 3ZVVA 4HROA 1XCTL 1V81A 1TT5B 3D32A 4HDQA 4EOYA 2KWUB 3A9KB 2G4SA 1WX9A 4RM8A 5FR3A 2VH1A 2RD0A 3Q8AA 2AL3A 1P3QU 3IT6B 4YSYB 2PE6B 4G3XB 4LLGM 2KMMA 4FHKA 3ZDMC 3OWEB 2KLCA 5IP4D 4IUMB 2KYWA 3ML9A 1TTNA 1C4CA 4H2AA 1TKGA 3AE8B 1WZ3A 3DDCB 3TEWA 3Q8FA 1N63A 1OGWA 1TGZB 5JHAA 1VLBA 1SBBB 1K53A 2NCNA 4ZRIA 2FIDA 3KWVA 3TL5A 3W5VB 4IDIA 2WXHA 3R7QA 4WAFA 3VUWA 5AEKB 1JALA 4TMAB 1YJJA 4E3CA 1WGGA 3P4QB 2G9HD 2C5LC 4MEMA 3X0WA 3RNBC 4TSSA 4TQ1A 2ONQA 4R3DA 3S2AA 3E9SA 3NUHB 2NR2A 1IYFA 3BVMA 3SHQA 2KHWB 4EEWA 1IP9A 1CMXB 4HDOA 2FBWB 4F8CB 4OHJA 3EFUA 5KHOA 1GB4A 4MDKE 4WQOB 4EKUA 4PK1A 1J8CA 2L05A 4NJ7A 4FHJA 2KWCA 4MSMB 2MJDA 3VTVA 2OOBB 1AN8A 2IO3B 3HUIA 5CX3A 4MSQB 2ZVNA 1E9MA 1UGJA 2Z0EB 2AEHA 1I42A 3Q3OC 3W1SC 3C19A 1XF5L 4ASWC 1WXQA 3IG3A 1T6BX 1DOIA 2KJ6A 4IWOA 3APCA 1J7AA 5EDSA 3QK0A 2PE9A 2CHZA 4IM2A 3ZW3A 5TR5A 3NZUA 3W1SA 3PO0A 2JYEA 3NOBA 3MC9A 5J2RA 1GNUA 1T0RC 2MW5A 3ZJUA 4HK2A 2GBJA 2RGFA 1QF6A 1YJIA 3MHZA 3B08A 5GMVA 2D10A 1F9JA 1CQVA 4PS7A 4HPLB 1SF0A 2NTSA 5BMIA 5CHVC 3DVGY 2MWSB 1GOZA 4MACA 2KDEB 1V5TA 1ZW7A 2G45B 4MGIE 1JROA 4P16A 2J42A 1N60A 2GMIC 3QA8A 4M00A 1WWTA 3N32A 1WR1A 5BYRA 3AI5A 3RNEC 4EUTA 1ZXIA 1TS3A 2WS3B 1QLBB 3PZ8A 1L2NA 3PREA 5G55A 2JXTA 2NBVB 3AEBB 2O6VD 4BVUC 3UQAA 2ZEQA 2ZPNA 5GXGB 3ZGZA 2WXRA 2CJNA 2FE8A 4EE2A 4C7ZA 2AQ2B 3JW0X 4ZDVA 3KWLA 1XLQA 1WGKA 2IO0B 4AJWA 2LGXA 1C78A 2M56B 4W9CA 3RZFA 1V8CA 3QWZB 3BY4B 5HKHA 4GDKA 1DOYA 2G3QB 5C23A 3ZNGC 1YJ1A 3V6EB 2BS3B 4ZRJA 2PLPA 4RM9A 2N4FA 2W54A 1YX5B 4FJZA 1R4MI 3T3NA 1KF6B 2REXA 3U30A 4FN2A 2K5PA 3KYDD 1C4PA 1C4AA 3A33B 2L8JA 3H1UA 4J6IA 3A1QB 3UF8A 3OG5A 1IPGA 2RDGA 3UGBB 1FMAD 1YQBA 2HTME 4JQWC 3I3TB 3L16A 3AU5A 4IWPA 4ICVA 2C7MB 1XQQA 1TZ1A 2JQRB 2PVOD 3NVYA 4PYZA 1OEYA 3QAQA 3PT2B 1NVID 4YT0B 2D3GA 3ZRCA 2Y5CA 3ZNID 4AP4C 4HPPA 3IVFA 3OAWA 2C9WB 1Y8RC 2NBUA 2L7RA 3L17A 3UI3A 3DVNV 4WWOA 4A6QA 4ANVA 2M17A 1ACCA 1E8WA 1E6EB 1V80A 4DXGA 2DAFA 3GE3C 1KLVA 4A3OA 2FCQA 3DHIC 4RFBA 1GJZA 4N6EB 2D3BA 2W3SA 5H92C 1PGBA 3PZDA 3TCAA 2BS2B 3APFA 3AE1B 2LXCA 3ZTCA 1UELA 1UH6A 2AYOB 4KKJA 2KD0A 2EMTA 4XC2A 2JRHA 4LNIA 5D7GA 4KX6B 2GB1A 2NBWB 1FXIA 3OLMD 5IO9A 2K25A 4BBNF 2WXFA 4W9LA 2WP9B 1ZP0B 4W9IA 3ZLZA 1P0RA 1N61A 2Y5PA 2WX1A 4AJYB 3WAMA 1ZGUB 2AWTA 3I63C 4ANWA 4TKNA 3IBEA 1RAXA 2PIAA 3WALA 2DNFA 2RDHA 1NYQA 1RM6C 1T5XD 1WJ6A 1NEKB 4LNKA 2DYMA 2INCC 1PFDA 1UBQA 2N7JA 5EE0A 1I4GA 3KQ4A 1V1PA 4DHZB 3UIPB 2DHZA 4XGAB 2OJWA 1DOXA 2AX5A 3RPFC 4IC7B 5CTRC 3OJ4B 5EE3A 2C7NB 2JWZA 4DK5A 3BIID 4HEA1 4WH4A 4LDTD 1YX6B 2ACZB 3R7RA 1OFFA 1QOGA 4MH0E 3TBLD 4ZHOA 4XX5A 4A9AA 3ZYYX 3BZDB 2LRWA 3N9YC 2ZVOA 2KTRA 2J0KA 3ZTDA 3AMZA 4HKQA 2FIFA 3T9LA 1E10A 2N9KA 2UWQA 1AYFA 1JWAD 2K1FA 4LDTB 2YEPB 4N58A 3BYYB 3RN9C 3MC8A 3MTNB 2IDYA 2BB5A 2MX2A 1UBIA 2UU7A 1FXAA 1ZXHA 1ZOYB 3WANA 2FCSA 3TEXA 3V61A 2KANA 5JZEB 2V3PA 3VFKA 2M0XA 3A4RA 3L08A 2ZCBA 1YQ4B 3KUDB 2W9NA 2TSSA 2LEKA 3M95A 4XE0A 3AE5B 3DPDA 2K8CA 2J4XA 3NVWA 1IUEA 2KN4A 3H7SA 4L2YA 2K39A 1H4RA 2BF8B 1KLUD 1FNUA 1N5XA 2OHFA 2NMQA 4GB9A 2RR9A 4JL9A 3B2FA 1ZE3D 2M4NA 5JXVA 1TKYA 2KDBA 1K52A 2KJRA 4JIOU 1Z5SB 1WGDA 3L54A 1WR6E 2LFIA 1JWMD 2V3SA 2RPQA 3C8YA 3PS6A 5AZFA 2MA9B 4BZAA 2EMSA 2PEAA 4MGYE 4RH6A 1Q1OA 3NZ3A 3P4SB 1UD7A 2KVZA 1L0YB 2LJ5A 2WDQB 3K9OB 4DQOC 3V6CB 4Q2JA 1MPEA 5D2MB 1I4HA 3DOWA 4G50A 4LNOA 3BVZA 3AEDB 4BAXA 1XEEA 3ZJVA 3NHEB 1MG8A 2YLMA 4HWIB 2MCNB 3HM6X 4B0MA 4WWNA 4NNJB 4W9EA 3PGEA 3AE7B 2N7DA 3BVGA 3VRBB 2PPHA 3W1YA 4ANUA 1ET9A 4GDKB 4PT5A 2DYOA 1QT9A 2NPTA 2BW2A 5L95C 3RNAC 1VJKA 3O65B 1WX8A 2KQSA 4EFOA 1WRIA 2DX5B 1IGCA 3RNCC 4ITKA 2INDC 5EE1A 3WA0A 2GBKA 2DYBA 4A3PA 3MHSD 1FD6A 2BKRB 1N5WA 1WM2A 2L00B 2WXNA 4KKIA 1LGRA 1FO4A 1WZ0A 2BYFA 2KFJA 4OW0A 3URYA 1FRRA 4MT5A 4N9F4 2KZRA 3P2BA 1CJEA 3SDLC 1HZ5A 4GN1A 3U7ZA 5G5GA 2LMCA 1M4VA 4IW0A 2WXKA 3SEBA 4OZBA 3B1LX 3NVZA 5T8IA 5IOIA 5AUIA 4C80A 4IM3A 2KTFA 2XNAC 1WMHA 2JU6X 3LDZE 3ZDTA 4XYCA 4RGTA 3KW5B 4EZKA 3WAOA 5BO4B 2M1MA 1WGRA 2VH2A 3HRDD 3VRAB 1ZUD2 3SFEB 2WWZA 4ZOHC 1XXGA 4KGSA 2LWPA 1YD8U 3I5JC 1ROEA 2ZJDA 1CK1A 2WDTB 3AULA 1JWSD 2ZW0A 2MQJA 4M01A 3GP7A 2INNE 4HXDA 3PLUA 1QOFA 3UINB 3VH4B 3QIJA 2KVRA 2FAZA 3ETRA 3NS8A 1KLGD 3P4RB 3DBLB 1YQ3B 3R2IA 4MELA 3DBLI 4ARCA 3RI7C 4MGKE 3AM9A 2Y3AA 2JWUA 3TUOA 2WLBA 3T8MA 3W5UB 2XEWA 2JZZA 1NBFC 2BPSA 2CHWA 2LGIA 5I4DA 1NI2A 3RD2A 3IXSA 1DGJA 4US8A 2K9XA 4B6WA 2KK8A 1ZKHA 4NZLB 1F1HA 2HDEA 3ZJTA 1V1PB 3AE6B 3MFGA 3DHGC 1EWYC 4O1NA 4IM0A 4OZCA 5MPOA 1YMHE 4PYUA 1R7SA 4IKGA 2WXPA 3AXCA 3JSVA 3V60A 2KTRB 3EA6A 1WYWB 1AW7A 1XLOA 3LB8C 1KTKA 4G11A 3ZXVA 1Y56A 4GLSC 2BB6A 4L23A 3ZNHB 2FUHB 2BTEA 3TSSA 2N9LA 1WI0A 1AARA 1SE4A 1J19A 4KSLC 4C7YA 4RF1A 4XZ4A 4ZYSA 5IA7A 3T3OA 4K7UA 2KX3A 1HA5A 4X57B 4HCPB 1ISNA 4HVBA 5BYQA 4P1BC 1WH3A 1RYJA 3L4PA 1WGYA 3NRZA 3AEFB 5D6JB 4FADA 3PZ7A 2FCMA 3VAWA 1Z2MA 3QQ8B 1WFYA 5G5HA 1OQRA 2BQQA 1JQ4A 1L6UA 2KMAA 5KHQA 3ECIA 2CR5A 1KRHA 3UQBA 1J7CA 2IY0B 2KNBA 3TMPB 2J53A 1E8XA 2EELA 4NPNA 2WNMA 2D3AA 4BOZB 5C2TB 3DQVA 2LUEA 2BVCA 2BYVE 4II2B 3CWIA 3OJ3A 2IGDA 2MJ3A 2G1EA 1QKZA 5JHBA 2D3CA 2K6DB 2KDMA 4MJSA 4D2KA 2FNJB 3DBRB 2CKHB 2KJHB 4C00A 3V3XA 4B9KA 1C76A 3DBRI 2DENB 4ARIA 2J0JA 3Q69A 3SR6A 1KFYB 3N1XC 1V6EA 4GXBA 3Q14C 4I6LB 4CO7A 2KQ7A 2PKOA 3MP9A 2RSUA 3WCQA 3TJPA 1NENB 1YN4A 1GAQB 2NPTB 1T3QA 4FLHA 1PGAA 1MI0A 1RLFA 5CHFA 2E3TA 1VRAB 2X8XX 3AE2B 5E6JA 2BS4B 1JWBD 2KC2A 2KQ4X 2KO3A 3AU4A 2BYEA 1ZPSA 4J3OD 1TYGB 4YSXB 1UNSA 1T0QC 2DAJA 2PVGC 2A5UA 2K3UA 3LYYA 4AOFA 1F2RC 2MBEA 4F7ZA 1XO3A 2C60A 4WWPA 1WIAA 5CHWA 3J9CA 3M3JA 1E7UA 2W82A 5D3IB 3Q3NC 1WMHB 3FILA 3HHMA 2VZKD 2KFKA 3ONSA 1SGHA 1PYWD 2KOXA 2KWVB 1JWUD 1EUVB 2JZPA 2L1AA 1MFWA 2LVQA 3FKYA 3PPAA 4PS3A 2QIEB 2QDFA 4DBGA 5JH5C 3Q6BA 2MJEA 3ZXRA 5D94A 1M94A 1F77A 5IN7A 3GE8C 2K8BA 3R3MA 2ICIA 4DHJD 2GBMA 1WE6A 3QX1A 2MEKA 2JVCA 2VZKB 1SJED 3I57A 4XWTA 2K22A 4GOCA 3KUZA 4GMVA 2K6QA 2WDVB 3EC8A 1VZ6A 4GU2A 4C4VA 4BOSC 2K0PA 1IBXA 4M8NA 2IGHA 4HLEA 3AV8A 3DBSA 4BFRA 1V2YA 4NQLB 3W2DA 4DHJB 2WGSA 3SU8X 4AS1A 1R4NB 2PW9A 3MJ5A 2JPHA 1TKEA 1C9FA 4JWUC 1FCLA 1R4NI 2WHIA 3UIOB 3WIMA 3VDZA 5J17A 1Q10A 4FULA 1WXMA 4S17A 5IAAC 1HTOA 1PUTA 2Z8LA 3HVZA 3ZNZB 1XLNA 1RRBA 3TEYA 5DPTA 3PRMB 3VR8B 3V05A 1B1ZA 4KSKC 4BKTA 1I4PA 3GS2A 1LQBA 1FXTB 3BK1A 3NZSA 4GSWA 4NJCA 1K51A 2MBQA 2XK5A 2W55A 2MH7A 3PRPB 4RNAA 2ZW1A 1ZDXA 2QSDA 1F0ZA 4FA6A 3AH7A 3JSVB 2BBCA 1LXDA 2YVCA 3U7DA 3NY5A 1E0ZA 5LXHA 4OVVA 4P7IA 1E7VA 1YN3A 1N62A 1P7EA 4LNFA 3CIRB 1TJEA 4KGTA 3Q8BA 3EHVA 1EU4A 3NS1A 3CMMB 4HJGE 3E56A 3VXWA 2JY6A 1WXAA 4S0RA 2Y5BB 4K81A 3U2SC 4DHZE 1C1YB 1EF5A 3ENEA 2KX0A 2LZ6A 1SIJA 2JT4B 4K7WA 2MBBB 3IAM1 4B95A 2LD9A 4G0NB 4YSZB 3AB5A 1Q0WB 1ET6A 4GIVA 2N1WA 3N30A 3CF6E 1I7HA 4KV2A 1KH0A 1OQQA 3DHHC 4YTNB 3P42A 4WQMA 3H7PA 1K8RB 1TY2A 1BMLC 4W9JA 3B9JA 1UWXA 3KUCB 3P4PB 2UYZB 1T0SC 3C0RB 2O6VA 2ASQA 3FC4A 2D11A 1PQSA 4WJNA 2G4DB 1EO6A 4MGZE 2KAJA 2QMTA 1EU3A 3RYTA 3AEEB 4W9FA 3VTWA 1XLPA 3CSFA 5HG2A 2IZVB 1P7FA 1WYGA 3PRZA 1LFDA 2Z0DB 1FFUA 1N6ZA 2DZKA 2BGFA 1LM8B 3DVNU 4CHKA 4MJSB 4RF0A 1QQRA 2WU2B 1D5MC 2GBNA 5HI1A 1SE2A 2KLGA 4OVZA 4WURA 2M19A 1IGDA 1J7BA 4LCDE 3AE9B 2JYTA 2AQ1B 2CU1A 4TV3A 3EFCA 1TY0A 4RCOA 1ENFA 4RGOS 1XCQL 2KMCA 4K1RB 1C3TA 2LASA 2J52A 5EE9A 3IHPC 2LGSA 3DWMA 2PMVA 2BKFA 1K50A 1DYQA 4F1SA 2KDIA 1SEBD 1V1OA 2WXGA 1QZEA 5DPRA 1A5RA 3RUIB 1KOTA 1WM3A 4QAYA 1BXTA 2LRUA 1F52A 2JRIB 4KGRA 5IKCM 3ML8A 2BT6A 2KXJA 3HK0A 3H9DA 1KJTA 4IG7B 3BK2A 4M8MA 4KDIC 4M02A 1SE9A 2MRPA 2KWDA 2GRIA 3KLSX 3PLVA 3KVFB 4ZRPA 1FIQA 1GUAB 2O2VA 1L5PA 3DBHB 2W3RA 1F2RI 5AUKA 3DBHI 2Q5WD 1YNTE 3FILB 1T0YA 2GLSA 2KFKB 1TIFA 3SFDB 1EWCA 2R2QA 2N1VA 5AZGA 1QOAA 3DCGA 2L3ZA 1FPYA 4NQKE 4ZRKA 1I4XA 4K7SA 3L10B 2JF5A 2DZMA 2CU3A 2FCNA 2V3NA 3R2TA 2YEPF 4USAA 4W9HA 1MJDA 3KYCD 1UUPA 2V4LA 3ZKJC 3RFZB 4HKZE 1X1MA 3IT4B 2KC1A 5FKAC 2L0TA 2BYTA 1NYRA 2LI5A 1FEHA 1P98A 1ZDVA 4GGQA 4WJQA 1GPXA 4NJ6A 1PDXA 3QC8B 1SJHD 3VH3B 4C4VB 1IBXB 4JLCA 3M63B 3Q3MC 4WJOA 3L13A 1UF0A 1P1AA 2RPVA 2WQYB 4FJVB 1ESFA 1VD2A 2EKIA 2IYDB 4ACFA 5AZHA 2AL6A 3TIXA 3Q3FA 1STEA 3N20C 4L1BA 3PTFC 1WE7A 4M0WA 2MP2A 1D4BA 2N9XA 5C3JB 4ICUA 3RCZA 2LXAA 2V9HA 1C77A 3A9JA 4EZJA 2IPKD 1HXYD 3QCAA 2L0FA 3HVDA 5LNK1 1L0VB 4RGNA 3PSEB 2I1KA 2XK5B 3WAPA 2LGYA 1HQRD 2PJHA 3QHTA 2I38A 1TS2A 1RWSA 2KKCA 3N3KB 5HHDG 2L32A 3BWUD 2IJ0A 3B0AA 3RNFC 1E7PB 1WF9A 2QHOA 3QARA 3MJWA 4KIKB 4WAAA 1YN5A 1OTRB 4IOIE 1SIFA 1B9RA 1V97A 2D2QA 3B2GA 1V5OA 2CS4A 2I2YA 4WWMA 1WGHA 2QILA 4TUUA 3NG0A 2N9PC 4FJYA 2EKEC 1I4RA 2Z59B 3EUB2 5DPWA 5LLIA 1BT0A 3H8HA 2GOWA 2KDFB 1L4DB 3GB1A 3X23A 2JX5A 3P1MA 1D5ZC 1HTQA 2WX0A 4OZAA 1HEZE 2SEBD 3VQIA 1PGXA 4W9KA 2JZ3B 3W9CB 4WIPA 4XWWA 4N59A 3QJZA 3AEAB 3I9V1 4BKSA 2LVOA 4E71A 1TZOA 4MM3A 1D3ZA 4XDCA 4RMAA 4RGMA 1SB3C 2IGGA 1JMLA 4YL8A 3H7PB 1XT9B 2JXXA 3L0WB 3HM3A 4II3B 2ZPYA 1NDDA 1GC7A 1CZPA 4HJKA 1V9JA 1SE3A 2OEDA 4URKA 4FBJB 2LHEA
chains in the Genus database with same CATH topology
2O6VB 4WQOB 4EKUA 2JPHA 4GDKB 1J8CA 2DYOA 2NPTA 2A4ZA 2L05A 4GDLA 5L95C 4NJ7A 1R4NI 3UIOB 3WIMA 3VDZA 4FHJA 3ZUNA 5J17A 4FULA 3O65B 1WXMA 1WX8A 2KWCA 2KQSA 4MSMB 3VTVA 2OOBB 5IAAC 4EFOA 2HD5B 2IO3B 5CX3A 3ZNZB 4LJOB 4MSQB 2ZVNA 2DX5B 4NAWA 2Z0EB 2AEHA 1I42A 1RRBA 1GC6A 5DPTA 3PRMB 3W1SC 3WA0A 1I35A 4ASWC 2GBKA 4KSKC 4BKTA 2DYBA 4A3PA 3MHSD 3IG3A 1LQBA 2BKRB 1FXTB 1WM2A 3NZSA 2KJ6A 2L00B 3JYUA 4IWOA 3APCA 5EDSA 4GSWA 3HIZA 3QK0A 2PE9A 2CHZA 1WZ0A 2BYFA 3EECA 2MBQA 4IM2A 2XK5A 3ZW3A 5TR5A 3NZUA 3W1SA 2KFJA 3NOBA 3PRPB 4N9F4 3A9KA 2KZRA 5J2RA 3P2BA 2R2OA 1GNUA 3SDLC 2XBBC 3ZIMA 3IFWB 2C7HA 2MW5A 4GN1A 4FA6A 4HK2A 2GBJA 2RGFA 3JSVB 1LXDA 2YVCA 3U7DA 4ZYNA 3B08A 2V1YA 1HE8A 3NY5A 4IW0A 5GMVA 2D10A 3BINA 1F9JA 5LXHA 4OVVA 3B1LX 1E7VA 4P7IA 4IM3A 2KTFA 1G6JA 1WMHA 3PHXB 4PS7A 3LDZE 4HPLB 2CHXA 1U4AA 3ZDTA 3KW5B 5CHVC 1VCBA 4EZKA 3DVGY 2MWSB 3EHVA 3WAOA 3CMMB 2KDEB 1V5TA 1ZW7A 2G45B 4MGIE 5BO4B 3VXWA 3PHWB 2J0MA 4HPMB 4EZLA 2JY6A 2M1MA 1WGRA 1WXAA 2IBIB 2Y5BB 2ZNVB 4K81A 4E74A 2GMIC 3QA8A 1C1YB 4DHZE 1EF5A 4PS8A 2K8HA 2WWZA 3N32A 2LWPA 2IY1B 2ZZPB 3ENEA 2KX0A 4WJPA 1WR1A 3AI5A 1UZXB 2LZ6A 1YD8U 2JT4B 2MLBA 2ZJDA 1EF1A 3PV1A 4EUTA 4K7WA 2MBBB 4B95A 1L2NA 2LD9A 3PREA 4G0NB 4W9DA 5G55A 1Q0WB 2WDTB 2NBVB 2NVUI 4GIVA 2N1WA 3AULA 2MQJA 5LXIB 1GG3A 3N30A 4BBNC 2O6VD 4BVUC 3CF6E 4HXDA 3DVGX 4KV2A 3PLUA 3UQAA 2ZEQA 2ZPNA 3UINB 3VH4B 3QIJA 2LGDA 3H7PA 2O2VB 2KVRA 2FAZA 3NS8A 1K8RB 4OVUA 3RZWC 3JW0X 2J7QB 4ZDVA 4W9JA 4MELA 3KUCB 2KN5A 2IO0B 4AJWA 2UYZB 2LGXA 2I1JA 3DBLI 4W9CA 3RZFA 4MGKE 3C0RB 2O6VA 2ASQA 2D11A 3GZNI 3QWZB 3BY4B 3T8MA 5HKHA 1PQSA 2XEWA 2JZZA 1NBFC 2BPSA 2CHWA 2MSED 4GDKA 4WJNA 2G3QB 2G4DB 3R66C 5C23A 3ZNGC 1NI2A 1EO6A 3RD2A 1OQYA 3M62B 1UGMA 4MGZE 1YJ1A 3V6EB 3VHTC 4B6WA 4ZRJA 4RM9A 1V86A 2N4FA 2KK8A 4W9FA 3RYTA 1YX5B 4FJZA 3KH0A 3VTWA 1E8YA 3CSFA 1ZKHA 1R4MI 2IZVB 2IO1B 2REXA 3U30A 4CYEA 3PRZA 1LFDA 2Z0DB 4FN2A 3RT3B 1P9DU 3KYDD 3GOEA 1WJNA 2DZKA 4IWQA 2BGFA 3A33B 1LM8B 2L8JA 3H1UA 3DVNU 4BKGA 4J6IA 5C1ZA 3A1QB 3UF8A 4CHKA 4MJSB 1IPGA 3UGBB 5L83A 1YQBA 3U8ZA 4IM0A 4I6PA 4JQWC 2GBNA 3I3TB 3L16A 2KLGA 3AU5A 4PYUA 4IWPA 4TQ0A 2N7EA 4DDGD 4ICVA 4LCDE 2C7MB 4AWJA 1XQQA 1TZ1A 5FR6A 4TV3A 2CU1A 4PYZA 1OEYA 3QAQA 3ZRFA 4ANXA 3AXCA 3PT2B 3JSVA 5E6OA 2D3GA 2KMCA 4K1RB 4A20A 3ZRCA 2IO2B 2D07B 3ZNID 1C3TA 1WY8A 2KTRB 2LASA 3V60A 4AP4C 3IVFA 2C9WB 3OAWA 1WYWB 1Y8RC 2NBUA 2HTHA 2L7RA 3IHPC 3L17A 3DVNV 2MBHA 4G11A 4WWOA 2BKFA 2BWES 1Q5WB 4ANVA 4KIKA 2M17A 3ZNHB 1E8WA 1J0GA 4F1SA 2KDIA 3ALBA 2FUHB 1V80A 2HJ8A 2DAFA 3SD5A 1WRDB 4AUQC 1QZEA 5DPRA 3VUYA 1A5RA 3RUIB 4HCNB 5J18A 1WM3A 4M0WB 1KLVA 1KOTA 4A3OA 2MP2B 2FCQA 1WX7A 1GJZA 1WI0A 1AARA 2LRUA 3Q3JA 1OEYJ 2JRIB 1J19A 4JGHB 4KSLC 3ML8A 3A9JB 2KXJA 3HK0A 3PZDA 3TCAA 1E5WA 3H9DA 1KJTA 3APFA 4XZ4A 4IG7B 2LXCA 3ZTCA 5IA7A 1UELA 2LVPA 1UH6A 2AYOB 2KX3A 4K7UA 1WJ4A 2KD0A 2OJRA 4KDIC 4M8MA 4X57B 4LJPB 1SE9A 2EMTA 4HCPB 3APDA 2MRPA 4XC2A 1ISNA 2JRHA 2WYQA 1XD3B 5D7GA 4HVBA 2NBWB 3H6NA 3RULA 3OLMD 3PLVA 3VUXA 1V49A 1WH3A 3LJ3A 2K25A 5E6NA 4BBNF 1WGYA 2B3AA 3KVFB 4W9LA 1E90A 1GUAB 2O2VA 4W9IA 3ZLZA 1P0RA 2WX1A 5D6JB 3VTUA 1WXSA 4AJYB 3DBHI 1S3SG 2N9EB 4FADA 1YIWA 2L76A 2FCMA 1T0YA 1Z2MA 3QQ8B 3VAWA 1L7YA 1WFYA 2KFKB 1ZGUB 3JVZX 3WAMA 3ZO5B 4DHJB 2AWTA 2M8SA 4ANWA 4TKNA 3IBEA 4BKSD 2R2QA 1RAXA 2N1VA 5AZGA 3WALA 2KMAA 5KHQA 3ECIA 3DCGA 2CR5A 2L3ZA 4NQKE 5E6PA 3UQBA 1WJ6A 4ZRKA 4K7SA 2IY0B 2KNBA 3L10B 3TMPB 3A4SC 1E8XA 2JF5A 4DDID 2DZMA 4NPNA 2DYMA 2FCNA 4BOZB 3DQVA 2LUEA 1UBQA 2BYVE 4II2B 4DHZB 3OJ3A 3UIPB 4KVGB 4W9HA 3PVLA 3KYCD 4KDLB 2DHZA 5JHBA 2MBOA 2K6DB 2V4LA 1WXVA 3A1QA 3ZKJC 4I6NB 1X1MA 4MJSA 2VRRB 1S1QB 2KC1A 3CSTA 5G2NA 2DZJA 1TBEA 2L0TA 2FNJB 4IC7B 5CTRC 2CKHB 2KJHB 3OJ4B 2LI5A 4WJQA 1P98A 4GGQA 4B9KA 3DBRI 2C7NB 2DENB 2J0JA 2JWZA 4NJ6A 2NS5A 4DK5A 3QC8B 4LDTD 1YX6B 3R7RA 4MH0E 3VH3B 3K9PB 3TBLD 4XX5A 1V6EA 4GXBA 2HE7A 4JLCA 5DCNA 2BWFA 4I6LB 1JRUA 4CO7A 3M63B 2LRWA 2KQ7A 2ZVOA 2KTRA 1RFAA 4WJOA 3L13A 2RSUA 1P1AA 2J0KA 3TJPA 3ZTDA 4FJVB 5DPSA 1KM7A 4DWFA 2NPTB 1VD2A 4GDLB 2JUOA 2IYDB 3V62A 5AZHA 2FIFA 3T9LA 1WJUA 2AL6A 2UWQA 3TIXA 4KZ0A 3Q3FA 4FLHA 2DZIA 1H8CA 4NY0A 3VVWB 1RLFA 4W9GA 2ZCCA 2K1FA 4LDTB 2ZNVC 3PTFC 4NAWB 5CHFA 1E8ZA 1WE7A 2MP2A 2N9XA 4ICUA 3RCZA 2KC2A 2LXAA 2KO3A 3AU4A 2BYEA 3A9JA 4KZCA 4EZJA 3QCAA 4DXAB 2L0FA 2GBRA 3ZVVA 1V81A 3MTNB 3D32A 2DAJA 4HDQA 2A5UA 4EOYA 3PSEB 2I1KA 2XK5B 3WAPA 4AOFA 2LGYA 1UBIA 2MX2A 2PJHA 2MBEA 3QHTA 4F7ZA 3WANA 2KWUB 3A9KB 2FCSA 2KKCA 2G4SA 1WX9A 4RM8A 3V61A 3N3KB 2C60A 2KANA 5JZEB 3VFKA 2RD0A 4WWPA 2M0XA 1WIAA 2AL3A 3B0AA 1P3QU 5CHWA 3A4RA 3L08A 2ZCBA 2PE6B 1WF9A 2QHOA 3M3JA 3KUDB 3QARA 3MJWA 4G3XB 4KIKB 2W9NA 4WAAA 1E7UA 3M95A 4FHKA 1OTRB 3ZDMC 1SIFA 4FBJB 2KLCA 2D2QA 4IUMB 1WMHB 1V5OA 2K8CA 3DPDA 2CS4A 3ML9A 3HHMA 1TTNA 2KFKA 3ONSA 3H7SA 2K39A 1SGHA 1WZ3A 1H4RA 3DDCB 2KOXA 1WGHA 2BF8B 1TGZB 1OGWA 2KWVB 4TUUA 4GB9A 2N9PC 2RR9A 4FJYA 2EKEC 2Z59B 5JHAA 4JL9A 1EUVB 2LVQA 3PPAA 4PS3A 5DPWA 5LLIA 4DBGA 1BT0A 2M4NA 5JH5C 2GOWA 2KDFB 2KDBA 2KJRA 5D94A 4JIOU 3X23A 1M94A 1Z5SB 1WGDA 3L54A 1WR6E 2NCNA 4ZRIA 2V3SA 2FIDA 2K8BA 2WX0A 3R3MA 3TL5A 2GBMA 4DHJD 1WE6A 2RPQA 3VQIA 4W9KA 2JZ3B 3QX1A 3PS6A 3R7QA 5AZFA 2JVCA 3QJZA 3VUWA 5AEKB 2MA9B 2EMSA 2PEAA 4GOCA 4MGYE 1Q1OA 3KUZA 4BKSA 1UD7A 4E3CA 1WGGA 2K6QA 2LJ5A 3K9OB 4GMVA 2LVOA 3V6CB 2C5LC 4MEMA 3X0WA 4MM3A 4E71A 5D2MB 1D3ZA 3DOWA 3EC8A 4TQ1A 4GU2A 4RMAA 4G50A 3S2AA 4YL8A 2NR2A 4BOSC 3H7PB 1XT9B 2JXXA 3L0WB 1MG8A 2YLMA 3NHEB 3HM3A 4HWIB 3HM6X 4II3B 2ZPYA 2MCNB 1IYFA 1NDDA 3SHQA 4M8NA 1GC7A 4WWNA 2KHWB 4NNJB 4W9EA 4HLEA 4EEWA 3PGEA 3DBSA 4HJKA 1CMXB 2N7DA 4BFRA 1V9JA 1V2YA 4HDOA 1IP9A 2PPHA 3W1YA 4URKA 4F8CB 4NQLB 3EFUA 5KHOA 3SU8X 4ANUA 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V B;  4WQO B;  4EKU A;  2JPH A;  4GDK B;  1J8C A;  2DYO A;  2NPT A;  2A4Z A;  2L05 A;  4GDL A;  5L95 C;  4NJ7 A;  1R4N I;  3UIO B;  3WIM A;  3VDZ A;  4FHJ A;  3ZUN A;  5J17 A;  4FUL A;  3O65 B;  1WXM A;  1WX8 A;  2KWC A;  2KQS A;  4MSM B;  3VTV A;  2OOB B;  5IAA C;  4EFO A;  2HD5 B;  2IO3 B;  5CX3 A;  3ZNZ B;  4LJO B;  4MSQ B;  2ZVN A;  2DX5 B;  4NAW A;  2Z0E B;  2AEH A;  1I42 A;  1RRB A;  1GC6 A;  5DPT A;  3PRM B;  3W1S C;  3WA0 A;  1I35 A;  4ASW C;  2GBK A;  4KSK C;  4BKT A;  2DYB A;  4A3P A;  3MHS D;  3IG3 A;  1LQB A;  2BKR B;  1FXT B;  1WM2 A;  3NZS A;  2KJ6 A;  2L00 B;  3JYU A;  4IWO A;  3APC A;  5EDS A;  4GSW A;  3HIZ A;  3QK0 A;  2PE9 A;  2CHZ A;  1WZ0 A;  2BYF A;  3EEC A;  2MBQ A;  4IM2 A;  2XK5 A;  3ZW3 A;  5TR5 A;  3NZU A;  3W1S A;  2KFJ A;  3NOB A;  3PRP B;  4N9F 4;  3A9K A;  2KZR A;  5J2R A;  3P2B A;  2R2O A;  1GNU A;  3SDL C;  2XBB C;  3ZIM A;  3IFW B;  2C7H A;  2MW5 A;  4GN1 A;  4FA6 A;  4HK2 A;  2GBJ A;  2RGF A;  3JSV B;  1LXD A;  2YVC A;  3U7D A;  4ZYN A;  3B08 A;  2V1Y A;  1HE8 A;  3NY5 A;  4IW0 A;  5GMV A;  2D10 A;  3BIN A;  1F9J A;  5LXH A;  4OVV A;  3B1L X;  1E7V A;  4P7I A;  4IM3 A;  2KTF A;  1G6J A;  1WMH A;  3PHX B;  4PS7 A;  3LDZ E;  4HPL B;  2CHX A;  1U4A A;  3ZDT A;  3KW5 B;  5CHV C;  1VCB A;  4EZK A;  3DVG Y;  2MWS B;  3EHV A;  3WAO A;  3CMM B;  2KDE B;  1V5T A;  1ZW7 A;  2G45 B;  4MGI E;  5BO4 B;  3VXW A;  3PHW B;  2J0M A;  4HPM B;  4EZL A;  2JY6 A;  2M1M A;  1WGR A;  1WXA A;  2IBI B;  2Y5B B;  2ZNV B;  4K81 A;  4E74 A;  2GMI C;  3QA8 A;  1C1Y B;  4DHZ E;  1EF5 A;  4PS8 A;  2K8H A;  2WWZ A;  3N32 A;  2LWP A;  2IY1 B;  2ZZP B;  3ENE A;  2KX0 A;  4WJP A;  1WR1 A;  3AI5 A;  1UZX B;  2LZ6 A;  1YD8 U;  2JT4 B;  2MLB A;  2ZJD A;  1EF1 A;  3PV1 A;  4EUT A;  4K7W A;  2MBB B;  4B95 A;  1L2N A;  2LD9 A;  3PRE A;  4G0N B;  4W9D A;  5G55 A;  1Q0W B;  2WDT B;  2NBV B;  2NVU I;  4GIV A;  2N1W A;  3AUL A;  2MQJ A;  5LXI B;  1GG3 A;  3N30 A;  4BBN C;  2O6V D;  4BVU C;  3CF6 E;  4HXD A;  3DVG X;  4KV2 A;  3PLU A;  3UQA A;  2ZEQ A;  2ZPN A;  3UIN B;  3VH4 B;  3QIJ A;  2LGD A;  3H7P A;  2O2V B;  2KVR A;  2FAZ A;  3NS8 A;  1K8R B;  4OVU A;  3RZW C;  3JW0 X;  2J7Q B;  4ZDV A;  4W9J A;  4MEL A;  3KUC B;  2KN5 A;  2IO0 B;  4AJW A;  2UYZ B;  2LGX A;  2I1J A;  3DBL I;  4W9C A;  3RZF A;  4MGK E;  3C0R B;  2O6V A;  2ASQ A;  2D11 A;  3GZN I;  3QWZ B;  3BY4 B;  3T8M A;  5HKH A;  1PQS A;  2XEW A;  2JZZ A;  1NBF C;  2BPS A;  2CHW A;  2MSE D;  4GDK A;  4WJN A;  2G3Q B;  2G4D B;  3R66 C;  5C23 A;  3ZNG C;  1NI2 A;  1EO6 A;  3RD2 A;  1OQY A;  3M62 B;  1UGM A;  4MGZ E;  1YJ1 A;  3V6E B;  3VHT C;  4B6W A;  4ZRJ A;  4RM9 A;  1V86 A;  2N4F A;  2KK8 A;  4W9F A;  3RYT A;  1YX5 B;  4FJZ A;  3KH0 A;  3VTW A;  1E8Y A;  3CSF A;  1ZKH A;  1R4M I;  2IZV B;  2IO1 B;  2REX A;  3U30 A;  4CYE A;  3PRZ A;  1LFD A;  2Z0D B;  4FN2 A;  3RT3 B;  1P9D U;  3KYD D;  3GOE A;  1WJN A;  2DZK A;  4IWQ A;  2BGF A;  3A33 B;  1LM8 B;  2L8J A;  3H1U A;  3DVN U;  4BKG A;  4J6I A;  5C1Z A;  3A1Q B;  3UF8 A;  4CHK A;  4MJS B;  1IPG A;  3UGB B;  5L83 A;  1YQB A;  3U8Z A;  4IM0 A;  4I6P A;  4JQW C;  2GBN A;  3I3T B;  3L16 A;  2KLG A;  3AU5 A;  4PYU A;  4IWP A;  4TQ0 A;  2N7E A;  4DDG D;  4ICV A;  4LCD E;  2C7M B;  4AWJ A;  1XQQ A;  1TZ1 A;  5FR6 A;  4TV3 A;  2CU1 A;  4PYZ A;  1OEY A;  3QAQ A;  3ZRF A;  4ANX A;  3AXC A;  3PT2 B;  3JSV A;  5E6O A;  2D3G A;  2KMC A;  4K1R B;  4A20 A;  3ZRC A;  2IO2 B;  2D07 B;  3ZNI D;  1C3T A;  1WY8 A;  2KTR B;  2LAS A;  3V60 A;  4AP4 C;  3IVF A;  2C9W B;  3OAW A;  1WYW B;  1Y8R C;  2NBU A;  2HTH A;  2L7R A;  3IHP C;  3L17 A;  3DVN V;  2MBH A;  4G11 A;  4WWO A;  2BKF A;  2BWE S;  1Q5W B;  4ANV A;  4KIK A;  2M17 A;  3ZNH B;  1E8W A;  1J0G A;  4F1S A;  2KDI A;  3ALB A;  2FUH B;  1V80 A;  2HJ8 A;  2DAF A;  3SD5 A;  1WRD B;  4AUQ C;  1QZE A;  5DPR A;  3VUY A;  1A5R A;  3RUI B;  4HCN B;  5J18 A;  1WM3 A;  4M0W B;  1KLV A;  1KOT A;  4A3O A;  2MP2 B;  2FCQ A;  1WX7 A;  1GJZ A;  1WI0 A;  1AAR A;  2LRU A;  3Q3J A;  1OEY J;  2JRI B;  1J19 A;  4JGH B;  4KSL C;  3ML8 A;  3A9J B;  2KXJ A;  3HK0 A;  3PZD A;  3TCA A;  1E5W A;  3H9D A;  1KJT A;  3APF A;  4XZ4 A;  4IG7 B;  2LXC A;  3ZTC A;  5IA7 A;  1UEL A;  2LVP A;  1UH6 A;  2AYO B;  2KX3 A;  4K7U A;  1WJ4 A;  2KD0 A;  2OJR A;  4KDI C;  4M8M A;  4X57 B;  4LJP B;  1SE9 A;  2EMT A;  4HCP B;  3APD A;  2MRP A;  4XC2 A;  1ISN A;  2JRH A;  2WYQ A;  1XD3 B;  5D7G A;  4HVB A;  2NBW B;  3H6N A;  3RUL A;  3OLM D;  3PLV A;  3VUX A;  1V49 A;  1WH3 A;  3LJ3 A;  2K25 A;  5E6N A;  4BBN F;  1WGY A;  2B3A A;  3KVF B;  4W9L A;  1E90 A;  1GUA B;  2O2V A;  4W9I A;  3ZLZ A;  1P0R A;  2WX1 A;  5D6J B;  3VTU A;  1WXS A;  4AJY B;  3DBH I;  1S3S G;  2N9E B;  4FAD A;  1YIW A;  2L76 A;  2FCM A;  1T0Y A;  1Z2M A;  3QQ8 B;  3VAW A;  1L7Y A;  1WFY A;  2KFK B;  1ZGU B;  3JVZ X;  3WAM A;  3ZO5 B;  4DHJ B;  2AWT A;  2M8S A;  4ANW A;  4TKN A;  3IBE A;  4BKS D;  2R2Q A;  1RAX A;  2N1V A;  5AZG A;  3WAL A;  2KMA A;  5KHQ A;  3ECI A;  3DCG A;  2CR5 A;  2L3Z A;  4NQK E;  5E6P A;  3UQB A;  1WJ6 A;  4ZRK A;  4K7S A;  2IY0 B;  2KNB A;  3L10 B;  3TMP B;  3A4S C;  1E8X A;  2JF5 A;  4DDI D;  2DZM A;  4NPN A;  2DYM A;  2FCN A;  4BOZ B;  3DQV A;  2LUE A;  1UBQ A;  2BYV E;  4II2 B;  4DHZ B;  3OJ3 A;  3UIP B;  4KVG B;  4W9H A;  3PVL A;  3KYC D;  4KDL B;  2DHZ A;  5JHB A;  2MBO A;  2K6D B;  2V4L A;  1WXV A;  3A1Q A;  3ZKJ C;  4I6N B;  1X1M A;  4MJS A;  2VRR B;  1S1Q B;  2KC1 A;  3CST A;  5G2N A;  2DZJ A;  1TBE A;  2L0T A;  2FNJ B;  4IC7 B;  5CTR C;  2CKH B;  2KJH B;  3OJ4 B;  2LI5 A;  4WJQ A;  1P98 A;  4GGQ A;  4B9K A;  3DBR I;  2C7N B;  2DEN B;  2J0J A;  2JWZ A;  4NJ6 A;  2NS5 A;  4DK5 A;  3QC8 B;  4LDT D;  1YX6 B;  3R7R A;  4MH0 E;  3VH3 B;  3K9P B;  3TBL D;  4XX5 A;  1V6E A;  4GXB A;  2HE7 A;  4JLC A;  5DCN A;  2BWF A;  4I6L B;  1JRU A;  4CO7 A;  3M63 B;  2LRW A;  2KQ7 A;  2ZVO A;  2KTR A;  1RFA A;  4WJO A;  3L13 A;  2RSU A;  1P1A A;  2J0K A;  3TJP A;  3ZTD A;  4FJV B;  5DPS A;  1KM7 A;  4DWF A;  2NPT B;  1VD2 A;  4GDL B;  2JUO A;  2IYD B;  3V62 A;  5AZH A;  2FIF A;  3T9L A;  1WJU A;  2AL6 A;  2UWQ A;  3TIX A;  4KZ0 A;  3Q3F A;  4FLH A;  2DZI A;  1H8C A;  4NY0 A;  3VVW B;  1RLF A;  4W9G A;  2ZCC A;  2K1F A;  4LDT B;  2ZNV C;  3PTF C;  4NAW B;  5CHF A;  1E8Z A;  1WE7 A;  2MP2 A;  2N9X A;  4ICU A;  3RCZ A;  2KC2 A;  2LXA A;  2KO3 A;  3AU4 A;  2BYE A;  3A9J A;  4KZC A;  4EZJ A;  3QCA A;  4DXA B;  2L0F A;  2GBR A;  3ZVV A;  1V81 A;  3MTN B;  3D32 A;  2DAJ A;  4HDQ A;  2A5U A;  4EOY A;  3PSE B;  2I1K A;  2XK5 B;  3WAP A;  4AOF A;  2LGY A;  1UBI A;  2MX2 A;  2PJH A;  2MBE A;  3QHT A;  4F7Z A;  3WAN A;  2KWU B;  3A9K B;  2FCS A;  2KKC A;  2G4S A;  1WX9 A;  4RM8 A;  3V61 A;  3N3K B;  2C60 A;  2KAN A;  5JZE B;  3VFK A;  2RD0 A;  4WWP A;  2M0X A;  1WIA A;  2AL3 A;  3B0A A;  1P3Q U;  5CHW A;  3A4R A;  3L08 A;  2ZCB A;  2PE6 B;  1WF9 A;  2QHO A;  3M3J A;  3KUD B;  3QAR A;  3MJW A;  4G3X B;  4KIK B;  2W9N A;  4WAA A;  1E7U A;  3M95 A;  4FHK A;  1OTR B;  3ZDM C;  1SIF A;  4FBJ B;  2KLC A;  2D2Q A;  4IUM B;  1WMH B;  1V5O A;  2K8C A;  3DPD A;  2CS4 A;  3ML9 A;  3HHM A;  1TTN A;  2KFK A;  3ONS A;  3H7S A;  2K39 A;  1SGH A;  1WZ3 A;  1H4R A;  3DDC B;  2KOX A;  1WGH A;  2BF8 B;  1TGZ B;  1OGW A;  2KWV B;  4TUU A;  4GB9 A;  2N9P C;  2RR9 A;  4FJY A;  2EKE C;  2Z59 B;  5JHA A;  4JL9 A;  1EUV B;  2LVQ A;  3PPA A;  4PS3 A;  5DPW A;  5LLI A;  4DBG A;  1BT0 A;  2M4N A;  5JH5 C;  2GOW A;  2KDF B;  2KDB A;  2KJR A;  5D94 A;  4JIO U;  3X23 A;  1M94 A;  1Z5S B;  1WGD A;  3L54 A;  1WR6 E;  2NCN A;  4ZRI A;  2V3S A;  2FID A;  2K8B A;  2WX0 A;  3R3M A;  3TL5 A;  2GBM A;  4DHJ D;  1WE6 A;  2RPQ A;  3VQI A;  4W9K A;  2JZ3 B;  3QX1 A;  3PS6 A;  3R7Q A;  5AZF A;  2JVC A;  3QJZ A;  3VUW A;  5AEK B;  2MA9 B;  2EMS A;  2PEA A;  4GOC A;  4MGY E;  1Q1O A;  3KUZ A;  4BKS A;  1UD7 A;  4E3C A;  1WGG A;  2K6Q A;  2LJ5 A;  3K9O B;  4GMV A;  2LVO A;  3V6C B;  2C5L C;  4MEM A;  3X0W A;  4MM3 A;  4E71 A;  5D2M B;  1D3Z A;  3DOW A;  3EC8 A;  4TQ1 A;  4GU2 A;  4RMA A;  4G50 A;  3S2A A;  4YL8 A;  2NR2 A;  4BOS C;  3H7P B;  1XT9 B;  2JXX A;  3L0W B;  1MG8 A;  2YLM A;  3NHE B;  3HM3 A;  4HWI B;  3HM6 X;  4II3 B;  2ZPY A;  2MCN B;  1IYF A;  1NDD A;  3SHQ A;  4M8N A;  1GC7 A;  4WWN A;  2KHW B;  4NNJ B;  4W9E A;  4HLE A;  4EEW A;  3PGE A;  3DBS A;  4HJK A;  1CMX B;  2N7D A;  4BFR A;  1V9J A;  1V2Y A;  4HDO A;  1IP9 A;  2PPH A;  3W1Y A;  4URK A;  4F8C B;  4NQL B;  3EFU A;  5KHO A;  3SU8 X;  4ANU A;  4MDK E; 
#chains in the Genus database with same CATH topology
 2O6V B;  1BUI C;  4ZHP A;  1R4M B;  2H88 B;  2A4Z A;  4GDL A;  5HFY A;  3ZUN A;  2MHJ A;  3LXF A;  2ON8 A;  2HD5 B;  1FNW A;  4LJO B;  4NAW A;  3TEZ A;  2L83 A;  1GC6 A;  1WSP A;  2QJL A;  1YOV B;  1I35 A;  4NAM A;  4JX1 C;  1QOB A;  1L4Z B;  3JYU A;  3HIZ A;  4YXD B;  1L0X B;  1C79 A;  3EEC A;  1VDV A;  4B0E A;  1QIL A;  3A9K A;  4AQ7 A;  2R2O A;  3O13 A;  2QC8 A;  2XBB C;  3ZIM A;  3IFW B;  4US9 A;  2C7H A;  1SXT A;  4ZYN A;  1FNV A;  2V1Y A;  1HE8 A;  3MC0 B;  3BIN A;  2PTL A;  2FUG 1;  1MHH E;  4YTP B;  4LNN A;  3N1Z C;  1G6J A;  2E6X A;  3PHX B;  5FK9 C;  2CHX A;  1U4A A;  1VCB A;  3Q2A C;  1MG4 A;  2H89 B;  3PHW B;  2DWQ A;  2J0M A;  4HPM B;  4EZL A;  2V0G A;  2IBI B;  2ZNV B;  4E74 A;  1SSN A;  4CQN A;  1FRD A;  4PS8 A;  1VZ8 A;  2K8H A;  3AEG B;  4K3C A;  1JRP A;  1A70 A;  2IY1 B;  2RDB C;  2ZZP B;  4WJP A;  1UZX B;  3ABV B;  2SAK A;  2MLB A;  3PV1 A;  1EF1 A;  4REZ A;  3NJT A;  4YTM B;  4W9D A;  2NVU I;  3FAH A;  5TSS A;  5LXI B;  1FM0 D;  2INP E;  1MVK A;  1GG3 A;  4BBN C;  4P1C C;  1I4Q A;  4A55 A;  3DVG X;  2LJI A;  4FXC A;  2LGD A;  2O2V B;  3RZW C;  4OVU A;  2J7Q B;  2KN5 A;  4UDU C;  2QEJ C;  2I1J A;  3GZN B;  3GZN I;  3N1Y C;  2MSE D;  3R66 C;  4LTU A;  1OQY A;  3M62 B;  1UGM A;  3VHT C;  4P6V F;  1V86 A;  1AWD A;  3KH0 A;  2DBY A;  1E8Y A;  3ZQ4 A;  2IO1 B;  4CYE A;  3RT3 B;  1P9D U;  3NVV A;  1LO5 D;  1WJN A;  3GOE A;  4IWQ A;  2D5G A;  1L6V A;  4BKG A;  5C1Z A;  3IAS 1;  2WU5 B;  5L83 A;  3U8Z A;  4I6P A;  2WXQ A;  4TQ0 A;  2N7E A;  4DDG D;  4AWJ A;  2X38 A;  2LHD A;  5FR6 A;  3EGR A;  3ZRF A;  4ANX A;  1EM7 A;  2NTT A;  5E6O A;  3DWG C;  4A20 A;  2IO2 B;  2D07 B;  2L52 A;  2WXM A;  1WY8 A;  2QCZ A;  2HTH A;  2MBH A;  1TS4 A;  5BYS A;  1VZ7 A;  4ZRQ A;  2BWE S;  1Q5W B;  4KIK A;  1HZ6 A;  4MH8 A;  4C56 C;  1J0G A;  3ALB A;  3P63 A;  3U4E G;  4YWG G;  2HJ8 A;  4AUQ C;  3SD5 A;  1WRD B;  3VUY A;  4HCN B;  5J18 A;  4M0W B;  2MP2 B;  2V4I B;  4HRS A;  1WX7 A;  1MHX A;  3Q3J A;  1OEY J;  4JGH B;  3A9J B;  1UWM A;  1E5W A;  4LK0 M;  2LVP A;  2GI9 A;  1WJ4 A;  2OJR A;  3Q8E A;  1FFV A;  2WXO A;  4LJP B;  2KT7 A;  2WDR B;  4JPS A;  3APD A;  2WYQ A;  4A8X C;  1XD3 B;  3H6N A;  3RUL A;  3VUX A;  1V49 A;  3LJ3 A;  5E6N A;  3BYT B;  2B3A A;  1E90 A;  3AN1 A;  1GB1 A;  4XDD A;  3VTU A;  1WXS A;  3AE3 B;  1S3S G;  2N9E B;  2WXI A;  1VR9 A;  1YIW A;  2KAC A;  2L76 A;  1L7Y A;  3ZO5 B;  3JVZ X;  2M8S A;  4BKS D;  2B76 B;  5E6P A;  3A4S C;  4DDI D;  5BMG A;  1JCK B;  4KVG B;  3PVL A;  4KDL B;  3Q8C A;  1NI3 A;  2MBO A;  2AQ3 B;  3A1Q A;  1WXV A;  4I6N B;  2JSV X;  2VRR B;  4DXF A;  1S1Q B;  2M0A A;  3CST A;  5G2N A;  2DZJ A;  1TBE A;  1JW9 D;  3RMK C;  4MM3 B;  2DLB A;  2NS5 A;  2XN9 C;  1D6E C;  3K9P B;  3VR9 B;  3AE4 B;  2HE7 A;  3AEC B;  5DCN A;  2R61 A;  4JWS C;  2BWF A;  5BMH A;  1JRU A;  2HJ1 A;  3R8B A;  2CJO A;  2N0S B;  5H8Y E;  2WXJ A;  1RFA A;  2WXL A;  3U52 E;  2LUM A;  1D5X C;  5D3D A;  5DPS A;  4K3B A;  1KM7 A;  4DWF A;  4GDL B;  2JUO A;  3V62 A;  4JE3 B;  1WJU A;  4KZ0 A;  2DZI A;  1H8C A;  4NY0 A;  3VVW B;  1TS5 A;  4W9G A;  2ZCC A;  2ZNV C;  4A90 A;  4NAW B;  1E8Z A;  1RFK A;  1FCC C;  4KZC A;  2RMM A;  4DXA B;  3RNG C;  2GBR A;  3ZVV A;  4HRO A;  1XCT L;  1V81 A;  1TT5 B;  3D32 A;  4HDQ A;  4EOY A;  2KWU B;  3A9K B;  2G4S A;  1WX9 A;  4RM8 A;  5FR3 A;  2VH1 A;  2RD0 A;  3Q8A A;  2AL3 A;  1P3Q U;  3IT6 B;  4YSY B;  2PE6 B;  4G3X B;  4LLG M;  2KMM A;  4FHK A;  3ZDM C;  3OWE B;  2KLC A;  5IP4 D;  4IUM B;  2KYW A;  3ML9 A;  1TTN A;  1C4C A;  4H2A A;  1TKG A;  3AE8 B;  1WZ3 A;  3DDC B;  3TEW A;  3Q8F A;  1N63 A;  1OGW A;  1TGZ B;  5JHA A;  1VLB A;  1SBB B;  1K53 A;  2NCN A;  4ZRI A;  2FID A;  3KWV A;  3TL5 A;  3W5V B;  4IDI A;  2WXH A;  3R7Q A;  4WAF A;  3VUW A;  5AEK B;  1JAL A;  4TMA B;  1YJJ A;  4E3C A;  1WGG A;  3P4Q B;  2G9H D;  2C5L C;  4MEM A;  3X0W A;  3RNB C;  4TSS A;  4TQ1 A;  2ONQ A;  4R3D A;  3S2A A;  3E9S A;  3NUH B;  2NR2 A;  1IYF A;  3BVM A;  3SHQ A;  2KHW B;  4EEW A;  1IP9 A;  1CMX B;  4HDO A;  2FBW B;  4F8C B;  4OHJ A;  3EFU A;  5KHO A;  1GB4 A;  4MDK E;  4WQO B;  4EKU A;  4PK1 A;  1J8C A;  2L05 A;  4NJ7 A;  4FHJ A;  2KWC A;  4MSM B;  2MJD A;  3VTV A;  2OOB B;  1AN8 A;  2IO3 B;  3HUI A;  5CX3 A;  4MSQ B;  2ZVN A;  1E9M A;  1UGJ A;  2Z0E B;  2AEH A;  1I42 A;  3Q3O C;  3W1S C;  3C19 A;  1XF5 L;  4ASW C;  1WXQ A;  3IG3 A;  1T6B X;  1DOI A;  2KJ6 A;  4IWO A;  3APC A;  1J7A A;  5EDS A;  3QK0 A;  2PE9 A;  2CHZ A;  4IM2 A;  3ZW3 A;  5TR5 A;  3NZU A;  3W1S A;  3PO0 A;  2JYE A;  3NOB A;  3MC9 A;  5J2R A;  1GNU A;  1T0R C;  2MW5 A;  3ZJU A;  4HK2 A;  2GBJ A;  2RGF A;  1QF6 A;  1YJI A;  3MHZ A;  3B08 A;  5GMV A;  2D10 A;  1F9J A;  1CQV A;  4PS7 A;  4HPL B;  1SF0 A;  2NTS A;  5BMI A;  5CHV C;  3DVG Y;  2MWS B;  1GOZ A;  4MAC A;  2KDE B;  1V5T A;  1ZW7 A;  2G45 B;  4MGI E;  1JRO A;  4P16 A;  2J42 A;  1N60 A;  2GMI C;  3QA8 A;  4M00 A;  1WWT A;  3N32 A;  1WR1 A;  5BYR A;  3AI5 A;  3RNE C;  4EUT A;  1ZXI A;  1TS3 A;  2WS3 B;  1QLB B;  3PZ8 A;  1L2N A;  3PRE A;  5G55 A;  2JXT A;  2NBV B;  3AEB B;  2O6V D;  4BVU C;  3UQA A;  2ZEQ A;  2ZPN A;  5GXG B;  3ZGZ A;  2WXR A;  2CJN A;  2FE8 A;  4EE2 A;  4C7Z A;  2AQ2 B;  3JW0 X;  4ZDV A;  3KWL A;  1XLQ A;  1WGK A;  2IO0 B;  4AJW A;  2LGX A;  1C78 A;  2M56 B;  4W9C A;  3RZF A;  1V8C A;  3QWZ B;  3BY4 B;  5HKH A;  4GDK A;  1DOY A;  2G3Q B;  5C23 A;  3ZNG C;  1YJ1 A;  3V6E B;  2BS3 B;  4ZRJ A;  2PLP A;  4RM9 A;  2N4F A;  2W54 A;  1YX5 B;  4FJZ A;  1R4M I;  3T3N A;  1KF6 B;  2REX A;  3U30 A;  4FN2 A;  2K5P A;  3KYD D;  1C4P A;  1C4A A;  3A33 B;  2L8J A;  3H1U A;  4J6I A;  3A1Q B;  3UF8 A;  3OG5 A;  1IPG A;  2RDG A;  3UGB B;  1FMA D;  1YQB A;  2HTM E;  4JQW C;  3I3T B;  3L16 A;  3AU5 A;  4IWP A;  4ICV A;  2C7M B;  1XQQ A;  1TZ1 A;  2JQR B;  2PVO D;  3NVY A;  4PYZ A;  1OEY A;  3QAQ A;  3PT2 B;  1NVI D;  4YT0 B;  2D3G A;  3ZRC A;  2Y5C A;  3ZNI D;  4AP4 C;  4HPP A;  3IVF A;  3OAW A;  2C9W B;  1Y8R C;  2NBU A;  2L7R A;  3L17 A;  3UI3 A;  3DVN V;  4WWO A;  4A6Q A;  4ANV A;  2M17 A;  1ACC A;  1E8W A;  1E6E B;  1V80 A;  4DXG A;  2DAF A;  3GE3 C;  1KLV A;  4A3O A;  2FCQ A;  3DHI C;  4RFB A;  1GJZ A;  4N6E B;  2D3B A;  2W3S A;  5H92 C;  1PGB A;  3PZD A;  3TCA A;  2BS2 B;  3APF A;  3AE1 B;  2LXC A;  3ZTC A;  1UEL A;  1UH6 A;  2AYO B;  4KKJ A;  2KD0 A;  2EMT A;  4XC2 A;  2JRH A;  4LNI A;  5D7G A;  4KX6 B;  2GB1 A;  2NBW B;  1FXI A;  3OLM D;  5IO9 A;  2K25 A;  4BBN F;  2WXF A;  4W9L A;  2WP9 B;  1ZP0 B;  4W9I A;  3ZLZ A;  1P0R A;  1N61 A;  2Y5P A;  2WX1 A;  4AJY B;  3WAM A;  1ZGU B;  2AWT A;  3I63 C;  4ANW A;  4TKN A;  3IBE A;  1RAX A;  2PIA A;  3WAL A;  2DNF A;  2RDH A;  1NYQ A;  1RM6 C;  1T5X D;  1WJ6 A;  1NEK B;  4LNK A;  2DYM A;  2INC C;  1PFD A;  1UBQ A;  2N7J A;  5EE0 A;  1I4G A;  3KQ4 A;  1V1P A;  4DHZ B;  3UIP B;  2DHZ A;  4XGA B;  2OJW A;  1DOX A;  2AX5 A;  3RPF C;  4IC7 B;  5CTR C;  3OJ4 B;  5EE3 A;  2C7N B;  2JWZ A;  4DK5 A;  3BII D;  4HEA 1;  4WH4 A;  4LDT D;  1YX6 B;  2ACZ B;  3R7R A;  1OFF A;  1QOG A;  4MH0 E;  3TBL D;  4ZHO A;  4XX5 A;  4A9A A;  3ZYY X;  3BZD B;  2LRW A;  3N9Y C;  2ZVO A;  2KTR A;  2J0K A;  3ZTD A;  3AMZ A;  4HKQ A;  2FIF A;  3T9L A;  1E10 A;  2N9K A;  2UWQ A;  1AYF A;  1JWA D;  2K1F A;  4LDT B;  2YEP B;  4N58 A;  3BYY B;  3RN9 C;  3MC8 A;  3MTN B;  2IDY A;  2BB5 A;  2MX2 A;  1UBI A;  2UU7 A;  1FXA A;  1ZXH A;  1ZOY B;  3WAN A;  2FCS A;  3TEX A;  3V61 A;  2KAN A;  5JZE B;  2V3P A;  3VFK A;  2M0X A;  3A4R A;  3L08 A;  2ZCB A;  1YQ4 B;  3KUD B;  2W9N A;  2TSS A;  2LEK A;  3M95 A;  4XE0 A;  3AE5 B;  3DPD A;  2K8C A;  2J4X A;  3NVW A;  1IUE A;  2KN4 A;  3H7S A;  4L2Y A;  2K39 A;  1H4R A;  2BF8 B;  1KLU D;  1FNU A;  1N5X A;  2OHF A;  2NMQ A;  4GB9 A;  2RR9 A;  4JL9 A;  3B2F A;  1ZE3 D;  2M4N A;  5JXV A;  1TKY A;  2KDB A;  1K52 A;  2KJR A;  4JIO U;  1Z5S B;  1WGD A;  3L54 A;  1WR6 E;  2LFI A;  1JWM D;  2V3S A;  2RPQ A;  3C8Y A;  3PS6 A;  5AZF A;  2MA9 B;  4BZA A;  2EMS A;  2PEA A;  4MGY E;  4RH6 A;  1Q1O A;  3NZ3 A;  3P4S B;  1UD7 A;  2KVZ A;  1L0Y B;  2LJ5 A;  2WDQ B;  3K9O B;  4DQO C;  3V6C B;  4Q2J A;  1MPE A;  5D2M B;  1I4H A;  3DOW A;  4G50 A;  4LNO A;  3BVZ A;  3AED B;  4BAX A;  1XEE A;  3ZJV A;  3NHE B;  1MG8 A;  2YLM A;  4HWI B;  2MCN B;  3HM6 X;  4B0M A;  4WWN A;  4NNJ B;  4W9E A;  3PGE A;  3AE7 B;  2N7D A;  3BVG A;  3VRB B;  2PPH A;  3W1Y A;  4ANU A;  1ET9 A;  4GDK B;  4PT5 A;  2DYO A;  1QT9 A;  2NPT A;  2BW2 A;  5L95 C;  3RNA C;  1VJK A;  3O65 B;  1WX8 A;  2KQS A;  4EFO A;  1WRI A;  2DX5 B;  1IGC A;  3RNC C;  4ITK A;  2IND C;  5EE1 A;  3WA0 A;  2GBK A;  2DYB A;  4A3P A;  3MHS D;  1FD6 A;  2BKR B;  1N5W A;  1WM2 A;  2L00 B;  2WXN A;  4KKI A;  1LGR A;  1FO4 A;  1WZ0 A;  2BYF A;  2KFJ A;  4OW0 A;  3URY A;  1FRR A;  4MT5 A;  4N9F 4;  2KZR A;  3P2B A;  1CJE A;  3SDL C;  1HZ5 A;  4GN1 A;  3U7Z A;  5G5G A;  2LMC A;  1M4V A;  4IW0 A;  2WXK A;  3SEB A;  4OZB A;  3B1L X;  3NVZ A;  5T8I A;  5IOI A;  5AUI A;  4C80 A;  4IM3 A;  2KTF A;  2XNA C;  1WMH A;  2JU6 X;  3LDZ E;  3ZDT A;  4XYC A;  4RGT A;  3KW5 B;  4EZK A;  3WAO A;  5BO4 B;  2M1M A;  1WGR A;  2VH2 A;  3HRD D;  3VRA B;  1ZUD 2;  3SFE B;  2WWZ A;  4ZOH C;  1XXG A;  4KGS A;  2LWP A;  1YD8 U;  3I5J C;  1ROE A;  2ZJD A;  1CK1 A;  2WDT B;  3AUL A;  1JWS D;  2ZW0 A;  2MQJ A;  4M01 A;  3GP7 A;  2INN E;  4HXD A;  3PLU A;  1QOF A;  3UIN B;  3VH4 B;  3QIJ A;  2KVR A;  2FAZ A;  3ETR A;  3NS8 A;  1KLG D;  3P4R B;  3DBL B;  1YQ3 B;  3R2I A;  4MEL A;  3DBL I;  4ARC A;  3RI7 C;  4MGK E;  3AM9 A;  2Y3A A;  2JWU A;  3TUO A;  2WLB A;  3T8M A;  3W5U B;  2XEW A;  2JZZ A;  1NBF C;  2BPS A;  2CHW A;  2LGI A;  5I4D A;  1NI2 A;  3RD2 A;  3IXS A;  1DGJ A;  4US8 A;  2K9X A;  4B6W A;  2KK8 A;  1ZKH A;  4NZL B;  1F1H A;  2HDE A;  3ZJT A;  1V1P B;  3AE6 B;  3MFG A;  3DHG C;  1EWY C;  4O1N A;  4IM0 A;  4OZC A;  5MPO A;  1YMH E;  4PYU A;  1R7S A;  4IKG A;  2WXP A;  3AXC A;  3JSV A;  3V60 A;  2KTR B;  3EA6 A;  1WYW B;  1AW7 A;  1XLO A;  3LB8 C;  1KTK A;  4G11 A;  3ZXV A;  1Y56 A;  4GLS C;  2BB6 A;  4L23 A;  3ZNH B;  2FUH B;  2BTE A;  3TSS A;  2N9L A;  1WI0 A;  1AAR A;  1SE4 A;  1J19 A;  4KSL C;  4C7Y A;  4RF1 A;  4XZ4 A;  4ZYS A;  5IA7 A;  3T3O A;  4K7U A;  2KX3 A;  1HA5 A;  4X57 B;  4HCP B;  1ISN A;  4HVB A;  5BYQ A;  4P1B C;  1WH3 A;  1RYJ A;  3L4P A;  1WGY A;  3NRZ A;  3AEF B;  5D6J B;  4FAD A;  3PZ7 A;  2FCM A;  3VAW A;  1Z2M A;  3QQ8 B;  1WFY A;  5G5H A;  1OQR A;  2BQQ A;  1JQ4 A;  1L6U A;  2KMA A;  5KHQ A;  3ECI A;  2CR5 A;  1KRH A;  3UQB A;  1J7C A;  2IY0 B;  2KNB A;  3TMP B;  2J53 A;  1E8X A;  2EEL A;  4NPN A;  2WNM A;  2D3A A;  4BOZ B;  5C2T B;  3DQV A;  2LUE A;  2BVC A;  2BYV E;  4II2 B;  3CWI A;  3OJ3 A;  2IGD A;  2MJ3 A;  2G1E A;  1QKZ A;  5JHB A;  2D3C A;  2K6D B;  2KDM A;  4MJS A;  4D2K A;  2FNJ B;  3DBR B;  2CKH B;  2KJH B;  4C00 A;  3V3X A;  4B9K A;  1C76 A;  3DBR I;  2DEN B;  4ARI A;  2J0J A;  3Q69 A;  3SR6 A;  1KFY B;  3N1X C;  1V6E A;  4GXB A;  3Q14 C;  4I6L B;  4CO7 A;  2KQ7 A;  2PKO A;  3MP9 A;  2RSU A;  3WCQ A;  3TJP A;  1NEN B;  1YN4 A;  1GAQ B;  2NPT B;  1T3Q A;  4FLH A;  1PGA A;  1MI0 A;  1RLF A;  5CHF A;  2E3T A;  1VRA B;  2X8X X;  3AE2 B;  5E6J A;  2BS4 B;  1JWB D;  2KC2 A;  2KQ4 X;  2KO3 A;  3AU4 A;  2BYE A;  1ZPS A;  4J3O D;  1TYG B;  4YSX B;  1UNS A;  1T0Q C;  2DAJ A;  2PVG C;  2A5U A;  2K3U A;  3LYY A;  4AOF A;  1F2R C;  2MBE A;  4F7Z A;  1XO3 A;  2C60 A;  4WWP A;  1WIA A;  5CHW A;  3J9C A;  3M3J A;  1E7U A;  2W82 A;  5D3I B;  3Q3N C;  1WMH B;  3FIL A;  3HHM A;  2VZK D;  2KFK A;  3ONS A;  1SGH A;  1PYW D;  2KOX A;  2KWV B;  1JWU D;  1EUV B;  2JZP A;  2L1A A;  1MFW A;  2LVQ A;  3FKY A;  3PPA A;  4PS3 A;  2QIE B;  2QDF A;  4DBG A;  5JH5 C;  3Q6B A;  2MJE A;  3ZXR A;  5D94 A;  1M94 A;  1F77 A;  5IN7 A;  3GE8 C;  2K8B A;  3R3M A;  2ICI A;  4DHJ D;  2GBM A;  1WE6 A;  3QX1 A;  2MEK A;  2JVC A;  2VZK B;  1SJE D;  3I57 A;  4XWT A;  2K22 A;  4GOC A;  3KUZ A;  4GMV A;  2K6Q A;  2WDV B;  3EC8 A;  1VZ6 A;  4GU2 A;  4C4V A;  4BOS C;  2K0P A;  1IBX A;  4M8N A;  2IGH A;  4HLE A;  3AV8 A;  3DBS A;  4BFR A;  1V2Y A;  4NQL B;  3W2D A;  4DHJ B;  2WGS A;  3SU8 X;  4AS1 A;  1R4N B;  2PW9 A;  3MJ5 A;  2JPH A;  1TKE A;  1C9F A;  4JWU C;  1FCL A;  1R4N I;  2WHI A;  3UIO B;  3WIM A;  3VDZ A;  5J17 A;  1Q10 A;  4FUL A;  1WXM A;  4S17 A;  5IAA C;  1HTO A;  1PUT A;  2Z8L A;  3HVZ A;  3ZNZ B;  1XLN A;  1RRB A;  3TEY A;  5DPT A;  3PRM B;  3VR8 B;  3V05 A;  1B1Z A;  4KSK C;  4BKT A;  1I4P A;  3GS2 A;  1LQB A;  1FXT B;  3BK1 A;  3NZS A;  4GSW A;  4NJC A;  1K51 A;  2MBQ A;  2XK5 A;  2W55 A;  2MH7 A;  3PRP B;  4RNA A;  2ZW1 A;  1ZDX A;  2QSD A;  1F0Z A;  4FA6 A;  3AH7 A;  3JSV B;  2BBC A;  1LXD A;  2YVC A;  3U7D A;  3NY5 A;  1E0Z A;  5LXH A;  4OVV A;  4P7I A;  1E7V A;  1YN3 A;  1N62 A;  1P7E A;  4LNF A;  3CIR B;  1TJE A;  4KGT A;  3Q8B A;  3EHV A;  1EU4 A;  3NS1 A;  3CMM B;  4HJG E;  3E56 A;  3VXW A;  2JY6 A;  1WXA A;  4S0R A;  2Y5B B;  4K81 A;  3U2S C;  4DHZ E;  1C1Y B;  1EF5 A;  3ENE A;  2KX0 A;  2LZ6 A;  1SIJ A;  2JT4 B;  4K7W A;  2MBB B;  3IAM 1;  4B95 A;  2LD9 A;  4G0N B;  4YSZ B;  3AB5 A;  1Q0W B;  1ET6 A;  4GIV A;  2N1W A;  3N30 A;  3CF6 E;  1I7H A;  4KV2 A;  1KH0 A;  1OQQ A;  3DHH C;  4YTN B;  3P42 A;  4WQM A;  3H7P A;  1K8R B;  1TY2 A;  1BML C;  4W9J A;  3B9J A;  1UWX A;  3KUC B;  3P4P B;  2UYZ B;  1T0S C;  3C0R B;  2O6V A;  2ASQ A;  3FC4 A;  2D11 A;  1PQS A;  4WJN A;  2G4D B;  1EO6 A;  4MGZ E;  2KAJ A;  2QMT A;  1EU3 A;  3RYT A;  3AEE B;  4W9F A;  3VTW A;  1XLP A;  3CSF A;  5HG2 A;  2IZV B;  1P7F A;  1WYG A;  3PRZ A;  1LFD A;  2Z0D B;  1FFU A;  1N6Z A;  2DZK A;  2BGF A;  1LM8 B;  3DVN U;  4CHK A;  4MJS B;  4RF0 A;  1QQR A;  2WU2 B;  1D5M C;  2GBN A;  5HI1 A;  1SE2 A;  2KLG A;  4OVZ A;  4WUR A;  2M19 A;  1IGD A;  1J7B A;  4LCD E;  3AE9 B;  2JYT A;  2AQ1 B;  2CU1 A;  4TV3 A;  3EFC A;  1TY0 A;  4RCO A;  1ENF A;  4RGO S;  1XCQ L;  2KMC A;  4K1R B;  1C3T A;  2LAS A;  2J52 A;  5EE9 A;  3IHP C;  2LGS A;  3DWM A;  2PMV A;  2BKF A;  1K50 A;  1DYQ A;  4F1S A;  2KDI A;  1SEB D;  1V1O A;  2WXG A;  1QZE A;  5DPR A;  1A5R A;  3RUI B;  1KOT A;  1WM3 A;  4QAY A;  1BXT A;  2LRU A;  1F52 A;  2JRI B;  4KGR A;  5IKC M;  3ML8 A;  2BT6 A;  2KXJ A;  3HK0 A;  3H9D A;  1KJT A;  4IG7 B;  3BK2 A;  4M8M A;  4KDI C;  4M02 A;  1SE9 A;  2MRP A;  2KWD A;  2GRI A;  3KLS X;  3PLV A;  3KVF B;  4ZRP A;  1FIQ A;  1GUA B;  2O2V A;  1L5P A;  3DBH B;  2W3R A;  1F2R I;  5AUK A;  3DBH I;  2Q5W D;  1YNT E;  3FIL B;  1T0Y A;  2GLS A;  2KFK B;  1TIF A;  3SFD B;  1EWC A;  2R2Q A;  2N1V A;  5AZG A;  1QOA A;  3DCG A;  2L3Z A;  1FPY A;  4NQK E;  4ZRK A;  1I4X A;  4K7S A;  3L10 B;  2JF5 A;  2DZM A;  2CU3 A;  2FCN A;  2V3N A;  3R2T A;  2YEP F;  4USA A;  4W9H A;  1MJD A;  3KYC D;  1UUP A;  2V4L A;  3ZKJ C;  3RFZ B;  4HKZ E;  1X1M A;  3IT4 B;  2KC1 A;  5FKA C;  2L0T A;  2BYT A;  1NYR A;  2LI5 A;  1FEH A;  1P98 A;  1ZDV A;  4GGQ A;  4WJQ A;  1GPX A;  4NJ6 A;  1PDX A;  3QC8 B;  1SJH D;  3VH3 B;  4C4V B;  1IBX B;  4JLC A;  3M63 B;  3Q3M C;  4WJO A;  3L13 A;  1UF0 A;  1P1A A;  2RPV A;  2WQY B;  4FJV B;  1ESF A;  1VD2 A;  2EKI A;  2IYD B;  4ACF A;  5AZH A;  2AL6 A;  3TIX A;  3Q3F A;  1STE A;  3N20 C;  4L1B A;  3PTF C;  1WE7 A;  4M0W A;  2MP2 A;  1D4B A;  2N9X A;  5C3J B;  4ICU A;  3RCZ A;  2LXA A;  2V9H A;  1C77 A;  3A9J A;  4EZJ A;  2IPK D;  1HXY D;  3QCA A;  2L0F A;  3HVD A;  5LNK 1;  1L0V B;  4RGN A;  3PSE B;  2I1K A;  2XK5 B;  3WAP A;  2LGY A;  1HQR D;  2PJH A;  3QHT A;  2I38 A;  1TS2 A;  1RWS A;  2KKC A;  3N3K B;  5HHD G;  2L32 A;  3BWU D;  2IJ0 A;  3B0A A;  3RNF C;  1E7P B;  1WF9 A;  2QHO A;  3QAR A;  3MJW A;  4KIK B;  4WAA A;  1YN5 A;  1OTR B;  4IOI E;  1SIF A;  1B9R A;  1V97 A;  2D2Q A;  3B2G A;  1V5O A;  2CS4 A;  2I2Y A;  4WWM A;  1WGH A;  2QIL A;  4TUU A;  3NG0 A;  2N9P C;  4FJY A;  2EKE C;  1I4R A;  2Z59 B;  3EUB 2;  5DPW A;  5LLI A;  1BT0 A;  3H8H A;  2GOW A;  2KDF B;  1L4D B;  3GB1 A;  3X23 A;  2JX5 A;  3P1M A;  1D5Z C;  1HTQ A;  2WX0 A;  4OZA A;  1HEZ E;  2SEB D;  3VQI A;  1PGX A;  4W9K A;  2JZ3 B;  3W9C B;  4WIP A;  4XWW A;  4N59 A;  3QJZ A;  3AEA B;  3I9V 1;  4BKS A;  2LVO A;  4E71 A;  1TZO A;  4MM3 A;  1D3Z A;  4XDC A;  4RMA A;  4RGM A;  1SB3 C;  2IGG A;  1JML A;  4YL8 A;  3H7P B;  1XT9 B;  2JXX A;  3L0W B;  3HM3 A;  4II3 B;  2ZPY A;  1NDD A;  1GC7 A;  1CZP A;  4HJK A;  1V9J A;  1SE3 A;  2OED A;  4URK A;  4FBJ B;  2LHE A; 
#chains in the Genus database with same CATH homology
 2O6V B;  4WQO B;  4EKU A;  2JPH A;  4GDK B;  1J8C A;  2DYO A;  2NPT A;  2A4Z A;  2L05 A;  4GDL A;  5L95 C;  4NJ7 A;  1R4N I;  3UIO B;  3WIM A;  3VDZ A;  4FHJ A;  3ZUN A;  5J17 A;  4FUL A;  3O65 B;  1WXM A;  1WX8 A;  2KWC A;  2KQS A;  4MSM B;  3VTV A;  2OOB B;  5IAA C;  4EFO A;  2HD5 B;  2IO3 B;  5CX3 A;  3ZNZ B;  4LJO B;  4MSQ B;  2ZVN A;  2DX5 B;  4NAW A;  2Z0E B;  2AEH A;  1I42 A;  1RRB A;  1GC6 A;  5DPT A;  3PRM B;  3W1S C;  3WA0 A;  1I35 A;  4ASW C;  2GBK A;  4KSK C;  4BKT A;  2DYB A;  4A3P A;  3MHS D;  3IG3 A;  1LQB A;  2BKR B;  1FXT B;  1WM2 A;  3NZS A;  2KJ6 A;  2L00 B;  3JYU A;  4IWO A;  3APC A;  5EDS A;  4GSW A;  3HIZ A;  3QK0 A;  2PE9 A;  2CHZ A;  1WZ0 A;  2BYF A;  3EEC A;  2MBQ A;  4IM2 A;  2XK5 A;  3ZW3 A;  5TR5 A;  3NZU A;  3W1S A;  2KFJ A;  3NOB A;  3PRP B;  4N9F 4;  3A9K A;  2KZR A;  5J2R A;  3P2B A;  2R2O A;  1GNU A;  3SDL C;  2XBB C;  3ZIM A;  3IFW B;  2C7H A;  2MW5 A;  4GN1 A;  4FA6 A;  4HK2 A;  2GBJ A;  2RGF A;  3JSV B;  1LXD A;  2YVC A;  3U7D A;  4ZYN A;  3B08 A;  2V1Y A;  1HE8 A;  3NY5 A;  4IW0 A;  5GMV A;  2D10 A;  3BIN A;  1F9J A;  5LXH A;  4OVV A;  3B1L X;  1E7V A;  4P7I A;  4IM3 A;  2KTF A;  1G6J A;  1WMH A;  3PHX B;  4PS7 A;  3LDZ E;  4HPL B;  2CHX A;  1U4A A;  3ZDT A;  3KW5 B;  5CHV C;  1VCB A;  4EZK A;  3DVG Y;  2MWS B;  3EHV A;  3WAO A;  3CMM B;  2KDE B;  1V5T A;  1ZW7 A;  2G45 B;  4MGI E;  5BO4 B;  3VXW A;  3PHW B;  2J0M A;  4HPM B;  4EZL A;  2JY6 A;  2M1M A;  1WGR A;  1WXA A;  2IBI B;  2Y5B B;  2ZNV B;  4K81 A;  4E74 A;  2GMI C;  3QA8 A;  1C1Y B;  4DHZ E;  1EF5 A;  4PS8 A;  2K8H A;  2WWZ A;  3N32 A;  2LWP A;  2IY1 B;  2ZZP B;  3ENE A;  2KX0 A;  4WJP A;  1WR1 A;  3AI5 A;  1UZX B;  2LZ6 A;  1YD8 U;  2JT4 B;  2MLB A;  2ZJD A;  1EF1 A;  3PV1 A;  4EUT A;  4K7W A;  2MBB B;  4B95 A;  1L2N A;  2LD9 A;  3PRE A;  4G0N B;  4W9D A;  5G55 A;  1Q0W B;  2WDT B;  2NBV B;  2NVU I;  4GIV A;  2N1W A;  3AUL A;  2MQJ A;  5LXI B;  1GG3 A;  3N30 A;  4BBN C;  2O6V D;  4BVU C;  3CF6 E;  4HXD A;  3DVG X;  4KV2 A;  3PLU A;  3UQA A;  2ZEQ A;  2ZPN A;  3UIN B;  3VH4 B;  3QIJ A;  2LGD A;  3H7P A;  2O2V B;  2KVR A;  2FAZ A;  3NS8 A;  1K8R B;  4OVU A;  3RZW C;  3JW0 X;  2J7Q B;  4ZDV A;  4W9J A;  4MEL A;  3KUC B;  2KN5 A;  2IO0 B;  4AJW A;  2UYZ B;  2LGX A;  2I1J A;  3DBL I;  4W9C A;  3RZF A;  4MGK E;  3C0R B;  2O6V A;  2ASQ A;  2D11 A;  3GZN I;  3QWZ B;  3BY4 B;  3T8M A;  5HKH A;  1PQS A;  2XEW A;  2JZZ A;  1NBF C;  2BPS A;  2CHW A;  2MSE D;  4GDK A;  4WJN A;  2G3Q B;  2G4D B;  3R66 C;  5C23 A;  3ZNG C;  1NI2 A;  1EO6 A;  3RD2 A;  1OQY A;  3M62 B;  1UGM A;  4MGZ E;  1YJ1 A;  3V6E B;  3VHT C;  4B6W A;  4ZRJ A;  4RM9 A;  1V86 A;  2N4F A;  2KK8 A;  4W9F A;  3RYT A;  1YX5 B;  4FJZ A;  3KH0 A;  3VTW A;  1E8Y A;  3CSF A;  1ZKH A;  1R4M I;  2IZV B;  2IO1 B;  2REX A;  3U30 A;  4CYE A;  3PRZ A;  1LFD A;  2Z0D B;  4FN2 A;  3RT3 B;  1P9D U;  3KYD D;  3GOE A;  1WJN A;  2DZK A;  4IWQ A;  2BGF A;  3A33 B;  1LM8 B;  2L8J A;  3H1U A;  3DVN U;  4BKG A;  4J6I A;  5C1Z A;  3A1Q B;  3UF8 A;  4CHK A;  4MJS B;  1IPG A;  3UGB B;  5L83 A;  1YQB A;  3U8Z A;  4IM0 A;  4I6P A;  4JQW C;  2GBN A;  3I3T B;  3L16 A;  2KLG A;  3AU5 A;  4PYU A;  4IWP A;  4TQ0 A;  2N7E A;  4DDG D;  4ICV A;  4LCD E;  2C7M B;  4AWJ A;  1XQQ A;  1TZ1 A;  5FR6 A;  4TV3 A;  2CU1 A;  4PYZ A;  1OEY A;  3QAQ A;  3ZRF A;  4ANX A;  3AXC A;  3PT2 B;  3JSV A;  5E6O A;  2D3G A;  2KMC A;  4K1R B;  4A20 A;  3ZRC A;  2IO2 B;  2D07 B;  3ZNI D;  1C3T A;  1WY8 A;  2KTR B;  2LAS A;  3V60 A;  4AP4 C;  3IVF A;  2C9W B;  3OAW A;  1WYW B;  1Y8R C;  2NBU A;  2HTH A;  2L7R A;  3IHP C;  3L17 A;  3DVN V;  2MBH A;  4G11 A;  4WWO A;  2BKF A;  2BWE S;  1Q5W B;  4ANV A;  4KIK A;  2M17 A;  3ZNH B;  1E8W A;  1J0G A;  4F1S A;  2KDI A;  3ALB A;  2FUH B;  1V80 A;  2HJ8 A;  2DAF A;  3SD5 A;  1WRD B;  4AUQ C;  1QZE A;  5DPR A;  3VUY A;  1A5R A;  3RUI B;  4HCN B;  5J18 A;  1WM3 A;  4M0W B;  1KLV A;  1KOT A;  4A3O A;  2MP2 B;  2FCQ A;  1WX7 A;  1GJZ A;  1WI0 A;  1AAR A;  2LRU A;  3Q3J A;  1OEY J;  2JRI B;  1J19 A;  4JGH B;  4KSL C;  3ML8 A;  3A9J B;  2KXJ A;  3HK0 A;  3PZD A;  3TCA A;  1E5W A;  3H9D A;  1KJT A;  3APF A;  4XZ4 A;  4IG7 B;  2LXC A;  3ZTC A;  5IA7 A;  1UEL A;  2LVP A;  1UH6 A;  2AYO B;  2KX3 A;  4K7U A;  1WJ4 A;  2KD0 A;  2OJR A;  4KDI C;  4M8M A;  4X57 B;  4LJP B;  1SE9 A;  2EMT A;  4HCP B;  3APD A;  2MRP A;  4XC2 A;  1ISN A;  2JRH A;  2WYQ A;  1XD3 B;  5D7G A;  4HVB A;  2NBW B;  3H6N A;  3RUL A;  3OLM D;  3PLV A;  3VUX A;  1V49 A;  1WH3 A;  3LJ3 A;  2K25 A;  5E6N A;  4BBN F;  1WGY A;  2B3A A;  3KVF B;  4W9L A;  1E90 A;  1GUA B;  2O2V A;  4W9I A;  3ZLZ A;  1P0R A;  2WX1 A;  5D6J B;  3VTU A;  1WXS A;  4AJY B;  3DBH I;  1S3S G;  2N9E B;  4FAD A;  1YIW A;  2L76 A;  2FCM A;  1T0Y A;  1Z2M A;  3QQ8 B;  3VAW A;  1L7Y A;  1WFY A;  2KFK B;  1ZGU B;  3JVZ X;  3WAM A;  3ZO5 B;  4DHJ B;  2AWT A;  2M8S A;  4ANW A;  4TKN A;  3IBE A;  4BKS D;  2R2Q A;  1RAX A;  2N1V A;  5AZG A;  3WAL A;  2KMA A;  5KHQ A;  3ECI A;  3DCG A;  2CR5 A;  2L3Z A;  4NQK E;  5E6P A;  3UQB A;  1WJ6 A;  4ZRK A;  4K7S A;  2IY0 B;  2KNB A;  3L10 B;  3TMP B;  3A4S C;  1E8X A;  2JF5 A;  4DDI D;  2DZM A;  4NPN A;  2DYM A;  2FCN A;  4BOZ B;  3DQV A;  2LUE A;  1UBQ A;  2BYV E;  4II2 B;  4DHZ B;  3OJ3 A;  3UIP B;  4KVG B;  4W9H A;  3PVL A;  3KYC D;  4KDL B;  2DHZ A;  5JHB A;  2MBO A;  2K6D B;  2V4L A;  1WXV A;  3A1Q A;  3ZKJ C;  4I6N B;  1X1M A;  4MJS A;  2VRR B;  1S1Q B;  2KC1 A;  3CST A;  5G2N A;  2DZJ A;  1TBE A;  2L0T A;  2FNJ B;  4IC7 B;  5CTR C;  2CKH B;  2KJH B;  3OJ4 B;  2LI5 A;  4WJQ A;  1P98 A;  4GGQ A;  4B9K A;  3DBR I;  2C7N B;  2DEN B;  2J0J A;  2JWZ A;  4NJ6 A;  2NS5 A;  4DK5 A;  3QC8 B;  4LDT D;  1YX6 B;  3R7R A;  4MH0 E;  3VH3 B;  3K9P B;  3TBL D;  4XX5 A;  1V6E A;  4GXB A;  2HE7 A;  4JLC A;  5DCN A;  2BWF A;  4I6L B;  1JRU A;  4CO7 A;  3M63 B;  2LRW A;  2KQ7 A;  2ZVO A;  2KTR A;  1RFA A;  4WJO A;  3L13 A;  2RSU A;  1P1A A;  2J0K A;  3TJP A;  3ZTD A;  4FJV B;  5DPS A;  1KM7 A;  4DWF A;  2NPT B;  1VD2 A;  4GDL B;  2JUO A;  2IYD B;  3V62 A;  5AZH A;  2FIF A;  3T9L A;  1WJU A;  2AL6 A;  2UWQ A;  3TIX A;  4KZ0 A;  3Q3F A;  4FLH A;  2DZI A;  1H8C A;  4NY0 A;  3VVW B;  1RLF A;  4W9G A;  2ZCC A;  2K1F A;  4LDT B;  2ZNV C;  3PTF C;  4NAW B;  5CHF A;  1E8Z A;  1WE7 A;  2MP2 A;  2N9X A;  4ICU A;  3RCZ A;  2KC2 A;  2LXA A;  2KO3 A;  3AU4 A;  2BYE A;  3A9J A;  4KZC A;  4EZJ A;  3QCA A;  4DXA B;  2L0F A;  2GBR A;  3ZVV A;  1V81 A;  3MTN B;  3D32 A;  2DAJ A;  4HDQ A;  2A5U A;  4EOY A;  3PSE B;  2I1K A;  2XK5 B;  3WAP A;  4AOF A;  2LGY A;  1UBI A;  2MX2 A;  2PJH A;  2MBE A;  3QHT A;  4F7Z A;  3WAN A;  2KWU B;  3A9K B;  2FCS A;  2KKC A;  2G4S A;  1WX9 A;  4RM8 A;  3V61 A;  3N3K B;  2C60 A;  2KAN A;  5JZE B;  3VFK A;  2RD0 A;  4WWP A;  2M0X A;  1WIA A;  2AL3 A;  3B0A A;  1P3Q U;  5CHW A;  3A4R A;  3L08 A;  2ZCB A;  2PE6 B;  1WF9 A;  2QHO A;  3M3J A;  3KUD B;  3QAR A;  3MJW A;  4G3X B;  4KIK B;  2W9N A;  4WAA A;  1E7U A;  3M95 A;  4FHK A;  1OTR B;  3ZDM C;  1SIF A;  4FBJ B;  2KLC A;  2D2Q A;  4IUM B;  1WMH B;  1V5O A;  2K8C A;  3DPD A;  2CS4 A;  3ML9 A;  3HHM A;  1TTN A;  2KFK A;  3ONS A;  3H7S A;  2K39 A;  1SGH A;  1WZ3 A;  1H4R A;  3DDC B;  2KOX A;  1WGH A;  2BF8 B;  1TGZ B;  1OGW A;  2KWV B;  4TUU A;  4GB9 A;  2N9P C;  2RR9 A;  4FJY A;  2EKE C;  2Z59 B;  5JHA A;  4JL9 A;  1EUV B;  2LVQ A;  3PPA A;  4PS3 A;  5DPW A;  5LLI A;  4DBG A;  1BT0 A;  2M4N A;  5JH5 C;  2GOW A;  2KDF B;  2KDB A;  2KJR A;  5D94 A;  4JIO U;  3X23 A;  1M94 A;  1Z5S B;  1WGD A;  3L54 A;  1WR6 E;  2NCN A;  4ZRI A;  2V3S A;  2FID A;  2K8B A;  2WX0 A;  3R3M A;  3TL5 A;  2GBM A;  4DHJ D;  1WE6 A;  2RPQ A;  3VQI A;  4W9K A;  2JZ3 B;  3QX1 A;  3PS6 A;  3R7Q A;  5AZF A;  2JVC A;  3QJZ A;  3VUW A;  5AEK B;  2MA9 B;  2EMS A;  2PEA A;  4GOC A;  4MGY E;  1Q1O A;  3KUZ A;  4BKS A;  1UD7 A;  4E3C A;  1WGG A;  2K6Q A;  2LJ5 A;  3K9O B;  4GMV A;  2LVO A;  3V6C B;  2C5L C;  4MEM A;  3X0W A;  4MM3 A;  4E71 A;  5D2M B;  1D3Z A;  3DOW A;  3EC8 A;  4TQ1 A;  4GU2 A;  4RMA A;  4G50 A;  3S2A A;  4YL8 A;  2NR2 A;  4BOS C;  3H7P B;  1XT9 B;  2JXX A;  3L0W B;  1MG8 A;  2YLM A;  3NHE B;  3HM3 A;  4HWI B;  3HM6 X;  4II3 B;  2ZPY A;  2MCN B;  1IYF A;  1NDD A;  3SHQ A;  4M8N A;  1GC7 A;  4WWN A;  2KHW B;  4NNJ B;  4W9E A;  4HLE A;  4EEW A;  3PGE A;  3DBS A;  4HJK A;  1CMX B;  2N7D A;  4BFR A;  1V9J A;  1V2Y A;  4HDO A;  1IP9 A;  2PPH A;  3W1Y A;  4URK A;  4F8C B;  4NQL B;  3EFU A;  5KHO A;  3SU8 X;  4ANU A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...