3ZPCA

Acinetobacter baumannii ribd, form 1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
357
structure length
357
Chain Sequence
SELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDDQLIGEGFHPKAGQPHAEVFALRQAGEQAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVVACPDPNPLVAGKGVQILKNAGIEVEIGICEDLAAKLNQGFLKAMSTGMPYVRLKVASSLDGRTAMASGESKWITGSAARQDVQHWRAISGAVITGIDTVIADDCQLNVRSLHNIDIETVAQPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQTLSKQYQIYDVLIEAGATLSSAFLQEGLIDEMISYVAPTLLGQSARAMFNADFEYMAQQLRFKLLDVIQLDQDIRLRLIPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Diaminohydroxyphosphoribosylaminopyrimidine Deaminase/5-Amino-6-(5-Phosphoribosylamino)Uracil Reductase from Acinetobacter Baumannii.
pubmed doi rcsb
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
molecule tags Oxidoreductase
source organism Acinetobacter baumannii
total genus 107
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 1.1.1.193: 5-amino-6-(5-phosphoribosylamino)uracil reductase.
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 3zpcA01
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3zpcA02
4NX6A 1RX1A 2HVVA 3K74A 2L28A 3S3VA 4OWPA 3S9UA 3DMOA 2W9GA 1OHJA 4XE6X 1P6OA 3JWCA 1AOEA 1LUDA 3JWKA 1Z3AA 2QLCA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 2Z3JA 3NZ9X 2KKSA 1DRHA 1TDRA 4PSYA 5HQYA 1DR4A 3E0BA 4O8YB 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 2QK8A 5HSRA 4XT7A 3GHCA 4MSQA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 5M52C 3NTZA 4PSSA 4WIFA 1RB2A 2ZNRA 4KY8A 5CCCA 1DAJA 4KLXA 5C2OA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 4MSDA 3TQ8A 3NZCX 3QLSA 1DREA 2O96A 4LC5A 4P9EA 4E0QA 1S3WA 1JTKA 4GH8A 1BZFA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 1OI0A 3CD2A 1OX7A 3DATA 4OCMB 2OG4A 4G3MA 4LD2A 2H2QA 4LCNA 1JUVA 2W3WA 4OR7A 4MSJA 4ELFA 4QHVA 2W3MA 1LY3A 5CW6A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 4MS7A 1UX1A 3GHVA 4QLFA 3SRQX 4PTJA 1QZFA 2INQA 3ZEFB 4PTHA 3TD8A 4ILGC 2NX8A 5JA3A 1KMSA 4LAHX 2ITHA 3NZDA 2ZNVA 3QFXA 4Q0EA 1MVTA 1RD7A 2FR5A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3OJ6A 4EG2A 3D80A 3FY9X 3NZBX 3IROA 1MQ0A 4OSGA 4P9CA 4F3WA 3G8QA 5HF2X 3QLRA 4M6LA 1DR7A 4ZD4A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 4OWPB 3JWFA 3JWMA 4OCNA 1RA8A 4KM2A 2W9TA 4Q6AA 1LY4A 5HT4A 1WN6A 4IXFX 3TQAA 4LD4A 2BLAA 2AZNA 3FRDX 1VQ2A 1JOMA 5M59B 3NZAX 1CTTA 3EELA 3QL0A 1DRBA 3L3RA 2FR6A 2Z3HA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 4HRQA 1DR3A 1VDRA 3FQZA 1ZABA 2FZIA 4BGDC 3SGYA 2JYBA 5GAOA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 4HOEA 4KITC 4G95A 3KGYA 3FQFA 1U70A 1D1GA 1CTUA 4O8XA 4KY4A 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 1AF2A 4DP3A 2BL9A 3QG2A 1AO8A 1RB7A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4JXEA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1YSBA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 4ZD5A 1YSDA 3S7AA 3F0BX 2RPZA 4XT4A 3DAUA 4K1RA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 2PW9A 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 4DFRA 4OCMA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 2O95A 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 1UX0A 1R5TA 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 4HRWA 2DRCA 2W3BA 1PD8A 3DH1A 3GHWA 4KFJA 4EIZA 1J3KA 3NXRA 4DDRA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 2W4LA 3NU0A 4WIGA 2C2SA 3SA2A 1RB3A 3INVA 4M2XA 3SBGA 3SRWX 4OCLA 5U26A 3RG9A 1S3VA 3KJRA 4KL9A 4I43B 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 3B8FA 4QLGA 1VJ3A 1J3IA 4ZFTA 3R2NA 1J3JA 1AI9A 4Q0DA 1UWZA 3JSUA 3M08A 5DCAJ 1CD2A 2O3KA 1R5XA 4ZFRA 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 3ZPCA 1DR1A 1RH3A 5HT5A 4KNEA 4P9DA 3KJSA 5HVEA 2D30A 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4O8YA 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 4O8XB 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 2HVWA 3R33A 3IA4A 3QYOA 1ALNA 1BOZA 3NXTA 2Z3IA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 2B3JA 1DYHA 1HFPA 1RA2A 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 1DHIA 2P87A 2Z3GA 3CSEA 2D5NA 1RX5A 2ZZAA 2NYTA 1SEJA 3D84X 4D10F 3NXXA 3K47A 4NQLA 1RC4A 1DR6A 3KFYA 2OBCA 4PQTA 2A8NA 3ZPGA 2P8RA 3IJFX 3OCQA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 1WN5A 3RO9A 3DGAA 1DDSA 1M79A 3NXOA 4H96A 3MPZA 4KEBA 1RG7A 3FQ0A 3M09A 4XRBA 3VCOA 4H98A 4HA9A 5JG0X 3GI2A 4LAEX 1WKQA 3FL8A 3RZUA 1RX4A 3QLXA 3E1UA 4QJCA 3QL3A 2BLCA 1TIYA 4LCPA 1PD9A 3RZVA 3DG8A 4F7OA 8DFRA 4ELGA 4KD7A 4EILA 2G84A 2FZJA 2KCQA 4FHBA 7DFRA 4OCLB 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4OCNB 4XT5A 4EIGA 5FDAA 5HUIA 1WWRA 4M6JA 4Q67A 1UAQA 2KGKA 5EAJA 3SAIA 3JVXA 4XECX 3NXYA 1DYJA 4LCOA 1KLKA 4QFTA 4ELHA 2P4GA 4MSMA 1RX2A 3QLZA
chains in the Genus database with same CATH superfamily
4NX6A 1RX1A 2HVVA 3K74A 2L28A 3S3VA 4OWPA 3S9UA 3DMOA 2W9GA 1OHJA 4XE6X 1P6OA 3JWCA 1AOEA 1LUDA 3JWKA 2QLCA 1Z3AA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 4A1OA 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 2Z3JA 3NZ9X 2KKSA 1DRHA 1TDRA 4PSYA 5HQYA 1M9NA 1DR4A 3E0BA 4O8YB 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 3ZZMA 2QK8A 5HSRA 4XT7A 3GHCA 4MSQA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 5M52C 3NTZA 4PSSA 4WIFA 1RB2A 2ZNRA 4KY8A 5CCCA 1DAJA 4KLXA 5C2OA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 4MSDA 3TQ8A 3NZCX 3QLSA 1DREA 2O96A 4LC5A 4P9EA 4E0QA 1VK9A 1S3WA 1JTKA 4GH8A 1BZFA 2B1IA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 1OI0A 3CD2A 1OX7A 3DATA 4OCMB 2OG4A 4G3MA 4LD2A 2H2QA 4LCNA 1JUVA 2W3WA 4OR7A 4MSJA 4ELFA 4QHVA 2W3MA 1LY3A 5CW6A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 4MS7A 1UX1A 3GHVA 4QLFA 3SRQX 4PTJA 1QZFA 2INQA 3ZEFB 4PTHA 3TD8A 4ILGC 2NX8A 5JA3A 1KMSA 4LAHX 2ITHA 1PKXA 3NZDA 2ZNVA 3QFXA 4Q0EA 1MVTA 1RD7A 2FR5A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3OJ6A 4EG2A 3D80A 3FY9X 3NZBX 3IROA 1MQ0A 4OSGA 4P9CA 4F3WA 3G8QA 5HF2X 3QLRA 4M6LA 1DR7A 4ZD4A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 4OWPB 3JWFA 3JWMA 4OCNA 1RA8A 4KM2A 2W9TA 4Q6AA 1LY4A 5HT4A 1WN6A 4IXFX 3TQAA 4LD4A 2BLAA 2AZNA 3FRDX 1G8MA 1VQ2A 1JOMA 5M59B 3NZAX 1CTTA 3EELA 3QL0A 1DRBA 3L3RA 2FR6A 2Z3HA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 4HRQA 1DR3A 1VDRA 3FQZA 1ZABA 2FZIA 4BGDC 3SGYA 2JYBA 5GAOA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 2IU3A 4HOEA 4KITC 4G95A 3KGYA 3FQFA 1U70A 1D1GA 1CTUA 4O8XA 4KY4A 4GGMX 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 1AF2A 4DP3A 2BL9A 3QG2A 1AO8A 1RB7A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4JXEA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1YSBA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 4ZD5A 1YSDA 3S7AA 3F0BX 2RPZA 4XT4A 3DAUA 4K1RA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 2PW9A 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 1ZCZA 4DFRA 4OCMA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 2O95A 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 1UX0A 1R5TA 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 4HRWA 2DRCA 2W3BA 1PD8A 3DH1A 3GHWA 4KFJA 4EIZA 1J3KA 3NXRA 4DDRA 2B1GA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 2W4LA 3NU0A 4WIGA 2C2SA 3SA2A 1RB3A 3INVA 4M2XA 3SBGA 3SRWX 4OCLA 5U26A 3RG9A 1S3VA 1THZA 3KJRA 4KL9A 4I43B 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 3B8FA 4QLGA 1VJ3A 1J3IA 4ZFTA 3R2NA 1J3JA 1AI9A 4Q0DA 1UWZA 3JSUA 3M08A 5DCAJ 1CD2A 2O3KA 1R5XA 4ZFRA 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 3ZPCA 1DR1A 1RH3A 5HT5A 4KNEA 1P4RA 4P9DA 3KJSA 5HVEA 2D30A 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4O8YA 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 4O8XB 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 2HVWA 3R33A 3IA4A 2IU0A 3QYOA 1ALNA 1BOZA 3NXTA 2Z3IA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 2B3JA 1DYHA 1HFPA 1RA2A 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4J6EA 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 4EHIA 1DHIA 2P87A 2Z3GA 3CSEA 2D5NA 1RX5A 2ZZAA 2NYTA 1SEJA 3D84X 4D10F 3NXXA 3K47A 4NQLA 1RC4A 1DR6A 3KFYA 2OBCA 4PQTA 2A8NA 3ZPGA 2P8RA 3IJFX 3OCQA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 1WN5A 3RO9A 3DGAA 1DDSA 1M79A 3NXOA 4H96A 3MPZA 4KEBA 1RG7A 3BH1A 3FQ0A 3M09A 4XRBA 4H98A 4HA9A 3VCOA 5JG0X 3GI2A 4LAEX 1WKQA 3FL8A 3RZUA 1RX4A 3QLXA 3E1UA 4QJCA 3QL3A 2BLCA 1TIYA 4LCPA 1PD9A 3RZVA 3DG8A 4F7OA 8DFRA 4ELGA 4KD7A 4EILA 2G84A 2FZJA 2KCQA 4FHBA 7DFRA 4OCLB 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4OCNB 4XT5A 4EIGA 5FDAA 5HUIA 1WWRA 4M6JA 4Q67A 1UAQA 2KGKA 5EAJA 3SAIA 3JVXA 1PL0A 4XECX 1OZ0A 3NXYA 1DYJA 3VX8A 4LCOA 1KLKA 4QFTA 4ELHA 2P4GA 4MSMA 1RX2A 3QLZA
chains in the Genus database with same CATH topology
4NX6A 1RX1A 2HVVA 3K74A 2L28A 3S3VA 4OWPA 3S9UA 3DMOA 2W9GA 1OHJA 4XE6X 1P6OA 3JWCA 1AOEA 1LUDA 3JWKA 1Z3AA 2QLCA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 2Z3JA 3NZ9X 2KKSA 1DRHA 1TDRA 4PSYA 5HQYA 1DR4A 3E0BA 4O8YB 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 2QK8A 5HSRA 4XT7A 3GHCA 4MSQA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 5M52C 3NTZA 4PSSA 4WIFA 1RB2A 2ZNRA 4KY8A 5CCCA 1DAJA 4KLXA 5C2OA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 4MSDA 3TQ8A 3NZCX 3QLSA 1DREA 2O96A 4LC5A 4P9EA 4E0QA 1S3WA 1JTKA 4GH8A 1BZFA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 1OI0A 3CD2A 1OX7A 3DATA 4OCMB 2OG4A 4G3MA 4LD2A 2H2QA 4LCNA 1JUVA 2W3WA 4OR7A 4MSJA 4ELFA 4QHVA 2W3MA 1LY3A 5CW6A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 4MS7A 1UX1A 3GHVA 4QLFA 3SRQX 4PTJA 1QZFA 2INQA 3ZEFB 4PTHA 3TD8A 4ILGC 2NX8A 5JA3A 1KMSA 4LAHX 2ITHA 3NZDA 2ZNVA 3QFXA 4Q0EA 1MVTA 1RD7A 2FR5A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3OJ6A 4EG2A 3D80A 3FY9X 3NZBX 3IROA 1MQ0A 4OSGA 4P9CA 4F3WA 3G8QA 5HF2X 3QLRA 4M6LA 1DR7A 4ZD4A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 4OWPB 3JWFA 3JWMA 4OCNA 1RA8A 4KM2A 2W9TA 4Q6AA 1LY4A 5HT4A 1WN6A 4IXFX 3TQAA 4LD4A 2BLAA 2AZNA 3FRDX 1VQ2A 1JOMA 5M59B 3NZAX 1CTTA 3EELA 3QL0A 1DRBA 3L3RA 2FR6A 2Z3HA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 4HRQA 1DR3A 1VDRA 3FQZA 1ZABA 2FZIA 4BGDC 3SGYA 2JYBA 5GAOA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 4HOEA 4KITC 4G95A 3KGYA 3FQFA 1U70A 1D1GA 1CTUA 4O8XA 4KY4A 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 1AF2A 4DP3A 2BL9A 3QG2A 1AO8A 1RB7A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4JXEA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1YSBA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 4ZD5A 1YSDA 3S7AA 3F0BX 2RPZA 4XT4A 3DAUA 4K1RA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 2PW9A 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 4DFRA 4OCMA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 2O95A 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 1UX0A 1R5TA 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 4HRWA 2DRCA 2W3BA 1PD8A 3DH1A 3GHWA 4KFJA 4EIZA 1J3KA 3NXRA 4DDRA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 2W4LA 3NU0A 4WIGA 2C2SA 3SA2A 1RB3A 3INVA 4M2XA 3SBGA 3SRWX 4OCLA 5U26A 3RG9A 1S3VA 3KJRA 4KL9A 4I43B 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 3B8FA 4QLGA 1VJ3A 1J3IA 4ZFTA 3R2NA 1J3JA 1AI9A 4Q0DA 1UWZA 3JSUA 3M08A 5DCAJ 1CD2A 2O3KA 1R5XA 4ZFRA 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 3ZPCA 1DR1A 1RH3A 5HT5A 4KNEA 4P9DA 3KJSA 5HVEA 2D30A 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4O8YA 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 4O8XB 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 2HVWA 3R33A 3IA4A 3QYOA 1ALNA 1BOZA 3NXTA 2Z3IA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 2B3JA 1DYHA 1HFPA 1RA2A 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 1DHIA 2P87A 2Z3GA 3CSEA 2D5NA 1RX5A 2ZZAA 2NYTA 1SEJA 3D84X 4D10F 3NXXA 3K47A 4NQLA 1RC4A 1DR6A 3KFYA 2OBCA 4PQTA 2A8NA 3ZPGA 2P8RA 3IJFX 3OCQA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 1WN5A 3RO9A 3DGAA 1DDSA 1M79A 3NXOA 4H96A 3MPZA 4KEBA 1RG7A 3FQ0A 3M09A 4XRBA 3VCOA 4H98A 4HA9A 5JG0X 3GI2A 4LAEX 1WKQA 3FL8A 3RZUA 1RX4A 3QLXA 3E1UA 4QJCA 3QL3A 2BLCA 1TIYA 4LCPA 1PD9A 3RZVA 3DG8A 4F7OA 8DFRA 4ELGA 4KD7A 4EILA 2G84A 2FZJA 2KCQA 4FHBA 7DFRA 4OCLB 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4OCNB 4XT5A 4EIGA 5FDAA 5HUIA 1WWRA 4M6JA 4Q67A 1UAQA 2KGKA 5EAJA 3SAIA 3JVXA 4XECX 3NXYA 1DYJA 4LCOA 1KLKA 4QFTA 4ELHA 2P4GA 4MSMA 1RX2A 3QLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NX6 A;  1RX1 A;  2HVV A;  3K74 A;  2L28 A;  3S3V A;  4OWP A;  3S9U A;  3DMO A;  2W9G A;  1OHJ A;  4XE6 X;  1P6O A;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  1Z3A A;  2QLC A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  2Z3J A;  3NZ9 X;  2KKS A;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1DR4 A;  3E0B A;  4O8Y B;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  4MSQ A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  5M52 C;  3NTZ A;  4PSS A;  4WIF A;  1RB2 A;  2ZNR A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5C2O A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  4MSD A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  2O96 A;  4LC5 A;  4P9E A;  4E0Q A;  1S3W A;  1JTK A;  4GH8 A;  1BZF A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  1OI0 A;  3CD2 A;  1OX7 A;  3DAT A;  4OCM B;  2OG4 A;  4G3M A;  4LD2 A;  2H2Q A;  4LCN A;  1JUV A;  2W3W A;  4OR7 A;  4MSJ A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  5CW6 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  4MS7 A;  1UX1 A;  3GHV A;  4QLF A;  3SRQ X;  4PTJ A;  1QZF A;  2INQ A;  3ZEF B;  4PTH A;  3TD8 A;  4ILG C;  2NX8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  3NZD A;  2ZNV A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  2FR5 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3OJ6 A;  4EG2 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  1MQ0 A;  4OSG A;  4P9C A;  4F3W A;  3G8Q A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  4ZD4 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  4OWP B;  3JWF A;  3JWM A;  4OCN A;  1RA8 A;  4KM2 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  1WN6 A;  4IXF X;  3TQA A;  4LD4 A;  2BLA A;  2AZN A;  3FRD X;  1VQ2 A;  1JOM A;  5M59 B;  3NZA X;  1CTT A;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  2FR6 A;  2Z3H A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  4HRQ A;  1DR3 A;  1VDR A;  3FQZ A;  1ZAB A;  2FZI A;  4BGD C;  3SGY A;  2JYB A;  5GAO A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  4HOE A;  4KIT C;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  1CTU A;  4O8X A;  4KY4 A;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  1AF2 A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  1RB7 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4JXE A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1YSB A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  4ZD5 A;  1YSD A;  3S7A A;  3F0B X;  2RPZ A;  4XT4 A;  3DAU A;  4K1R A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  2PW9 A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  4DFR A;  4OCM A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  2O95 A;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  1UX0 A;  1R5T A;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  4HRW A;  2DRC A;  2W3B A;  1PD8 A;  3DH1 A;  3GHW A;  4KFJ A;  4EIZ A;  1J3K A;  3NXR A;  4DDR A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  2W4L A;  3NU0 A;  4WIG A;  2C2S A;  3SA2 A;  1RB3 A;  3INV A;  4M2X A;  3SBG A;  3SRW X;  4OCL A;  5U26 A;  3RG9 A;  1S3V A;  3KJR A;  4KL9 A;  4I43 B;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  3B8F A;  4QLG A;  1VJ3 A;  1J3I A;  4ZFT A;  3R2N A;  1J3J A;  1AI9 A;  4Q0D A;  1UWZ A;  3JSU A;  3M08 A;  5DCA J;  1CD2 A;  2O3K A;  1R5X A;  4ZFR A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  3ZPC A;  1DR1 A;  1RH3 A;  5HT5 A;  4KNE A;  4P9D A;  3KJS A;  5HVE A;  2D30 A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4O8Y A;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  4O8X B;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  2HVW A;  3R33 A;  3IA4 A;  3QYO A;  1ALN A;  1BOZ A;  3NXT A;  2Z3I A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  2B3J A;  1DYH A;  1HFP A;  1RA2 A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  1DHI A;  2P87 A;  2Z3G A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  2NYT A;  1SEJ A;  3D84 X;  4D10 F;  3NXX A;  3K47 A;  4NQL A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  4PQT A;  2A8N A;  3ZPG A;  2P8R A;  3IJF X;  3OCQ A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  1WN5 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  3NXO A;  4H96 A;  3MPZ A;  4KEB A;  1RG7 A;  3FQ0 A;  3M09 A;  4XRB A;  3VCO A;  4H98 A;  4HA9 A;  5JG0 X;  3GI2 A;  4LAE X;  1WKQ A;  3FL8 A;  3RZU A;  1RX4 A;  3QLX A;  3E1U A;  4QJC A;  3QL3 A;  2BLC A;  1TIY A;  4LCP A;  1PD9 A;  3RZV A;  3DG8 A;  4F7O A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2G84 A;  2FZJ A;  2KCQ A;  4FHB A;  7DFR A;  4OCL B;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4OCN B;  4XT5 A;  4EIG A;  5FDA A;  5HUI A;  1WWR A;  4M6J A;  4Q67 A;  1UAQ A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  4XEC X;  3NXY A;  1DYJ A;  4LCO A;  1KLK A;  4QFT A;  4ELH A;  2P4G A;  4MSM A;  1RX2 A;  3QLZ A; 
#chains in the Genus database with same CATH topology
 4NX6 A;  1RX1 A;  2HVV A;  3K74 A;  2L28 A;  3S3V A;  4OWP A;  3S9U A;  3DMO A;  2W9G A;  1OHJ A;  4XE6 X;  1P6O A;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  2QLC A;  1Z3A A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  4A1O A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  2Z3J A;  3NZ9 X;  2KKS A;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1M9N A;  1DR4 A;  3E0B A;  4O8Y B;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  3ZZM A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  4MSQ A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  5M52 C;  3NTZ A;  4PSS A;  4WIF A;  1RB2 A;  2ZNR A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5C2O A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  4MSD A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  2O96 A;  4LC5 A;  4P9E A;  4E0Q A;  1VK9 A;  1S3W A;  1JTK A;  4GH8 A;  1BZF A;  2B1I A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  1OI0 A;  3CD2 A;  1OX7 A;  3DAT A;  4OCM B;  2OG4 A;  4G3M A;  4LD2 A;  2H2Q A;  4LCN A;  1JUV A;  2W3W A;  4OR7 A;  4MSJ A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  5CW6 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  4MS7 A;  1UX1 A;  3GHV A;  4QLF A;  3SRQ X;  4PTJ A;  1QZF A;  2INQ A;  3ZEF B;  4PTH A;  3TD8 A;  4ILG C;  2NX8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  1PKX A;  3NZD A;  2ZNV A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  2FR5 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3OJ6 A;  4EG2 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  1MQ0 A;  4OSG A;  4P9C A;  4F3W A;  3G8Q A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  4ZD4 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  4OWP B;  3JWF A;  3JWM A;  4OCN A;  1RA8 A;  4KM2 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  1WN6 A;  4IXF X;  3TQA A;  4LD4 A;  2BLA A;  2AZN A;  3FRD X;  1G8M A;  1VQ2 A;  1JOM A;  5M59 B;  3NZA X;  1CTT A;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  2FR6 A;  2Z3H A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  4HRQ A;  1DR3 A;  1VDR A;  3FQZ A;  1ZAB A;  2FZI A;  4BGD C;  3SGY A;  2JYB A;  5GAO A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  2IU3 A;  4HOE A;  4KIT C;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  1CTU A;  4O8X A;  4KY4 A;  4GGM X;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  1AF2 A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  1RB7 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4JXE A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1YSB A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  4ZD5 A;  1YSD A;  3S7A A;  3F0B X;  2RPZ A;  4XT4 A;  3DAU A;  4K1R A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  2PW9 A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  1ZCZ A;  4DFR A;  4OCM A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  2O95 A;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  1UX0 A;  1R5T A;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  4HRW A;  2DRC A;  2W3B A;  1PD8 A;  3DH1 A;  3GHW A;  4KFJ A;  4EIZ A;  1J3K A;  3NXR A;  4DDR A;  2B1G A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  2W4L A;  3NU0 A;  4WIG A;  2C2S A;  3SA2 A;  1RB3 A;  3INV A;  4M2X A;  3SBG A;  3SRW X;  4OCL A;  5U26 A;  3RG9 A;  1S3V A;  1THZ A;  3KJR A;  4KL9 A;  4I43 B;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  3B8F A;  4QLG A;  1VJ3 A;  1J3I A;  4ZFT A;  3R2N A;  1J3J A;  1AI9 A;  4Q0D A;  1UWZ A;  3JSU A;  3M08 A;  5DCA J;  1CD2 A;  2O3K A;  1R5X A;  4ZFR A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  3ZPC A;  1DR1 A;  1RH3 A;  5HT5 A;  4KNE A;  1P4R A;  4P9D A;  3KJS A;  5HVE A;  2D30 A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4O8Y A;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  4O8X B;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  2HVW A;  3R33 A;  3IA4 A;  2IU0 A;  3QYO A;  1ALN A;  1BOZ A;  3NXT A;  2Z3I A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  2B3J A;  1DYH A;  1HFP A;  1RA2 A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4J6E A;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  4EHI A;  1DHI A;  2P87 A;  2Z3G A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  2NYT A;  1SEJ A;  3D84 X;  4D10 F;  3NXX A;  3K47 A;  4NQL A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  4PQT A;  2A8N A;  3ZPG A;  2P8R A;  3IJF X;  3OCQ A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  1WN5 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  3NXO A;  4H96 A;  3MPZ A;  4KEB A;  1RG7 A;  3BH1 A;  3FQ0 A;  3M09 A;  4XRB A;  4H98 A;  4HA9 A;  3VCO A;  5JG0 X;  3GI2 A;  4LAE X;  1WKQ A;  3FL8 A;  3RZU A;  1RX4 A;  3QLX A;  3E1U A;  4QJC A;  3QL3 A;  2BLC A;  1TIY A;  4LCP A;  1PD9 A;  3RZV A;  3DG8 A;  4F7O A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2G84 A;  2FZJ A;  2KCQ A;  4FHB A;  7DFR A;  4OCL B;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4OCN B;  4XT5 A;  4EIG A;  5FDA A;  5HUI A;  1WWR A;  4M6J A;  4Q67 A;  1UAQ A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  1PL0 A;  4XEC X;  1OZ0 A;  3NXY A;  1DYJ A;  3VX8 A;  4LCO A;  1KLK A;  4QFT A;  4ELH A;  2P4G A;  4MSM A;  1RX2 A;  3QLZ A; 
#chains in the Genus database with same CATH homology
 4NX6 A;  1RX1 A;  2HVV A;  3K74 A;  2L28 A;  3S3V A;  4OWP A;  3S9U A;  3DMO A;  2W9G A;  1OHJ A;  4XE6 X;  1P6O A;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  1Z3A A;  2QLC A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  2Z3J A;  3NZ9 X;  2KKS A;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1DR4 A;  3E0B A;  4O8Y B;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  4MSQ A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  5M52 C;  3NTZ A;  4PSS A;  4WIF A;  1RB2 A;  2ZNR A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5C2O A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  4MSD A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  2O96 A;  4LC5 A;  4P9E A;  4E0Q A;  1S3W A;  1JTK A;  4GH8 A;  1BZF A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  1OI0 A;  3CD2 A;  1OX7 A;  3DAT A;  4OCM B;  2OG4 A;  4G3M A;  4LD2 A;  2H2Q A;  4LCN A;  1JUV A;  2W3W A;  4OR7 A;  4MSJ A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  5CW6 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  4MS7 A;  1UX1 A;  3GHV A;  4QLF A;  3SRQ X;  4PTJ A;  1QZF A;  2INQ A;  3ZEF B;  4PTH A;  3TD8 A;  4ILG C;  2NX8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  3NZD A;  2ZNV A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  2FR5 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3OJ6 A;  4EG2 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  1MQ0 A;  4OSG A;  4P9C A;  4F3W A;  3G8Q A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  4ZD4 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  4OWP B;  3JWF A;  3JWM A;  4OCN A;  1RA8 A;  4KM2 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  1WN6 A;  4IXF X;  3TQA A;  4LD4 A;  2BLA A;  2AZN A;  3FRD X;  1VQ2 A;  1JOM A;  5M59 B;  3NZA X;  1CTT A;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  2FR6 A;  2Z3H A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  4HRQ A;  1DR3 A;  1VDR A;  3FQZ A;  1ZAB A;  2FZI A;  4BGD C;  3SGY A;  2JYB A;  5GAO A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  4HOE A;  4KIT C;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  1CTU A;  4O8X A;  4KY4 A;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  1AF2 A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  1RB7 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4JXE A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1YSB A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  4ZD5 A;  1YSD A;  3S7A A;  3F0B X;  2RPZ A;  4XT4 A;  3DAU A;  4K1R A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  2PW9 A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  4DFR A;  4OCM A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  2O95 A;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  1UX0 A;  1R5T A;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  4HRW A;  2DRC A;  2W3B A;  1PD8 A;  3DH1 A;  3GHW A;  4KFJ A;  4EIZ A;  1J3K A;  3NXR A;  4DDR A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  2W4L A;  3NU0 A;  4WIG A;  2C2S A;  3SA2 A;  1RB3 A;  3INV A;  4M2X A;  3SBG A;  3SRW X;  4OCL A;  5U26 A;  3RG9 A;  1S3V A;  3KJR A;  4KL9 A;  4I43 B;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  3B8F A;  4QLG A;  1VJ3 A;  1J3I A;  4ZFT A;  3R2N A;  1J3J A;  1AI9 A;  4Q0D A;  1UWZ A;  3JSU A;  3M08 A;  5DCA J;  1CD2 A;  2O3K A;  1R5X A;  4ZFR A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  3ZPC A;  1DR1 A;  1RH3 A;  5HT5 A;  4KNE A;  4P9D A;  3KJS A;  5HVE A;  2D30 A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4O8Y A;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  4O8X B;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  2HVW A;  3R33 A;  3IA4 A;  3QYO A;  1ALN A;  1BOZ A;  3NXT A;  2Z3I A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  2B3J A;  1DYH A;  1HFP A;  1RA2 A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  1DHI A;  2P87 A;  2Z3G A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  2NYT A;  1SEJ A;  3D84 X;  4D10 F;  3NXX A;  3K47 A;  4NQL A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  4PQT A;  2A8N A;  3ZPG A;  2P8R A;  3IJF X;  3OCQ A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  1WN5 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  3NXO A;  4H96 A;  3MPZ A;  4KEB A;  1RG7 A;  3FQ0 A;  3M09 A;  4XRB A;  3VCO A;  4H98 A;  4HA9 A;  5JG0 X;  3GI2 A;  4LAE X;  1WKQ A;  3FL8 A;  3RZU A;  1RX4 A;  3QLX A;  3E1U A;  4QJC A;  3QL3 A;  2BLC A;  1TIY A;  4LCP A;  1PD9 A;  3RZV A;  3DG8 A;  4F7O A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2G84 A;  2FZJ A;  2KCQ A;  4FHB A;  7DFR A;  4OCL B;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4OCN B;  4XT5 A;  4EIG A;  5FDA A;  5HUI A;  1WWR A;  4M6J A;  4Q67 A;  1UAQ A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  4XEC X;  3NXY A;  1DYJ A;  4LCO A;  1KLK A;  4QFT A;  4ELH A;  2P4G A;  4MSM A;  1RX2 A;  3QLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...