3ZQKA

Von willebrand factor a2 domain with calcium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
181
structure length
181
Chain Sequence
SMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDILQRLREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Calcium Modulates Force Sensing by the Von Willebrand Factor A2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 66
structure length 181
sequence length 181
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zqkA00
5KYUB 2VDMB 4PN7A 3TVYA 3EH1A 4HQFA 3V4VB 1UEXC 3PPWA 1M2VB 1PCXA 1SQ0A 2ODQA 2I6SA 1JV2B 4WK4B 2ICAA 3K72B 1RS0A 3FCSB 2IUEA 4WK0B 1LFAA 2NUTA 3ZDZB 1M1UA 4UM8B 3VI3B 1XDDA 1JEQA 3N2NA 4IGIA 2VDNB 2VDOB 3PPXA 4F1KA 3EGXB 5KYWB 3RAGA 5KYNA 1AOXA 1MF7A 2O7NA 2ADFA 4WK2B 3ZE1B 3VI4B 3V4PB 1SHUX 4G1EB 4NENA 4C29A 3EH2A 4MMZB 2NUPB 3GXBA 4FX5A 2VDPB 5KYUA 1QCYA 4WFQA 1U8CB 3IJEB 3F78A 1M2VA 3FCUB 1OAKA 3BQMB 3HI6A 4F1JA 3T3PB 2WW8A 3TW0A 3EGDB 1T0PA 3EGXA 4CNBA 5KYWA 1RD4A 1MQ9A 1MHPA 1M2OA 5LN1A 3EOBI 5HDBB 2NUPA 2ODPA 2VC2B 1L5GB 2I91A 3F74A 4MMYB 3K71B 2B2XA 2NVOA 1U0NA 1M1XB 2M32A 3PPVA 1TYEB 2X5NA 2QTVA 1MJNA 5E6SA 4BJ3A 2XWBF 4HQOA 1IJBA 3Q3GE 3K6SB 3PPYA 1RTKA 4Z7NB 1NA5A 1PD1A 1N3YA 2VDLB 3EG9B 1IDOA 4HQLA 3ZQKA 3EGDA 5E6SB 5BV8A 3ZE2B 4CN9A 4G1MB 4DMUB 1U0OC 1JEYB 3TCXB 1QC5B 1M10A 4UM9B 4C2AA 2VDKB 1ZONA 1ZOOA 4HQNA 1RRKA 1YVRA 1SHTX 4O02B 3NIGB 4JDUA 3TXAA 4Z7QB 3BN3A 3QA3E 3EFOB 3HXQA 4MMXB 2XGGA 1PD0A 3K6SA 3ZDXB 5KYYB 5E6UA 3EG9A 5ES4B 5E6RB 5HGJA 1MQAA 2VDQB 3HXOA 1BHO1 5KYXA 1V7PC 1JEYA 5E6UB 3BQNB 2XWJI 1MQ8B 4XW2A 1QC5A 4IXDA 1FNSA 1AUQA 1XDGA 1XUOA 3M6FA 5KYXB 4NEHB 4CN8A 4M76B 1CQPA 1IDN1 2WINI 1IJKA 3ZDYB 4UM9D 1Q0PA 1ZOPA 2VDRB 1FE8A 3EFOA 2NUTB 3E2MA 3NIDB 1PT6A 3ZE0B 1DGQA 4A0QA 5KYYA 1JEQB 1T6BY 5HJ2A 1N9ZA 2I6QA 1CK4A 4IHKA 5E6RA 3NIFB 4WJKB 3T3MB 4HQKA 1BHQ1 4Z7OB 4NENB 1DZIA 1YVPA 3IBSA 1ATZA 4C2BA 1JLMA 3EOAI 1AO3A
chains in the Genus database with same CATH superfamily
1V8OA 4P32A 3IOBA 3AVOA 5IJZA 2W4MA 1RRVA 4JQSA 5EINA 3ON5A 4TMFA 1L8XA 2ADOA 5IF3A 2VTDA 1HFJA 3HL4A 2HK9A 1U7DA 1MO3A 1Z2AA 3BG5A 3LCRA 4N3AA 1FBNA 1CY4A 1NC3A 4V38A 5GY7A 3LQKA 1A72A 2W6MA 3QH4A 4DLWA 2A0XA 5K8JB 2PJRA 4TWRA 1KBOA 2R4UA 3KKNA 4TKLA 1T26A 4NZOA 1GNVA 2P2GA 1Z75A 4IGEA 3VHQA 4MPDA 4G6ZA 3SQMA 3PX7A 2VPIA 4EENA 2B6HA 3HGTA 4FX5A 2GNAA 4C5AA 1KAQA 4LJ8A 4KACA 2V6GA 4R7ZA 1G8YA 3MAJA 2YH2A 1ZJYA 2JEYA 3LUKA 1N2CB 3G0BA 5FO1A 4XYEA 3P9XA 1H05A 3RSSA 5IUKC 2HJRA 4FGZA 4NP6A 5JY6A 1UJCA 4ALIA 3X2EA 2Z83A 4BEBA 3NHKA 4PQGA 3GPBA 2OZEA 121PA 1M2HA 1YIOA 3QE3A 5JH7B 5GPBA 1FXWA 1VSTA 3H2JA 1Y5NA 2WNHA 3MGCA 4M98A 2D8AA 3D8UA 2HFJA 1WXHA 4OIMA 5KTSA 1UFQA 4D8WA 1FX0B 1VKRA 3D7MA 3G5MA 2Q3JA 4HGOA 4BBJA 5IZCA 3TVDA 4QRDA 3AB3A 1U6IA 2XV1A 2Y05A 3H6KA 2A86A 4QBTA 3C3YA 1TQHA 1G6Q1 1Y1KE 2B4AA 5AO9A 1K2VN 4UFPA 2C04A 4YT5A 3SBXA 4IFBA 5A9RA 2C5LA 2OGZA 1F8GA 1GPWB 2Q3FA 1GUDA 3MTDA 1JXQA 3PPYA 5DXFA 4DCTA 5C51B 4OP1A 5ELMA 4RZSA 1CY0A 5A6SB 4RD6A 3KETA 2NYAA 1QE5A 2XVYA 1NQUA 3H9BA 3ZHSA 2WP0A 3CEHA 1Y4UA 2D5AA 2FPPB 4G89A 1ZIXA 5E4YA 3UUGA 5I8PA 1GV0A 2DM6A 1Q0UA 1X1SA 3MB5A 1OAAA 3CW2A 1DLJA 1E9DA 2DCUA 3BMCB 2G0TA 2JI8A 5ICFA 1UPFA 2W98A 4Q93A 1GGMA 5A7FA 1J8MF 5EQFA 1MOPA 3A6EA 1CJCA 1GGFA 1U3TA 4KO3S 4PU0A 3MMNA 3PHLA 1NXPA 4X24A 3V6LA 3ZLUA 5ALUA 3GUUA 1E64A 4Q4DA 4ZDIA 4EJ2A 3MSXA 4LWPA 3ZYCA 4WZAA 1OH7A 3IKMB 2FMFA 1NF8A 4B5LA 1FDVA 2OQIA 4QXOA 1ZN8A 4OFBA 4ZVQA 1L7RA 1G19A 5C8YB 4KAXA 2J3EA 1XEWY 4OP2A 4F04A 1LTKA 1JKJB 2I2XB 3U6KA 4ZVRA 3DZGA 5ILQA 4DKJA 4DR5B 1UBRS 2Z08A 2NV2B 2QYOA 4PXAA 3PF9A 3SQNA 4OM7A 4Q7MB 4ZO6A 5BMVF 1X6VA 5L6MB 2OV6A 1LQUA 1YDEA 4M1MA 2QPLA 1XHLA 4P7BA 4PFQA 2RKWA 3W5JA 1C1DB 3I45A 2O2DA 4ZVUA 1LNQA 5I9MA 4Z4IA 1FRNA 1DBPA 1H2HA 1UK9A 2PZAA 4PQRA 3VZBA 4QL3A 1D04A 1JG3A 1WMBA 3OI7A 5D84A 4DCOA 3FDFA 2C7GA 2AMFA 4KTVE 1WB4A 1G64A 1U11A 1Y34E 3OM1A 3TUJC 1I9CA 4IMRA 4D4GA 2I6XA 2QW0X 2V5UA 3G0GA 4DUGA 4JC8A 1JLLA 2XOKD 3GFVA 4PQFA 3GGPA 1Q16A 4GI5A 3K1AA 2ECQA 4AXXA 2W6ID 3TLCA 2I87A 5A1TA 4UTVA 1CJUC 4KXNA 1ZOSA 1C7EA 5FR2A 4X94A 4A0FA 4KPFC 4RLHA 4XGQA 3NT4A 3T1HB 2BGMA 4BQPA 2HXSA 2R751 1AHNA 3U19A 1ZK2A 3QFTA 4WK2B 1APBA 4US1R 5HEKA 2CLOB 3F3SA 1N6NA 5C5CA 2ZCUA 4JS0A 3I0NA 5BR8B 4RDHA 4BMPB 4ZIRA 4XTRA 1EK1A 2F9FA 3E61A 4UHEA 3HY4A 3U44A 1H94A 1UJ4A 4Y7DA 2WYVA 2YXEA 2J33A 4LRQA 2HNAA 1JF8A 3E0QA 3VJLA 4OQ4A 2YQ5A 4YMUA 2Z9BA 3VYVA 1W2WB 2W37A 4D9HA 3FOAA 3V4LA 2WIFA 1KI2A 4LRSB 4I1RA 2KS6A 4LYFA 4O4LA 4LPKA 2F59A 4AJ4A 1QKJA 3WGKA 1JJAA 3R9XA 5HRUA 1REQB 4D25A 3SP1A 2C2GA 4NDZA 2YBEA 3ROPA 5AQ1A 2ZIFA 3CIOA 3AJ8A 3C8ZA 1I4LD 2Z2YA 2DJ5A 5B4VA 2PX2A 2WU0A 1ZJ6A 1PLLA 2IJGX 4R6WA 3CUTA 3ZZMA 1O96A 3L1HA 1X77A 2ZZKA 5BSTA 4M4SA 1SFRA 3RD5A 1AD2A 1V3QE 2WK1A 1NC1A 4ZI7F 2LZ0A 1HBJA 3HR8A 3HKCA 5EYPB 5AVUA 8AT1A 1H6BA 3AMVA 3IT3A 2HJVA 4EG4A 3GVCA 1IN7A 4GLFA 4YJGB 1JHUA 1RBMA 3DQQA 1JBQA 1RHRA 1FYXA 2HPVA 3F71A 4YWHA 2O0MA 2QJFA 5I7UA 3OEHD 3WMWA 3ZLVA 4AG3A 5TIIA 3SJAA 1OPXA 1JAXA 3GNSA 2Z30A 3WA6A 3GHYA 3KEFA 1P4GA 1QZUA 3NHFA 1NR1A 5CVDA 3DS8A 5BR4A 3PFFA 3FGPA 2P1ZA 2MINB 3D64A 2WKPA 3NBFA 4HJRA 4JELA 2R68A 3SLKA 1D2EA 1UJNA 3GB9A 3J81k 1AZSC 2E21A 1GZVA 3P5SA 1CZRA 2K5UA 2WFAA 1C1HA 1OLSA 2HCBA 3CS3A 2ZUSA 4RESA 5CA0F 1WXDA 1QU3A 2AOTB 1U0SY 4CLDA 4BNTA 3IBGA 1W4ZA 2ERYA 3M6MD 3DEZA 4ONEA 2IYEA 2X13A 2BMAA 4MJ3A 4Y98A 1LLDA 1ZK3A 3CJQA 3ZHBA 2HUNA 2VZ0A 3H11B 5IUNC 1U7WA 2WJHA 4EVIA 1DADA 3QUSA 4ARIA 2A9FA 4A6PA 3QX3A 3IQEA 2OZLB 4DTIA 2EYQA 2IQIA 3AF5A 5E38A 5KYTA 3Q87B 3LF1A 1M76A 4FZRA 4R8SA 3IHWA 5EXTA 4JVMA 2JVJA 2OHIA 4ZOLA 3BREA 2VP5A 1RVDA 1WDLA 4B79A 5KTKA 2Z5GA 2ZUWA 5JEEA 1A8QA 1DBQA 4LJ7A 3WS7A 1YI0A 2VOJA 3GWGA 4GMKA 4OHOA 3DVLA 3NVKI 2DQZA 4M8IA 1HRKA 1KXZA 3IEKA 3ETJA 2OV3A 2IF0A 3JWGA 3R20A 2COKA 4QDZA 5DTQA 3NM6B 5E0OA 4ZYLA 5HM8A 1E96A 1N1MA 3JWHA 5L3QA 3E6AA 2LP4Y 1QF7A 1X8KA 1NMXA 2V7XA 3HDQA 3I01A 3QTBA 4ENWA 4HVCA 4GPZA 3P4XA 3DOCA 4G5XA 2GPTA 3K5PA 4GS5A 4FLEA 3R7LA 2CNOA 4E32A 1ENYA 1Y7HA 1ECBA 3B1VA 3AR4A 1LDEA 2HO5A 1XKTA 1B2RA 1WM1A 2G6TA 4PLPA 4UBOA 4B3XA 3G9TA 1B0AA 1MIHA 4R5MA 4LF6B 1VB5A 2JGJA 3FLAA 1F38A 2JHAA 1MZVA 1PWXA 5B4TA 1E63A 1FJ2A 3PGXA 3RTEA 3TGWA 1V35A 4XYMA 3NVDA 3SS9X 2VJPA 2WIJA 1U0EA 4CR7A 1ORHA 1BEEA 1P0PA 2AK2A 1WJGA 2B2CA 2OV8A 2ZUVA 4GRDA 4XAQA 1ZESA 3PXBA 5AM0A 5TQ0B 3TFOA 3IBTA 4MAAA 3ZNOA 2O3UA 2G5CA 4DLBA 1Z6AA 3FF4A 4J0GA 2PTGA 3ISVA 3IURA 3OJXA 4TS1A 3T94A 1GTSA 1TI7A 3D02A 3LC1O 2XZTA 1OBFO 2FMXA 4JUCA 4MQEB 2J9YB 4Q1FA 4GYWA 3TPFA 4CL3A 1Z4IA 2WHPA 5DHAA 1ZVJA 4ETMA 2A59A 2UVDA 2G83A 2ZRQA 3ADBA 1U2ZA 4P5EA 2ZATA 2XB8A 3HFRA 1W76A 3KC2A 4MS3A 5TS2A 4DYVA 5K05A 3P97A 4WOPA 1PGNA 5DCLA 4RM3A 3AEUB 4HQRA 4AI6A 3FROA 5K3OA 1FZQA 3HDTA 3QLTA 4LXGA 3AHFA 3HE3A 2P67A 5IMSA 4BO3A 2BP7B 1RHUA 4KE6A 4KX5A 4LXUA 5CP8A 4Z86A 3KOZA 2VA9A 1ZGJA 3EMDA 1A7KA 3REGA 3DNMA 3LBIA 1KKMA 3H4VA 4M86A 3T4XA 4CEIB 3WRYC 5HZKA 2ZSKA 1K6JA 3ANSA 1GTJ1 3V42A 5C35A 3D7LA 3KBOA 3TI9A 1L8QA 3N3BC 1NVKA 2Q4DA 5ALNA 1A04A 1Z2DA 4BLSA 1PX0A 1RZRD 1MAVA 3L6DA 4Z5XA 5HQTA 5LFAA 1OTHA 3H75A 1JHQA 4GXNA 1O9HA 1T4BA 3L7DA 4CMAA 3K6SA 3WB0A 2E37A 2QWXA 3U60B 3AQ4A 2YZKA 1EWVA 3BHMA 3OPQA 1G6KA 3QWAA 3S4YA 2ZJYA 3MLAA 3SG0A 2AJBA 1Q77A 4WOJA 2DECA 1SK8A 4TYWA 1W25A 3W4JA 4BN5A 1KAGA 4CCAA 4IDPA 4LDNA 2P9BA 5B1DA 3T3GA 1NN1A 3WAKA 3VPAA 5ULLA 4FJ1A 1L5LA 1YOVA 2VDRB 1FDTA 1RQPA 1WXGA 1ZAKA 1ZOPA 2A1UA 2K2WA 3H1AA 3AFGA 2BR3A 1OR8A 4CM8B 3MT9A 3S70A 1XP5A 2BEUB 2QA5A 3EF0A 3HRHA 4DMKA 4RA6B 5F1OA 5KHOC 4UHFA 2E9SA 4GR5A 1DZIA 4LFAB 2ZR8A 3DWFA 1DXOA 1YRHA 2EG9A 2GEUA 3UJ8A 5FRDA 1DKQA 2ZSDA 5EJ9A 5JAZA 4WSOA 3RW9A 4LZZA 3WMXA 2GJ9A 2JLBA 3DO5A 1KJJA 4RETA 1Q6ZA 6Q21A 1YNOA 4QEDA 1MVNA 2N9UA 3DGEC 1NKTA 3HUDA 1JDZA 3ICCA 3AF0A 3AKEA 3AEYA 3NI2A 4BO4A 1J8QA 2WM2A 2KYRA 4OAOA 3T5MA 2FEOA 2AK3A 3ORHA 2C31A 2QGZA 3R6TA 1WVGA 1L4BA 1ZD2P 1XEWX 2O2SA 4BLUA 1CQJA 4KFCA 1EZ1A 2J7PA 4EQ6B 1E4EB 1FLAA 2MYTA 3R7BA 3H5AA 4P9NA 2UUCB 4IIJA 1RYYA 2QD1A 3OPYI 4PR3A 4BN4A 2HD4A 3RBZA 5HZHA 3UJNA 1H2EA 3CUWA 1B76A 5LQNA 3L7LA 4LXIA 3QXHA 2V5VA 4IXMA 4KXFB 1KZ7B 2OG1A 2O19A 4Q3EA 2Z2IA 2NX2A 3CPHA 3EA5A 1RT9A 3H2SA 4B4UA 2B25A 4EMUA 1NBHA 5JDCA 4L2IA 3DT8A 2YIDA 3T38A 2P2SA 3U7EB 2O0JA 1CDDA 4QLBA 1DO2A 5LN1A 1PDVA 1DZ3A 4HNSA 3K94A 5H83A 2VQDA 2B9VA 1H4SA 1VBFA 4I50F 3FH0A 2QTTA 3EXFA 3JQGA 1U0FA 3HA7A 2C77A 4LSZA 3U7RA 2GK4A 4CQLA 2YHSA 3HN7A 2ID8A 2WVHA 3LPAA 1ESZA 5CNMA 4TPKA 2RH8A 5FB3A 2VKQA 4TMZA 4Q21A 1ZJ5A 1DG3A 4UE3S 1JVBA 3UMCA 3WGHA 3SLRA 2AE2A 2FB9A 5CDGA 1U3CA 1Z4NA 3M6AA 5IDYA 3G2PA 1C3XA 4YACA 2IZ7A 4CL0A 4F2GA 1B0PA 4KBYA 4QUIA 4R7GA 4ZT2A 3GOQA 4ZEOA 4Z8XA 5CAEB 3C7TA 5SV2A 3TAXA 3D8RA 3FKSD 3W5SA 4U9UA 5F21A 2PQ6A 5PNTA 3IB6A 3ZHCA 1DFHA 4N0QA 2IY8A 2UV8A 4YRMA 3AXSA 3IOMA 1W0KD 3ORRA 3UV7A 1ELOA 1YR2A 2GN8A 2GFQA 2I1LA 1XGKA 1ZWKA 1RE1A 3EGEA 4DF3A 3Q15C 1SH7A 4KQGA 3AP1A 4DIDA 2FWNA 4NZMA 1YB4A 3I9MA 3N76A 2I4MA 3OPYA 5ALXA 5FBKA 3ZY3A 6REQB 3FMOB 4MW0A 1SG9A 1VPVA 4JQYA 4MS4B 3O4IA 3ANTA 4XSGA 5K99A 2JHGA 3NKFA 4IQGA 1VE9A 2QN2A 4QUDA 4DGQA 3HZZA 2HADA 1LX7A 4QOHA 1RR6A 4RIIA 1OFIA 3PCTA 3MA0A 1IJKA 2CNLA 2CMFA 4DQXA 1F12A 2J6CA 5LDDC 4KKXB 3EFOA 3LDAA 4PPGA 4LF9B 4OFXA 3CLVA 3QE2A 5LNK1 3C6XA 1NVGA 3WQQA 3UT5B 1HR0B 2ZXUA 4GPTA 4KEAA 4RA9A 3KXPA 3V4FA 3VR5D 3DMRA 3H83A 3Q88A 4E14A 2A5JA 3BMNB 3LUBA 2ZM5A 4BZZA 2UXBB 3VAZA 1T9CA 3HR7A 1B3RA 3SZGA 3FDJA 4GR4A 5LDGA 1SXJA 5ALDA 5KO2A 1ZWLA 3KSMA 2FPKA 3LXMA 3TVYA 5LOVF 1ZU5A 1Z6TA 4LXQA 4TLCA 2PSJA 2YCLA 1XZQA 3ETCA 4U63A 2LR0A 4ZN6A 2OBMA 1QMGA 3BHIA 3WNZA 4S1NA 2QORA 2F43B 5CURA 3ZGXA 1NBME 2P4EA 2V54A 2FDCA 3OF3A 2FP4B 1T13A 3K0CC 3B51X 4E03A 3LUDA 3ZWNA 2C2OA 2CNDA 4CFSA 4BNFA 2Q7DA 1UPBA 4WKCA 1DC5A 2CMDA 5IG2A 3D8NA 3GHHA 4QFBA 4KI0A 3VGPA 1DDGA 1V16A 2RG7A 3NNDA 3WGOA 2AC2A 3PQ2A 5K0ZA 3WAJA 1TU0A 2PXCA 2VDVE 3K6KA 3B9QA 1SZCA 1DKMA 4L5YA 4OKNA 3VGJA 4WFJA 1QG2A 5BQ3A 4DR4B 3E3MA 5LQDA 3DZFA 2PS1A 4IDQA 3WGNA 2Q2NA 4R40A 1RAIA 2J9RA 3AUXA 3H18A 4A2CA 4LRYA 1EDZA 2XUFA 1KJWA 3C6YA 4I2NA 4PZUA 4Y2GA 1FFEA 4CE6A 3F46A 4BVLA 4Q34A 1AXRA 2Y1KA 3T3PB 5FX2A 3UAZA 2JLYA 1ANKA 1QGOA 3D4IA 3HB1A 2YJTD 3PT5A 4MS1B 3EDQA 5CB4F 1WBJB 4ZT7A 3G59A 3VDNB 2BEWA 2GA9A 2JBHA 2PUWA 1GQ2A 3GCWA 3EPLA 1M8FA 4RZQA 4DRXA 3TIIA 4YLYA 3B1YA 5ES3A 1YR8A 1IATA 1XF1A 3USZA 5JASA 2VG8A 3VTFA 2EGUA 4FB4A 2J5XA 3H86A 3KQHA 1G18A 2OV2A 4BLRA 3QUTA 1R66A 1P4AA 4UTXA 4O2AF 2C5GA 3IKVA 2IBMA 2GJKA 1ZZEA 1BYUA 1L4FA 4IXTA 3B78A 1ABEA 1A95A 1C80A 3IOCA 4GP9A 4WZBB 1IYZA 1HT0A 1E1RA 1VG0B 5FULA 3TQTA 2M9MA 4MCJA 3AI3A 2YMLA 4NOJA 3RFXA 1X14A 2PZLA 1F0KA 3FPGA 3MJSA 1NSFA 2MU1A 3Q2KA 2NO9A 2QPTA 1M75A 5JD3A 4DJJA 1IXRC 2I4TA 1PSWA 5ALTA 3H3FA 4L74A 5T64A 4XKJA 1T10A 3A6KA 4WACA 3AL3A 1A1VA 1P2TA 4KO1S 3QFSA 1R37A 4F4CA 1KO8A 4TTPA 1M1NB 3UWKA 4CWAA 1XU7A 3P0IA 6GPBA 5C5IA 1E2JA 5BW4A 4AYWA 2VK1A 2Y3IA 2WF9A 3OKPA 1EGVB 4OK3A 3TRIA 2QI9C 1XZBA 3NVMB 1O89A 2PZEA 1A69A 2OKCA 2IEBA 8MHTA 3G79A 5DYIA 2GBIA 5CXXA 1JEYA 5KWEA 3CEAA 1GZ6A 5EZYA 1W5FA 1VA4A 4BP3A 3W3ZB 4HP8A 1JAHA 4KDFA 1TMKA 3CXRA 4YRNA 4O4JB 3GIWA 3ZHVA 5KJCA 1DJNA 5D5HA 3IAFA 2P4QA 4D46A 1HSZA 1VKOA 3I4LA 1N3LA 4J8PA 4CIDA 4DZTA 3NEYA 4FOPA 4NDAA 5TY0A 3AFIA 4M0UA 1D03A 1E2LA 1MO6A 4H1HA 5KHLB 5LP1A 4LQ4A 4W1RA 1F5SA 4KPUB 4HQ0A 4RPLA 5LR6A 3JAMA 3AL0C 2V3VA 2QX8A 5LP6F 5KNDA 3AV0B 4M0DA 4JI4B 1U31A 3OZXA 2CXTA 1RADA 3EOAI 5BR1A 4OHXA 3KUKA 2VF5X 1AZWA 1QRUA 3VBCA 3OQHA 1GZHB 1JIQA 2Z04A 4IKPA 4RK0A 1HT1E 4POAA 4R68A 3T7TA 5AM4A 4WKBA 1ETHA 3M1AA 4FTWA 1E5TA 3GX1A 2FPWA 2GNPA 4MQFA 3V8EA 5G4KB 2GCNA 2H7YA 2VHCA 3KYDB 5LQKA 2NUBA 2B5WA 1SOAA 3LNTA 3NDJA 1BG6A 2OFFA 3VR3D 3AUJB 1R6UA 4HSGA 4PYMA 4A6XA 1DO0A 2I34A 5DX1A 3O9ZA 3QLEA 3SIWA 3ZHUA 4ER7A 1ZW1A 4G1EB 4MR8A 3N9IA 4MX8A 3HCWA 4WJZA 5JQWA 1D2CA 3K30A 2FMUA 2Z1MA 5K0GA 2I7VA 1QYRA 2J5KA 3AFOA 3LAWA 4JKYA 1P29A 5DOVA 3CUUA 3QMPA 4G4GA 4FW9A 1DMSA 3JQ7A 1C3LA 1XNQB 3FR7A 4CQMB 1CU1A 3Q9LA 4L8VA 2Y76A 3IR5A 4BFZA 5HUHA 3FTQA 3O8NA 4DLNA 3F0TA 4HNAB 5DNCA 2A1TS 3AUAA 3OT5A 3SD7A 3FYUA 2YHIB 2W2OA 4I1VA 2R87A 1CUWA 1XC7A 2YV1A 3K0FA 4YCLA 4KJZA 4ON9A 4BFXA 1CYEA 2F3RA 4OQZA 1M8GA 5BYKA 1SCUB 1KDVA 2HSWA 1W6RA 3DDZX 2RHDA 1GGKA 1QPBA 2X8WA 1BMQA 2A5GA 1SU7A 3ZZTA 1NVAA 1IWPB 3MD9A 2VYND 4QASA 3IQZA 3TTWA 5ESRA 2ZRLA 5AKLA 1YMUA 3HR4A 1DDOA 3KTDA 1UXIA 4I4LA 4GP6A 3OU6A 2PBRA 3PE3A 3PI7A 4YBZA 1IBSA 1ONPA 2D54A 4XWTA 1Y4SA 4LGYA 4XCVA 1U2TA 4TT3A 5AICA 3SZOA 2NO6A 4GX0A 1RQNA 3VU9A 1P91A 1UZAA 5IM4A 3BJMA 4KV9A 2IE8A 3DFIA 4L4YA 3RWOA 1IJEA 1JT2A 4W5HA 1C4OA 5ITZB 5CDFE 3CUVA 3JTEA 2FN8A 3LHDA 3K1JA 2C97A 2JANA 5I3ZA 5ICCA 1G8JA 1VHWA 2QP3A 1WPGA 3DEKA 2JA2A 1FJGB 2X5JO 3W90A 2H1OA 4E6EA 1VJRA 1JPNA 1RKBA 2R8BA 2ZT6A 1G21E 1VBMA 2AYZA 4G25A 4EO9A 3OX2A 4ZCQA 3ZWBA 3RABA 5FWYA 5ITVA 4O2RA 3RIXA 5AWFC 1NN3A 5KNDH 2PE5A 2IEDA 4AY6A 3IDOA 1N5IA 2BFNA 3UCFA 2IU3A 3IHLA 5JSKA 1D5WA 2J07A 2ID7A 3H6HA 2PH5A 5JISA 3UJ7A 1CK4A 4RHXA 4DYHA 1A3CA 3PC7A 3ZIAD 4PM4A 4M9ZA 4OAPA 1I01A 4M8KA 3EK2A 3NDBB 3MRTA 4G0NA 2Y67A 3ZVLA 4PSDA 2PT6A 3GJ7A 4P1ZA 1NNUA 4JU8A 1Z6YA 3A1FA 5J43A 1PJSA 4PGGA 3U7QB 2O2IA 3V2GA 2ZYWX 4HB2A 1E0KA 3QMWA 3L4KA 4AICA 2HAEA 2XGMA 5JD5A 1F7UA 3D81A 4N7JA 3Q3IA 1J2EA 3JAKB 1D09A 1H9BA 2PKCA 3N0RA 1F4VA 2OHHA 3LY7A 4Y2PA 5EMLA 1V8DA 1KBQA 4G5YA 5ENZA 3VMMA 3MPOA 4I4CA 3ZWQA 4G0UA 1KSFX 1XAGA 1SXHA 3T4UA 3RANA 3GLFB 4YAIA 5I7EA 1VHQA 2AVDA 4C20A 3H2HA 3U09A 3GAMA 1L5VA 1T15A 4P2BA 3R40A 3RC3A 3P4UA 3PJEA 1X1EA 3Q9NA 3BFVA 4IPTA 4JBGA 4WXHA 1J56A 2YICA 3R6WA 3S2GA 2EKZA 1EX9A 4E4RA 2DH6A 2I8AA 5DI9A 3G1UA 1ZCFA 3BE8A 4GKJB 3E9QA 3GJYA 2EOAA 2R1ZA 2FSFA 1E1NA 1PZNA 2JKYA 1NBMD 3OIDA 4Q4HA 2GRUA 3C1AA 1QQ5A 3PA8A 4WT7A 3QBVA 3THXB 1Q50A 4Z4EA 2C8VA 3Q8XB 1L1RA 2JI9A 1IK4A 2Q1SA 5A62A 3UPTA 1NHWA 2J48A 1EFUA 3EIFA 2J0UA 3HJCA 4INPA 4AXBA 4F60A 5HGXA 2J9FB 4G65A 1D1QA 3U7IA 3WVNA 5KVQA 4CT0A 5IH7A 1RXVA 4PQYA 4QDXA 5KWVA 4K6HA 1Z7YA 1JG4A 3U81A 3NKLA 3O93A 1DT3A 4JASB 1W4AA 1GOTA 5I7VA 1HLPA 3BWDD 1TQDA 5CJPA 1YRBA 1R4ZA 3KYIB 3CG0A 4P6VF 5HR5A 3W5CA 3PDWA 2LV8A 1FYWA 2SNIE 5B2EA 5JC1A 4YP0A 4LNHA 3W2IA 4C6SA 4V1CI 1IAQA 1U98A 3DTVD 4OIFA 1ODIA 1XDWA 3QIVA 4E6PA 4MPJA 2GSDA 1BSVA 1D7OA 2VAPA 1KVUA 1NWCA 1SKYB 2Q62A 3F2VA 4HWOA 4WCFA 4JWKA 1K5GA 5LA6F 2OUKA 4WIAA 3IVCA 3TSAA 1ZUHA 1TC1A 5HKKD 1RJGA 2HIHA 3RSZA 1DX4A 2WT8A 4L6IA 5L8VA 1T36A 1D2NA 3UJ6A 3ZCVA 4YMGA 3R8FA 3PIRA 3NBXX 5JT1A 4GPAA 2ZI6A 3FTNA 4TV9F 1T4DA 1K4YA 1UJ2A 4IUBS 4N7BA 3U5TA 4CG2A 1GN8A 2R4TA 4BX3A 1YB2A 4UTOA 5BN5A 3CJRA 5I9LA 4U9IS 3CW9A 2P3OA 3UWMA 5G53C 2ECPA 3T5GA 1R6XA 2H18A 4KNYA 4BPRA 1XTPA 2ZUEA 1C29B 2JDIA 3ROXA 1TJPB 5IK2D 3RJ5A 4BB5A 3ZU6A 5BUQA 3ZC3A 1WQ3A 4PTYA 4U2KA 4INOA 1KJQA 4KUHA 2HNKA 1QK4A 1KPIA 1PZGA 3H3XA 3LL4A 3T12A 2E4ZA 2O7VA 2Q28A 2QV0A 4UBNA 2Z5VA 1ATZA 5AI8A 1Q21A 2NUAA 4FYXA 4TXNA 3ZDQA 4GOMD 4FI3C 3DF7A 3QBJA 3GVHA 2CYCA 5K0BA 1M5RA 4M55A 4PN3A 5TF0A 3PPWA 4WK4B 2F7SA 1ADYA 4ITRC 1D9XA 1BS2A 2IXBA 3T9BA 1WB6A 2CDBA 4DEXA 4YUYA 5LQUA 4OGLA 1PR3A 1XDBA 4ABTA 4F7WA 1E6MA 2QUKA 3GZNB 3PK0A 3E8XA 4JHLA 5FPTA 1NI3A 1GLGA 1GCGA 3ILYA 2FMHA 3ZBUA 3EY4A 3ZY4A 2LD4A 5AOBA 4ETWA 2NT4A 6ADHA 1Z36A 1RM4A 1TJNA 2I54A 3A6ZA 3OD5A 4WNYA 1K4MA 2O23A 2CXOA 2ODEA 2QW8A 1NFRA 3IUBA 4YJ2B 4AZ3B 4XUGB 3Q8LA 3P9NA 3ZWPA 1KKLA 3T15A 1IOVA 4OHKA 1UBFA 2VWGA 1N8NA 4GBGA 2QJTA 5KNCD 4G0VA 1LPBB 1QYDA 2HRDA 4HKTA 3RYCB 2GCOA 2ZBRA 4XH9B 2VHJA 3ELBA 4ZAWA 3QK7A 3O1JC 4OQPA 4YNBA 1HMYA 1TEXA 1E1MA 3LUPA 4FZ3A 4HUQA 4DG9A 4F2HA 2P0YA 3U62A 5AIAA 1JSZA 1NWHA 1P62B 1R4AA 3EE6A 4MUNA 4UEOA 4JI1B 2QSUA 3A1EA 4CGZA 1FCJA 4M1QA 4RPJA 3ESDA 1EFRA 3TI7A 3K6RA 2HJGA 1G38A 4WQMA 4WX2B 3V7NA 4C6HA 4COOA 2QZ9A 3RYIA 1Z5OA 3JPWA 5DFAA 1CUEA 4IEEA 4MRPA 1O54A 3BB3A 4L73A 1SJ9A 4MQ4A 3RHSA 3QI2A 1J2UA 3AH8A 3GW8A 4ZP1A 3I61A 3RU3A 2C84A 5JWRA 2DLCX 4R51A 2PMKA 3H0CA 4GDMA 4IHJA 3PC6A 4TXMA 1AUPA 2HF7A 2X15A 2PXAA 1OILA 4X91A 3UTDA 2VDLB 2XIJA 4BVFA 1KBZA 3CLUD 3V55A 4PYJA 1W36B 1Z6QA 5DXAA 3EPPA 3G9XA 1EDEA 1WLYA 4K86A 1U8XX 3GARA 3SPXA 1YQQA 3BRWD 2KWIA 3IJRA 4AF7A 3ENZA 3P32A 5IKXA 1Q44A 1TU4A 3Q6NA 3ZN2A 4A6DA 1OWOA 4DIBA 2DMRA 4NJEB 4FQ5A 3H5WA 2F3SA 4ZJZA 3PLNA 1T0UA 2D1TA 2F1RA 3FB4A 3UK7A 4V0MA 4N3BA 1B26A 4KFTA 4QDKA 1UMCB 1G55A 4YQEA 3S5UA 3W4KA 4G0OA 2FQQA 2QMEA 3JASA 4I2VA 3EXHC 4C22A 1QX3A 3UG7A 5EL0A 1RQRA 1W19A 3WO0A 1XVUA 1U3GA 5LQMA 1W4BA 1L2TA 4P31A 2VF2A 1MG0A 5CYOA 2FCAA 4H7KA 4K6MA 5AM5A 1DKLA 1IE3A 4H17A 2GAOA 3OC6A 3EODA 4EEXA 1JQAA 2GZMA 2SKEA 3L92A 5ALYA 4EY7A 1G3RA 1I7SB 5BOSA 3DPIA 6YASA 1JI0A 3EZYA 1KO7A 4IIEA 5UKDA 3WMGA 1WDWB 1P7PA 4TKVA 1AKTA 1QRRA 3OHSX 2YC4C 3IEPA 4QBGB 5BR7A 3QWHA 1P0IA 1ZQ1A 2OCBA 4FHFA 3ZUGA 1U7XA 1N2HA 1UMBB 2I6UA 4WAUA 5CIWA 5FBWB 2JFHA 5K8IA 5F2EA 3GLGE 5IYZF 4UHCA 5CA1A 4QTXA 3L40A 4PG8A 5D7BA 3L4BA 2RJNA 1NMEA 1GCAA 2O2GA 4ML3A 4QHYA 2WKWA 4A8TA 3RNLA 4DCNA 4P22A 2BEKA 4QAJA 4INJA 3KYBA 1YS2X 2VJMA 3IAS6 5CFRA 1GG9A 3QVOA 3JQAD 3N70A 3DEAA 3H9UA 1F17A 1JMYA 1GZ5A 1UADA 1P60A 2CZGA 1VLMA 4YH1A 2ZJ2A 1F4PA 1QH1A 1ZR2A 4F3TA 1P8AA 1FLDA 2FR0A 4QPJC 3WYCA 3FHTA 1KI6B 1N75A 4DM3A 3HO1A 5CTJA 4I6GA 1HQKA 4HDSA 5BMOA 1GEGA 1N6PA 5K5EA 1PL7A 2ATVA 4LKRA 1ECLA 1WUJS 2DKFA 3L8EA 2FW7A 2DB3A 2O5EA 3D2CA 4MRMB 4Q1BA 3K1ZA 2DUMA 4FKBA 1HY3A 1XMOB 3LLMA 5JPDA 5IAOA 4G4SO 2ALJA 2DH5A 3FMFA 2ONKA 1TM7E 4JJ6A 3TNYA 3DOUA 4LDAA 3W8NA 4AWBA 2EFCB 1XVTA 2QZSA 4HVTA 2Q6KA 1JA0A 1E2QA 5SYAA 4E33A 2JGIA 1NPDA 5LWHA 3VPDA 2WTUA 1XTSA 2QK4A 4MVXA 5AVJA 5FI5A 4NRDA 2VUUA 2FEAA 3E2PA 3PXEA 1FFDA 2ZSAA 5DWQA 1MG5A 5IJAA 3SQLA 2FFQA 5MGBA 2IS2A 3PEYA 4CHTA 2EQBA 1N1DA 2HGSA 1N2JA 3QJGA 2VP9A 1AJEA 1O4WA 1RW4A 3HJRA 4YCNA 4UEWA 5FWAA 1W4CA 3G0OA 1T5LA 3J80A 3OHPA 1JKMA 1SIOA 2OFXA 4HXGA 3NBZC 2RMKA 3PDCA 2DFKB 2F1KA 5H81A 4RHUA 2VZLA 5JR3A 5EP3A 3I76A 3NC4A 4Q9JA 4ZO9A 4C9BA 5CDSA 1ML4A 1XL0A 3DTNA 7YASA 2E6KA 5LYJA 2BL4A 3TZHA 3VHXA 1K8XB 1XMVA 2RHLA 3ODPA 1VPEA 1EKXA 1V71A 2HJSA 4KRXA 4JYPA 4PLYA 2BUBA 2JJQA 5CJJA 5CVUA 5DM2A 5JCOC 2D6FA 1U5CA 1M2KA 5J9FA 6AT1A 3AGPA 2VRCD 1TM2A 3E9YA 2W2LA 3W9SA 4PRKA 1KI8A 3OO0A 3R77A 3WRVA 4ZK2A 1KC3A 1LS1A 3F1LA 3JVDA 4LC0A 3T9FA 3G5AA 1OLXB 4DJFC 1RC8A 1XPJA 1GPMA 3L84A 4FN5A 1BOFA 1NW9B 4KW7A 5D2CA 5EWMB 5EMMA 5TMDA 4OHPA 1VL5A 4DIUA 5TQVA 5YASA 5KX5A 3W3AD 3PI6A 1KJZA 4GLOA 1K7FB 4ZANA 3WBBA 3RC9A 2VJBA 1LRJA 1GUBA 3NYIA 4F5YA 5DULA 4CV1A 3DZCA 2VDQB 3QHAA 3RU9A 4IICA 4WE3A 2BHTA 3IDQA 2PT9A 3PEVA 3ZWMA 4BAZA 4XVHA 3RVJA 1IXSB 2ZJBA 3CZRA 1U8AA 1FNSA 2WQZA 3GP5A 3PKZA 2FZ5A 1G6HA 2J4CA 5DCYA 3J81A 2JAHA 1BWRA 5I9IA 3DLAA 1YI8A 4LI3X 1DGQA 1XK6A 2WOOA 2Q29A 4O2BB 3RUAA 2X2FA 2VF4X 4HAIA 4FDAA 3QPDA 1JXMA 1U7ZA 1KYWA 3JATA 4CCWA 2GSWA 5AKJA 2W42A 1Y8RB 1NOIA 4NQRA 2EJCA 2EJTA 1HK7A 3FRJA 5F7ZA 3CNHA 4O4HB 2PSSA 4H0FA 2PGOA 1IONA 1CQWA 2HNBA 4BB9A 4NZPA 1RDFA 3DQZA 4R1PA 4WH0A 1JV2B 4YRGA 1XYGA 2XLBA 2WE7A 5KYVA 1BW9B 4EF5A 2GVNA 2B5OA 1PL6A 1DRJA 4RO0A 2TRSB 4C06A 4YYZA 5IC4A 3ZD6A 4G26A 5DBOA 2FPOA 7ABPA 1B8PA 3ZBTA 2GN4A 1OGYA 2V9ZA 5IBCA 2AWOA 1OXUA 1SVIA 3QYFA 4AP5A 4DIMA 4DLTA 3ZE1B 1IY2A 1SELA 2A33A 3PJFA 4CYMA 4BNWA 2NYRA 3ESXA 3KPJA 1U2PA 3MWJA 4N54A 4EDFA 1ZH8A 1B93A 2H1HA 4MIYA 5AK3A 3EAQA 3IJEB 1ISJA 2JI4A 4ZAFA 3JSAA 4B6GA 4CM5A 2BAGA 2ZT8A 3OZ7A 4MAFA 5A5GA 3HXMA 2AF4C 5JVDB 1BMFA 5F7XA 3RADC 3AI7A 3BQMB 2RBEA 3L8MA 4RF5A 2WTAA 3QOYA 3F5DA 4YX9A 1AHPA 4YMWA 1UKBA 3M81A 3BTSA 2P5YA 4WJLA 2C1ZA 1GGNA 2ORYA 3HRIA 3RRBA 3HKBA 3P9SA 3PT9A 4OAQA 1Q1BA 4PXSA 2JG3A 3T06B 4REOA 1N9GA 2ZTSA 2I78A 1BDJA 3FF1A 4K03A 3RAFC 3C8UA 3KWJA 1B0UA 5HWSA 5KHAA 4UARA 1DE0A 1TO6A 1WUHS 5SY4A 3M9XA 5C3UA 1PS8A 2WDZA 1HH4A 1RKUA 1U4OA 3H3JA 3SEFA 3W9UA 2PMBA 3AHCA 5EVCA 5BVHA 3TN7A 4F7DA 2X3YA 2GJ8A 3A1NA 4ZZIA 3PNLA 5HRAA 1PD1A 2NOAA 2PS3A 4Y2YA 3PA6A 4P7GA 1J5EB 3NGXA 1UCFA 1DDIA 3QKUA 4MJ7A 3HEMA 2O2YA 3TQRA 4CV0A 3IMGA 2D4HA 3CHYA 3KSBC 1T1RA 1L5KA 4YRDA 1ZA2A 2NLOA 1CUFA 3QRWA 4FHCA 4ECAA 1A8IA 2WNSA 3LYUA 4MB0A 4D0NA 3RAEC 1HTWA 2GXQA 1KJIA 2RIPA 3L1JA 3O1HB 5DLYA 1LWNA 1Z4QA 2A1IA 2GZAA 1NW6A 4JHXA 3V48A 3W2FA 1KJ9A 3PEFA 3GL9A 2FFHA 2YRFA 5B2ZA 5B4UA 4Z1OA 3FNFA 4JY7A 3DG9A 4C6TA 3ILXA 2G9ZA 3ESBA 4FCVA 3NBAA 2BBSA 4G36A 4N3NA 5EIFA 5H02A 3WMRA 4ENQA 3CZCA 5AHXA 4YAOA 5C7OO 4QJBA 3AVWA 2XB9A 4Q3CA 4D99A 1FFBA 3WLQA 1HF3A 5DCUA 1XZEA 1NIJA 5HBRA 1EUDB 5JD6A 4QU0A 1FFXB 1J90A 3GT7A 4QA9A 3ONWA 5AJHA 2HRBA 5IPFA 2PKWA 3AVQA 2Z2XA 3TL3A 1N77A 4TVKA 4EDHA 1IHXA 1FMFA 4KLZA 1CS0A 2O48X 4F3CA 1HYBA 1Z62A 2DG2A 2JGLA 1PJZA 1QLJA 3G2LA 3S68A 2A5FA 3USES 4IJUA 4PVDA 1UZMA 1D4OA 1SEVA 1V48A 2Y0PA 4X3CA 5AKGA 1SWVA 1UT5A 3K70B 3K73O 2XEXA 1PR2A 4PIPA 2HA6A 2YVLA 3EXIB 2E3JA 2IF2A 3PCXA 1C0EA 1U3UA 2EEZA 1YE5A 4EO7A 5KYUB 3V34A 4ZT3A 5BQFA 5B53A 2XMQA 4FSDA 4GZ3A 4F86A 1D2HA 3KZ1E 4LDZA 2R6R1 1BO6A 3B1FA 3GLTA 1MR3F 4ZJYA 1Z8HA 1ZUNB 5IABA 5J5AA 1K0FA 1NVUQ 1RC0A 1FXWF 2Z9DA 5LCXA 3U9LA 4V3CA 4WECA 1IVSA 1XMJA 1ZL2A 3IELA 5IS2A 4QIHA 3GQVA 1O95A 4MEJA 4Y9UA 1RIFA 2HA5A 4B3RB 3OOSA 4KC0A 3OZTA 2YOGA 2Q07A 1P1JA 2YFKA 3PVSA 1D7AA 1UBNA 4JBLA 4E7PA 3AR6A 1B3BA 2GF2A 4QDOA 4UHBA 2HWWA 3OZAA 1OWLA 3EMVA 5BYBA 3UFBA 1DIGA 4I14A 3AWDA 3UJAA 1A7JA 2BTQA 3ZGOA 1R27A 2MSEB 2QTVB 1WSAA 2FUG1 4GWGA 5B58T 1GAQA 4OH7A 2PA0A 2W11A 4XGNA 3R76A 3NR2A 4R83A 3O73A 3W79A 4BZPA 2WOJA 5B3LA 2QT9A 4H6XA 5FV7A 1D5CA 3OZIA 4TWBA 4YHHB 4GMXA 2YWGA 3NV9A 4PX5A 4MUIA 3RFVA 3SNHA 1C9YA 4WKNA 3OT4A 3GFQA 4OI2A 5G0VA 3HO8A 1KIMA 3STWA 5C81A 3LPMA 3O4GA 1UEIA 3WGIA 4OU5A 4GXQA 2HMVA 1GNPA 3I01M 5DGHA 3A0RB 1KQOA 7REQB 2QVZX 3TCKA 1N2CA 4QELA 3RV4A 3FD8A 1SVUA 2WU8A 3AR2A 3HG7A 4KO2S 2WWHA 4LGCA 2VBFA 4R54A 4TWZA 2P9EA 4UU0A 5JCJD 3LY5A 5J4KA 2NZUG 3GP8A 1M0SA 5JH7A 2W6CX 4X1YB 2VJYA 2FV8A 2EHJA 1GRQA 3K20A 3PYLA 4KHPB 1JDTA 4RJTA 4BS9A 2QTAA 1FX0A 2G36A 2IU0A 4BP9A 2BE9A 2YWEA 3BS4A 5C8DA 4B3BA 4QWMA 3QVMA 2C1EA 1YFJA 3B5JA 3PHHA 5B1SA 3L1VA 3HFJA 4ZVKA 4H6VA 5JMTA 1ZQ9A 4HG2A 3PYXA 2FR8A 4HNTA 2TSYB 4M53A 1FFSA 1LLQA 3ENWA 4YMLA 1ULUA 4K6OA 3MYRA 5A6SA 3SDZA 1L5HB 5FWDA 2ZIVB 4RXMA 2KX7A 4Z4FA 2FPPA 1HG0A 2L18A 3ZQUA 2W0MA 2YWXA 1GKLA 3CUEF 4HDRB 3AW8A 3KDAA 1XA3A 1XRSB 3TLZA 5E2BA 3TQCA 2I67A 3BMCA 5IANA 1AXGA 3OU2A 2LVBA 4DRZA 3PC2A 3CWQA 1N57A 2ZRGA 4HRAA 3WXMA 4ETIA 2JLQA 3ER8A 2MYUA 3ZVMA 1BTOA 4FOLA 4P92A 3WTCA 4A16A 2OO7A 1KMMA 4N82A 5BNIA 3I0ZA 3NTRA 3F98A 2VH1A 3JQDA 4JJIA 3KRTA 1P7YA 4LGMA 3DXXA 1Y1LA 4A5SA 3LH5A 1Z6XA 1IY0A 5G0TA 3UMBA 2FEKA 4KPYA 4G1UC 4NENB 1CZOA 2NNLD 3H84A 4QHSA 4EFDA 5C8YA 4B44A 3L8ZA 4RFVA 3T7JA 1YTUA 2B1JA 2PZ8A 5CR9A 1JKJA 4PBRA 3THRA 1KWKA 1D2GA 3D4OA 3HHPA 2XRMA 1COWA 3HPRA 4J0EA 2BT4A 4X92A 1QZZA 4UJ3A 1HV8A 3BTUA 4IZHA 1O6FA 3HV2A 4LI0A 2YMQA 4O4LF 2Y92A 2UKDA 3TBKA 1HORA 2CSXA 1ESNA 1PKEA 2REQB 3KS9A 4NK5A 4P4NA 2OMKA 3FJ1A 2UZ4A 3AONB 3FGZA 1C1DA 2VDOB 4ID3A 5EHIA 3C5EA 2JZCA 1U7OA 1E9CA 5DBFA 4IJKA 5EUMA 4G63A 1NUQA 2WU1A 4IMIB 3RAGA 2WM8A 1QO0D 2JLZA 5AKXA 1KTIA 2HDHA 4P3KA 4LCEA 3C5WP 4M0LA 5IVHA 1V26A 1DFGA 1G5HA 1L5MA 4KL8S 2PWAA 2OXTA 1YDMA 4YALA 3ZQJA 2CB9A 4OHCA 3Q1KA 2ZROA 1PJBA 3P9YA 3QKSB 1WV1A 3ZY6A 4BVKA 4F21A 2RH4A 3EVBA 4XFKA 1V5EA 2QDXA 4MIEA 3FOCA 3L6CA 4IRUB 3OPXA 1Y7PA 4M9UA 1ENOA 4ZGGA 4BMZA 4FYVA 3FZNA 4L7VA 2W0SA 4BOYA 4UTRA 1CFZA 1UAYA 2J30A 2FRVA 2XMZA 4PFSA 4QGGA 3DPSA 3RS4A 4HD8A 2CDRA 4A9AA 5C32A 1YU6A 3BCUA 2PWPA 4A8JB 3HBFA 3CLUC 4E4YA 1BDMA 2R11A 3ULKA 3H9QA 4QGAA 2M32A 2BELA 3C3PA 1RI1A 2VYVD 3OQ1A 2BPOA 4KN8A 2VPQA 1MX3A 1SWWA 1HEUA 3JWEA 4M1ZA 4EEKA 1YKFA 1H93A 3RI3A 3PFBA 4R9VA 3ZU4A 4K87A 4B9EA 3II6X 2W6OA 4WLOA 1REQA 1AV6A 3K4PA 4TXHA 1QB8A 2BM9A 4LGVA 2DYKA 1FJXA 1ISMA 3SX4A 2R9VA 5C1PA 1K66A 1W29A 2F90A 2VAXA 1N4AA 4FGWA 1FP2A 1NVBA 3H8SA 1LRKA 4RVGA 4KX3A 4XD2A 5KNBD 3UK6A 1WAMA 1A9RA 3ESRA 3G8BA 5KWSA 4FWBA 1XRMA 3T54A 3DKPA 5EYPA 1RXEA 3QE9Y 5KYYB 1UKCA 2G63A 1M1YB 2EZUA 3CKLA 3OO1A 4CTNA 4YJGA 5IT0A 2ZTLA 1NVXQ 1YK1A 1ZK4A 4DCGA 1SQ6A 1NF2A 3PQ8A 4JBIA 2H9YA 1TEHA 3HZOA 3JYNA 1Z35A 4PLWA 3TOXA 4QNNA 2WZQA 4F46A 4X5OA 4HWTA 4FJ0A 1BWSA 4J7UA 2HYIC 1IQRA 1XF9A 3EVFA 2QUJA 3NCHA 3JVVA 2AUMA 2EX0A 3LWZA 1QJ4A 2PX8A 3GEIA 1DARA 1VDMA 2MINA 3HZHA 2XT9A 4YJFB 5AJTA 2GHTA 2P9GA 2V97A 2IGTA 1GWNA 1E9FA 2BI7A 3HJHA 3KEGA 3ROEA 5HJ2A 1XU4A 2AOTA 4H15A 2IK8A 3ENVA 5DGTA 2R1TB 2QM8A 4FN4A 5TPZA 3R3UA 5FORA 1XA0A 3DC2A 1OZAA 2YN0A 3QVJA 5T57A 3THSA 5J47A 1CR2A 5BV7A 2GARA 4PGFA 1SQFA 1VOTA 4LG1A 3VYSB 4FMCB 3H11A 5BPFA 1LTHR 1NF9A 1HEIA 2HT6A 3B82A 3HYRA 2I33A 3VHLB 4A36A 4PYNA 1IMOA 3RVOA 4XYGA 4LJ4A 5ALZA 5G3YA 3WZLA 4EJFA 3RS7A 2OZLA 3EDYA 2ICAA 4DMLA 4ITUA 4TL7A 4MI6A 3DF9A 1P33A 3G2KA 4OHWA 3N86A 1XZDA 4FPXA 4MARA 1JPUA 2VDNB 5F12A 1L7MA 2W2KB 4K88A 2OD2A 1AOXA 1B15A 1MF7A 2AX3A 3FBWA 3G8AA 3K96A 4NG5A 4OLHA 2DX7A 4JI5B 3S44A 4BO5A 4PG7A 3IERA 4EPXA 1TM3E 2V7GA 1E3IA 1EDDA 1ZBQA 4U39A 1DWUA 2QM0A 3AV3A 2OFPA 3FZQA 2EERA 4UFNA 3WTBA 4BV8A 3KPYA 3X1KA 4MV6A 2GCGA 1SBNE 3C5HA 1R00A 2ZYRA 3F49S 4TTSA 2CJWB 3GCXA 2ILVA 3VMFA 3BE5A 4D82A 1JDVA 4KO4S 4DT1B 4I8DA 2G4CA 4XUEA 4GMGA 2AFVA 16PKA 4EMSA 2ETVA 1VIDA 4MULA 1XTBA 1YU9A 4MUAA 3EWAA 4MVYA 3WZMA 2J0QA 1DQRA 1QWOA 2WIAA 3A4NA 4J1NA 2IELA 4J0KA 1Z2EA 1CHDA 3OZVA 2WMOB 3D6FA 4W1QA 4Z1MD 3WWOA 1A9TA 1J2RA 1K8QA 3FCXA 4UDOA 2P0EA 1PEDA 1VSUA 2WAAA 1EFPB 1X1TA 1Z0DA 4CLRB 5B1EA 3OHMA 4HEJA 5B2FA 4HDOB 2V6IA 2CFOA 3SE0A 1FX1A 4ARBA 4W8OA 2XWBF 1JDSA 4BJ3A 2A0KA 1OXKB 4KWEA 3G9UA 3W04A 3C41J 2QLBA 3HNPA 1QQ7A 1OFHA 4Q82A 4UQPA 4MQEA 3SXUB 3EDCA 3DKRA 3VDMA 1XXHB 2DSTA 1K4KA 4F4UA 2HHCA 2ZBUA 4BLTA 2Y2UA 3OX3A 4KIFA 4S1PA 2J31A 4D9CA 2I76A 4HVAA 5F9FA 3F7OA 2IUUA 1I1QB 2VTKA 4YJDA 3VA7A 1GT6A 1FTNA 1GSIA 2D2FA 2YVUA 4F93B 4AQDA 3AEUA 2V5AA 3BIFA 5COQA 1DIAA 4EO4A 4EZEA 1E3DA 1GZ7A 5LZ2A 1HFEL 3I28A 1R12A 2JCGA 2Q41A 2ZRJA 2P2YA 4NFLA 1VM6A 1U4SA 4NLLA 2BP7A 5JADA 4HNGA 2PIDA 4NFSA 5D5PA 3PHBE 1P73A 1RP7A 3GRAA 1IZYA 2HWYA 5HCUA 2XIQA 3F7NA 3OLZA 4CEIA 4PZZA 3WK9A 4P08A 4CTJA 4ZYXA 3DMDA 3D3EA 5JC8A 2ESRA 3R7FA 5EKDA 1ILEA 4EMBA 1II8B 4G5FA 3C15C 3H2IA 3VKGA 1AXEA 1C3OB 1U7PA 4HRVA 2Y6VA 5K3BA 4F4IA 3FPBA 1OFUA 1TAQA 1WW2A 1N6RA 2B98A 2GLUA 3PQ3A 5I01A 4QUJA 2XF8A 1V37A 2REXB 3WICA 1H1DA 4LE0A 1N5MA 1QP8A 5BOVA 1OBCA 1KFEB 2AG8A 3KQYA 4UDXX 5AUNB 4UZFA 1LQTA 2R8XA 4IIJF 4RWZA 2FOXA 4YWJA 4D96A 5FUQA 4KBGA 1G8FA 2H3HA 4O63O 4JEIA 1SC3A 3RGWS 4BP1A 4B4KA 4IWYA 4LVNA 3PZRA 3NB0A 1I2MA 4K9NA 1EQAA 4PO9A 8OHMA 2J3LA 4R8MA 4C21A 2FDRA 1EJ0A 5DM4A 3E9EA 3G7SA 3AR7A 3NQ41 4ED9A 5LJLA 1KC1A 4PLFA 2C9BA 3FPSA 2BHRA 4IUYA 1SXPA 2HA7A 3CO0S 2BEUA 3B36A 2EP7A 4RA6A 3EZLA 3ORFA 3ZK8A 4H1WA 2A67A 2GM3A 2D5LA 3K09C 1JU3A 3S27A 3STXA 3LO5A 3UGKA 2QL7A 1A71A 3K8YA 1KK2A 2Q5CA 1H66A 5GQSA 1OAOA 2GHIA 5K0SA 2CKDA 3DOHA 3OJCA 3I4FA 4MICA 1Z16A 3CRZA 3SF0A 2XA9A 5AW5A 2VR1A 3E03A 3T52A 2WTBA 3CO5A 4DLPA 4DLXA 1DINA 4QXQA 2CDCA 3JYHA 5CB6A 4ACBA 2B4YA 4M0MA 1OYVA 2YWFA 1AE1A 3LA6A 4CFZA 4OJMX 2QSZA 4N9WA 1MENA 3DEJA 3U80A 5D7NA 4EECA 5KINB 1P3JA 4ARVA 4EQ6A 1E4EA 2FQYA 3Q7RA 5TB5A 1YIAA 2JLUA 2H4JA 4AAYA 4ZO7A 4M2LA 4QOFA 3IQXA 4J4BA 5DLQC 1HYGA 2PJDA 2IKSA 4BU0A 3CF4A 2OHGA 3UWPA 4BV9A 3S8EA 4MMYB 5E3IA 3H8VA 3IJ5A 1ORRA 5DM70 4DR1B 4HN2A 5K1ZA 4Y2HA 5E3HA 3MMZA 3Q40A 2OCLA 2IOYA 5ICGA 4MSUA 3BSWA 3OICA 2O4CA 4FONA 2ANCA 1UIMA 1QHSA 2FFAA 5EGNA 4AK9A 4WL0A 2P9QA 3PLRA 2GCPA 3OURA 4Q7KA 1WNFA 3RVDA 2CV1A 3RSQA 1IOLA 4O4IB 2J3MA 2X3FA 3L1UA 4TZTA 3AW9A 1IPEA 2XXJA 4RPGA 3RK4A 3UGTA 3W34A 3W2TA 3I2YX 5F7JA 3LHSA 4FZVA 3A11A 4GZMA 4OJKA 1E7YA 4OP3A 2ABWA 2Q21A 3BK7A 3LVFO 2ZIUB 3L79A 1RJ9B 2ZTHA 2CVFA 2EZ4A 3INNA 3C5CA 3LC2O 3NIGB 4CV3A 4UD2A 5IFKA 3T8YA 1T9HA 5K09A 2OHXA 4HYEA 4DMMA 2OGWA 4YI5A 2FGJA 1HNXB 4ALJA 2YY6A 2FPMA 2ASVA 5ITSA 2E6UX 1K7EB 1YZYA 2JASA 3E3OA 3ETHA 5ESDA 3TLBA 3S7TA 3V32A 1IL0A 2CJPA 1ZSVA 1C0IA 1AUXA 3E4DA 3R3YA 4ND2A 1X87A 2H7XA 3GT4A 2NSLA 5E6UB 4AF8A 4OB6A 3ZWWA 1AUQA 2BFCA 1SKMA 5KZMB 1Z6GA 4W5WA 5E4FA 4CM4A 1E0AA 2ZI5A 1YB7A 3I32A 4FC6A 4JLUA 3KDSE 4BJ6A 3O38A 3EF3A 4XCXA 1C0LA 4EG0A 4CG0A 1A4RA 3ERCA 3IVRA 5EQTA 1U8UA 3W2GA 2PQMA 3ESQA 3H13A 1JL3A 1Z5ZA 3SR3A 4S1TA 1CPYA 1XQWA 1KY2A 1H22A 1UBMS 2QGNA 2ZBEA 2GXSA 4RDCA 4AUKA 4WY5A 1N8SA 3RV3A 4AZTA 4CV2A 2VJDA 2I6FA 4O59O 2V74B 2CNBA 3GGDA 4MS4A 4AYTA 2DWCA 4KN6A 5AW1A 5DNDA 1OCEA 3HXTA 1EX1A 4D3SA 4EPVA 2XCLA 4Q03A 2BHNA 1E2NA 3SMQA 1C9EA 1JSRA 1JXAA 1UBLS 4O25A 4JP3A 1UQRA 4XGRA 4LFCB 1EA7A 3RRXA 3L77A 3CWZA 1XDDA 4M9XA 2HKIA 1MZPA 3FFWA 1EZZA 4MUGA 4NMXB 3SVZA 3SC2B 1ZINA 3IP6A 1ULZA 5B30A 3A4LA 4ZU6X 4GQBA 5A9SB 4QOSA 3VVBA 2LDXA 3BWCA 4HMOA 2WWVD 4PXYA 4E5KA 2WKRA 1GL9B 2NTJA 2WYHA 1T3TA 1Z73A 4CKBB 2QE7D 1ZG3A 1UBJS 2WSYB 4TWIA 3S2EA 3RJTA 1I0LA 2ZI9A 3AHGA 3TDKA 2PX3A 5LD2B 1A8UA 1EGAA 1KZ1A 1V1MA 2JL1A 1U0TA 2F43A 2PH7A 1KFCB 3FNIA 3PWSA 3U4GA 4ALMA 1ISPA 2FP4A 2FZKA 2PRYA 2XDQB 2EIXA 4LC9A 3RJZA 3TW0A 5KEIA 3CJTA 1FDIA 1UZLA 4HN4B 1GPH1 3IEIA 3QJYA 1S2OA 4KIGA 4BKRA 2PKEA 1OD6A 4LMBA 3OVMA 4N65A 3PQCA 4JYCA 3T7CA 2C3MA 2OZVA 4B2PA 3TE7A 2ODPA 2JD2A 3JU3A 2UZ1B 4KE7A 1VLLA 4LF4B 1VCOA 4J1TC 4KSYA 2PPLA 2JJ8A 3GU3A 1SCDA 4P5DA 2E0IA 1E2EA 1DKUA 1P3DA 1I6WA 1V39A 3NHWA 1L4MA 1IC6A 4H31A 4H59A 4B46A 3EZXA 2PTHA 3MTAA 1U63A 1W48A 3IQIX 3LNCA 2LTAA 2HSGA 3LCCA 1USKA 8ABPA 1T2NA 2EW2A 1WZIA 1X7GA 1XEXB 4C4TA 5MFZA 1OXBB 5EZYF 4G0MA 3QKRB 5JXHA 2YMPA 5FLEX 2IY9A 1QC5B 2W7TA 5FUMA 2WABA 3LT4A 3FKJA 1XAIA 4V02A 3TTVA 4CM7A 2MT9A 3T9CA 3GLUA 1CCWA 3ELDA 3NT2A 1DKNA 2I8CA 4IEIA 4JA0A 2Z4TA 4PZCA 4DJEC 1VE7A 1Z17A 4MRSA 2EXXA 1H2FA 3G17A 2W6QA 3IOYA 2F48A 2AGVA 2HRRA 3QU2A 4PPQA 4BVHA 2JLWA 5G2OA 4WZBA 4Z4CA 3NEAA 1WZUA 4HNRA 3O90A 5I51A 1U65A 4U6NA 2WMDA 1UXOA 5DASA 1Q91A 5BSHA 2YZMA 1PT5A 3O47A 5ESXA 2Y0CA 3M6FA 3CG4A 4G23A 1O8CA 2BLLA 3PPIA 4IBOA 1DC4A 1GGVA 1RCFA 1N6KA 1E0DA 2OFOA 4O8CA 1U9ZA 4RS4A 1J99A 2ZWVA 1DCKA 4TVBA 1M1NA 2VHEA 4EB0A 2HMSA 4R8LA 4MUXA 1PP4A 2IKQA 3E9NA 2G4VA 4NYMR 5CMLA 3VR2D 4CEJB 2QRZA 3GQBB 4C0BA 2ZBVA 3H1TA 4HPXB 2HCRA 1FF9A 2D0DA 2XT0A 3A4MA 4HAUA 2CL5A 3I2HA 3GAFA 4EMTA 1CJMA 3MLEA 1UKAA 1BVHA 4O4JA 1M0TA 4ZAXA 2WLTA 3RTDA 3RSHA 3TQIA 1AS3A 5A3QA 4NZNA 5I9NA 4C4RA 2V7UA 5J23A 4NV1A 3M4NA 3IGFA 5T6BA 4GEGA 2IRWA 2BDEA 5FWXB 3NPAA 4UVDA 1VGQA 3CKKA 4XI9A 3WQBA 2IV3A 5FUWA 1SIUA 4JT9A 3VYWA 3NDRA 1M1ZA 1ZH0A 3AEQB 1BHJA 1W94A 2YZ2A 2ZRFA 4KPUA 1Z68A 3KUDA 1T8UA 2QR3A 3ABZA 1IPFA 1W581 4IIFA 5I9TA 3T6KA 4D9KA 1KPHA 2RONA 2HSZA 4YUWA 4KAJA 2YWBA 2PMFA 3OTWA 1Y8QB 5CPBA 2GVDC 5LQSA 4FMDF 1PEYA 5HK9A 3RPEA 3NHAA 5DOZA 3MS7A 5CDYA 1DAMA 3BK1A 3S5JA 4EELA 1RC1A 3TRHA 4BEVA 1CZKA 3I5XA 2WF8A 2X5XA 5KTYA 1OB5A 4GL2A 4X1KB 4O6VA 4RGQA 5G4KA 5TGDA 3EQ6A 3KYDA 2G25A 4LDJA 4R98A 1MXFA 4IM7A 4M22A 3RKSA 4CNBA 1JT9A 2JLSA 2Q9BA 3RFFA 1HKHA 2ZJ5A 3JWJA 3ESCA 5FOUA 3TLKA 4DA0A 4MLZA 4RHCA 4AJ1A 4D9JA 5JI2E 1PVOA 2A3NA 2IDMA 4BKUA 5DTJA 4J4TA 4P0PB 3WDKA 3A6JA 2YDYA 2H7CA 4JITA 2BVNA 1WPRA 3AOEA 3TZEA 4TGLA 1UJ5A 4YUZA 4RV5A 4MW2A 4DXHA 2X5NA 1P44A 3A2LA 1USIA 4QARA 1OA0A 4IH1A 2BJHA 4II2A 4CQMA 4RVDA 3VX4A 1Z0ZA 1AUOA 1R0CA 3FUWA 4HNHA 4HNAA 5AVOA 2XUAA 3IDSA 3MG9A 1QAMA 2DT8A 3KQNA 1NT4A 2YHIA 3L7AA 1L3IA 4MVCA 1B23P 2O8EB 3OPNA 5ER9A 1S3GA 4TLAA 4UEKA 2X0IA 3T7EA 4FNOA 3TQFA 1QKIA 2NTVA 2PZJA 5FIUA 1SCUA 4CBVA 3MRSA 4NE9A 4QZVA 2GNOA 3CVVA 1I80A 2OD7A 2B1IA 2CXNA 2RK3A 2VP2A 3OKAA 3WLNA 2OBBA 3OFJA 2KPOA 5CBPB 2ZYHA 1D8TA 4B17A 5THQA 5D3MA 3VOBA 5LMZA 3VH2A 1PRYA 2FU5C 1T35A 3IALA 3LDUA 4UEQA 4TYPA 1UMDB 4RE5A 3J7AC 1UR5A 5EXEA 4Q01A 2HRQA 2P68A 4X20B 4YAKA 1A8SA 4CMCA 4HGZA 2I7TA 5ARDA 3F9RA 1M0EA 3PITA 3SQDA 2G9RA 1SZDA 3ZDYB 4ASUA 4G0WA 1P72A 2O8VA 4A8HA 1MMFB 5ITZA 3Q98A 3ZKWB 3FWKA 1OE0A 1VYUA 3LC0A 4AN1A 2GBLA 2XUKA 2C00A 3M89A 1D0VA 2BGJA 1S2GA 3LDHA 5F2KA 5EQDA 5KJ1A 4B7CA 2AC7A 2YWDA 3A14A 4XDYA 5CIQA 2XUZA 4KV7A 3HDGA 1PFYA 4OB7A 4ER3A 2II6A 2HX1A 2X9NA 2GN1A 4Q18A 5DI3A 3WLHA 4BNNA 3A4VA 5J5CA 3JD0A 3T34A 5IT9A 2JI6A 3TRFA 4DWWA 4MQMA 2Z1NA 3KT8A 2I4NA 1PGJA 2I66A 3FHLA 3G2OA 4TZ0A 3BORA 4A3SA 5A4JA 5LXTB 1NZFA 1E79A 3CH6A 4XWOA 2WJVA 2F8SA 1YCHA 1NP7A 1C81A 1L4HA 1ZUIA 3AO0B 1O87A 2VVTA 2XB6A 4JCCA 1U8YA 5KYWB 1V2HE 1SK9A 2O7NA 1HTTA 2BHSA 3LGXA 3ISTA 2WV9A 2JCBA 3TR6A 2X1LA 1HWYA 3C1TA 3J7TA 3INRA 1JSCA 1SVOA 3I53A 1ULBA 3CTMA 1EXDA 3DVQX 3EUWA 5EIAA 3D9QX 1UK8A 1WHTB 3U7QA 1TYCA 2JRLA 2O8CB 1XB2A 3C8DA 1GG8A 5DEIA 3LGSA 3X1XA 3B52X 1I4TD 1MABB 1NJ5A 1QDUA 3AR5A 3JAKA 1QGUB 1JB1A 1TAGA 1SCBA 2GI4A 2Q3EA 4A27A 3SMVA 3ZK7A 2ZIAA 1C14A 1JB9A 2PVPA 1E62A 4EHFA 4YY3B 2XUOA 2I29A 3GLFA 4B3JA 1XQVA 2OGTA 3DVRX 3MT0A 2NVUB 4WK6A 3C85A 3ZD9A 4OQQA 4DILA 4PSCA 1CVIA 2QEQA 3ANXA 4BIIA 4OK5A 2CMHA 3PNYA 2X9GA 3C43A 3AVPA 2HZBA 4WINA 4DGSA 4OA8A 3VYUB 5LMUB 1PUJA 5EE0A 2AX4A 2J3DA 1QTNA 5DSTA 4A7PA 4OYLA 2CHUA 2PY6A 2NAPA 1PAUA 2N0SA 2ISQA 2PGLA 3WR5A 1WS6A 2B1GA 3TKAA 3TTYA 1E4VA 1H42A 3KELA 4F72A 4XB2A 3D4NA 4ND8B 3RRZA 4MVJI 3ZGLA 2P2CA 3EXHB 3GWZA 1K98A 4HXFB 5I8WA 3H05A 1U9IA 3KVVA 1JU9A 3QVKA 4OI4A 4URHA 4EGAA 1XK7A 3IR7A 3QEKA 2JLVA 2W6PA 1WZEA 3LX4A 2RKBA 1AK1A 3ZK9A 1UQUA 2ILTA 4BNKA 3UTCA 3KKQA 2J9FA 3LM8A 1T1EA 1M83A 1YL5A 2V65A 3GLKA 3O1IC 1GEEA 1EK5A 4R1TA 3UQYS 4IGAA 2XE6A 3SHTA 3CMMA 3OC0A 2JI7A 4E5SA 4UUNA 2IYSA 1C50A 4MO2A 3QTTA 1SKUA 4JUDX 2QQFA 4XX1A 4ZVSA 3HXOA 4L9AA 1Y3BE 4OHUA 4EB6B 4L15A 3GUHA 4B8YA 1C0PA 4D4MA 1LSSA 4F12A 2CF6A 1H0SA 4X7RA 3ZV4A 3VC7A 1IN5A 1XUOA 2G7MC 2Q4BA 2QUAA 2J9ZB 2XDYA 3AKDA 4YS6A 1F0YA 3LHFA 1IVYA 3VVCA 3P2KA 4ETNA 4PC1A 5IJXA 1AQYA 1ZJJA 2JGRA 1VP9A 4BX8A 1JP7A 3DUWA 2FSVC 4LCJA 1LBIA 3H7IA 3MB8A 1XFDA 2IODA 3HKDA 4G37A 4XR9A 1T91A 3F7MA 6LDHA 2YFHA 5DKFA 4DMGA 2MSKA 3JQ8B 2V7BA 2GBCA 5EJ7A 4MDFA 3BK2A 4L07A 4LK3A 1HI9A 1UQTA 2VHXA 2OYRA 2WU4A 4JXKA 4RMNA 1NW4A 4G8BA 2RBKA 3IAEA 5DGCA 1W5AA 2NO4A 2ZTMA 1JLMA 1Z3CA 5ANRB 5GAJA 3HDVA 1ODKA 4K0RA 2VT3A 2ZT7A 1C8VB 1I1HA 2Z58A 4EI9A 1QIIA 2WE8A 3ROGA 4CEHB 1ZHHA 221PA 2VXCA 4ZMRA 1YF3A 4RSRA 5FA6A 3O7MA 4YRTA 3QW4B 3AIKA 2OORA 1Z34A 2F6RA 4A82A 1U7UA 2A0UA 2C7VA 3B8HA 3NAMA 3CT6A 4MKRA 5T67A 3NRBA 1Q17A 2WYUA 1EQUA 3JXEA 4C7JA 4V1CB 4MVJA 1XZJA 2VPTA 4RACA 1AKMA 2JBAB 4XFJA 5NLLA 1ZH6A 4JB0A 2ATXA 4YRRA 2NT3A 1BROA 1SBCA 1FSGA 3EAGA 2AOWA 2ORWA 4ZMBA 2XKJE 4G9GA 4DEYA 4JI6B 3X2SA 1Z8NA 2X4IA 4U5XA 5LC1A 4EUSA 3QLUC 3QLVA 4L8LA 4PHTA 1SOVA 3EEYA 1P7WA 2QUIA 3FDXA 4CMBA 2ONCA 3W8RA 1Q74A 4RV9A 2YJGA 2PDAA 2EGHA 3ZJUA 4RD2A 3E1SA 5TQ2B 5JS7A 3GZNA 4YV7A 3MJFA 5SZHB 2CFSA 4IDAA 3QV2A 4JSRA 3CZ4A 2C7OA 2ZJ3A 3VR1A 2B2NA 3AYZB 2ZW9A 3SYLA 3DONA 4K7JA 2B4KA 5E1OA 1II0A 2VPXA 4NESA 2IBSA 4YJ2A 1JQBA 3E1KA 3EISA 4AZ3A 1SIBE 4PYOA 5CBKA 4BNGA 4EX6A 4MKXA 2WJJA 5CU7A 1ZM7A 5FLXA 3M6WA 2B2XA 1K08A 2WWTA 1QP0A 1DAIA 3DAPA 4BCBA 3IUPA 3ZD8A 3RYCA 2J7PD 3RTBA 5F3WB 1O2DA 1SHKA 3B85A 1ZUD1 5D01A 1SCAA 5TVGA 2GBFA 1CEEA 4F1WA 3V7YA 3WRXC 4W1PA 2RAPA 4QHTA 2CYAA 1EAYA 2Q0HA 3AUYA 3AHDA 2ZT5A 4J75A 4BFSA 2JIPA 4CMEC 1DUIA 1ZCZA 1KXJA 1X70A 2GK3A 4G8DA 1OTYA 2GN6A 1P4SA 4M9CA 3OJLA 3O4JA 1ZY2A 3O4FA 4HB4A 3GZTB 3K5IA 4UHJA 4DIEA 2O5VA 1LVUA 2C5HA 1OWNA 1C9JA 4QQ8A 3IRVA 2D06A 3RGGA 1Z37A 3FUXA 2M6LA 1MORA 4FGJA 4BE7B 2YKGA 1V6AA 3GRRA 4QTUB 2AEMA 2CLIB 4DB4A 5CA1F 3M5CA 4P7FA 1VIYA 1K2WA 1YZQA 2C9ZA 2FG5A 4PEVA 1AT1A 1JAIA 5A1JA 5KVCA 1ODTC 5EKTA 4MQLA 4CM9A 3UUEA 1U28A 1XZGA 3C16C 3LLSA 1OIXA 3B12A 3L0OA 4PIMA 1FEZA 1LLCA 5L4SA 3KVRA 4MUHA 3PB3A 4EHDA 2DPMA 2Y8EA 1Z8DA 1P5JA 4QDUA 4UFOA 4LJRA 1C30B 2O7SA 2Q45A 3AJ9A 4UBJA 3AHHA 3N7TA 1CEXA 1I8TA 4ZCRA 1UMCA 3ZGZA 2O4UX 3D0RA 1SY7A 1XRNA 3G0IA 3QA9A 5E8RA 3TNFA 4CM6A 4QKQA 2XWQA 3DCIA 4MA4A 2ZVDA 1TTQB 1KEEB 1L4KA 1XE3A 2AOUB 4JMPA 3RU2A 2H2HA 1UBHS 4BNIA 3VPCA 2REBA 4Q9DA 2IQ5A 1Q7RA 3DD5A 3OZDA 2A5DA 3HY3A 1IEXA 2VPZA 1JQEA 4MVJH 4C4OA 5IT5A 2XXAB 4NVRA 1CX9B 2EFYA 4OJYA 1CV2A 4N3CA 4MDHA 1J5XA 3H5LA 3ZHYA 4XR4A 3P52A 4CM3A 1RS0A 3M4YA 4PAMA 2H5LA 2XTAA 5JDIC 2I80A 3CLSD 4HN9A 1NM5C 5FLKA 2XCSB 4JC5A 2MSNA 5E4JA 3SJCA 1GKUB 2BN4A 4DC9A 1AMOA 1W0JD 4ZTBA 4DSUA 2J4FA 1N0UA 1UMBA 2J9XB 1HA3A 2GYWA 2G76A 3UXMA 3V4PB 5JYDA 1X39A 3IIJA 4H6PA 1Z3IX 3WXBA 2OPBA 4CF4A 1GHTA 4AC9A 4PVCA 2Z6QA 1KNQA 5EE9A 2WG2A 3L18A 1DVRA 2XLCA 4U7GA 1H9AA 5HMMA 2BKXA 4IYJA 3VXKA 4B47A 2PUAA 3EZ9A 5I4CA 4LJ6A 2ZJ1A 1Y7IA 1VL6A 3O3CA 1XCPA 4FGUA 5L7WA 4RX1A 3NW9A 2A78A 4HL6A 4JGBA 5CXUA 2JFNA 4BL5A 2G9VA 2FQ1A 2OG2A 1KI6A 4HYTA 5AMXA 5H1YA 1S2DA 4L22A 3T5CA 2G8LA 4HO1X 1TGVA 3EUEA 4Y9RA 4M87A 4PINA 1ZU4A 3DEIA 3GRVA 4GGMX 3MCVA 4FGLA 4NSNA 1I10A 1UFRA 2V9PA 4MRMA 2WG0A 3CE6A 1UP6A 3RYFB 4RKFA 1RWWA 5E8JA 4RJLA 5JG7A 3H8JA 3FXAA 3TOVA 2GPBA 5DF1A 5J2UB 1P1RA 1XZPA 3HYNA 1YBVA 2NAFA 5KQMA 5HOQA 1JQKA 1C8BA 3C3WA 3KQVA 3GVPA 4EHHA 3SYNA 4C0QC 4DVJA 2JFGA 4QM6A 1F7VA 1E3SA 3EQ2A 3PC8C 4RY2A 4GECA 4YJKA 1K86A 4A6EA 1EK2A 4BMSA 3A3KA 5KREA 4YAEA 1BX1A 4CF7A 2QVYX 3FSEA 4I4NA 2GZ2A 1NN0A 2WT9A 3UJ9A 2JAUA 3EA4A 5DNUA 4YRPA 4QPDA 3D8SA 4X65B 3KR2A 2QIOA 3ANLA 3NTQA 4LZAA 5D6OA 1KFKB 2VFAA 4JT4A 2HHJA 5LB2A 2MCFA 1E3WB 3BHJA 4BBZA 1WRBA 2P40A 3B1XA 3Q7EA 4HH3C 1EFAA 4G81A 1XVIA 5AW2A 5BURA 4MLDA 1OW3B 3CUSA 3K6JA 4CKXA 1JALA 3CKMA 4UNIA 4Y6PA 2RH9B 3M4JA 3RTAA 4J0QA 1ZVQA 3LBFA 1I7NA 3GGGA 2XKAA 1CZUA 5KOJB 1CSEE 1OLXA 1U7TA 3ZOZA 1VJCA 1KMCA 1XCOA 4PGMA 5EWMA 4JLSA 4U2CA 4NONA 2PMEA 1ODCA 4MGEA 2GDJA 4QJ5A 4AU1A 2QLLA 4DPKA 5DV9A 5GZ6A 3ZR4B 4JBHA 2X0FA 3R9IA 3B9BA 3C7KA 4H60A 4Q12A 2H65A 2Z8YM 3HC7A 3AB7A 3VNQA 5BY2A 4NJOA 2R6ZA 1BQ4A 3T0FA 5CLLA 2VCEA 5GVRA 1NY6A 3D5QA 2OHJA 2B1RA 3I3SR 5DSZA 1POWA 2NZYA 4PNZA 4ZMSA 4XQEA 4NCIA 1CR6A 1S02A 2YHAA 4FIDA 1S4QA 4O3FA 4QUGA 4DA4A 1ZITA 3GT0A 1HL7A 3LDFA 4GZ6A 2X6QA 4PANA 4V0LA 5DWVA 3RLIA 1S3IA 2X0JA 1YJBA 3D7SA 3L0DA 1HZZA 4REMA 1RLUA 1USUA 2A7QA 2IOQA 5D3KA 4OX9B 2OAP1 4NOKA 1BFKA 1YHYA 3FRHA 4YGXB 5HJ7A 1UXHA 2O54A 2AUNA 3GLHE 4O2BA 4DV5B 3C4JA 3F4BA 5AI4A 1AF4A 1M8JA 4WBNB 4L50A 2XX3A 2ZGVA 1Y8RA 2NU7B 2MSCB 2IZZA 4E1AA 3PQ4A 2E2WA 1GZSA 4KWHA 1L3BA 4MMZB 3DHVA 3TQQA 3S2FA 2C3UA 3ZDCA 4K8RB 1PWHA 4O4HA 2RHMA 3GCDA 4F3NA 1HX7A 4R8RA 4B84A 1WZ2A 1ZMRA 2BI4A 1MC5A 5H59A 3SBEA 4F6RB 3NHLA 4LJYA 1M0WA 1NXXA 1Y6QA 2ZJ0A 1BW9A 8ADHA 1JHRA 2Q3MA 4UMFA 1OV6A 3F3YA 3R5FA 1KY4A 2X5KO 3G8DA 2YN4A 4JGGA 5KIAA 2Y66A 2QTNA 1NLZA 2Z8XA 3NWEA 2AXNA 4R2HA 2Q9CA 4IMPA 1K5DA 2PJUA 2FHPA 3UG6A 4D42A 3VZQA 4IINA 4ZV7A 2AI2A 4E3ZA 5AFSA 2QR5A 1JA9A 1PUIA 3DBHB 3DTVB 3FYCA 1J8VA 3K4HA 3QPWA 2GK6A 3HWRA 4YRCA 2NVOA 1GFZA 3L4EA 3PU6A 4TM7A 2HF9A 5JVDA 5TE9A 2FN7A 2ID9A 1GILA 4B6OA 4B6QA 2ZWOA 4OGFA 3QX7A 1G3IA 5KMGB 1G9SA 3FZGA 4JA2A 3L1KA 4RBNA 2ORED 2I62A 3IXMA 4OBXA 3JALB 2OLJA 3W7VA 4EY8A 5I7HA 2HUPA 2ZYGA 1N5RA 1N5DA 1W4RA 3E8SA 1PW7A 5BWCA 2H2GA 2FPXA 4IO0A 1ADBA 2YJ6A 1W30A 3A6GA 3UAVA 2X2EA 4ZI3A 5GZ3A 2YOFA 3BX1A 4ME6A 3DW1X 4XEUA 4B3SB 3GJ6A 1LXCA 2JGDB 4HATA 5ICMA 1E3EA 1GAXA 10MHA 1NJGA 2R7AA 2SBTA 2YUIA 2PEYA 3OBBA 4RVOA 3RRFA 3PTAA 4V0ME 2G5TA 3ROQA 1MPXA 3Q9SA 4XLTA 2IVZA 4X61A 1VGVA 4D4JA 4JXXA 3FI9A 5JCXA 1W8IA 3TTSA 2NGRA 1HLDA 1TFUA 4RTOA 2ZWIA 2MMCA 4C88A 1ULHA 3U3JA 2E5FA 2R62A 4WMLA 4EA9A 1E3TA 1MIOB 4CLEA 3L7CA 1LNZA 4TXLA 1ZA1A 3GH3A 3NJ4A 1MBZA 2P4HX 4KQWA 2FX3A 2PLWA 4UM9D 2YJZA 5JI3E 2O50A 2C7BA 2VYCA 2QMZA 1CD5A 3CY6A 2X1HA 2GFIA 3NXSA 2W8BB 3W4IA 4M7OA 4D9NA 2B7CA 2YY7A 4M9QA 4DDMA 4EKGA 1D3AA 3OMLA 2I99A 4TOIA 3VYRB 3E35A 4LBVA 4UM7A 1FQJA 4MWEA 4DHWA 2VJCA 3BBLA 4HZGA 4KR0A 4LXXA 5FTMA 1EUDA 3H4TA 5JMPA 4G24A 1FFXA 3OZUA 4QOJA 3GA7A 3KHUA 5C37A 3ICOA 1U2GC 1OX6A 5DP1A 3KQTA 4BASA 3E3AA 3QEJA 2GT1A 4F4JA 1Y4DE 2Y9MB 4AMGA 5CDHA 1IBCA 3O8DA 4X41A 1ULSA 1EIWA 1FK8A 2FEWB 2NO0A 2IIBA 3ETNA 1AK2A 1Q57A 3OCVA 1MTOA 3OQVA 2GEJA 1P5RA 1FDUA 4IZOA 4IVNA 1QCCA 1QUFA 3C98A 3EXIA 5ED4A 4KXLA 1E20A 2CCKA 3CCFA 4IF6A 4PLCA 5CT5A 1A0OA 5AKIA 5KYUA 3FAKA 3GNQA 3OSUA 4N7MA 2KSQA 2IL1A 5I45A 5LQJA 3O8OB 4DKXA 1I36A 2VT7A 1ZUNA 4K9QA 1RPZA 3Q8WA 5JH7F 2WSMA 1G8SA 4FR2A 4NBVA 2QXUA 5KC9A 3GFOA 3PCRB 1GTRA 2E87A 3PENA 1L9XA 2AW3A 3WADA 1K97A 2GMWA 1ND5A 5GONA 3I5YA 1R15A 2JVIA 4OJTA 1FSPA 1R6AA 5FL7A 1ZGHA 1M3SA 1JEDA 5FXMA 5BUCA 1HZJA 3NYRA 2HO4A 2JIRA 3QUQA 3OQIB 1SHJA 4QJ4A 4BO6A 3M3HA 4WLEA 2PLFA 3PPVA 3FRIA 4DUPA 2GD2A 821PA 1IHUA 1EAMA 3G2IA 1Z63A 1MX1A 2E5LB 2QTVA 3RS8A 3SXJA 3KD2A 1E98A 2Q1WA 3HUEA 3UW3A 5JZBA 2IXEA 3BT7A 3CGWA 4GMHA 5IWAB 4LFBB 4HNVA 4XB1A 3CRRA 3BPSA 1Q7GA 4RL6A 3WLOA 1TL7C 2YRXA 3Q7IA 4A91A 3IEMA 4KDEA 3OCJA 5E7JA 1LI4A 1Q3HA 3CR3C 2XYQA 2D1RA 1XV5A 4P3XA 3IBFA 1PT8A 1K63A 1F5NA 4YYEA 4M0EA 7REQA 1MRSA 4IJVA 4DE5A 3DWEX 2JD1A 1KSHA 1V96A 5E1MA 3A9CA 3JAWB 4RVUA 4RD4A 4URWR 1ZNWA 3T7DA 4B6PA 2ZXEA 3LQQA 2RI6A 4N8SA 1N2ZA 2YVAA 2W6JA 5G0WA 3FX2A 4X1YA 5C8YF 5AJZA 5DT9A 3UT0A 4B3FX 3ASZA 1BD3A 2C99A 1CR0A 5EZ5A 2GS9A 2KLBA 4NU8X 4F91B 1RXWA 3UJPA 1X92A 2A9VA