3ZQKA

Von willebrand factor a2 domain with calcium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
181
structure length
181
Chain Sequence
SMVLDVAFVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDILQRLREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Calcium Modulates Force Sensing by the Von Willebrand Factor A2 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 66
structure length 181
sequence length 181
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zqkA00
2NUTA 3ZE0B 4C29A 2NVOA 3T3MB 3EOBI 4BJ3A 1V7PC 2VDKB 1T0PA 1YVRA 5LN1A 4M76B 1Q0PA 1BHQ1 3BQMB 4FX5A 3TW0A 1BHO1 1M2VA 5KYWA 4NEHB 3K72B 5HJ2A 1ZOOA 3ZDYB 4CN9A 2I6QA 4UM8B 5KYYA 3K6SA 1IDOA 1QCYA 2ADFA 4WFQA 1XDGA 2ODQA 5E6UA 1U8CB 1FNSA 1MJNA 2ICAA 2VDOB 3EOAI 5KYUA 4HQNA 2WW8A 1ATZA 4Z7OB 1MHPA 3TCXB 2B2XA 3EGDA 3BN3A 3ZDXB 5ES4B 4IHKA 1QC5A 3EFOB 3FCUB 1ZONA 3TVYA 1M10A 1RRKA 1AUQA 3IJEB 4A0QA 2VC2B 1MQAA 1N9ZA 1CK4A 3N2NA 1JV2B 3Q3GE 1JEQB 3EGXB 3T3PB 2XWBF 1PD1A 2O7NA 2NUPB 2VDRB 1PCXA 2ODPA 3QA3E 1RD4A 4IGIA 1NA5A 4Z7NB 2VDPB 3IBSA 3BQNB 4C2BA 3GXBA 3V4PB 4CNBA 4DMUB 1YVPA 3ZE2B 1MQ9A 3TXAA 2I6SA 5KYNA 3RAGA 2I91A 3V4VB 1U0NA 2VDLB 1ZOPA 3EFOA 3F78A 1M2OA 1RS0A 4HQLA 5HGJA 4F1KA 4JDUA 2X5NA 1PD0A 1M1XB 4HQFA 1DGQA 1AO3A 4G1EB 5KYXB 3EH2A 1OAKA 4MMXB 2IUEA 1JEQA 3EGXA 5E6RB 3PPWA 3PPVA 3HXOA 2NUPA 5BV8A 1JEYA 3HXQA 3ZDZB 1MQ8B 4HQOA 2XGGA 1N3YA 2VDQB 1AOXA 4MMZB 2WINI 4CN8A 5E6SB 1IJKA 1LFAA 2VDMB 1U0OC 4O02B 3EG9B 4HQKA 3HI6A 4XW2A 4WK0B 3VI3B 2XWJI 3K71B 4NENB 1JLMA 4G1MB 1JEYB 4PN7A 3VI4B 1FE8A 2NUTB 1SQ0A 1UEXC 1T6BY 2VDNB 3ZE1B 4Z7QB 1PT6A 5KYXA 4F1JA 3FCSB 5E6RA 1XDDA 1M2VB 4UM9D 5KYWB 1XUOA 2QTVA 3NIFB 1MF7A 1M1UA 3EH1A 3PPYA 5KYYB 1IJBA 3K6SB 1TYEB 4MMYB 3NIDB 1CQPA 1DZIA 5E6UB 1SHTX 3E2MA 3M6FA 3PPXA 5HDBB 3NIGB 1IDN1 5KYUB 5E6SA 4WK2B 4WJKB 3EG9A 4C2AA 3EGDB 3ZQKA 3F74A 4UM9B 1SHUX 2M32A 4WK4B 1RTKA 1L5GB 4NENA 1QC5B 4IXDA
chains in the Genus database with same CATH superfamily
1H2BA 4BJ6A 3MMXA 4N8SA 4HCJA 1J70A 2JDIA 4TQ9A 3GLIA 4H4EA 4ZT7A 2EATA 3TLAA 3M3PA 3KQNA 4FX5A 2WVJA 4K9LA 1R6DA 3QWFA 2BZ1A 3OI7A 3WAKA 2X13A 2CNNA 2YMPA 3SR4A 4KR2A 4ARSA 1ONOA 1QX4A 4GECA 1Z6XA 4G6ZA 5FRDA 5FWYB 5CLFA 2FF5A 3LH5A 4LJ8A 4ZALA 1KORA 2W43A 4D25A 3B1XA 1PFVA 4FT4A 1XRSB 3UFXA 3VR6A 2KPOA 3EC1A 2BEJA 3MBOA 1ZRMA 5AXCA 3B1WA 4TYQA 4KR7A 3PQDA 1XTTA 4K46A 3TZLA 2PZ8A 2ZBRA 4ZOCA 5AOVA 3UGKA 4I4NA 3VJLA 1HQYE 1LK5A 4LZWA 4O2LA 1J5XA 1UXOA 2QRKA 2B35A 4RANA 4X7RA 2ORED 3LRTA 2FGJA 2IQIA 3KPYA 4N4AA 4PONA 1XXHE 5HJEA 4N12A 3ZS9A 1GA4A 1JPVA 1B73A 1XTPA 1RU3A 3EHEA 3OOJA 2YY5A 1E3WA 4YAKA 3FWZA 3DYVA 4X3CA 3ZZ0A 5L7WA 1Z4LA 4PC2A 2J33A 3C15C 1UWKA 1CB7A 3JTEA 2PRIA 4KYUA 2FMTA 1V2GA 3UJBA 3SOPA 4D42A 4WN9A 1E1RA 3O0TA 1EX9A 3DQQA 4YT5A 2XVAA 4ZEMA 5BVGA 1CF4A 2IIVA 3CZMA 4FW8A 4XX1A 4HYTA 2LCQA 1B8NA 2Y4OA 1XYGA 4OX9B 4MGKR 1IZ9A 3HI4A 4DEXA 1SWWA 2PGAA 2XD4A 3HY4A 4UHCA 5HKLA 3W5JA 4HQLA 4D0GA 3RO7A 4DNOA 2OB1A 4DIDA 4ZXFA 3LRPA 2P6RA 2DFNA 3C6QA 2UV8A 3VSDA 1OWMA 3BB4A 1RM4A 3FZEA 4WJZA 4L4SA 4BEVA 1K7CA 1BROA 3WGVA 2DFPA 4KH1A 3FWKA 2WTMA 4ACAA 4ND6A 1FSFA 2ROQA 2VH1A 3B2EA 3P2KA 3GJ7A 4F92B 2ZCUA 4KO2S 5SY6A 3V8VA 2XUGA 1ZK1A 2C0QA 3EEIA 3VU9B 1WSBA 4HLCA 3HXLA 5GZ1A 1DO0A 4L4RA 4EGAA 4NBWA 1EHIA 4QULA 3O4IA 5DM70 2AN4A 4CM9D 1MORA 2YIDA 4KGZA 3AESB 2QTFA 5CT9A 1CR6A 5DOVA 5EEGA 2J41A 1YS1X 4K6GA 1KVQA 4DHWA 5IVHA 2Z2JA 3CRMA 3FWYA 4NDNE 3F67A 2P3QA 3LWDA 4JA0A 4NYMQ 1R4NA 4QUGA 1GZ3A 1Z5PA 1QVRA 3FCSB 3PNMA 3TVDA 2XUPA 1JAZA 2YJ5A 2F62A 4UTOA 1DC7A 1GNRA 2ACKA 4QU5A 4LF6B 3EQ2A 1Z8NA 3C8MA 1NYTA 3ZQ4A 2RKWA 1WETA 4Y1FA 3BXFA 2GTPA 1I4LD 3SQMA 5E6UB 4QLBA 4BLQA 4PYQA 4UNPA 4P31A 1JIXA 2AF3C 4KFCA 4KR3A 1ZNQO 4ZOLF 1ULAA 4MQFA 2MIIA 1SHUX 1CE8A 1GPNA 5J4LA 1HQDA 1C41A 2YUIA 4Q18A 4DEYA 4N6NA 3FPJA 2Q5OA 1XF9A 3KOZA 4A6XA 2NX2A 1M74A 2RFLA 3O75A 1FFXA 5A3QA 4IEEA 2QUBA 3N53A 1DTSA 5EN4A 2EJVA 4E07A 2OLEA 5JYDA 2R96A 3IQDB 3FNFA 3WDKA 3WMEA 3FZYA 1T4DA 4UUMA 1W25A 4EHLA 3MJFA 4KZPA 1U28C 5TQ0B 4FT2A 1UJ5A 3KELA 1AKNA 1P4GA 2JFXA 1DC8A 3K2BA 4CDMA 3R24A 3H8VA 3STVA 4W5OA 4EG6A 2PUGA 3SX2A 4AO8A 4H0NA 1ZESA 3BTVA 1OYWA 2BJVA 3LLSA 4QNRA 4YJGA 1I36A 4LDPA 3L82B 1Y1SA 2GN9A 2JVIA 3VV3A 1R2QA 2LPMA 3UTDA 1OTHA 2ZRDA 2IYVA 1F8UA 5K6AA 1R6XA 3KEFA 3KOWA 2H9IA 2QVXX 2BHSA 3W9UA 1WMBA 5EWMA 5IKPA 2VC2B 1SBIA 3NU1A 4Y9DA 2EDCA 4MV5A 2XPCA 4I4CA 3LY8A 2Q7DA 4BLUA 1TK9A 1C81A 1K0FA 1VHWA 3E9MA 3IGFA 3QSGA 4JFAA 4CTMA 1GV1A 1N2XA 4XRGA 1OOEA 4RYLA 1QDUA 3UGJA 4LOKA 1QKKA 4RU1A 4ZCLA 1P9WA 3I8OA 4U9UA 1UADA 1T2AA 2PDAA 1E32A 2PL9A 1MRZA 4P7GA 3ZV5A 2B5WA 4EJSC 1EAYA 3KKEA 4ZVTA 4F56A 1CRWG 3FRHA 1QUFA 3DP7A 4ZD6A 4WZZA 2AXNA 3DPUA 1OBCA 3HBAA 3I2YX 2XCRB 1N7IA 4ITVA 4MA0A 1POXA 4FFPA 3WQHA 4D98A 4EY4A 4Z3OA 1A7AA 3VYSB 5HWSA 3HJNA 1JSCA 4TZKA 2VN8A 1PGOA 1EDZA 2CMKA 4CMEC 5C53B 4JI0B 3OETA 3MWJA 1B6RA 1MOPA 2BMWA 1NV8A 3QWHA 3T7EA 1GUDA 3NOXA 5IBCA 1LWNA 2JD2A 1PLJA 3HYNA 2C95A 2ZJ4A 3DT9A 2FR1A 3IAXA 5AUPB 1JQ5A 1Z6TA 1N7GA 2BEUB 3BRQA 1N1GA 4DLNA 2SCUA 3GT3A 3NVAA 1X15A 1ZWLA 2FUG1 4X3PA 4UU7A 4H59A 2V7TA 3BERA 4EJFA 2FR8C 3NC0C 4YJ2A 3ADKA 3KQPA 1UBFA 2IH2A 3N7UA 4NTZA 2HWWA 3BMNA 3M9XA 1WS6A 3QELA 4AWBA 2YIVX 1TCUA 5TF4A 4URYR 4M0UA 2CNKA 4L74A 3K09C 2F59A 1HWYA 3D64A 4FCVA 2ZSBA 4Q7MB 4FD2A 2Z2KA 2GJ9A 5DO9A 2FMUA 1GFZA 3FHCB 4D92A 1G21E 2J0QA 1CU1A 3K70C 1Y6JA 2WJZB 4OM8A 4AJHA 2YINC 3T9EA 1N8SA 3NORA 1KY3A 3BIXA 4O5OA 4AYWA 1PTJA 3E9RA 1DX6A 3CTPA 2YWGA 3NONA 4LW8A 2O59A 4IDBA 4BNKA 3EF1A 3D8SA 1LNZA 4ETMA 1ZQ9A 4YRBA 3ORHA 3JQBA 4OQXA 2C2OA 3DG9A 3MOGA 3P0FA 4JLPA 1J2JA 4O4LB 2IHYA 2I6FA 3QTLA 4MITA 1JRLA 3ZHUA 1CZLA 2LR0A 4NZNA 3EPPA 4IIGA 4XOIA 4HFRA 5LN1A 5KDLA 1ZVQA 1GGKA 1Z5NA 1LLUA 4DIOA 4HWSA 4GFDA 3LP6A 4MYTA 4E13A 1ZN9A 1CUCA 2GCGA 4YBRA 3GLFB 5FPTA 3O8LA 1AUOA 5FBLB 4MKHA 2PMEA 5KYYA 3KUUA 3TUIC 6AT1A 5GJBA 4BRUA 1P5FA 3SF0A 5DW0A 3EXIA 1OF1A 1FU7A 2XIJA 2GPYA 1JF8A 2ZJAA 3IAM6 4MVCA 5MN4A 1VIDA 4QDUA 1JQJC 1DWQA 1YS4A 3KQOA 1OLUA 5DXAA 1ZAYA 4IDDA 4PCUA 2YJZA 2FZ5A 2HTFA 2WZQA 5EWLB 2LP4Y 5TT1A 2QRPA 4PR3A 4BEBA 4BQEA 2JFVA 5C52B 3IBYA 4NU6A 3HWSA 3GLTA 1E89A 2F2TA 2FCAA 1CHNA 5CIQA 3RV4A 4Q1VA 3E2IA 5JRJA 3AEYA 1WMFA 1GGMA 1BCRA 2PYZA 1WZNA 4LZPA 4O4IB 1JH9A 3DTVA 3SC6A 2JEYA 5IAAA 1ZJZA 2QU7A 4FR0A 2ZBGA 6Q21A 1SCQA 4I5IA 2DQYA 1GNSA 5CNMA 5JE8A 4XQEA 4HDAA 3QXGA 2DM6A 5IUKC 4IWYA 3ZY5A 4JLJA 1JDPA 2EW2A 2VHWA 3LQKA 1DVRA 4JD5A 1SC4A 3TCKA 1YIAA 2VSOA 3FCXA 4FP9A 4GBED 4CLEA 5K45A 3QIAA 4B44A 4E3WA 2HPZA 4PYJA 4Q3OA 3W8FA 2EF1A 3VH3A 3PEYA 1U9IA 5EUMA 1PWHA 1PSDA 4AULA 1BFKA 4MW2A 2RCNA 4EHAA 3TLGA 3THXA 3BEOA 3VUFA 2R68A 4TUYF 5CUQA 1KZ4A 2C77A 2CMDA 3CMCO 4Q1FA 1EVJA 3D3WB 4A7PA 1DEAA 1G2IA 3A9CA 3ER9A 1LQTA 1XQXA 3O4GA 5E9JA 1IAVA 2GM9A 4C0HA 4ZHQF 5LUAA 1W88B 3DXXA 4KQ9A 5BT9A 3BRCA 2JEZA 4P36A 1YRQA 3TMAA 4Z4EA 2BR4A 2N9UA 1A9XB 1YL5A 3PR1A 4IH1A 5AM4A 2XB4A 3ZJTA 3H4TA 1QRRA 2P79A 5D7NA 5B2ZA 2QT0A 4CV0A 4EA8A 3SLGA 3UQYS 3WS7A 4BUCA 4B3SB 1RCFA 4XB2A 2V55B 3QKTA 3ISVA 2V7WA 3VYRB 2VQDA 3CFYA 4UKDA 3FPAA 4Y7CA 3GRUA 1FQWA 2IBSA 1T91A 4DZTA 4HEJA 4R1SA 5K0FA 1KFJB 3FMGA 1GLGA 3MGBA 3I9V6 1OZAA 3QBDA 3RYIA 3UEOA 4XLTA 1F3LA 2BELA 2ZUCA 3AF5A 3N8IA 3IKMB 3QNUA 4PNEA 4HEA1 4RGVA 4C2TA 5FPPA 1LGYA 2AUMA 4B34A 3HC7A 4AT1A 5HKOA 5LD2B 1WR8A 2Z8XA 1RRMA 3FZGA 1ZSVA 5BQPA 5G4KB 5LYJB 2IVFA 4AWXA 3KU4A 4HNRA 4K81B 4X7MA 1P6XA 3W9YA 1QJCA 3K20A 1WU8A 3FF1A 5JY6A 3CJQA 3Q1KA 1L7PA 3MCVA 1EEHA 1X9IA 1KARA 4E5UA 1XQ1A 1Y1TA 2CZCA 2EBUA 3OJFA 1AHNA 1Y1RA 3OPNA 4R6WA 3HVHA 1JJBA 5EKSA 3SE7A 4ZGGA 3NVMB 2JS7A 5JSZA 2DCMA 2W4IA 1BGWA 1JECA 2BFAA 3H87A 4MR9B 1C3OB 4DLVA 3P0RA 1MC1A 3X1YA 1PU2A 2UVQA 4QL3A 4C0AC 2C3YA 2J7PD 3PQ8A 3EPKA 3FYTA 1ZNYA 4J94A 8OHMA 2HMWA 2HLHA 4JYPA 2PG3A 4AZTA 4BDTA 2FVYA 3F8WA 2EL9A 1AO0A 1KDOA 3M83A 3LD9A 1T4GA 2PD4A 3HABA 4TL7A 4WFQA 5AUNB 4W1SA 4MGYR 2ODQA 3TLCA 1Q50A 4DSAA 2O1EA 1PYDA 4CM6A 4Y2QA 3HLKA 5D86A 5FFNA 3X2FA 1B1AA 1XLVA 3QPWA 2HQRA 5EKUA 1N2EA 2FWMX 5ILGA 4B3DA 4X41A 1VLZA 2RK4A 4ENWA 3ES9A 4GBJA 1ZU5A 3T1HB 1R0XA 3L8HA 4PCAA 4G97A 3UMMA 4IQ0A 3IODA 4MUFA 1XP8A 5JXGA 4TV9F 2GYVA 5CR9A 1U8XX 3JPYA 2D1RA 2D1FA 5DHAA 3O9ZA 1KKMA 3GV0A 1ELOA 4HZUB 3OCYA 2XTZA 3BWBA 3UCXA 3UJHA 4EYOA 2JKYA 1DE0A 2C88A 2MJLA 1FVHA 2Q0XA 2XH8A 3ONWA 4H60A 2MYUA 3G2JA 4KXLA 4R1TA 3GVPA 4UCFA 1GJRA 5D01A 3EXFA 5G0TA 3USZA 4DRZA 2AQKA 2QJFA 2F8MA 4TYPA 4BNVA 2P6MA 3QE9Y 4K6CA 5FTJA 2JCYA 1Z37A 4MW4A 4BNZA 1Q14A 4LHVA 1T2NA 3E3AA 3A7DA 3HR7A 4O3MA 2QD1A 5A4DA 3FBWA 4N3NA 1EA7A 1AGYA 1GQ2A 2GPAA 1NYRA 3E18A 4RNDB 3COJA 1ESCA 1OV4A 1QMPA 3DNMA 4G0PA 1E7YA 3F6YA 4DM7A 5LMNB 3EFBA 4BZWA 5JISA 1PSZA 3TNFA 4FNAA 4GU5A 2QP9X 4B6EA 2QKYA 5LA6B 1ATIA 3IB6A 1H3EA 2AJDA 1T6NA 5GINE 1XP5A 2KWIA 3B3QA 4MRSA 1IQUA 3R6TA 5EESA 2HB6A 2VJPA 3PPWA 2FW8A 2GJKA 2YC4C 2PCLA 4PQRA 2GGSA 4E32A 2XOEA 3ITDA 3TJMA 1QIIA 1JMYA 3L1VA 4H3HB 4AJ2A 3LW8A 4J4BA 4QJ5A 4R5MA 3OT1A 1YAHA 2Y0DA 3KL4A 4W7IA 4Q9HA 1IZ0A 4M8NE 4YA6A 4BKOA 1LFAA 4C3UA 5A3RA 5I4BA 3SF8A 2HHCA 1EQ2A 1JYEA 4DVGA 5F9FA 1RIIA 4P4TA 1NVAA 1I2AA 1OKKD 4YCMA 1MAHA 3FTNA 2RHCA 1NJFA 2LBPA 1UEXC 1UMCB 2ZS8A 2GWHA 4JOQA 1DFHA 2BM8A 3UKJA 2YV3A 4KLAA 2BN4A 1I2CA 4LK3A 4B80A 1EWQA 3HVIA 2ZJZA 2MTBA 4IHQA 4QOIA 5REQA 1U0BB 1GPBA 4J1TA 1PR2A 4LY0A 3ZW7A 1VHLA 1DNPA 1BXRA 4EO7A 1V1RB 2XGJA 5A4MS 3U19A 1KZYC 2BDUA 3WB0A 5BURA 3QRWA 1QFZA 3A8TA 4MEJA 4WT7A 3L1IA 1VPWA 3LT2A 3RYFA 2E85A 3BXZA 4PFJA 3S27A 3ZHCA 1Y82A 5M7EA 2QAGA 1M6YA 5I7UA 1N4DA 4YO8A 4Y2SA 3L8FA 2M32A 1VJCA 3HJHA 4L5JA 3T9CA 5LQSA 1A04A 3A6GA 5KAMA 1KAHA 4DUGA 2PPLA 2BEWA 2PH3A 1UAYA 2WZCA 5KYVA 4X54A 3GZTB 5KWJA 2B3DA 3KQWA 3IR6A 3PD1A 1BHO1 3TM5A 4D9HA 2NVWA 1G9SA 1SOWA 3D4NA 4K87A 1FFEA 2L18A 3NOOA 5F1YA 4C6TA 3OM1A 5KYWA 1SBYA 2IELA 3AW8A 1X77A 2NU6A 4UEOA 3NWEA 3SQLA 2O0HA 1PJ3A 2YFYA 3LPNA 3AR3A 3TQTA 4QO7A 1WL8A 2P8JA 3OZXA 4G4GA 4KU4A 2ICAA 1OA0A 2X4LA 1OI7A 1TJ3A 3BWXA 3HCDA 3MOIA 1S2IA 2XE4A 4BZPA 4WI1A 4BZZA 4ETIA 1SQGA 3TCXB 1SPXA 1Q1AA 2X40A 4AJIA 2FEAA 5JY1A 4E14A 2OPHA 1V7ZA 1TJPB 1NHWA 3D3EA 2V5AA 4G0OA 4HAUA 1O9GA 2RBGA 3KUKA 4CETA 1H3FA 3KFVA 4FGZA 4J2TA 4PSDA 5IC5A 2IF0A 1GUBA 3QEOA 4YMUA 3FMPB 1W4RA 2I6XA 1LRJA 2FZGA 4MJ7A 1CUUA 3PICA 3S1LA 1TTTA 2PS3A 5CK4A 2JI8A 4Z51A 1WQ1R 2XZTA 4DPMA 4IY1A 3H86A 3P96A 4L9SA 2BEKA 2HIHA 2ZYRA 3GK3A 3NHYA 1M83A 1UDRA 3EASA 3V42A 5BORA 4KX3A 1U1IA 2O6HA 1QO0A 3IB3A 5AH0A 5DFAA 3LBYA 3ZBQA 5JFGA 5JZOA 4OQQA 4KIWA 1L1RA 3U1BA 3CN9A 1XRNA 4H1UA 2OCKA 4IYJA 4P58A 4L0DA 4UNRA 4YJ3F 1Y1LA 1NC1A 3RAGA 3D6JA 5A7GA 3LIIA 4EI9A 1KQFA 4MAFA 3ZIAD 1MMFB 1ACJA 4RVDA 3AI7A 3ACBA 3O9VA 1PG5A 1UBOS 2R9VA 4IDGA 4YWJA 2N42A 5DTIA 1ZI8A 4KO8A 3L6EA 4D4HA 4DQUA 3SIPA 1ODCA 3AEUA 4QQFA 3G5TA 3DGFC 4JU9A 3U9SA 5JJKA 2EFCB 5LFAA 3KPWA 4XUCA 2Z0MA 4DC1A 1YRWA 1LBTA 5KVQA 1RR6A 1SBTA 2ORYA 3S55A 3VSCA 5HZGA 2C5BA 1FZTA 3CJTA 1D7OA 5JD5A 3R9KA 2F90A 3LS2A 4F9EA 4AMUA 1TU0A 1VIAA 1YRYE 1GGJA 4GI7A 5DWVA 3W2TA 3IOEA 4NL4H 3TPFA 4KBFA 2IDJA 2WIKA 2XWPA 3M6MD 4PCLA 4X00A 4A6DA 2A92A 4RZHA 1COWA 4PAOA 1XRLA 3PXDA 3OZUA 3CPHA 3PX3A 3KT6A 2IC5A 3Q0TA 5BMVA 1NWHA 2B8NA 3UO8B 2VNIA 1Z22A 3R6WA 1V16B 1PFYA 2GO1A 5AKIA 3RREA 3U3ZA 2VKQA 1MB9A 2ZB2A 3I09A 1NN5A 2J5QA 1CBUA 3IAUA 3VDQA 1JYFA 5F21A 4A15A 4PAGA 1FSSA 4JT9A 5DHSA 3CCCA 1E5DA 4DDHA 1GAXA 2I66A 3OOYA 1JQDA 3TIVA 4DY4A 5L6LB 5GONB 1VM6A 1KBZA 3P0EA 4XPIA 3QNMA 5D5HA 3HBMA 2DKNA 2AUNA 1MU0A 2XUHA 3IDAA 1JR3E 2DHDA 3OJCA 3U7GA 1FPQA 3RJZA 3EEBA 3G5AA 2HQOA 4LJKA 1C3VA 4XIJA 3HE3A 5GV8A 5TQVA 4L5IA 3BMOB 2V7QA 3NEJA 5DYNA 3WE7A 1N57A 2H11A 2VP5A 4W99A 2YQZA 4QJIA 5ENDA 1YS6A 1HNZB 3KXDA 4ETNA 4M1ZA 3HUTA 1B0UA 1PQUA 3BL5A 1YVEI 4GI3A 4GKJB 1CVRA 1KK1A 3FVQA 3ICEA 4DCMA 3GGJA 4PYKA 2H2HA 2YR0A 3L4BA 4BXOA 5COQA 5ENVA 1GG8A 1N5OX 1OT5A 1TYZA 4KLCA 3RYHB 1TEZA 4A0SA 1QP4A 1HRDA 4N40A 3MWKA 2L42A 4LGMA 3MSCA 3UAOA 3L01A 3SBXA 2OXCA 3PVCA 2BLLA 1IXSB 3E9EA 2DFTA 1V6AA 1VLMA 1X1TA 2P40A 4FSDA 3VPSA 5AQ1A 4KWEA 4XE5A 3C2QA 3PFNA 1NXSA 2DFKB 3PQEA 1OGJA 2DOKA 4ZO7A 4JXJA 4KO1S 4EDFA 3P19A 4JQCA 221PA 2Y9MB 3NRBA 1NVDA 1V7CA 3ZDCA 5IT5A 1C0PA 3WC4A 4LV5B 5KEIA 1CNEA 4Q1DA 5FUXA 5IC6A 2OCIA 5E9QA 3N2KB 1TMKA 4TQGA 5EUCA 1PYGA 5GAJA 1CUJA 1HEYA 1NA5A 1H8EA 3ZHZA 3COSA 2NQ8A 5ARCA 4A1OA 1N1EA 2DHEA 3W8EA 1WDMA 1RWQA 4UAGA 2GZMA 4FQ5A 2GOYA 3UT6A 3NBYC 4GR5A 2QM0A 5AVYA 2ZB7A 2CE7A 1OU0A 4OQMA 2J9XB 1NQVA 2IY8A 4LRSB 3BAFA 3OICA 1JFFB 2I4IA 3DVSX 3MOSA 4XYBA 4MWDA 3ZBPA 1E6UA 3DFKA 1KVRA 4H7FA 2RHJA 1U7OA 4NBSA 3OG9A 1BX1A 1M73E 5K8JB 2BOVA 4C1BA 8MHTA 2GHRA 1HFEL 3MT7A 2JGFA 1M8FA 2FE4A 2HZBA 3AJDA 4UVIA 2WT9A 3EW7A 5GADl 1GR1A 2HK8A 4FHZA 3FI9A 3A0RB 1OHHD 5DGDA 1P18A 2AMJA 1F8XA 4NV1A 5JWHA 5KOJA 4D4KA 3HXKA 2WG1A 1R4AA 5DT2A 2Z98A 4DLSA 3NRCA 1E2JA 4PFKA 5L51A 1TM5E 2CHUA 4M0KA 1JPNA 1S9DA 3SI7A 4CIYA 1D4AA 2C3OA 3FBTA 5FYDA 3RC2A 2H63A 3RBZA 1QYWA 2QR2A 5JH7A 1CDEA 1JVNA 3SG0A 4OYRA 1N0WA 4MV3A 2JB9A 1W30A 3D7LA 3O0DA 3NCHA 3K1AB 5LZ2A 1FFCA 1X0VA 4H35A 1YJBA 5LP6C 3KXKA 2FE1A 4RK4A 4MHSA 3RWBA 4YJFA 4PG7A 1A9ZA 1MIOB 1Y5NA 3SJBA 2Q29A 1XXLA 3HNOA 5I9MA 3PC8A 3Q72A 3CY6A 4L85A 4LYFA 3OTGA 2A5FA 4NF2A 2PKRA 1UC5B 2A5DA 4MULA 3JW8A 5THKA 5C5CA 1E9EA 2JHCA 2A59A 4MUKA 1KQPA 3R9XB 5FEUA 5E4YA 4UPEA 1PFKA 2J9FA 1D7AA 2DT8A 2I2WA 4P9NA 4F85A 1E61A 1CX9B 1EWTA 2IVZA 3WMWA 3IUQA 2IH5A 1E2BA 5DLDA 4RENA 1X86B 2J0UA 1DP4A 1II8A 1NVGA 2RGGA 3WRWA 1T0PA 1QPBA 3Q8MA 2CFOA 2P2SA 1XVTA 2ZVDA 3TW8B 3HU5A 3H0EA 1XVVA 4CL2A 2FSSA 3QFHA 1HDXA 5E0KB 5J4VA 2Q3BA 3WL6A 3BHIA 3IQIX 4WY5A 5EP1A 3GUVA 1XDGA 4HN4B 1G8HA 4MOWA 4ZJPA 3BFVA 5JZVA 1BFUA 1U3CA 3KO8A 1R66A 4KQKA 2FETA 5B30A 3WJAA 2FB9A 1I2ZA 5I01A 5EMHA 5H81A 4MPPA 4QUDA 3LU1A 2V65A 3U3XA 2RG1A 2UAGA 2C4KA 1WZUA 3FTDA 4OXIA 5TNXA 3UAVA 2J3DA 2P65A 5JNUA 1IXYA 1G8PA 5U9CA 2CVZA 4L76A 1I4WA 2H0RA 3F9CA 1P7CA 1YZLA 4HDNB 3ZWYA 4ZAZA 3WYEA 1GRQA 3HHPA 1G1AA 3H7AA 4UBLA 1SHKA 3KAKA 1WMSA 4OUDA 4NULA 4OHMA 2Z08A 1WXQA 4KNWA 4XH9B 3SZOA 2PRKA 1J8YF 2VQEB 4KO3S 2ZYAA 4GMDA 5EXDA 1VJGA 2QNRA 1E6MA 3CXRA 1MD9A 3V4ZA 5JCZA 3RSZA 2C7GA 2BFDB 2R8XA 4D2IA 1YONA 1ADYA 2JFBA 2REBA 2ZG6A 3N3AC 4J90A 3O3NB 1M1ZA 4LS3A 2OV6A 3QVLA 5CBKA 4KQ2A 4U0JA 1VMDA 1VE1A 2DUMA 1HTWA 2VYND 4RZUA 1M6HA 5DXJA 1DDGA 3L6UA 1HLGA 4YRJA 1NQOA 1R8SA 2GFIA 2J7KA 3O2SB 4NJEA 4L8VA 3FE2A 4PPFA 3OU7A 4H7PA 4KGVA 3CBGA 3ORYA 4MVJP 4QPCA 1C3EA 1CUYA 5FFMA 2PUAA 1KP9A 3GA0A 1GRNA 1GUZA 3U6BA 1MPXA 1X70A 5A5DA 1PR4A 2ZPUA 4MLZA 4HQOA 5IG2A 1NY5A 2HEIA 3PDIB 4MRRA 2QG9A 4BMNA 2Y99A 2X6RA 4AUNA 3SJ7A 4HC4A 2C58A 1NUAA 1RXIA 2OTCA 3GX1A 4BFXA 4CNQA 3FPEA 3BG5A 4ARIA 3C5EA 4QPNA 3AHEA 4PQYA 3TWOA 4BX8A 1GIAA 1G6HA 4PN7A 1DDIA 1LC0A 2VRNA 4UM7A 5E9AA 2QV7A 2HTEA 4WGGA 1XAIA 2GN2A 4ZDKA 5LBUA 1ACLA 1YJ8A 1ODIA 1F0NA 2R8PA 4D8TA 2NSHA 2ECQA 1ADGA 2D4HA 4L72A 3VR6D 4KUHA 4BNWA 1QTIA 2NYUA 5BQ3A 3D2CA 2DPGA 4LDRA 4XYGA 4E94A 4IZIA 4CU2A 4EPVA 4LJYA 2DLDA 2FPPB 1ISMA 3PT9A 4U2CA 4L4YA 4O2AA 3ZNOA 4IFBA 3ZCRA 4C20A 4ERNA 1U1GA 5AXAA 1ZH2A 1S8NA 4J43A 4U3JA 2GN4A 4Q4CA 5KQPA 1GO2A 4MWEA 3R44A 4V1CA 3KPUA 3MHTA 3KYCB 3O1LA 1CUVA 4DIMA 3H2IA 4EKEA 5AMXA 3IAS6 1NM5A 1ZXBA 4G8BA 4ND4A 4U7GA 5KS2A 1ZH4A 2BGNA 4MA5A 2GA8A 3VPGA 4BB0A 3IHWA 4EUHA 2W00A 8GPBA 2WKQA 1E1RD 1MG5A 1QR2A 3WLPA 4DA7A 4ZYTA 5ITSA 1M2VA 5HIMA 2CNOA 2XUQA 2GEDA 3PDUA 3K0SA 2HGSA 3KOOA 3GBVA 3IR5A 1JT2A 3PU6A 4U7TB 4NCXA 4F2GA 2HXGA 1DT3A 1FNSA 2H4JA 4RLSA 2EWWA 3W3AH 2O8DA 2Q5CA 2ZYTX 1PV2A 1JBQA 3K0HA 2PLAA 1BX3A 4YV1A 1A95A 5IS2A 2IUSA 2Q8QA 1T0HB 1AKWA 1YOVA 1L3BA 3ZDXB 3R76A 2JLVA 2WIAA 2FOLA 1QAQA 1R0LA 5L4NA 2ODBA 4FE4A 1GTZA 1RFLA 2Q4OA 3A6LA 4EI8A 2FV8A 5JDIA 4QYTA 1R0ZA 2GHTA 2WFAA 2RBKA 1XCOA 5G0WA 3DCJA 2JHPA 3D6MA 4OHRA 1UOQA 3QOWA 4LBWA 5D6NA 5K0TA 2WQ7A 2D2FA 2G71A 2PX2A 4AX8A 2JJQA 3M34A 1S3GA 3GC6A 3GUHA 3UIEA 1SHZA 2JFWA 1DELA 4FKBA 4MQ6A 3A6DA 4TMTA 2JIBA 2P4QA 2OFWA 2E87A 3QLUA 3PNPA 1RYBA 3FDJA 4ZYXA 1VKJA 4BWFB 2ZSKA 4KR6A 1T34A 1TF5A 1UXGA 2HU7A 3PC3A 3KZNA 2FTKE 1VBKA 3BMCA 3CW8X 3IBFA 2G72A 2BBTA 3Q6NA 4TPKA 3TB4A 1WOYA 1N2ZA 4C3VA 1UWCA 1Q1NA 3DMYA 2OHFA 2VQSA 4KK3A 4LGVA 1Q15A 1JI3A 4C6RA 3F47A 5EP3A 4P4GA 2DSNA 5ELLA 1EFRA 2X7JA 3EZ6A 3A1NA 4R81A 1O5TA 4KTVE 3C8UA 1EAMA 1K4KA 1ZUWA 1GSOA 1QR6A 1TA4A 2CEKA 2VG8A 2VF5X 1JAHA 1O95A 3AJ8A 4KRGA 4YAWA 3AJEA 1ZIYA 2NOAA 4ALIA 4F3CA 1V5EA 3WLKX 1WCV1 2IUFA 4CT4B 4QBIA 2XSZD 4KN8A 5HILA 1NV9A 1XCMA 1D09A 1ZMXA 3GFQA 2O7VA 4RESA 5BQ5A 4NH0A 1JA1A 5BYKA 3AILA 1TU3A 1XTKA 4R69A 3WNVA 3VI3B 1IOLA 3SEQA 1DO8A 3PG5A 1AS2A 1NQAO 2IDZA 3NT2A 3V6LA 2QPAA 4FXPA 3RV3A 2RGBA 2HADA 3HXMA 2QSYA 5LOVB 3EZ7A 1LPBB 2A9KA 3KT3A 3VVLA 3IL2A 1V48A 3NHUA 4JSTA 5JMPA 5FWNA 2UYOA 3O3OB 3OOHA 2F8SA 4B4OA 2IODA 2LD4A 1FTGA 2AK3A 3AR7A 2QTVA 3QYAA 2G9NA 3OTOB 2H17A 1ZK3A 1VPEA 4M6WA 5EUQB 1DAGA 3DCIA 1FF9A 2OG1A 2XF2A 1UFQA 4J2OA 4PZ0A 1Y3BE 3M6FA 2VXBA 3WLFA 2WWXA 2XMDA 4QSMA 2NAPA 5E1OA 1QU2A 3L84A 2P9CA 2XDQB 3ND6A 4LVCA 4RD1A 2X5OA 4X8MA 3WL4A 4UM9B 1VB3A 3IBCA 4BV2A 1TVKA 2D5CA 1JZQA 1T8SA 3ADPA 1HLFA 3CEHA 2ENUA 4H4DA 5A1JA 5L3VA 3LFUA 4MUAA 2P3LA 5KYTA 1R3UA 1MP0A 4OU4A 2PWPA 3SS9X 1G20B 4UUQA 5EJ5A 2XTJA 4EYGA 3I8XA 3B89A 4BNIA 5TJ9A 4W1PA 4HO1X 1WQ4A 1KRWA 2WEKA 2P5TB 1CT9A 3L8GA 3DKIA 1CJMA 4X1KA 2WJWA 1D2HA 1AKMA 2ZLBA 3LK7A 4JUAA 1U5BB 1N77A 2AN5A 5E2IA 4KPYA 3RW9A 5TPZD 3CRNA 3LKVA 2LRHA 1B76A 1C9NA 1H22A 3BQ9A 3OLQA 4RPJA 5BV1A 5I5EA 3GLGB 3IV9A 1PR9A 3WLSA 3GLHB 2FFJA 4Y1RB 4A8PA 4C01A 3OO1A 3WGKA 4QJ3A 1CJSA 1N5DA 2DLCX 4Q3KA 3ULKA 4DCVA 5GIOE 1XNGA 1MC8A 4I1UA 3M3HA 4QOSA 3OCCA 5DISB 3K5IA 3USES 3TKYA 5CVJA 3UH0A 4HJXA 2QN3A 3NEAA 2XQJA 4HLUA 1N2CB 1VTKA 4P92A 4AXBA 5CW2A 3DZDA 2C7RA 1OFIA 4QPZA 4TWBA 4CPDA 3RC1A 2R7AA 3SWWA 5KIAA 1JMVA 1CP2A 4BE9A 2O2SA 3O8BA 4D9NA 4JUCA 1IZZA 1BEEA 2BKEA 2BGUA 2FQ1A 2CXTA 4PZAA 4TZ0A 4KACA 1TZCA 2E89A 2H51A 2RAFA 3QIVA 3JQEA 4MA4A 4MRPA 5BWLA 5IJ9A 4RMIA 3MCUA 4E88A 5A9RA 5FJJA 3MWFA 2QZ9A 3V32A 2Q3HA 1Z6QA 1P4AA 4MR7A 3TFQA 1FFSA 2Q50A 2Z9CA 1GQYA 4JL8A 3SQOA 2P7HA 2QE6A 3IJPA 3IUJA 1CJKC 5FD8A 1NE2A 1II0A 3GEIA 3NYQA 5JCJA 4P33A 4J1SA 1SRQA 5HKKD 3GEMA 2YC2C 1T8PA 3LLUA 4TRNA 4CHTA 4FKMA 1WXIA 1CS0B 3UF0A 4B3MB 4RSGA 3LPDA 3PVZA 4JU8A 4XUEA 4X5OA 2C97A 5FOUA 2V7UA 4XAQA 2Q6VA 3HS3A 3BD6A 4EBFA 1H0HA 3AOGA 4WIAA 4IIJA 1A4UA 1ZIDA 3TLYA 2XMZA 4ENVA 1NRXA 1SQ0A 1VL5A 5JDIC 1IPHA 1OWNA 4C4OA 4ZHQA 4D9KA 4NS4A 4P3OA 3FFWA 4ZN6A 3AFNA 4MWBA 1QH8B 1T8UA 2EEZA 3SM9A 2WJHA 5JHGB 2IPAB 4ZRDA 2V3WA 1YD7A 3GCWA 4QGHA 2PO5A 1O9BA 3RT9A 2YJ3A 1B14A 1ZH6A 4U7WA 3R9WA 4LOIA 2FZ4A 1JJ7A 4P80A 2OP0A 2CSXA 3FR8A 5FUMA 2WV7A 2BGTA 3E8MA 4K9DA 4EAAA 4UOEA 3ZJYA 2BMEA 3W8DA 1RRVA 5BWCA 4EH1A 2BR5A 3B8EA 4FBLA 1RABA 1C4XA 2LDBA 4PG6A 1T9GR 2YJ6A 1QQTA 1T1IA 3FOZA 1LD3A 2J5XA 2O8BB 2OZEA 1T8TA 1XCGB 2P9YA 3IEIA 4L6AA 3AY3A 2FFRA 2DERA 2H07A 3GDGA 4TZTA 5EIAA 5BSRA 4AMVA 3P94A 1YFZA 3KV3O 3IAAA 2YWJA 2FPRA 2WC1A 3H11B 4YK7A 3RBVA 3RVRA 2B4TO 4NCAA 4GI5A 3DAGA 1ECJA 4I9HA 3B6IA 1G21A 2CHGA 2WPNA 1EKXA 3PQ5A 5B64A 1R8QA 4KQCA 4TWIA 3FIUA 1O95C 2YZGA 4HX5A 3SFVA 5DEIA 1VCNA 1C7EA 1G4UR 4JX8A 3E5RA 1ESDA 1QYVA 4GSLA 1M75A 5E3IA 1HMYA 3EEFA 5BQOA 4BDSA 4UTPA 2ZZNA 2CFSA 2VZLA 1PVVA 1VLHA 1F8FA 2LCFA 4BBZA 5AM3A 3R3XA 4MS4B 4PQFA 2JFHA 3EZLA 2HFKA 1YA6A 9LDBA 1K2VN 5MDHA 1LA2A 5K3SA 2OMEA 4FYWA 4RJ2A 3TB6A 4RTOA 2NT4A 2YS6A 1QF6A 3UENA 2GBIA 4YY3B 2AJCA 2M6SA 2GARA 3DMNA 3UN1A 4QYIA 3N8HA 5IVPA 3FJOA 4G5SA 3DBHB 2O3RA 2BKVA 3D1VA 3DAHA 1GVNB 2FPIB 1GARA 3H5AA 4Y67A 3VKHA 1MKYA 3R8XA 2OQRA 3T5BA 2HF9A 3RBAA 3MS2A 1E1CA 4TWRA 4B47A 4BS9A 2CYBA 2ODAA 3ZD8A 2H9YA 3PDHA 2HMUA 5TGDA 4DMUB 1Y0BA 1ZX1A 3NHKA 5B3KA 1IOZA 4IQ4A 2VZEA 1DKNA 4YRRA 3BILA 3OAAA 2GYYA 2A94A 2X19A 3LUPA 4YLGA 5EZYA 3PE3A 421PA 4C7OB 4K9NA 1J21A 1LQUA 3K4PA 3KPJA 1E1YA 3R5KA 3I9KA 3EIEA 3MTJA 3JWPA 4ILKA 3HL0A 2XNDA 2O2CA 4ND2A 1WB4A 2ARKA 1FA9A 2YJNA 3KQTA 2OC9A 3X43A 2CDAA 2R7LA 3BH0A 3I5XA 3AIIA 3LHIA 1HI9A 4GR4A 2C04A 1EDOA 3ANXA 4PPNA 4P4SA 4LFAB 3OQIA 4QFCA 4WNAB 2HA2A 2HYDA 3OT5A 3W77A 5EMNA 2JH8A 5DI9A 2JJ2A 3BVPA 1G6Q1 2GR9A 3RVJA 3D5QA 1IUNA 3M5CA 4IOLA 1AGRA 3KVVA 5IN4A 3PKIA 4ABYA 1V9LA 4OB8A 5IZCA 1I8TA 1TEVA 2B69A 4KDCA 3B20A 1YK1A 2BGIA 5IBQA 4GOXA 4PGAA 5E4FA 2VK4A 2APJA 3B51X 4ISCA 1C7FA 2BRUC 4JR0A 3DVRX 5BN4B 2W5UA 4YV0A 2AZMA 4ZYZA 3ONEA 4D9FA 4AQYB 4ZVSA 1UJ4A 3QWAA 4R8VA 4ZCPA 3ELBA 2QU8A 2AMYA 4DR7B 1KAOA 3PFWO 1QP7A 3ZXSA 5BV0A 5HG0A 2R5NA 2EARA 3BJEA 4RZSA 1KERA 1KF0A 4FGKA 3A05A 4EUKA 1NHGA 3BIFA 1Z88A 1CYDA 4GNKA 1P1RA 3EDQA 5DPMA 4DA4A 3HDVA 1G3RA 1UMBB 3HGTA 1JX6A 1GFWA 1Z0KA 4RSHA 2VJOA 3QVMA 5KTNA 1QG2A 3AGPA 3LY5A 3I32A 1K88A 3WGGA 4EI2A 4MYUA 3IE1A 2X1VA 1KXJA 1NSYA 4PPYA 4ZU1X 2L82A 4LSMA 3CRQA 3JPWA 3L4JA 3V3KA 4P4NA 1EJBA 1WZIA 2CVOA 3UYKA 1UKAA 3VX4A 1IK4A 2QQFA 4H17A 3KZOA 4RY2A 1OFUA 4DV3B 2QG4A 4KB5A 1XTZA 2HBYA 5LXTA 4U4AA 1PFQA 1N32B 1XZMA 2OXTA 2DPXA 5AM2A 5HJ2A 5B36A 2OORA 4H1HA 1H2HA 3D4BA 4DPLA 2AR0A 3LY9A 4EDHA 1IE3A 2Q4BA 2HKIA 2NSDA 4EW1A 1B6SA 3DBRA 4K9KA 1R50A 4DJTA 1YJXA 3I4CA 3OQBA 2ZAOA 2W2VA 2OFOA 2VNAA 1VMKA 5LJIA 9ATCA 1PEKE 3GNQA 2CUNA 3A1CA 3CUSA 1HYQA 4U8GA 1L5RA 4ZYUA 1PN3A 5MN5A 1E5XA 5C1PA 3OPYB 3F5QA 1N92A 1GD1O 1JDBC 4FYVA 4MYRA 4XJVA 5C2JB 5HMLA 1CUBA 2V8OA 4OK5A 4G26A 2P35A 5FOSA 4TSKA 4OAPA 4OKSA 2C4HA 1Q0QA 2CLFB 4TM7A 1BVRA 4YBZA 1AS0A 1OTXA 1Z8FA 4JLVA 4A0RA 4UVEA 1KEEB 4N6OA 4DLXA 4IXMA 4KQFA 1LY1A 3KVOA 2V3VA 5KCMA 1NRWA 3OCJA 2X9NA 4II2A 2OCPA 1VFPA 1E4EB 3NTUA 3FBGA 3DAYA 3O84A 1GU0A 2FMHA 4WOPA 2IWHA 3ROZA 2ECPA 4ZT2A 1QZUA 4FUTA 3ZLBA 3N5CA 3WIDA 4C0QC 5KX5F 2X1HA 1DEOA 3KFLA 4JC8A 1WG8A 1PD0A 2I4TA 1ZBDA 2DPYA 4WD3A 2RSLA 4MIYA 3DJFA 3FDXA 5AKLA 4EG4A 4IJ5A 2HXYA 2CGEA 4KQIA 2TMKA 1A9SA 3RNOA 3QTBA 2H5EA 3NVDA 3PRHA 3B8HA 2POCA 3FVVA 5DMHA 4RVOA 3BGSA 4OF4A 2RIRA 1UPAA 3F5DA 3PDWA 4DZRA 5AOCA 1TQ4A 4LJ6A 2WWWA 3L8ZA 1XJ0A 3A14A 4F7WA 5JRZA 3NYWA 4MUMA 3HWWA 3ZDZB 3GJ8A 5KC9A 1M76A 3LLMA 1M7GA 1Z36A 3ESCA 2FEPA 2VSNA 2PMDA 1PGJA 1NBMA 5TT0A 1ECBA 4FB5A 4YLYA 1DS6A 4BNTA 1E1DA 4I4TB 4UHJA 2VPYA 4QOGA 3HCRA 1N6NA 4HQ6A 1K8QA 5DBGA 1OI3A 1XQYA 2J85A 2EFJA 3H5NA 4HQRA 4A2PA 4C4XA 2LWIA 2P5UA 2VXCA 4QTUB 3ID6C 3JAWB 3S3TA 3GA5A 1JXOA 1PNOA 3SYLA 4QZVA 5JUWA 5K8VA 1QOQB 3L79A 4OHWA 4TMKA 5ECDA 3I37X 2FVXA 3I9OA 5E7JA 1KIAA 3TDKA 1TLFA 2C9BA 5FWAA 2J8ZA 3LWZA 3CH4B 4QM7A 1IXRC 3ZH9B 4N7RA 4J9UE 3JZAA 2GXAA 1ZJ5A 2REQB 4NCBA 4RA9B 2VHYA 5KYUB 2Y1OA 2II6A 2ZAYA 4J8PA 4YDRA 5TMEA 3VU9A 4ENTA 4CIBA 3CO5A 5H9WA 3W34A 2PRJA 3OT4A 2PUTA 2PZFA 3OY2A 1HE1C 4AG6A 4MHTA 1BC5A 3ELDA 1QH1B 3AESA 1YB5A 3VNUA 1L5OA 1BE6A 1IY1A 4NYIR 2CL7X 1YC5A 3A9WA 4E08A 4N65A 2C7QA 4R0NA 1NVWQ 4BMVA 4BU0A 4HB2A 5C8XA 1OW3B 3SJZA 1OFHA 4J9VA 1TZJA 2QAIA 3HRIA 3CF0A 3CSUA 5E2BA 4JQSA 3F49S 5AICA 1M0SA 3DF9A 5IMSA 2H1WA 2ZRMA 3IBGA 1LTHR 3L7DA 3EVBA 5AVZA 1WKBA 1HQKA 4ZT6A 5E6UA 4YRCA 1U4NA 3DD5A 4IOMA 1P7ZA 4AZVA 4ZAYA 3U44A 4QOFA 2YHAA 3RU9A 3TEJA 3PEWA 2VPZA 5A3JA 2JCXA 2J1LA 3KJQA 3ENZA 3GLGE 5ADWA 4DXHA 4OO3A 5GZ6A 5EIBC 5FAKA 3DT8A 1MT3A 3PBKA 2W11A 4HNGA 3S1AB 3OZIA 1ZD1A 3KLMX 5BUQA 4GOMD 3FMOB 3I0MA 1RWPA 1BH6A 1SOUA 4Z86A 3WWPA 3CLTC 1NX6A 3UMFA 1LLDA 2DVMA 3CF4A 2LKDA 4UFPA 2TMYA 4Q12A 1OYVA 1O97C 2MYNA 2HSDA 3C7TA 3QMVA 1N2CE 5TQ0A 3S2ZA 4GYYA 4HGPA 4DTIA 4DV4B 2WBLC 3JRWA 4D5GA 1ZR4A 1VMAA 4Y2HA 2O4UX 2NACA 4FCWA 3UB4A 1TTQB 4KX5A 1D5CA 4BBJA 4C5AA 3BJMA 4IR7A 5ALWA 2BMDA 1L7NA 2Y67A 1WMDA 3FFXA 4GICA 5EXTA 3DTYA 4M7RA 2W6PA 4FFWA 2HW8A 4C3OB 4FMDF 3U39A 2QLNA 2AOVA 4RUKA 4KWIA 4J0FA 3RS4A 3TTXA 4E12A 5IBPA 1V3TA 3OPYI 4P4LA 4JH0A 3F0TA 2QRMA 4YP5A 2P9HA 1T5HX 4IVRA 2PX4A 2AMVA 2OORC 2OWEA 3QKUA 2NUAB 1Z4IA 1YA8A 1ES9A 5L7YA 1CUIA 2HU2A 2V7QD 2JLUA 2AWNA 1BKDR 2HRQA 3L6BA 1NJ1A 2ZPAA 5E6SB 3OKCA 2H57A 2H29A 3K0BA 3KSZO 4FJ1A 4R1UA 1E5LA 3UVEA 3BL8A 3D6FA 3RASA 1W29A 5JLAA 5CEEA 3RBXA 2QAJA 4FYHA 4Z9AA 2PAAA 1BMDA 2V58A 3ANNA 3OQHA 2QLLA 3I01M 4D8WA 4NV0A 3REQB 4KV7A 3BIOA 1HMPA 3GZNB 3TPZA 3JX9A 4Z4GA 4QFBA 5EUBA 2WMOB 2GQ0A 4YNBA 1CQZA 4BMYA 1B3RA 3SAJA 4BO9A 1PJRA 1NMXA 2QVCA 2JLSA 3D2AA 1XU9A 2PH5A 3KB1A 4KQ1A 1K6EA 3DEAA 4MLDA 4CLHA 4F4HA 5ISMA 3BRWA 1CXZA 1LTKA 2BEUA 2BKAA 4YMLA 4PNHA 4QJ4A 1FTWA 3H4VA 3KEOA 1MN6A 2PMCA 2YRFA 4C2AA 4DCPA 4GI2A 2B2CA 2YN2A 4L51A 3CZRA 3GDHA 4AD8A 4NE9A 5AJZA 2BGLA 4O2BB 5CMLA 3MMPA 3H16A 4TV8B 4MP8A 5FA8A 3DNFA 4JB8A 1EESA 2WWRA 1OU4A 1VLVA 3A3OA 1H8ED 1YVRA 3CT6A 1Y81A 3UOGA 4BY9E 4XD7D 4UDYX 1G19A 1B42A 2BHTA 4MR8A 2GZ2A 4Q1AA 4PZDA 4R1MA 3WMFA 2VT6A 5K3CA 4RTKA 4B8ZA 1EUQA 10MHA 4KHPB 1GQRA 1KAGA 3V2UA 4YJKA 3B38A 3N7TA 2QD3A 2P77A 4BJHB 5JQGB 3DE2X 4W63A 3TSZA 3G2MA 3OBBA 4FZJA 1XMVA 2VA8A 3EBPA 5HM8A 1JQ3A 3L92A 1J90A 5EP2A 1RWWA 2ECFA 1JR3A 4UM5A 5TB5A 3R0QA 3OJ0A 1S7GA 3K96A 1E7RA 4RC9A 4Z7OB 1KU0A 3BN3A 1E3SA 2PUWA 4JNKA 3VKFA 5C46F 1YJQA 1RXCA 4W8OA 2XE6A 4DQKA 2Q3JA 3LRXA 1LSUA 4O4LA 2QX7A 4ND3A 3P20A 4ZJZA 1DXYA 3E81A 4PC7A 2BJWA 4LRQA 5G53C 3DEKA 4RACA 3ZCVA 1T8RA 4BGVA 3O95A 3A1EA 5B7NA 1G5RA 1CFZA 1YQWA 2O23A 3GLFA 1AZTA 2HJRA 3JYOA 2FPXA 5DT9A 2IS6A 2GZRA 3DNPA 1CULC 2I29A 4XTRA 2KBFA 2P11A 3OCZA 4Q3DA 1CUFA 1U31A 3OBIA 1FS5A 1ZVMA 3N6XA 4Z4CA 2B8WA 2M2IA 2WTEA 3T3OA 4P08A 5CG1A 3A4IA 3OQNA 1YUBA 2XAUA 2OFFA 4B7XA 1VL2A 1Q0SA 1T9ZA 3BMQB 3VR5H 2FNAA 2B5VA 3A32A 2OR3A 3OKAA 2Q4DA 5EWLA 4DDWA 1HT0A 2GD0A 4KVGA 2BGRA 3ERCA 3GVIA 1SRRA 5ILQA 2CHFA 2PKQO 3JATB 4AIIA 5JVDB 3ZDFA 1KR5A 1HSOA 1Q20A 1VKOA 3C7DB 3VOSA 4D99A 2PUFA 5F3WB 1FVOA 3ASYA 1OAKA 4O4IA 3II6X 2YZ7A 1W35A 1D6MA 1X7GA 3GCGA 1LPOA 3R5JA 5U4QA 4UQOA 1BQEA 1HE2A 3C3MA 1IY8A 2GKGA 2C5SA 4PY2A 2MMGA 4IV5A 1MW9X 3F2IA 1YZFA 4ZMRA 2XF8A 1A77A 3AFGA 1UT8A 4I4IA 5KSZA 1VE7A 2BZGA 4P3NA 5ALFA 4PZPA 1WVMA 3ZCSA 2FJUA 2HZ7A 2LZ0A 5AESA 5I3CA 3AVWA 1ID8A 2H4XA 1FLDA 3R3VA 4LCBA 1GV0A 2Q2NA 4ZI2A 3GT7A 2BR3A 3V9PA 1TUIA 4I36A 1WW2A 4NEGA 1H2EA 2V6BA 2ETVA 4PHTA 2GBFA 1NVXQ 3NR2A 3D3WA 1UKYA 3TYXA 4B31A 4NRDA 1HPLA 3AQ4A 4N76A 2CJFA 2G0TA 3A1VA 1W88A 1JU9A 3QXHA 4V0QA 3RGGA 1Y6GA 3SQXA 1IH8A 1KI8A 2PHZA 4M9UA 1TT5A 4X20B 1UEJA 3FWHA 1A9XA 2W48A 5EIEA 3JCZA 1ZCBA 3K8QA 3UUGA 3N39C 3SU8A 3GFBA 4BEWA 4HNSA 1NAHA 1QONA 4N49A 3WMXA 1TVCA 1CUXA 3RVQA 3U31A 5G3YA 3VHRA 3L0BA 3WNDA 4XPZA 5LIRA 4MGHA 1FRZA 4WJKB 1AKQA 1VE3A 5BN1A 2Z6UA 4GLOA 2OCXA 1AV7A 3CUTA 1EFVB 3LXMA 4CM5A 1DV2A 3WL8A 1SM4A 3AUKA 5AVUA 1XCBA 3NHJA 3W3AA 4AL4A 5C34B 4X6LA 4C0SA 1O96B 3DOOA 4ADSG 3IA7A 5IFKA 3JVEA 3P71T 3BZUA 4NAUA 1VL8A 4R40A 5F5NA 1E5VA 1KMHB 1Z6AA 3LAWA 3THSA 3SICE 5B4TA 1EGQA 2CXQA 2BMJA 3B82A 4QAJA 4EHKA 3BAZA 2GAFA 1O6FA 3SC4A 5G4KA 1LDNA 1DC6A 1SUWA 3GAFA 4LJ5A 5LYJA 2AKYA 4GP6A 1RIFA 3VYVA 4AJJA 1I0ZA 1P7VA 4ZWNA 3OZSA 4G56A 2CW5A 4AC9A 4B6QA 1FXUA 2ZAIA 3KJNA 3DULA 1K08A 1MEEA 1AVTA 4CIDA 2C2KA 2VUIB 2O19A 2VLIA 1QORA 4WXEA 4MROA 1AK1A 5JR3A 4WW0A 5DM2A 2ZRGA 4KQGA 4MR9A 2OV4A 1HKUA 1C3OA 1GP2A 2AT1A 1NURA 5JI3E 4Q7JB 3IP9A 2JA2A 3VPHA 1M8KA 5B58T 4G0XA 2HV8A 1T5SA 3OZVA 4PCVA 3G5LA 2ERXA 4V0SA 4J4TA 4C4SA 2DB3A 2ZUDA 1YQTA 2C20A 3M6WA 4Y6QA 2HRCA 2JRCA 3HCOA 3S70A 4N48A 5L95A 1V37A 1GN8A 1NXQA 1WVIA 4RGQA 4RIGA 4PLTA 1R9NA 3NEPX 5DYTA 4QDJA 1U99A 1CVLA 1WXWA 2NNWB 1E77A 2O0MA 3IAHA 3JQQA 3E7DA 5ER6A 5E0OA 3JS5A 2PXXA 4OG2A 1XROA 5G1PA 4QOJA 1T2FA 1E0DA 1EGAA 4AKTA 3NDBB 2RK3A 4RADA 5HBGA 3L05A 5CDFE 2IU0A 3GGDA 5J47A 2J31A 2WM3A 3I2JA 4F2HA 3Q3IA 1KBQA 4BUJA 4CQLB 4I55B 4Y30A 2DTDA 2R8RA 3IAM1 1IJFA 3BGVA 4L73A 4KQEA 4EQ6B 4RKQA 5T8KC 4JYAB 2ZJ3A 1HG1A 2WJIA 4HZUA 4HWPA 3I52A 3PQ2A 4D9IA 2HCRA 3EUAA 4EITA 1T4CB 3W5IA 2OLJA 1OWPA 3H4IA 3ONNA 1EXNA 1VHJA 3PPVA 4P86A 4TL9A 4A82A 1UAGA 3T0GA 3TXXA 3ZDEA 1AMOA 1D0IA 2VLBA 3FKQA 3TQFA 3EMKA 4QWWA 5IH7A 3SZLA 4LKOA 5DE3A 4Z4FA 3UM9A 2W6CX 3UAGA 1KA9H 4M9XA 5JXHA 2YQ5A 1KDRA 4LY9A 3QNWA 2HWXA 2F6RA 2CNDA 2EBFX 2FX2A 4OFZA 2DWQA 4RQUA 4JVLA 1T9GS 4ZXPA 1ISSA 1IPEA 4RMJA 1B26A 4IIDA 3EWNA 4BNDB 1W36B 4B6JA 4G1MB 4I7EA 4XM2A 4P0QB 4IIYA 4JOBA 4L8FA 2AKAB 4ZK6A 5CFRA 2WTUA 2PWYA 4JJZA 2BL4A 4PLCA 4QU9A 5LA6A 3SX0A 3RWMB 2HT1A 2AX4A 3WNBA 1XMXA 3RODA 1ARZA 1TO2E 2VQ3A 2YHSA 2Y0PA 5BVHB 3O82A 4D0LB 3RJ9A 1E9BA 4KXMA 4UE3S 3QUQA 1G5FA 4UW9A 2JGMA 4KKVA 1EVLA 3FA2A 3LO8A 4ZQHA 1HRKA 5U1PA 5F1OA 4GKKB 3MQ2A 5CG2A 1YFLA 1OIVA 2OCYC 2AI2A 2NPIA 3NKFA 3N5KA 4KUEA 4WFKA 2BI8A 1PNVA 4D6XA 1CIVA 1REQB 1IDN1 5BOVA 4EGCB 4PGHA 1MENA 4WK2B 3MF4A 2FEMA 1RC8A 5BUZA 3OP1A 1GNVA 5IAEA 4ZEXA 3V9AA 1Y7HA 3NWBA 3H2ZA 4RK5A 3TRHA 1J0BA 4QTYA 3LYAA 2R8YA 5IWCA 4FC7A 1OFUX 2BTQB 3EWAA 1YR6A 3Q7PA 1UMCA 3WK5A 1KXZA 4ZVRA 3KZMA 4FBGA 4B5LA 1F2DA 4DA6A 2QTNA 1CUDA 1H6CA 4YRMA 3X1ZA 3OZDA 2A5LA 3PUWA 3QQPA 4F5YA 3UY4A 2RHRA 3I9V1 5DIFA 3ZDAA 3CCBA 4LQ4A 2AEMA 5AUOB 1V1RA 2IEYA 4K26A 2XCLA 2ONJA 5LR6A 2QLMA 2Q5EA 4KIJA 4OBXA 1L9XA 4C5BA 2JFUA 4WNYA 1U81A 3C3WA 3ZWMA 2FZKA 4AS1A 2JJ8A 2ALJA 3AWDA 1BZYA 1JR4A 3OVMA 4AROA 2UYCA 1ATZA 2BM1A 2HF2A 2JW5A 3DLCA 3TIFA 1K4YA 3HTXA 4LXHA 3LX4A 1EFRD 2ZI9A 5AVRA 3R8FA 3FY4A 3H5TA 1KDZA 5ER9A 3DGEC 4OFWA 1TM2A 1TD1A 2CNLA 2UVDA 4BVEA 3T3IA 4L07A 1ISPA 4LHZA 4G24A 1WVGA 3WHIA 3UMJA 5IFLA 4M0EA 2X5XA 1XYVA 2WF9A 2Z2IA 1FLNA 2BHNA 1BFDA 2JAOA 2VYFA 5JSQA 5ECWA 5DM0A 4YCNA 2O8NA 2R66A 3E8XA 4WBNF 1FRQA 2WHXA 4AJPA 4DMCA 4H18A 4RK0A 2YNMA 3AIKA 3DUWA 3CR8A 3TQQA 4JC5A 1GPUA 1TUGA 1USIA 2CJWB 1LI7A 2WSIA 4N5NA 3LDAA 5IWAB 3RS8A 2CV1A 4Q3BA 3DEHA 4LVUA 4BQFA 1T35A 1DQSA 2WOJA 5CB8A 3IVMA 4R9RA 2VNHA 1CS4C 2GCEA 1NW7A 3OCXA 3HVRA 5SV2A 2HA4A 2IYWA 2FG5A 1RHQA 4NIMA 3JZFA 1HL3A 1DJPA 2ZI5A 4FDVA 5HE8A 4CL8A 1A88A 4AJLA 2IS1A 3QV1A 4UNQA 4RHTA 3ZUPA 3QLTA 2PSEA 4YAUA 3LVFO 3VFDA 4DLUA 1LFDB 1XCLA 1A71A 3T12A 4AQDA 3Q0IA 4BVKA 4E5NA 4JYZA 4OLBA 2CC2A 1OPXA 4NECA 3ETHA 5FA6A 1KE2A 3AOEA 3Q41A 1W52X 1UBTS 5AKHA 2GTHA 2X9VA 3RQIA 4TWAA 3R7WB 2R48A 3V34A 4B4UA 2VHQA 2TMDA 4HJRA 1XPOA 1G3IA 5GJCA 5DK4A 5E8RA 1M1YE 2A1TR 3L7OA 5TS3A 1FP2A 1W8DA 5J5VA 4L5CA 4E33A 4DQDA 2F3UA 2P9JA 4L4UA 4P3PA 4PAMA 3JYNA 1TXGA 4IAOA 4Z0PA 2EZTA 1PQWA 4LQDA 1EM8A 2JGRA 3LC0A 2EFHB 4JLKA 4XYEA 4KITB 2AZTA 1COZA 3AR6A 3UAZA 2ZSDA 3DHNA 2HDNB 3VGJA 4MI6A 4UTNA 3KT8A 3U2QA 4A4DA 3RT7A 4Z9BA 2I3BA 1T2UA 2WHPB 4J29A 1W85B 4JCCA 4ZIRB 2C94A 1IJBA 3TOCA 4JUFA 1Z35A 2GEJA 2IX9A 3NBQA 4JT8A 4LBZA 4Q4LA 5CNIA 1EGHA 3WJ2A 3TRFA 1Z4KA 2XTAA 4GHWA 4GOLD 1ZH8A 2C4VA 2RGXA 1QNFA 1GPKA 4RYDA 1M5UA 2O2ZA 4N5MA 4D4MA 3F7NA 4DQ0A 5DNUA 2ACWA 1RHKA 1Q91A 3IPXA 2GBLA 4IHJB 4BGIA 1P2FA 3R7BA 3SIXA 1FX1A 1ORHA 4LF4B 3L6CA 8LDHA 3MJEA 4L02A 3TJZA 4O0MA 1V16A 3C41J 4DLKA 2R6GA 4UMVA 4MEBA 1KC1A 1MB0A 4QFMA 3ZX5A 4DWOA 4P8RA 1FQJA 1DKQA 3LPMA 2FX5A 4X93A 1JXQA 2WF8A 4NZPA 1JXMA 1P2VA 4JLBA 1RAIA 2R86A 1CJVC 5TGZA 4UQLA 4U63A 5JSHA 5DSTA 1G9XA 5AKJA 2VPPA 5GONA 3E9NA 3SC3A 3AUTA 4ENPA 4JR1A 3O5AA 3UYLA 1QO7A 3X1JA 2XKAA 4PLYA 1OX4B 3PTZA 3T6KA 1CR4A 3WIUA 4Q3CA 1YRHA 4WZAB 5DRTA 3EFHA 3QVTA 3AERB 5DKFA 5JD6A 1T1SA 5DCWA 1TADA 2DUUA 5JCJD 3SHOA 5H0IA 2QQGA 3BMOA 5CGQB 1OB5A 5A5FA 3PWZA 2XDWA 1X8XA 3I3SR 4I5EA 2WFMA 5CLJA 2P9GA 1DHRA 2A84A 4XQ0A 4A0QA 2PQ0A 5AK3A 4BLSA 2PWBA 1LJLA 3ACCA 3KKQA 721PA 2HX1A 2D7DA 3LNCA 1VIMA 1ZMOA 4WKCA 1WBBA 1ORVA 2HMVA 3UHFA 4ENQA 4JJ6A 4UFOA 1OC4A 4CR6A 2O2HA 4Y0AA 5G02A 4UU0A 3IR7A 3RYHA 1WJGA 2F1RA 1SUAA 1UBHS 4ER0A 5BSHA 2NXWA 3LT1A 1P9OA 1V6SA 5CB4F 1VB5A 2BP7B 4BBPA 5IYZF 4KR0A 4UE6A 5MGBA 4M8SA 4XYLA 1U8AA 1X1AA 3TOZA 1Z0SA 3RFCA 4QVKA 5C4IA 2DP4E 3L1HA 5BPHA 1ZCAA 1FLAA 3BIWA 1WCIB 3R0ZA 3ETEA 1F51E 4UBIA 5JYCA 3GRPA 5K8TA 4OLAA 2K7ZA 3RVPA 3LWNA 2X9QA 3VJKA 3WK8A 1GR0A 2K2QB 4QUBA 2O6LA 4H0FA 1D9XA 5KYXB 1T9DA 4HMPA 1P1JA 3N2KA 3R3HA 4IH9A 1CF2O 3KZXA 4LG1A 1JWBB 1J0AA 3ASVA 1Y8RB 2PZEA 4BE4A 4DQXA 2NTJA 3GT0A 1HNNA 2QM7A 2QJRA 4MLCA 4B7CA 1IOVA 2XDYA 1TGVA 4PWZA 4C1NA 4N3GA 3U4GA 2B1RA 1AXEA 4JKYA 4E0BA 1ZQ1A 5BQFA 4LEIA 2B1IA 1DBRA 1G0NA 3BWEA 1QRUA 1UKVY 4FS8A 1EGMB 4P32A 1JFFA 3ACDA 3BF8A 3GJYA 5HX7A 2OLKA 4CF7A 3AKZA 4DSUA 3ECAA 3ZCQA 3B52X 3NUQA 3TNDA 2NTNA 4EJ6A 3IVCA 1EHCA 1J2YA 1L7VC 3LXRA 5B7GA 2R0QC 4PC3A 2BSXA 1RQNA 1RVV1 2H6EA 1PEDA 2J07A 3FPHA 4YS6A 5L6MB 1Q84A 3PPYA 5MFPA 3E9YA 3H42B 1JDNA 1TC1A 4IIFA 5AJUA 4BL5A 4JP3A 5IM4A 4EA9A 3N8DA 3ZNNA 4CI0B 5CVVA 5I8WA 3AXTA 2G5CA 2YZMA 3EGDB 3IKTA 4XFKA 4X84A 2E18A 1WTAA 3QSYA 1NIJA 1M7HA 4TLDA 2R79A 5AKKA 3PGKA 3L9WA 3BSFA 4TSFA 2JGKA 3KZKA 1OFTA 4CMKA 3AVVA 1S3SA 3GPBA 2OGUA 3GUZA 1TI7A 2YASA 2HMSA 2Q2OA 1Y7IA 4WA8A 4DLWA 1P5JA 2X2PA 5CJJA 1D0SA 3I62A 2B6HA 3K1AA 1MV5A 3W4KA 3OAAD 1NQWA 4OGKA 3V97A 3NGLA 2EVWX 2VP9A 2XE7A 1MIOA 2HMAA 2JHFA 3NTLA 1KDTA 1Z08A 2D2IA 5EE9A 1FP1D 1NVBA 2UZIR 3PPIA 1ODFA 5A5EA 2BFEB 1AN0A 2RK6A 3KL2A 3R9XA 1Z0DA 4QAQA 5CB6A 5A62A 3T5TA 3H2GA 1F8YA 1ZNWA 3PRJA 1TD9A 3FH0A 5HNKA 1M8PA 1V8OA 2JJ2D 3JALB 2HA7A 4OXNA 3VKWA 4B45A 1F1BA 2OPBA 2Z5FA 1TZBA 3TW8A 5JNRA 4Y7DA 3PQ6A 4UU8A 3RJ5A 3V46A 1G8MA 2WJGA 4OBBA 3ET5A 5AHXA 4REOA 4LIPD 1DTEA 1FC0A 2Q3DA 3EXHC 3F4LA 4UZEA 4YUAA 4V0KA 1W7AA 1WIWA 4UBNA 2ONCA 1RI2A 1M2NA 2I6TA 4G81A 3VXKA 2ZW9A 4OHCA 2SKEA 4C0LA 2QBYB 4JROA 3R5FA 4CUKA 1YKFA 4PX2A 4L4XA 1L4EA 3A4LA 1QPZA 1M8GA 2Z09A 2WA2A 3LCJA 4J49A 3TLXA 3K2IA 3W1WA 3CPSA 2GBLC 3ICCA 2ZVPX 4P53A 2EOAA 2FN7A 1A1VA 1NUPA 2OY0A 2Q5QA 4GGMX 1U8YA 4EJ2A 3ZKAA 3WMRA 3BJIC 2FN3A 4FGLA 1I7PA 4HDNA 2XUDA 4ND1A 5C0OE 1W59A 1N5IA 2XWSA 1ECPA 2I1WA 4YGXB 2FRDA 2JLRA 4QGBA 3S2EA 4DIKA 3Q8LA 3E2PA 1XLTA 1E2UA 4KO4S 4EFMA 3DOIA 1G64A 4NYIQ 5CH3A 5EJ4A 2B3TA 4QQRA 1TQHA 2IJGX 2R00A 5HQJA 3X1XA 3VHLB 3FNRA 2BFDA 5KVVA 3HADA 2QRVB 4LOAA 1R64A 3LP8A 3W2FA 3WHKA 1NR5A 1KRXA 3ME5A 3R6GA 1CLUA 5DBIA 1SXJC 1ACMA 7REQB 1PJ8A 3EIQA 4REQB 4L08A 1KKLA 4OSEA 5JAPA 3HY3A 3H1TA 3Q11A 5IABA 2I8LA 1N6OA 2AC4A 3IQFA 2IOFK 4ARZB 3QMMA 4L78A 3FCCA 1UOEA 1BVYF 2RKBA 3VNQA 4G63A 3RSOA 5K2OA 2R6ZA 1NPTO 3UZUA 3K0CA 2XYRA 1YQDA 5LBIA 2DPHA 2AW5A 1Z7BA 1FZQA 3K3PA 1NVVR 4G8JA 4OTZA 3PTAA 4BVFA 2VHCA 2IXFA 4HAYA 4DLPA 4UUNA 3PDIA 5GWXA 5K3EA 4I2NA 5FHQA 3NKLA 5K8LA 4R31A 3PQFA 5EJIA 1XD9A 4DMRA 1O94A 1EWYA 4IMPA 1T4MA 4D0SA 3SVLA 1AF4A 6GPBA 1CCWA 2Q2VA 1Y3FE 3O31A 3PEUA 1PVOA 2FY8A 3WB1A 2O7RA 4JBNA 3WHLA 3BX1A 2WSBA 3MGKA 1CUAA 1PDVA 1LC3A 2RBEA 4LYHA 3P9RA 5BO5A 4HLDA 3N75A 2FW6A 2X7HA 3NCTA 4J3FA 1ZM9A 1CEXA 3O74A 5IN5A 2O50A 3PENA 3B3FA 3QU9A 3FUXA 3EVCA 3A1DA 2OXIA 1LZKA 1DPGA 2FUG6 2RONA 4EMBA 1I6LA 1H0SA 1Q1QA 3ZWPA 2VZ9A 3GJRA 4J6FA 4XUGB 5FUVA 3RVLA 2CXOA 1V4VA 3H4MA 1JP7A 1NOJA 4YDHB 2CMGA 3U17A 3VR2A 4DBZA 4LSGA 5H3CA 1Y4SA 4HH1A 2IU4A 1H6DA 3AEXA 1WKCA 4X44A 3Q3EA 3QITA 3WWEA 1ZNZA 3PI6A 5DHPA 4JUDX 4LJ9A 1G8JA 1GXSB 5G1OA 1Z5VA 3KYCA 3DV9A 1KK0A 2WTXA 1UKEA 3S68A 5KHAA 2PGIA 1ULSA 4DPKA 1Q11A 1QCDA 2R7NA 5LU8A 5CX1B 4M86A 2UDPA 5DVZA 1XO1A 1QM5A 1KVTA 2WVHA 2ERCA 2COUA 4J16A 2Y4NA 5F2EA 1E9AA 2OV2A 1HDRA 1NBMD 3DBOB 4PC6A 1RQLA 2HJGA 2WAMA 4LOHA 5CJPA 4ZV7A 4L3OA 1JU3A 3RIMA 3QA3E 4IUCS 1GSIA 4FHDA 1P1BA 5F9MA 2B7BA 1PX0A 4EY8A 1BQ4A 2QRGA 1EHYA 3WLQA 1R5BA 3AWIA 3GXBA 3O4HA 5HM6A 3F6BX 1V96A 3CUYA 5F7OA 3DE3X 3E9ZA 1IY2A 3MS7A 2A78A 3QVKA 3RJTA 3N2LA 3T34A 4BC1A 1EFDN 2EKPA 1ZOPA 2BHRA 5CW1A 4L5YA 1WUJS 5LUBA 1UJBA 2Y05A 1MXHA 4BNNA 1TAUA 2J0VA 4R2HA 2PANA 1XF1A 2VQ6A 4D57A 3AR2A 2HLNA 4XWOA 1NC3A 1KYXA 1PJSA 3NEYA 4OJNA 2EJCA 3AIMA 1G60A 5CT8A 2PZBA 1L5FA 1S4MA 2C1ZA 2AFRA 2AOXA 2WUWE 4O4JB 1NF8A 4EUSA 5H1YA 5SICE 1P4RA 4P84A 1FJXA 2ISQA 1SJ9A 4MTCA 3E3OA 4KE6A 4QQNA 4M21A 5TC4A 3SEFA 3QXJA 5JDCC 4KMSA 3W6NA 3FYSA 1T1EA 3INNA 4KQJA 3P45A 4R1QA 3VRHA 1ETUA 4BFWA 1IM8A 3BGDA 4GZ5A 4HS9A 1W48A 3N74A 3IS3A 1QIEA 3PZRA 5CVEA 2XT9A 1CYEA 3G1WA 3QPDA 4MV9A 4ZVQA 4UOQA 2H7VA 4FYIA 3B5EA 4RDHA 1AG9A 4NESA 5CBPB 4NU0A 1D8TA 4DF3A 3HXPA 1RJWA 3MYYA 3QLJA 5ICFA 2EFYA 2IDKA 4IF4A 5CGZA 2O0KA 2XLCA 3CLRC 2V98A 4JP5A 4LZZA 2C42A 3C6BA 3KYIB 4R8MA 4NBTA 1DEKA 4RHCA 4NFYA 1Q2UA 4LFBB 1WEHA 3JQ6A 1FDTA 2BMFA 4KI7A 2XCQA 4K8OA 2PSHA 4IHAA 4A8TA 4D56A 3SEAA 3ZQJA 5H8WA 1P91A 4K6KA 2JASA 3GMDA 5HBRA 2HSJA 4Y9TA 2C8LA 5J43A 3WV4A 3DLBA 2VDUE 5F76A 4IIVA 3T41A 3JQ7B 3GP3A 3ZWVA 1FW6A 3T35A 3IIIA 2I7CA 4PZZA 5ESWA 2P0EA 3Q7TA 5IU6A 4ZQFA 4B2LA 1SELA 3ROXA 4EECA 3KAJA 3RDPA 2WSLA 5K6RA 2XMCA 3SKXA 1L5GB 2P9QA 3GGGA 2ZXFA 1RS0A 4C7MA 2EAUA 1SFRA 1CZUA 2YIMA 3GQBB 1SG9A 5JC8A 5A0TA 1GTJ1 4IEIA 5LOVA 2VJNA 5F3RA 3JVDA 3PGXA 2OQIA 3UMGA 5CA0B 2ZE6A 1DQYA 2A88A 3CVXA 1TRHA 2C2WA 2VUHB 5LB2A 1JSXA 1Z3IX 3AI3A 1EXMA 4N82A 3T3GA 3UK6A 4DMMA 5B1EA 3AONB 3CMMA 4KXWA 2CHVA 1JDVA 2XUZA 1QH9A 3FFTA 4Z0NA 3ETCA 2M6KA 4PM4A 2VSXA 2X86A 2YCBA 3DDSA 3ZWXA 4R6XA 3ZJ4A 1L4HA 3I53A 4X8HA 1ZRHA 5DYYA 5GGYA 5H82A 2Q3EA 2XDQA 4G9EA 3N0RA 4WZAE 5IAJA 3UKOA 3PYLA 3E5MA 5LU9A 2V7GA 3KB6A 2D59A 4XIGS 3WDSA 4YTEA 3KKLA 5F7XA 5C1BA 2P0AA 4FSHA 4PGFA 1WP4A 4NBVA 5DX1A 1UIRA 1VKZA 3HCEA 3VR5A 3CH5A 4URWR 1G20A 2IXBA 1IATA 2VS1A 5EQJB 2HIGA 3WSWA 3IAS1 3PC2A 5IW8A 3Q3JB 1B8UA 4G1VA 4GPD1 3QFFA 4XVQA 1Q3TA 1XZKA 3UOAB 3ZCUA 7MDHA 2IHNA 2A7XA 3FZQA 2DXIA 3WYBA 1OAOC 1SXHA 1A27A 1DINA 2D1SA 4RHFA 3FRJA 5AVQA 3S8EA 2UUOA 3TCNA 2OWDA 4V0ME 1BNCA 5CYOA 4LBVA 4EKNB 1IULA 2VTBA 1U5BA 1QDLB 3CUEF 1VKNA 3LG2A 4NJMB 4U2DA 4YUWA 5JNWA 1YIOA 3HMQA 4IPTA 2BEVB 1JTVA 2WNHA 4XIFA 4QBFA 3GLGA 3EX7C 2TRSB 5HGJA 4EIWA 3GLHA 4Y1RA 1N0HA 1IHOA 1RLOA 4OHUA 2XECA 4F45A 3BRWD 1XG5A 2R6FA 1KJYA 2BUBA 1ZK4A 1K4MA 5FNVB 1PZEA 2YCLA 4AKSA 3DL0A 3EH2A 2A5YB 3B70A 4MMXB 2MMCA 1WXHA 1XJ5A 4WCVA 3W5HA 1Q7GA 4CMJA 4EA6A 5CXUA 3A27A 1IEQA 1N2CA 4B4DA 5MN6A 4QYMA 1BVUA 1K6IA 2X22A 4RKEA 3TAXA 2C7PA 4M1OA 3X44A 4G4IA 5ALPA 2Y3IA 2PWZA 2M98A 2PLWA 1RC0A 4FHEA 1FP4B 4C4AA 4R2WA 3LQYA 3VMFA 3IEXA 4EZIA 3A2LA 5KSWB 4EJMA 1YNOA 3C3CA 4QPJC 3QZUA 3H9UA 1WZCA 4FHFA 2I8AA 5ESXA 1B93A 2J67A 3RGWS 3JYHA 3PT5A 4MXDA 3CU5A 2B4QA 3J81k 4PO1A 3ZC3A 4RPHA 5KJ1A 1JR3D 3WMGA 3PXGA 5JZBA 1AZWA 1KEWA 2LUOA 4RBNA 5KNBA 3N8KA 4KR9A 3ANYB 4AJKA 2NP7A 2RC5A 2GCPA 3F90A 2N3ZA 2Z95A 4HB3A 4C21A 4DCGA 3PC4A 3BCHA 2RGCA 1CS0A 2XE8A 3JQRA 1VJRA 3V4LA 4A03A 1TNDA 5FBZA 5A4AA 1XX6A 2EWVA 3IOMA 4U02A 2UUAB 2J48A 5HMMA 2W22A 2PMWB 2R6HA 1KZ9A 4QG3A 1Q0ZA 5DX0A 4HMQA 1K6MA 1GQQA 3M8KA 4FZVA 1BYIA 3TN7A 3QEAZ 3C3DA 4GPZA 1R12A 4DUPA 4Q5IA 2ZWMA 1WCWA 4PU0A 4C7XA 5EINA 4ROTA 2PKQP 2HFJA 3RC8A 1KY4A 3P9IA 1HDCA 3Q1LA 2Y6VA 1QH8A 3TG8A 5JS2A 2IEGA 3C3EA 3DC2A 3BFPA 5I8ZA 1M6WA 1PL8A 4M99A 3GT4A 2ZWIA 5FI0B 5KOJB 4CN9A 3PKZA 1BEZA 1SQ6A 1K9SA 3FRIA 3GARA 3UJAA 2G25A 3ZG6A 2J6HA 3O3CA 5B1HA 4TWZA 4QTZA 1SBNE 2JLZA 4WXPA 1GTRA 1JFTA 3K0KA 1WXGA 1AHHA 1PGPA 4ZHSA 4RZ2A 1FDUA 3PE4A 2O8BA 5CHYA 5BW6B 3TZCA 4F0JA 3D7NA 1EXDA 2I99A 3IE2A 4WN3A 1T36B 1EEXB 4B6GA 1E79A 2FEWB 2BGWA 3VV2A 3WOVA 2VHTA 1IBSA 1K5GA 2Q1SA 2XMRA 3UBTA 3ZVKA 3FNIA 4DYVA 2AEEA 2NUPB 3FGZA 2F9LA 5COAA 1SKQA 4O2RA 4PF1A 2W98A 5DNAA 5C35A 3S7ZA 1E6EA 1P0CA 4RXUA 4Q9AA 5JO0A 1T2DA 1G42A 5K3FB 1CY1A 4G0VA 1E9RA 1B23P 2PS0A 3HVKA 4I9UA 2C2BA 2HJHA 1LSOA 2PCJA 5C8YF 4RTRA 3ZGZA 1YDFA 2A1TS 1Y5IA 1E6KA 1VE9A 3ILYA 2CXHA 1SKAA 4FZRA 4MS4A 1MC5A 1VP3A 2G40A 2VAWA 3UK2A 4QKQA 3CSDA 1DFIA 1ZUNB 5CP8A 2JFFA 3Q9UA 4WCFC 2H1OA 1QLWA 1KO4A 3ZYCA 4LECA 1E60A 1L0BA 3LX6A 4PYIA 2I2BA 3GRKA 3IPYA 5KWSA 3HPRA 3Q6IA 2CSUA 1E9VA 3BE4A 3JYPA 1DAHA 2D13A 3DBHA 2HCTA 1X9GA 1KMCA 1X7WB 3KHUA 5AJTA 2X4DA 4YYEA 4EUEA 5C81A 1E2KA 1IHDA 3JD4A 2FPIA 2JATA 3JWHA 1B8VA 1IHUA 3L02A 2AVNA 3PC7A 2EQAA 2FLKA 4MUGA 3TQRA 3ZWAA 3E3NA 3C3BA 3VH1A 1NW8A 1L5MA 1FFDA 1RZ3A 1WUHS 1ZCZA 2C61A 3OPVA 4FSXA 2P91A 4ZTBA 3PQCA 3W3AD 3U7RA 2XBLA 2CFRA 4NLLA 4A8JB 4P4UA 4DA0A 1SU8A 2A0UA 2WYIA 2Y76A 4JNCA 1RYDA 2QTLA 3C3XA 3BWVA 1MO3A 2QGNA 3U7FB 1NLUA 4C7OA 1V5WA 4MV1A 4TMYA 3WP1B 3MQ4A 3K71B 4AS3A 3CNHA 4KH0A 3AV0B 3BRSA 1RJDA 4OK6A 1D8AA 1ZW6A 1AUVA 2ZTHA 1SC6A 3LKDA 1HNWB 1QP0A 3EPHA 4PLFA 3LHSA 3D5TA 5DBHX 4Y18A 4BBAA 5EQFA 4CLDA 4XCXA 1HZJA 2GM5A 5KKNB 1YBAA 4MW5A 1YS7A 1I0LA 1JHYA 3E15A 3FJ1A 3RTCA 5THQA 4WNAA 2IF2A 1KO8A 3BCRA 3AR5A 4GPBA 1MAVA 4BMOB 1L5HB 1SY7A 3IVRA 3KXIA 1NLZA 1VPVA 1NKVA 5ILOA 3DEZA 2M6RA 1U3TA 2ZJ7A 3LM8A 3JQAB 1WUKS 1SHTX 4G1BA 1G98A 3I1FA 1R8JA 2IHTA 3IHTA 2FFBA 2CZQA 4PXSA 1OB2A 3K7EA 3MC1A 4R9SA 1W8IA 4GYWA 2WJAA 4H3VA 2GH1A 5DCLA 1KEPA 3DDNA 5FOWA 2CVPA 1S2OA 4HHEA 4OA5A 5CCDA 1KHTA 4D97A 1N33B 2YHIB 3H9GA 4L16A 4WDQA 5BN4A 3G2QA 3ILXA 3NB0A 4KE7A 2LE0A 4LYJA 2XMQA 2Y0BA 3GUCA 5IMBA 3ZLUA 4EYQA 3PX7A 1FS4A 1J0XO 1O57A 2FRXA 2MHCA 5FWYA 5DU2A 1JXAA 3NOQA 4R2KA 1ENZA 1W19A 3ORQA 5I7RA 5HOQA 1DQPA 2Z8YM 4HY3A 4LHYA 5KNCA 3E35A 5EMJA 2NXNA 3PFKA 1E2PA 3GUYA 3HBJA 3P9YA 2RGNC 4HX2A 1KQNA 2QTRA 3KG2A 4PQGA 1J5EB 3PJDA 1PK7A 1UMBA 3PFIA 1CY8A 1VI6A 3R8CA 2PNFA 1FS6A 2H4ZA 1XI2A 4HXYA 3AM3A 1ZBQA 4U0KA 2VVTA 4B7UA 1BW9B 3B5IA 1BCSB 3NHWA 2Z83A 1PZGA 3H65A 1JNYA 1SBZA 3OF5A 3NNSA 2MSNA 4N7JA 3BGIA 1FX0B 2F1IA 3GVCA 4YP0A 4TVKA 1TUBB 4WNCA 4OQNA 1DG1G 4LJ7A 3MB5A 4LYGA