3ZQLA

Dna-bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
236
structure length
236
Chain Sequence
VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Tetr Family Transcriptional Repressor Simr Bound to DNA and the Role of a Flexible N-Terminal Extension in Minor Groove Binding.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Protein-dna complex
molecule keywords PUTATIVE REPRESSOR SIMREG2
total genus 85
structure length 236
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3zqlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3zqlA02
5FKOA 2YU9J 2DMNA 3BR0A 1U8BA 1FEXA 3PM1A 5BNGA 4HKUA 1WH7A 1MBJA 1H89C 3O60A 2NP3A 3VVXA 1APLC 3S15J 2JN6A 2M0CA 3VUQA 3GTKJ 2KT0A 4YZEA 3HE0A 4NN1A 2EZHA 3A01B 4DYCA 4A3IJ 1RPWA 1VNDA 1A6IA 5EF6A 1ZGWA 1JKRC 2GBYA 1NK2P 2WGBA 9ANTA 1AHDP 3HTAA 2TCTA 2PMZN 4JX5A 1TWAJ 3RKQA 3DPJA 4M3DA 2WB1N 3OIOA 3NNRA 3LSRA 2YVEA 2JA5J 3C2BA 5CW8A 5IP9J 1EF4A 4UUSB 3NARA 2MGQA 4V2FA 5J1YA 1YRNA 1W0UA 1GUUA 1T33A 5E3OA 1WI3A 4BBSJ 2UXUA 3BG5A 4JYKA 2OF7A 4XIDA 1IDYA 4AF5A 4AC6A 5J3LA 2G7SA 4L5EA 3Q0UA 2JJ7A 2HOSA 4B3AA 2LR8A 3GTMJ 3OSGA 2EZIA 2KDZA 1W0TA 3ZQLA 1HOMA 2UXOA 4GCKA 2L9RA 3BT9A 5EEAA 2QWTA 2VKVA 3HIMA 1JKPC 2L7MP 5IOZA 1F43A 1IV6A 2Y30A 2DA2A 4A93J 2GUHA 2LY9A 2R5ZB 5FHPA 2MG4A 2Y9YA 3JRBA 5F04A 3BRUA 4GCTA 1QRYA 3HBLA 2EH3A 2R5YA 1E3OC 2ZOZA 2XPWA 5M5XJ 2VI6A 2Q24A 1VF9A 2X6OA 2FBQA 1RETA 1MBFA 4I6ZA 3ZOBA 3E7QA 2LD5A 1UI6A 1ETYA 1GV5A 2QCOA 1FTTA 4ME9A 4XRMA 3BCGA 3FK6A 5EZGA 3V78A 2RASA 3B81A 2E2JJ 2N8GA 3B6AA 1RKWA 3Q3SA 2HXOA 2LTPA 2XGEA 2NVTJ 3M4OJ 1IRZA 2LP0A 4GFBA 1IDZA 5FKMA 4AUXA 2FD5A 3VP5A 4A3JJ 2ME0A 4A3FJ 4GFKA 4B1RA 4MFEA 2M8GX 5HBUA 5DS9A 4D7NA 4QTRA 1RKTA 5K7ZA 1PUFA 4BKXA 3BR2A 3JREA 1TWFJ 4M3FA 5C3EJ 4JNNA 2NX4A 1TWGJ 2Y31A 1JGGA 1Y1VJ 5FKLA 5F0FA 2XGCA 3DEWA 3S2HJ 4GFLA 4RDUA 4IHXA 2M34A 3GTLJ 3JRAA 1I3QJ 3H0GJ 5F0HA 5F1JA 1JUPA 2HKUA 2WUIA 5EGOB 4A3CJ 3CMYA 3RZDJ 3S1NJ 1XC5A 3IH3A 4XRSA 4I76A 2XB0X 2DMTA 2GM4A 1P7JA 3QBMA 4FE4A 2UXIA 1ZQ3P 5M5WJ 2K40A 4FISA 2M2EA 2LKXA 2O9LA 3Q0VA 4NELA 4DZPA 2CJJA 3HOYJ 1GVDA 3CQZJ 2R0QC 1AKHB 3G56A 5K58A 2R92J 4S0HB 3SDGA 3VVYA 4A3MJ 2UXPA 3MVPA 3NI7A 5M5YJ 5F0CA 4DZJA 1T56A 2ZOYA 4A69C 1MBEA 2K9QA 4BY7J 5FJ8J 4ICHA 4V2GA 1XS9A 5CXGA 2XDNA 4M3BA 3QQAA 4Y7NJ 3OOUA 2HOTA 3ON4A 2X48A 4FCYA 1ZTRA 1XG1A 4MXMA 1ETXA 2QOPA 2HQ5A 3O8GA 5E3MA 5FKKA 3HTHA 1BJZA 5IOYA 3S14J 3ON2A 3S17J 3ANGA 1UG2A 2B63J 2G3BA 1LFUP 3HOUJ 4MO7A 4AYBN 4M3GA 3JRHA 2IBDA 3G1LA 4C3JJ 3CJDA 2XSDC 2DMPA 3LNQA 2ECBA 5J1UA 2ID6A 4RBOA 2E2IJ 4DYQA 2LK2A 3BR3A 2EQRA 4B4CA 1VFCA 1QVUA 3TEDA 1MH4A 1NTCA 4IHYA 2QIBA 2ZCXA 3P9TA 2UXHA 1ITYA 3JR9A 4A3LJ 4MIMA 1B72A 3BG9A 5IYDJ 2LVSA 2Y0SN 4M6VA 4DYRA 3L1PA 1DU6A 4UDSA 3HGGA 3VOXA 4ACIA 3AQTA 3MNLA 3RH2A 1ETOA 1OCPA 2JWTA 3HGYA 1MSFC 2DG8A 5CXIA 2O7TA 3M3YJ 3KZ9A 1OJLA 4A3DJ 4W1UA 3FIWA 1X58A 1IJWC 5FGLA 2FQ4A 5D1RA 2H8RA 3BTCA 2JMWA 2FX0A 5FLVA 2R7ZJ 3BTJA 2IEKA 5IYCJ 5C4XJ 4BBRJ 5EG0A 2NS7A 1H88C 5GPCA 4MK6A 4PXIA 3HOVJ 1U78A 5C4YA 4CYCB 5EG0B 5E3LA 4CYCA 3ZQGA 1Q1VA 1ZR4A 3OSFA 3GTQJ 4M3EA 4JX6A 3T6NA 4ABZA 4JKZA 3K7AJ 3BHQA 2CUEA 3GTJJ 2O7OA 2TRTA 4A3GJ 1HDPA 1AU7A 3JRFA 2ELKA 3HOZJ 2RHAA 3COLA 4JX4A 2LFBA 2MW8A 3NRGA 1RESA 5AQCA 2R5YB 2HXIA 4QSHA 3GTOJ 2JA7J 3G1MA 2D6YA 1X2MA 2DA5A 2G0EA 3LSGA 3QPSA 5EGOA 2ZCMA 1LE8A 5EDNA 1MSEC 2PZ9A 4C2MJ 2PBXA 3FKIJ 4JL3A 3GZIA 5IP7J 4UUTA 1NK3P 1TC3C 5H9TA 1AKHA 1Z0XA 3BTLA 1ETWA 4BXXJ 3VVZA 1IGNA 2OPTA 4AC0A 3I4NJ 3TP3A 1YRNB 1QPIA 4A3BJ 3A03A 4LOCA 1A5JA 1BA5A 5HSZA 5M3FJ 1JTXA 1TWCJ 3UKGA 1GT0C 2CRGA 3BQZA 2DJNA 2R93J 4QIWN 2XPUA 3H3VK 3ZQIA 3SFIA 4L62A 3ANPA 5EFYA 5DAJA 3PO2J 3KKCA 5HAWA 3JRDA 2K9SA 1MBHA 1ENHA 3D1NI 4IHVA 2E2HJ 2VPRA 3PASA 2L7ZA 5JLXA 3JRGA 3G1OA 3JRCA 1FTZA 2JA6J 3EUPA 1MBKA 1FIAA 3JSJA 5M3MJ 1ORKA 3JRIA 3VIBA 2AO9A 2DA4A 1TWHJ 3VW1A 2MSYA 2CQQA 2R5ZA 3LSJA 1UMQA 2DA6A 5F08A 2EBIA 1X2NA 5F27A 1QVTA 5IYBJ 1BL0A 2E19A 4DW6A 5D19A 2W48A 2DTZA 1SGMA 2XRLA 3TW6A 4XICA 3VW2A 3K2AA 1CQTA 1WPKA 3BTIA 3QKXA 3NXCA 2EZLA 3A01A 1IC8A 1JT6A 1IUFA 3CCYA 1ZR2A 3IH4A 3ZQCA 3LOCA 4W97A 1G2HA 2CU7A 4NDLA 3BJBA 3F1BA 2QKOA 3CRJA 5HODA 2NVYJ 2VKEA 2DG7A 5K7HA 3AQSA 4IEJA 1POGA 4UUSA 4BY1J 3C07A 2ECCA 1SANA 2P81A 3SJMA 2NOGA 4FTHA 3HDDA 3S1MJ 1HF0A 3RZOJ 3BR6A 2AHQA 3BR5A 1GDTA 2E1OA 3LSPA 5FKNA 4XRSG 2Y2ZA 2JK3A 2ZB9A 4CGRA 2L7FP 3MKLA 3S1QJ 3V6GA 1GV2A 1VI0A 1B8IB 1OCTC 5GPAA 1LFBA 1B72B 3IH2A 1S7EA 3VOKA 1D5YA 1B8IA 2COBA 2RAEA 1K61A 3GBGA 3ZQFA 3KKDA 1UHSA 3WHCA 2IAIA 3BR1A 3I4MJ 3CWRA 2GLOA 3ZQHA 1LE8B 3E7LA 2G7LA 1UI5A 1JUMA 2DMUA 3HTIA 3LWJA 3RD3A 3DCFA 2V57A 4EEFG 1ETQA 3VPRA 1RR7A 1MBGA 2OI8A 3HKZN 3NAUA 3F0CA 3GTPJ 3FK7A 3O8HA 5IP6A 1JKQC 1IG7A 3S2DJ 5GP9A 1Y1WJ 1F36A 4XK4A 3PPBA 4KWAA 1JJ8C 2QF7A 1WGXA 3HOWJ 1HCRA 3LHQA 1SFOJ 2IU5A 4J19A 1FIPA 2I10A 3IUVA 2XB5A 4X6AJ 2M9HA 2F07A 2W53A 1ZK8A 2CQXA 2DMQA 3WHBA 4MLOA 3A02A 4HNVA 2WAQN 5JLWA 1DU0A 1I6HJ 2OERA 1JTYA 5D18A 2H1KA 5IPAA 3W6VA 3VW0A 1O4XA 1JT0A 4D5CA 3TW7A 2O8KA 3LJLA 1I50J 3FISA 1JUSA 4GCLA 2CUFA 3HEFA 3RQIA 3B6CA 4FE7A 2FJ1A 2LLKA 2YUSA 3QPLA 1MNMC 2EZKA 1R9TJ 2DN0A 4MFDA 2HI3A 1HDDC 3FRQA 3S1RJ 1JKOC 5FMPA 2JA8J 3G7RA 1K83J 1BW6A 3EGQA 1ETKA 2G7GA 3TP0A 2ID3A 1BW5A 2WV1A 1JJ6C 2NVXJ 1U9OA 1WCMJ 3GEUA 3BG3A 2DA1A 3KNWA 2YS9A 2Y9ZA 1MH3A 2XGDA 5DTDA 5C44J 3HB9A 3BNIA 4C3IJ 2HYTA 4IHWA 2ZCNA 3GTGJ 1WH5A 3IV5A 3HOXJ 3Q0WA 2QTQA 2XPVA 2VUMJ 5FLMJ 5E3NA 4C3HJ 5EYRA 3HM5A 3PO3J 5EZHA 3BQYA 2HOAA 2REKA 1ETVA 1P7IA 5J1RA 2D5VA 4D7MA 3S16J 1ZKGA 2DA7A 4Y52J 2YVHA 2NP5A 1U9NA 3CDLA 4JP0A 1HLVA 2HYJA 2X9DA 2ME6A 4D5FA 3HTJA 4X1EA 3S5RA 2NS8A 4G12A 4A3KJ 1Z77A 1OFCX 5K7FA 1PUFB 2NVQJ 3MN2A 2DA3A 2GFNA 2L0KA 3NPIA 1H8AC 1FJLA 2K9NA 5C4JJ 4A3EJ 2GENA 2HDDA
chains in the Genus database with same CATH superfamily
2OCCH 5EEGA 2I5UA 3BJOA 3QU3A 4CDGA 5B66C 1Z91A 5CKTA 3L2WA 1IRXA 4G7HF 1FEXA 1X1DA 4B3XA 5AIQA 3WTTC 1TQMA 1WH7A 3O60A 1O3TA 1FMVA 2OU2A 2DK5A 4L5IA 2KT0A 2EIMH 2HZTA 2RV8A 3A01B 4DYCA 1ZGWA 4KFCA 1H9TA 5H20A 9ANTA 2WB1A 1KONA 2WV0A 4WXDA 3CP8A 1TWAJ 3DKWA 3R61A 4JX5A 3RKQA 4IX7A 4BU2A 3OYMA 2BE5F 3OIOA 3LSRA 3NS4A 1KYZA 2E7XA 4FASD 2EJRA 1KQ0A 1W0UA 5HDNA 1T33A 1WI3A 3BG5A 4XIDA 1IO2A 2DT5A 1JI8A 5AIPA 1WJBA 3C3WA 1Z21A 5DYMA 4AC6A 3R60A 5J3LA 4L5EA 4CCJA 2LR8A 3CJRB 4XMYA 4BXUA 2UUZA 1Y6IA 2UXOA 2VOOA 4PK4A 4GCKA 5E79C 3EDPA 4DNCA 3KP5A 5IOZA 1E2XA 4XLPF 1VQ6I 5BS6A 4A93J 1FPQA 3ZMUA 4YG2F 2LY9A 2R5ZB 2MD0A 2OC6A 4AIJA 5FHPA 2MG4A 3JRBA 3BRUA 1F4KA 2KJCA 1W36D 3SWHA 2ZOZA 3KP3A 2F6CA 1X19A 5B3SH 2XPWA 2Q24A 3EUAA 4GYGA 2QQAA 2W25A 2DFFA 4ETSA 3SZPA 1SFKA 1RETA 2NXNB 1MBFA 5H6QA 3IP4B 5FFZA 2LD5A 2E5NA 3DTEA 2ZBKA 1FTTA 1OYYA 2QCOA 5DUIA 4XRMA 4OD4A 2P5VA 2QBYA 1JGSA 4XKVA 3RPQA 3CZ6A 1SAUA 4PJ0C 2CYYA 2CW8A 3M4OJ 2J5OA 2MC4A 2RDPA 2M87A 1O7LA 2EILH 3QAHA 1U5TB 4XOTA 3VP5A 1ZGAA 2ZXWH 3K4KA 1YJWI 2EFPA 4A3FJ 2IS6A 4B1RA 4U88A 4MFEA 2Y69H 4QTRA 3RCOA 4M9SA 3J80K 1RUNA 4RGSA 3U1DA 3JREA 4HSTA 4JNNA 3KYLA 3LAJA 2NX4A 1TWGJ 2OUMA 4XLEA 2LREA 3KLNA 2DW4A 4BDZA 4GFLA 2FRHA 4C9YA 1AWCA 5IT9Z 2P6SA 4RMNA 1W1WE 2XUBA 4AD9A 4KYWA 5F0HA 2Q0OA 1SD7A 2HKUA 3L9FA 3CMYA 1W5TA 1XCVA 4XRSA 4LJZF 1HKTA 2FE3A 2XF6A 3KP4A 2DMTA 4MNUA 5EJCA 2GM4A 1P7JA 2W24A 4HX4A 2OTLI 1SD5A 1ZYRF 3HRSA 4II3A 2HDCA 1SEUA 2DXIA 1T0FA 4NELA 3GCMA 1IUYA 3DU5A 2HYGD 1ZRFA 3F8BA 2R0QC 2LF7A 3BZ6A 3D5RC 3O6BB 1BC8C 3W6KB 3VDXA 1MGTA 4UNOA 2R7FA 1HW5A 4WF2A 2FA5A 2LRDA 5L3GA 2MLKA 3CJQB 4BE1A 4Q47A 1SVOA 4DZJA 3MWMA 4A69C 3DF8A 3K2ZA 4V2GA 1XS9A 3ON4A 3C18A 1XG1A 3BC8A 3S14J 3ON2A 1YJ9I 3ANGA 2XDVA 1WJEA 3E5QA 4MO7A 3JRHA 3ROUA 2BHYA 2IBDA 2FEZA 3G1LA 4NHJA 1UELB 2ZY9A 1LDDA 2ECBA 4RAYA 5J1UA 4RBOA 1UAAA 2BGCA 4EJVA 1U3EM 1GXPA 2EQRA 2VBZA 4L9VA 1YLFA 2WTEA 2UXHA 2KP6A 3S2WA 4A3LJ 5J40A 4XLAA 1XDSA 3WU1B 2Y0SN 3M8EA 4M6VA 3CCUI 3L1PA 3F22A 5IYDJ 1DU6A 4UDSA 3VOXA 2DG8A 3M3YJ 1S9HA 2G9WA 3CF2A 3FXUA 3E6MA 2NS0A 2O6GE 5KVRA 3L7WA 3H3UA 5FGLA 2FQ4A 5D5XB 2EV6A 1N77A 2IGMA 3BTCA 2JMWA 5L3BA 1R4NB 2FX0A 4OOIA 4CHUA 1IN6A 4BBRJ 2KKOA 3ZMDA 3SEQA 2NS7A 4PXIA 3HOVJ 1U78A 3AL0B 2FBKA 4N4NB 4LLLA 2QEXI 1ZR4A 1T6SA 2DQLA 2W84A 3ABMH 1USTA 4RB3C 5D6EA 5FRMA 2VJ4A 2V1DA 5K5QA 3NRVA 2F5FA 3WTSC 3GTJJ 4FX4A 4B48A 2MBFA 3JRFA 1VQOI 2B3WA 1L0OC 4DVYP 3V8LA 3RI4A 2VQHA 4JX4A 2LFBA 2MW8A 3NRGA 5FROA 1RESA 4LB5A 5AQCA 1FP2A 2W85A 4QSHA 2L01A 1IXCA 3F8NA 1Y0UA 1P4AA 4QPQA 4E70A 2WAEA 2B9SA 3CC7I 2D6YA 2G0EA 5J4VA 5EDNA 2KIFA 2PBXA 4XLNF 3AG2H 2OD5A 3SDBA 4UUTA 5HS9A 4EM1A 2A3SA 2KDOA 1NK3P 4CCOA 1ZLJA 2WAQA 1FSHA 1ETWA 1R58A 2VBXA 2QSHX 3DBLB 3ZMVA 1Q1HA 1Y8RB 2OPTA 4AC0A 4WCGA 1R00A 1YX3A 2R7XA 4R8HA 3WG7H 5M3FJ 3BZKA 3GFMA 3DEUA 3UKGA 2CRGA 3ABLH 2B7EA 2FNAA 4JBAA 4XKCA 3OYCA 4GCVA 5FGMA 4U7BA 4ZC3A 2W4SA 4CZZA 2EK5A 2DT7B 4L62A 2IA2A 3ANPA 4R1HA 3PO2J 4KIFA 5J8CA 2P4WA 2ELHA 3D1NI 1FY7A 5F64A 2E36A 2E2HJ 1YW9A 4E4HA 2VC1A 3G1OA 4I02A 3AKZA 1FTZA 2JA6J 4M9XA 1A35A 4IRIA 3EUPA 2V7FA 4AIDA 1FIAA 5JVGF 1G8XA 2IP2A 5M3MJ 2J5PA 3VIBA 1LPQA 2W1OA 2IS2A 2DA6A 1X1PA 5F08A 2EBIA 5F27A 4CUGA 3BZCA 3QWLA 5IYBJ 4BDYA 3VWBA 3I59B 1SGMA 3TW6A 2JUGA 1CQTA 3NXCA 1LVAA 1MJ9A 3TBIA 3G3ZA 3WTUC 1EJ9A 1S8NA 3J7ZI 3V7SA 4ZYGA 4C2MA 2CU7A 5LHIA 2CW7A 3OMYA 1W4MA 1ZAOA 2OZUA 5K7HA 1R5HA 4LGWA 1HBXG 3EYYA 4DBRA 2GQQA 4IEJA 4L9JA 4RAGA 4UUSA 2ECCA 2P81A 1MJBA 4M9ZA 4FTHA 2AS5F 4C2UA 3RZOJ 3CLOA 2AHQA 3LSPA 3ZQ7A 5FKNA 4XRSG 3CUQA 5HDKA 4HNUA 2K3FA 2MFZA 3V6GA 1YX5A 2V26A 3IH2A 3ONQA 1P9QC 1S7EA 2EINH 2RQQA 1D5YA 2RAEA 2RGVA 4IRGA 4A12A 4RB0A 1K61A 2KJBA 3GBGA 3ZQFA 1ZG3A 1OISA 2CFOA 3OYAA 3K9TA 1LE8B 1QBJA 3G73A 3RD3A 3HTIA 3DCFA 2LF8A 4EEFG 1ETQA 5D5VB 2V57A 5D5UB 3TMOA 5BOXA 3GTPJ 3FK7A 3ZXSA 1JKQC 2AXTC 4L9TA 3S3NA 3KEYA 5CVRA 2X4HA 3HOWJ 3LHQA 1SFOJ 3AAFA 3DEEA 4KMFA 3GFJA 4A0XA 3U9GA 1D1BA 4IQJA 2BV6A 1ZK8A 2XGXA 2WAQN 1HW2A 3EQLF 1WQ2A 5JLWA 2KZVA 1JTYA 1DU0A 2QGUA 2OERA 1QZZA 5IPAA 1JT0A 4PJNA 2A68F 1YE9A 3TW7A 1MW7A 3VYUB 1X1AA 1I50J 3R6SA 4GCLA 1QZYA 2X1EA 3RQIA 3M7GA 2IA1A 4MHGA 2P5LC 2EZKA 4BEHB 1MNMC 4L0ZB 2DN0A 1KQ9A 2IA0A 4MFDA 3S1RJ 4LB6B 3DLAA 3EGQA 1PP8F 2LH9A 2ID3A 2WV1A 1JJ6C 1X1BA 5HNFA 5DM6F 1SMYF 2YS9A 3HTUA 2OJED 3DKYA 3MCZA 2LDUA 4HQMA 5DTDA 3ZN1A 1PDNC 1VZ0A 4LIUA 4C3IJ 2KRHA 3RDIA 4L0YB 3OWTA 3SYTA 3GTGJ 1BJAA 2L2OA 3JAMK 3DTKA 4RGRA 4KUMA 2CH0A 4EMSA 1DPRA 3E6BA 5E3NA 3MFKA 3HM5A 2HPIA 2ACJA 2KHMA 3PO3J 4IRVA 2A6TA 2REKA 1ETVA 4CCKA 3KEOA 1R49A 3K4MA 1ZKGA 2BOLA 3I4PA 3EUKL 2NP5A 1UCRA 3RPUA 4A0YA 4IOAF 2ME6A 4D5FA 1MD0A 1UHWA 1LDKB 2M7BA 4G12A 5HDGA 4A3KJ 2EPFA 1FOXA 3MN2A 4EJTA 4RGUA 2GFNA 1J0RA 5KCMA 4PJLA 2V4JC 5C4JJ 4LLNA 1LJ9A 2VJIA 3IC7A 3Q9VA 5FKOA 4KT6A 1U8BA 1R7JA 3ERMA 3S93A 5BNGA 1B9MA 4HKUA 1P4WA 2RQPA 4NC8A 5GADJ 5CQGA 2A2FX 5K5RA 3S15J 1LEAA 1C0WA 3GTKJ 2WY7Q 5IT3A 2R7SA 2JT1A 2QKLB 4UVAA 1VNDA 1JKRC 3IWFA 5EF6A 2WGBA 1NK2P 1BR2A 3OL3A 1PP7U 1AHDP 4N4OB 3G71I 5L3EA 3CDIA 1K6YA 3DPJA 4PDKA 2KPMA 3DPTA 3FMSA 3FMRA 2WB1N 3I3LA 4ZZLA 1BI1A 5CW8A 4BAYA 1EF4A 3FHZA 1UG0A 2MGQA 2DTRA 4HW0A 4ENMA 2BY0A 4MTEA 5DDGA 1VQLI 1GUUA 2V6EA 1O3QA 4CXFA 4BBSJ 2UXUA 4HNTA 4H4KC 1IDYA 2BVLA 4A5NA 2P7VB 4Y4RA 3CF5F 3Q0UA 5J6XA 2JJ7A 2HOSA 3GTMJ 3OSGA 1NG6A 4HA8A 2KDZA 2R7UA 1A6QA 3K70D 4A5MA 5EEAA 2VKVA 2IGNA 3MEXA 1JKPC 3OYIA 2L7MP 3QYBA 1F43A 1Y8QB 1V3FA 5ED4A 1T0FC 3OS1A 4S05A 1B59A 5DCMA 5F04A 2NVUB 4GCTA 2XKPA 1QRYA 3HBLA 1E3OC 2RNJA 1S5LC 4EM2A 1TW2A 5M5XJ 4LG0B 2Y0MA 4F55A 1J7KA 2UZKA 4PZJA 2KRFA 1ETYA 2ESNA 4ME9A 1VTNC 4F52A 2PLYA 1O3RA 3BCGA 3FK6A 4F93B 5ILUA 1XPXA 4WIBA 1O57A 3B6AA 1AOYA 5LHGA 1FBQA 2YPRA 2HXOA 3MMYB 2LTPA 2XGEA 1A31A 2DLLA 4PUSA 1WJ5A 4CA0A 2GAUA 2LBFB 5FKMA 2PBIA 1VQPI 2H27A 2ME0A 4GFKA 1WRJA 5FLXK 5CYVA 4IF4A 2M8GX 4D7NA 1RKTA 5TISC 5LEJA 1T98A 2RKHA 3SQNA 3BR2A 1OCCH 1TWFJ 4M3FA 4XKWA 2XRNA 2PJRB 4XLFA 2Y31A 1E0EA 5CVJA 5FKLA 2OAZA 2XGCA 3DEWA 3T1BA 3GTLJ 3K8PC 1I3QJ 3ZMTA 1J75A 5LRRA 5F1JA 1XGSA 2WUIA 2MLGA 4A3CJ 4U87A 4HX7A 1Z7LA 3IH3A 3LFKA 4UVBA 3S1NJ 2XB0X 3OYHA 3I64A 1R1VA 3K10A 4FE4A 4M71A 4N9HA 1T8IA 2UXIA 2F4OB 5M5WJ 4XRFA 2H94A 3VFZA 4R79A 2O9LA 2UWMA 1YW7A 4E7IA 4DZPA 5ERIA 1QA6A 5AONA 4HDVA 6PAXA 5FFXA 4DIQA 3HOYJ 2O8XA 3G56A 2LY2A 1W5SA 2VN2A 1I3AA 3F3XA 1D8KA 1V5FA 1YHQI 1REPC 3ZR8X 1DGWY 4S0HB 3SDGA 4Q48A 4I0BA 2F4MB 5HNHA 4GDFA 2UXPA 3L09A 4L5JA 1VQ4I 3MVPA 3NI7A 4GGGA 4KICA 2EFWA 1JXSA 1MBEA 3DP7A 5CXGA 4IKFA 3PFYA 2R7QA 3I9V2 2XDNA 4M3BA 3QQAA 3OOUA 1ETXA 2HQ5A 5FKKA 3FXJA 3S3OA 1BJZA 1YS7A 3CC4I 3PSFA 4M73A 1D1AA 1LFPA 5H6RA 3S17J 2K9MA 2G3BA 2VJJA 4AYBN 4JK1X 1H0MA 3CJDA 2XSJC 2HEOA 2XSDC 1SMTA 4XSXF 3OYKA 4UV8A 2D1HA 3HIFA 2E2IJ 4DYQA 2O5RA 3N97A 1D0YA 1NTCA 2CSOA 2ZO4A 3HG9A 1ITYA 3JR9A 4M6YA 2BVMA 3BG9A 4DYRA 1BI3A 3HGGA 4YFXF 4C30A 1ETOA 1OCPA 3HGYA 4EJUA 4D0PA 4A3DJ 2QSGX 1KA8A 4W1UA 2L7KA 4YFNF 3FIWA 4TV7A 4B44A 3F23A 1I27A 3R4KA 3FMQA 2H8RA 3CJTB 2BW3B 3SHFA 1XD7A 4KIBA 4KNYA 1P92A 2CV0A 4LFUA 4B09A 2BW3A 2IEKA 3BTJA 5IYCJ 1VQ5I 1Z6RA 4HRIA 4WWCA 5EG0A 3JTGA 5GPCA 4DBQA 3KETA 2L9SA 5GAEJ 5C4YA 4CYCB 2IRFG 2LKPA 5E3LA 4BS9A 2IPQX 3V8JA 3LFUA 4M3EA 3LAPA 1GXQA 4HPQA 4ABZA 2KZGA 2CUEA 4EATA 2TRTA 3GX4X 2QA4I 3U2RA 2ELKA 1RC9A 3COLA 3K69A 2YR2A 2H09A 2PN6A 2GWRA 3VSKA 2BHZA 2JA7J 3RTRA 4HLYA 2UV1A 3DWLE 4ENJA 2DA5A 1MMNA 4Y13A 3QPSA 2ZCMA 1LE8A 1MSEC 5JHUA 4JL3A 1FT9A 3GZIA 2P8TA 1WJFA 4HF1A 3CCVI 2WY8Q 5E18F 1T38A 5DCMB 4IZZA 2P6TA 5E1WA 2C6YA 1AKHA 4OAYA 3TGNA 5HOOA 3BTLA 4RB1A 3LL7A 3OIPA 4XBFA 3NEUA 3REOA 3LA3A 5JHFA 5JR3A 4CYDA 3I4NJ 1YRNB 1UZCA 4P9UA 1QPIA 3VOEA 2R7RA 5HSZA 2HTJA 4G6TB 1A5JA 3P9IA 2VXDA 2GIVA 1DQUA 1JTXA 4UUVA 2XAUA 2QYOA 1IV8A 3CUQC 1Y56A 3K4CA 1RIOH 1R5ID 1DP3A 2FUG2 5TGTA 2HOEA 3L2UA 3OIQA 4XLHA 1LKXA 2R7DA 4QIWN 3ZQIA 2VQLA 1V5EA 5DAJA 2WA0A 1DPUA 2HKXA 4KN4X 1CF7A 5HAWA 2ZSIB 4OD5A 4NB5A 4A0ZA 2HNHA 2L7ZA 4RA2A 1X1CA 3JRCA 3M1EA 1K6OA 1R6RA 1YS6A 4OMZA 2K27A 5DD8A 3JSJA 1J5YA 3IRRA 2AO9A 2VPLA 4E7KA 4FX0A 1UMQA 5E8GA 2DYRH 1U5TC 4HAMA 1X2NA 1M1EB 2HPMA 2E19A 4PFOA 4Z2YA 4B43A 4DW6A 5D19A 2W48A 4CCMA 2DTZA 2XRLA 2M4GA 4XM3A 3PIPF 1YQAA 3K2AA 4LK1F 1I1SA 3BTIA 3QKXA 3ABUA 3RYPA 1OR7A 1IC8A 1I1GA 3A01A 4PCQA 3GVAA 1BIAA 4I01A 1JT6A 2VB6A 2ISYA 4E7JA 1BI0A 5D8KB 1FBSA 1ZR2A 3IH4A 3ELKA 3J7AY 3D5LA 3LOCA 1S7OA 2IGOA 3H5AA 3FZVA 4NDLA 1G2HA 4NUBA 3CO7C 4DGWB 2QKOA 5HODA 3OYLA 1SFEA 2DJIA 2A69F 3CP2A 3ZPLA 3PFIA 5DM7F 2JZYA 3BG6A 4CGZA 1PYVA 5FB2A 3I55I 1IRFA 2LC2A 2X6XA 3DU6A 3BY6A 5EEHA 2M5WA 2MH2A 2COMA 3BR5A 3GF2A 3OYEA 2NNYA 4A6EA 2IW5A 1KQ8A 3W2VA 2K3PA 3QP5A 4NQWA 2JK3A 1E3HA 3H9GA 3QYEA 3LWFA 2L7FP 5J8FA 3DBRB 1LVKA 1VI0A 4KISA 1MZBA 3TL4X 1TL8A 2IS1A 1WZ2A 3COAC 3VOKA 1B8IA 2BBYA 3A0HC 3CESA 3V8KA 4B47A 5B1AH 4WK8F 1MMSA 3KKDA 2EA2A 3R0AA 3CWRA 3I4MJ 2OQRA 2GLOA 1STZA 2JRMA 1CGPA 3ZQHA 2RC4A 2EV0A 3GXOA 4XSZF 3LWJA 2A07F 2A61A 3KIOA 3F0CA 1DUXC 2LKSA 3V42A 5GP9A 1Y1WJ 1F36A 3CCMI 4XK4A 2PMUA 1JJ8C 3I59A 4P55A 3IKTA 3S3MA 4UB6C 4KN7X 3ZCOA 1IXRC 4XKBA 1FIPA 1WJDA 4G6DA 1N75A 3FBIB 3IUVA 4Y33A 2O61A 2M9HA 4Z6YA 2F07A 2CQXA 3C1DA 2DAOA 3DBHB 4MLOA 3A02A 4HNVA 4BL0B 1XGOA 1I6HJ 3K1PA 1D3YA 2H1KA 3W6VA 3VW0A 3D0SA 3I58A 3FWEA 4FETA 4IO9F 2GIZA 2KLOA 3U21A 1R22A 1OYIA 5KNLA 1FBUA 3QYFA 3LSMA 3H1CA 3T0YA 3CUOA 1OR7C 3CC2I 3FRQA 4OMYA 2V6CA 3K70C 3N4MA 4N0BA 5FMPA 3G7RA 4LD5A 1R1TA 1BW6A 2M7AA 5ILVA 2FU4A 3H0DA 2XKOA 2W00A 1BW5A 3QOEA 2JRTA 2DA1A 4Y15A 3KNWA 1X4PA 4NNJA 1MH3A 3MD2A 2IS4A 2XGDA 5C44J 3KFWX 1EA3A 1KGSA 4MGRA 3CCJI 1SAXA 4MQVA 3W2AA 2ZCNA 4DOZA 5B5EC 1QHGA 4KITB 2ZMEC 5D5WB 3PUBA 4AM3A 1XSXA 2KQRA 4MQ9F 2XPVA 5FLMJ 1HC8A 3NWSA 2XIGA 2XROA 5EZHA 3ZRGA 3KP6A 4I99C 2CQNA 3BQYA 2HOAA 2R7OA 4ZTJA 1P7IA 1BOAA 2AXLA 2L02A 1IN8A 4BJ5C 4ZZDA 3JTHA 1QHHD 5GTIC 3GZ5A 2YVHA 2K4JA 3ML6A 2DT6A 1ZGJA 2X9DA 1OLTA 5E1XA 3H9JA 1NH3A 4F92B 3WGHA 3KZZA 3OYBA 2Z16A 2FF4A 2NVQJ 1PUFB 3FM3A 4II2A 1XB4A 4AVZA 4M72A 3IKVA 1FMWA 1FYKA 3NPIA 1VQKI 3VYSB 2HVSA 1FJLA 1T2KA 1RR8C 4I09A 3OS0A 4A3EJ 2DPDA 2FQ3A 4EGZA 4UB8C 2ZC2A 2MC3A 3QRFF 4UY8I 5KAIC 3BR0A 1BC7C 3MZYA 1K78B 1G3TA 4I2OA 4BJTA 3FXQA 3PM1A 3LA2A 3DV8A 3C2HA 4XL9A 2GA1A 2NP3A 4U9NA 3VVXA 3QP6A 3AG4H 3E5XA 2OCEA 2F5EA 4XN3A 1APLC 1YYVA 2VE9A 4EGYA 3AFHA 2QUFA 3HE0A 4NN1A 2P7CB 3K4JA 3ASOH 2TDXA 1HSJA 1RPWA 3BCBA 1G6NA 2X1DA 2GBYA 3FF5A 5BPIA 1ZN2A 2FMYA 3E3VA 2TCTA 5E17F 2PMZN 1G3SA 2ZNZA 3IHUA 1LQ1A 5BPDA 3P5JA 3LSKA 4RGXA 3P9CA 4CSWA 4IHTA 3NNRA 2YVEA 4OIPF 2CFXA 4CICA 1OCZH 3NARA 4V2FA 1K4SA 5J1YA 1YRNA 5DCFA 4NBQA 4IQ4A 3BCAA 3OR1C 5E3OA 4JYKA 2ELJA 1J2XA 4AF5A 5K5OA 2GOMA 1ON2A 1A36A 4D9JA 4M6XA 2EZIA 1W0TA 3K1NA 1BI2A 1DP7P 4IXAA 2ICWG 2R3SA 1B4AA 1MNDA 3BT9A 4OIQF 2QWTA 1E17A 4EQQA 1JHFA 3QOPA 1YTYA 3HIMA 3H92A 1T39A 2QZ8A 2CO5A 4BEHA 2M8EA 2Y30A 2DA2A 5F1RA 3J81Z 5TRDA 4GO1A 3I71A 2Q2EB 3GMEA 2JSPA 2GUHA 4OIRF 1FZPB 2Q2EA 2A6EF 3J7YJ 2R5YA 2PEXA 3A0BC 2ZMEB 1J9IA 3BPXA 3CMMA 1KU7A 2Y48A 3OY9A 4I6ZA 2L54A 2D45A 2V9PA 1UI6A 1YOVB 1GV5A 3VSLA 2DFHA 2HS5A 3H35A 3V78A 3B81A 2NNNA 1IW7F 2N8GA 2O0YA 2R4GA 1IRZA 5LGTA 2LP0A 4AUXA 2BZTA 4P96A 5ICFA 4BJ6C 2HQRA 5DS9A 5D8LB 3WODF 3X2QH 1XMXA 3TQNA 1FYMA 4AWXB 3MZ8A 4BKXA 4ANJA 3QU6A 5JI6A 1LNWA 1TP4A 3SFZA 3BLYA 3FDYA 1XCBA 3VYTB 2VE8A 3WE3A 5C3EJ 1S7AA 1IXSB 3JCUC 3KE2A 1JGGA 4EM0B 1Y1VJ 5F0FA 3F72A 2DOFA 3FX3A 2NRAC 1MMDA 4IHXA 2M34A 4HOBA 2XVCA 2ZXHA 4NC6A 1VQ9I 1XX5A 5LHHA 2I8DA 2A5WA 3HHHA 2HGCA 4BGDA 3B02A 3N05A 5CVIA 4I7HA 3RZDJ 3DTIA 3SEZA 3BJ6A 2YU3A 2GXGA 3KZIC 1ZQ3P 2WC2A 2K5CA 2X0LA 2M2EA 2LKXA 3Q0VA 4ITVA 2Z9OA 4DJAA 2LY1A 3KP7A 5GTHC 1GVDA 3CQZJ 5CPRB 1AKHB 3IL2A 5K58A 4A2UA 1BR1A 2ZJPF 4LMYA 1H9GA 1FX7A 5DD4A 3KYDB 1KU3A 5F0CA 5LFAA 4PGHA 4U7DA 3ECOA 1XSDA 1A04A 5FJ8J 4BY7J 2V9KA 1RUOA 2BY2A 1XMAA 4LLGF 5HLGA 2HU9A 2HOTA 4ON0A 1ZTRA 3FXKA 2QVOA 3KX2A 2QOPA 2MYSA 3HTHA 5IOYA 3TDZC 1ODDA 1V5GA 2B63J 5LRSA 1LFUP 3HOUJ 3F9KA 4QLCU 4M3GA 4J01A 1YJNI 2DMPA 3VYRB 2L3DA 1EH7A 3LNQA 2XHKA 2LK2A 4B4CA 1VFCA 5HS8A 1QVUA 5FD6A 3P9TA 2QIBA 3H9QA 4IVNA 4MIMA 3QODA 1VQNI 2E1MB 2K9LA 1IRGA 2CG4A 2VJ5A 3L2VA 3WTVC 1B9NA 1HW1A 4PFPA 3AL0C 1V4RA 1GLNA 2HZDA 3BDDA 2ZNYA 2V79A 3HRUA 1OJLA 3GZ6A 2Z33A 3WTWC 1HKSA 5D1RA 2STTA 3V7CA 2Z1DA 4XN0A 2X6WA 2BYVE 2DOAA 1UHMA 5FLVA 5C4XJ 4E7ZA 2IJLA 5JFRA 1H88C 4MK6A 4LIVA 3HUGB 4BQOA 3ERED 5DUKA 5EG0B 3LA7A 5GAGJ 4WX9A 2R7WA 1X4OA 1Q1VA 5BQTA 3RKYA 1R71A 3H5RA 2V1UA 1I39A 3ASNH 4JKZA 3K7AJ 3BHQA 4L18B 4ZYAA 4HQEA 1HDPA 1AU7A 2M45A 1HXDA 3HOZJ 1DDNA 4F7ZA 3HXLA 2LOOA 3HKZA 4G6QA 5FRNA 2CQKA 2CW0F 2JA2A 2L4MA 3GTOJ 3G1MA 2KIUA 1IN7A 2FMLA 3LSGA 5EGOA 1SVMA 3QPHA 4BH9A 3FKIJ 4RM2A 1ONVA 3KPHA 5ICCA 2QENA 5H9TA 2Q1ZB 1W5CC 1UJ8A 3CLQA 3F8CA 3GYHX 1S3JA 4E7HA 3GEZA 1MIJA 4WXCA 2MA3A 3E97A 3K0LA 3G4SI 1YI2I 4BXXJ 3FXLA 1BM9A 4BQQA 2XAHA 2X1CA 3O3KA 2PI0A 4A3BJ 2KIQA 4XNFA 1Z3XA 5H2FC 4G7ZF 3IUOA 3ABTA 1PVEA 3TDUC 1Z9CA 1TWCJ 2HQAA 5CVVA 4BXFA 5HLIA 1IN4A 3W6JB 4G7OF 1U5TA 2DDAA 2DJNA 4XONA 2R93J 3GFLA 3DQVC 3TO7A 3WTZA 4LG3A 3SFIA 3H3VK 3F21A 3L00A 2FBHA 1USSA 2K9SA 1MBHA 3HSFA 2H1LA 2MD5A 3FXMA 3ZQQA 4IHVA 1U8RA 1CF7B 1B1BA 1BR4A 4D1QA 2JQ7A 3PASA 4ZDLA 5JLXA 4ZDOA 3JRGA 2W57A 3WE2A 4F91B 2VONA 2YVXA 1HQCA 4NQWB 3GLLA 1ORKA 2PG4A 3JRIA 2VBWA 1TWHJ 2M0MA 3VW1A 3K4LA 2CQQA 2MABA 3WU0A 2Q8KA 2A6HF 1QVTA 3OL4A 2VODA 1O3SA 2Z3YA 1UFMA 3WGGA 5LD2C 4HF2A 2F5VA 3VW2A 1LB2A 1LUJB 3DKXA 2EIKH 2GA2A 5FO5A 4EVIA 2D1VA 4GRIA 1IUFA 2EFQA 3B73A 3FXRA 2OA4A 2QM3A 3GW2A 4W97A 2E35A 3SXYA 3F1BA 1ACIA 3CRJA 2M30A 1W7PB 2NVYJ 2VKEA 2ZCWA 3K1MA 3CD6I 2DG7A 3BJAA 4CCLA 2F48A 3AQSA 5HVQC 2KIMA 1Z1DA 5LGNA 1SANA 4CZCA 2NOGA 3HDDA 3HRTA 3I0TA 1HF0A 3S1MJ 4Q5SF 1P6RA 3BR6A 3CUQB 3IRQA 2E1OA 4FHTA 2PMHA 2EA4A 5FD5A 1OMIA 4RAFA 3T8TA 2Y2ZA 4RM3A 3GLXA 2ZB9A 2WWYA 1TZLA 2K02A 4EV0A 1YITI 3MKLA 1GV2A 2H6CA 4HF0A 1LFBA 5GPAA 3W3CA 4ENKA 2Z99A 1B72B 1RRJA 1WKMA 4XOPA 1G3WA 2HDWA 1G4DA 1UHSA 4YELA 2K7LA 3E7LA 1YW8A 3RKXA 5E20A 1UI5A 4GXOA 1ERDA 2DMUA 3M1CA 4IJAA 3VPRA 3I54A 1MBGA 2DI3A 2CMPA 2VKDA 1KU9A 1SC7A 2ESHA 3O8HA 5IP6A 3PJRA 3S2DJ 3HYIA 3ULQB 1OYWA 4EJWA 3CCSI 4KWAA 4YFKF 2DO7A 2A05A 2W82A 2LSOA 3OYNA 2M4KA 1ZREA 4CH7A 2XAFA 4E6KG 2AQEA 3H3ZA 4BE0A 4HEA2 2ZXIA 3JSPA 2W53A 1BOBA 2HTSA 2W7NA 3Q5FA 4YIRX 1U0JA 1KU2A 2UXXA 4KIGA 4E7LA 2EFOA 3JAMZ 1MMGA 4D5CA 1ZARA 1L3LA 3PSIA 2O8KA 1VQ7I 2K86A 3OYFA 1FNNA 2B1EA 1D0ZA 5L3FA 1Y39A 2V1NA 3FISA 1OQYA 1JUSA 2XAGA 2HKOA 3CJNA 1FOWA 3DFGA 2CQ7A 2CUFA 4OIOF 3M9AA 3B6CA 1D1CA 2FJ1A 2YUSA 2LLKA 3M07A 1JHHA 4ESJA 1R9TJ 2HI3A 4MEXF 1PJRA 3AG3H 3JW4A 1EKEA 2JA8J 1ZRDA 2PMZA 2G7GA 3TP0A 2V9VA 2EFNA 2EWNA 2NVXJ 2CWEA 4HDUA 2DDBA 3KCCA 3J7AO 2X51A 2CV2A 1OCRH 1QPMA 4AVPA 3FHNA 1BIBA 4XQFA 3GWZA 5JVTA 3IAS2 2M3AA 4IHWA 1V55H 3LQRA 4XR6A 4HBLA 3IV5A 3HOXJ 2QTQA 3LQQA 3F8MA 1YFHA 4C3HJ 3MAJA 5EYRA 1YG2A 3WTYC 4KDPA 3MQ0A 3TOAA 1B6AA 5FLXZ 3PIOF 3CMEI 3I53A 5J1RA 4M74A 3RYRA 3LSHA 2D5VA 4AU7A 2DA7A 2IGKA 1X3WB 4QWQA 1U9NA 3VB2A 4ESBA 3HTJA 3GFIA 2X85A 4X1EA 3S5RA 2NS8A 1HKQA 4IPAA 1EH8A 1Z77A 1VQ8I 3HSEA 5J4YA 4FQGA 2X6YA 4QPOA 1PUEE 4RLFA 2GENA 2HDDA 1ON1A 1FLIA 4JOMA 2DMNA 2E5ZA 3MKZA 2YU9J 4BQAA 2QLZA 1I5ZA 4BHBA 1MDMA 2VASA 4IOCF 4BNCA 5L3CA 2KMUA 4U0WA 1MBJA 4Y17A 4YRVA 1OCOH 1H89C 3E5UA 2E60A 2JPCA 1XTAA 3HOTA 2JN6A 2F5CA 2DU9A 4XORA 2HVQA 2M0CA 4U0VA 3ZGKA 3VUQA 2VT3A 3PUFA 4YZEA 2EZHA 2WADA 1R4MB 2RNGA 4A3IJ 2EB7A 4KT5C 1A6IA 5BMZA 2XASA 1U2WA 3BROA 3HTAA 1W7PD 1Y0NA 2OZ6A 2ZFWA 3EUHC 4M3DA 4O3MA 2STWA 4PSWA 4HX8A 2WBMA 2JA5J 3C2BA 3R0JA 5IP9J 4UUSB 1OKRA 1TQIA 1P2FA 2MH9A 4HV6A 4AYBA 4YIFA 1WHUA 1ZRCA 2CUJA 2OF7A 2LBFA 1QGPA 2YX7A 3T8RA 3F6VA 2XAQA 2FBIA 2IT0A 2G7SA 3BG7A 4P9FA 1J59A 1LEBA 4B3AA 1TW3A 3NQOA 1F5TA 3HPGA 3V4GA 4IRHA 5LBQA 3ZQLA 2H8WA 1E3PA 1HOMA 3DLLF 3V7RA 2L9RA 3PNVA 1QO0D 2XAJA 2YX4A 5CVUA 1RI7A 2M1BA 1TNTA 1D0XA 1IV6A 4BACA 2PQ8A 1KYWA 4ESFA 1I6XA 2F5DA 3P7NA 2CS3A 2CV1A 2Y9YA 3OYDA 1N78A 1WVRA 3RKWA 3G6EI 2EH3A 2QKMB 3PL8A 4HZFA 2E71A 2VI6A 1VF9A 5D4RA 2X6OA 4BHCA 2ZXJA 2FBQA 4MEYF 4A6DA 3ZOBA 3E7QA 1J09A 4Y3OA 2FXAA 2G7UA 2RREA 4JQFA 1XSVA 5EZGA 2NOJB 2RASA 2E2JJ 1R5GA 4H0EA 1RKWA 3Q3SA 2QQ8A 1ZG5A 2NVTJ 4GFBA 1IDZA 2UXNA 2OV7A 2FD5A 4G8XA 2VC0A 4Q4ZF 4A3JJ 5CJ9A 5HS7A 1SFUA 2P0WA 2WAFA 5HBUA 5CLSA 5K7ZA 2ZJQF 1PUFA 1NG7A 1FOKA 1GHCA 2E1NA 2VLAA 4ZYEA 3E0JB 1HSTA 1Z7UA 2EIJH 2K4BA 4KJZA 5ICEA 3S2HJ 2VBYA 2LNBA 4RDUA 1K78A 2L9VA 5J47A 1AA7A 2QQBA 3JRAA 3H0GJ 1JUPA 1X3ZB 3ISPA 5EGOB 4MTDA 3T5XA 5LGUA 1WFXA 1XC5A 1ZG1A 1V54H 3EUHA 4I76A 4BQNA 3E1SA 3QBMA 4OU0A 4O5VA 1R36A 5KAFC 5DEQA 2K40A 4FISA 1HA8A 1MNEA 3HZJA 4IL6C 1QNTA 4UXNA 3VTIA 2CJJA 4V19K 2L4AA 3HTSB 1IN5A 3EYIA 2R92J 2KRCA 2CGPA 3FKJA 3WG9A 3VVYA 4A3MJ 3E6DA 5K1YA 1BBYA 1MJAA 3ECHA 4RLQA 1IAWA 2OTJI 5M5YJ 1FC3A 1T56A 2ZOYA 2HR3A 2K9QA 2V1XA 1FOYA 4ICHA 3CCLI 4Y7NJ 3HPHA 4BUPA 2X48A 1LDJA 4FCYA 2GXBA 4MXMA 1FWZA 3O8GA 2GOXB 5E3MA 2FOWA 2KFDA 1MDMB 1WJAA 1UG2A 2ZFUA 2OBPA 4CCNA 3H36A 5HLTA 3JSOA 4C3JJ 3QPTA 2QSFX 1WWXA 2PJRA 2E7WA 5B1BH 2ID6A 3F6OA 3MKWB 2FJI1 5D4SA 1W36C 1Z3YA 3BR3A 3OR2C 3TEDA 1MH4A 1S72I 4IHYA 2ZCXA 2VT2A 3TOBA 1RZ4A 3E6CC 3P9KA 1TBXA 1B72A 2VXZA 4XLCA 4AIKA 2LVSA 1SFXA 4PJJA 4ACIA 1ZHFA 4ZH4F 3AQTA 3MNLA 3RH2A 2JWTA 2DCEA 1T08B 1MSFC 5CXIA 2O7TA 3KZ9A 1TQPA 3LSIA 1X58A 3WU2C 1IJWC 1YIOA 3M8FA 3SZTA 3C7JA 3ZN0A 3K6GA 5DV5A 3HHGA 2JTVA 3O2PE 4G9YA 1R1UA 2E1MC 2R7ZJ 1O7FA 1W7PA 2HWVA 2P5KA 3HJEA 2ISZA 2R7VA 2XC7A 2ZJRF 4I0AA 1TTYA 5IY5H 3M8JA 3BP8A 2PFBA 3KZYA 3K4NA 3GZNB 3LSTA 2DK8A 4CYCA 2BY1A 3ZQGA 3GTQJ 3OSFA 2GXAA 5E1ZB 1TT0A 4U0YA 3RQ4A 4JX6A 1VQMI 4ZDPA 2LYCA 3T6NA 3HL2A 3A2KA 2ETHA 1EH6A 1K4TA 2O7OA 4UHTA 4RB2C 4A3GJ 5HLHA 3C2GA 1XGNA 5KK1A 3PNTA 4WXHA 2RHAA 2HQNA 3IAM2 1XN7A 3G2BA 2R5YB 2HXIA 4AIHA 3HC7A 2F2EA 4L9NA 2E34A 1X2MA 2KISA 2PZ9A 4C2MJ 5IT9K 3CDHA 3RJPA 5F6FA 1K7AA 5IP7J 1TT5B 4KMUX 3EPZA 2HYFA 1Z67A 3AG1H 2PX9A 1TC3C 1TLHB 3A4CA 1T95A 1R23A 2F4IA 1Z0XA 2L9NA 3CCQI 5A2QZ 3ZMSA 3W2WA 3L2QA 2ZMEA 3VVZA 1IGNA 1SD4A 4J00A 1SD6A 3TP3A 2RVCA 2ZJ2A 3A03A 4LOCA 3UNGC 1BA5A 2PFVA 2KL4A 5ILSA 3RIRA 5LEKA 1GT0C 3BQZA 2JSCA 2HVRA 2L5QA 2DOEA 3CCEI 3OYGA 1N25A 5KHDA 1FP1D 2FOKA 2XPUA 5A2QK 5EFYA 3MZHA 3KKCA 2AQFA 4EJOA 1WI9A 3FXOA 3JRDA 1ENHA 4G94A 1QU3A 2VIXA 3HRMA 3KP2A 3OV8A 2VPRA 4BHPA 3GO5A 2O3FA 4U9LA 3HSRA 3TO6A 1IZ1A 3NWTA 3FBNB 1DGRM 4HG2A 1MBKA 4S04A 2DPUA 3J81K 2DA4A 4P5OA 2DYSH 2MSYA 1D8JA 2R5ZA 3H5NA 3LSJA 1F1ZA 1XGMA 4LG0A 1BL0A 2VOPA 4HYEA 2VQGA 1RNLA 2XF5A 4HLXA 2IVMA 2BXZA 1ZELA 2QWWA 4OAZA 4XICA 2E1CA 4ZYDA 1WPKA 1FYLA 2EZLA 2HFHA 2XV4S 4RAZA 2ZKZA 3S8PA 3KYCB 1Z05A 2CUZA 1TNSA 1G3YA 2ZSHB 3CCYA 1X3UA 3ZQCA 4OWRB 1U6GA 3BJBA 4ZTFA 4C2TA 4CO8A 4E7SA 1F9NA 2LG4A 3EETA 1POGA 4B8XA 2NYXA 4BY1J 1BN5A 3C07A 1MKMA 3SJMA 4BE2A 1QQIA 4KA4A 2XF7A 2YSRA 3VEPA 3DPUA 3FM5A 2D2WA 3RSNA 2DFIA 3DXJF 2H6BA 4GYIA 2K85A 2A5YB 3OYJA 4NC7A 4CGRA 2Z2SB 3S1QJ 3I5UA 1OPCA 1YIJI 1B8IB 1ULYA 2BXYA 1OCTC 4LK0F 2COBA 2VQCA 2JVHA 3DPLC 4UVCA 2B0LA 3WHCA 2IAIA 3BR1A 3GUDA 2JVGA 4DQ2A 3RPUD 1JE8A 2G7LA 1XMKA 1JUMA 4HV5A 3ZP5A 3PQKA 4BYYA 1RR7A 2OI8A 3HKZN 2DQRA 3NAUA 2VKHA 1IG7A 1EV7A 2LMDA 3ABKH 5CQEA 2BEOA 3PPBA 3MKYB 2QF7A 3TKYA 1WGXA 3A1YA 3ESWB 3VODA 3CCRI 1HCRA 2IU5A 4J19A 3TO9A 1QZEA 2DODA 2I10A 4LITA 1K79A 1ZLKA 3BWGA 1FSEA 1SVLA 2XB5A 3S32A 3UR3C 4X6AJ 2QQ9A 2DMQA 3L2CA 3WHBA 2IXSA 1Z6TA 2Y75A 5TJJA 4O6JA 5D18A 4RS8A 2EV5A 4ASNA 4YIIA 3SZGA 1O4XA 2JPBA 4X0GA 4HSRA 3BPVA 3LJLA 4PSXA 2OQGA 1XDUA 3L2RA 3HEFA 1ZH5A 4FE7A 2RN7A 5E8IA 3D5SC 3QPLA 3BOQA 2R7TA 2VL8A 3PQJA 1HDDC 3KLOA 4I98B 1D5VA 1JKOC 1KZHA 1K83J 2DFEA 1ETKA 3IWZA 5L3DA 4ZYHA 4IHSA 1U9OA 1WCMJ 2FSWA 3BG3A 3I56I 3GEUA 4OINF 1WJCA 5LLQA 2Y9ZA 2NAZA 4N9IA 2Z5UA 5ICGA 3HB9A 3BNIA 2HYTA 4P1WA 1IF1A 2O03A 1WH5A 3Q0WA 3J80Z 3CTAA 4ENNA 5D6FA 2VUMJ 4FT8A 4ZJZA 2JUCA 2QBYB 1GVJA 3OS2A 3F8FA 1S6LA 3ZMZA 3WGIA 4D7MA 3S16J 4UV9A 1UB9A 5GAHJ 4F3QA 4K2EA 4Y52J 1NHAA 3CO6C 3K4BA 2DBBA 3CDLA 2BY3A 2ADUA 4JP0A 4PGGA 1S29A 2Y0SA 3HOSA 2HYJA 3HUGA 1YO5C 1HLVA 3PNYA 4YEJA 1MMAA 1WSUA 4PJMA 1OFCX 1P4XA 3OOPA 5K7FA 1G59A 2DA3A 2PJPA 2L0KA 2GZWA 3CMAI 3U1KA 2FNPA 3KEQA 1H8AC 2G7HA 2K9NA 3LMMA 3Q9SA 1GDTA 3WTXC
chains in the Genus database with same CATH topology
5FKOA 2YU9J 2DMNA 3BR0A 1U8BA 1FEXA 3PM1A 5BNGA 4HKUA 1WH7A 1MBJA 1H89C 3O60A 2NP3A 3VVXA 1APLC 3S15J 2JN6A 2M0CA 3VUQA 3GTKJ 2KT0A 4YZEA 3HE0A 4NN1A 2EZHA 3A01B 4DYCA 4A3IJ 1RPWA 1VNDA 1A6IA 5EF6A 1ZGWA 1JKRC 2GBYA 1NK2P 2WGBA 9ANTA 1AHDP 3HTAA 2TCTA 2PMZN 4JX5A 1TWAJ 3RKQA 3DPJA 4M3DA 2WB1N 3OIOA 3NNRA 3LSRA 2YVEA 2JA5J 3C2BA 5CW8A 5IP9J 1EF4A 4UUSB 3NARA 2MGQA 4V2FA 5J1YA 1YRNA 1W0UA 1GUUA 1T33A 5E3OA 1WI3A 4BBSJ 2UXUA 3BG5A 4JYKA 2OF7A 4XIDA 1IDYA 4AF5A 4AC6A 5J3LA 2G7SA 4L5EA 3Q0UA 2JJ7A 2HOSA 4B3AA 2LR8A 3GTMJ 3OSGA 2EZIA 2KDZA 1W0TA 3ZQLA 1HOMA 2UXOA 4GCKA 2L9RA 3BT9A 5EEAA 2QWTA 2VKVA 3HIMA 1JKPC 2L7MP 5IOZA 1F43A 1IV6A 2Y30A 2DA2A 4A93J 2GUHA 2LY9A 2R5ZB 5FHPA 2MG4A 2Y9YA 3JRBA 5F04A 3BRUA 4GCTA 1QRYA 3HBLA 2EH3A 2R5YA 1E3OC 2ZOZA 2XPWA 5M5XJ 2VI6A 2Q24A 1VF9A 2X6OA 2FBQA 1RETA 1MBFA 4I6ZA 3ZOBA 3E7QA 2LD5A 1UI6A 1ETYA 1GV5A 2QCOA 1FTTA 4ME9A 4XRMA 3BCGA 3FK6A 5EZGA 3V78A 2RASA 3B81A 2E2JJ 2N8GA 3B6AA 1RKWA 3Q3SA 2HXOA 2LTPA 2XGEA 2NVTJ 3M4OJ 1IRZA 2LP0A 4GFBA 1IDZA 5FKMA 4AUXA 2FD5A 3VP5A 4A3JJ 2ME0A 4A3FJ 4GFKA 4B1RA 4MFEA 2M8GX 5HBUA 5DS9A 4D7NA 4QTRA 1RKTA 5K7ZA 1PUFA 4BKXA 3BR2A 3JREA 1TWFJ 4M3FA 5C3EJ 4JNNA 2NX4A 1TWGJ 2Y31A 1JGGA 1Y1VJ 5FKLA 5F0FA 2XGCA 3DEWA 3S2HJ 4GFLA 4RDUA 4IHXA 2M34A 3GTLJ 3JRAA 1I3QJ 3H0GJ 5F0HA 5F1JA 1JUPA 2HKUA 2WUIA 5EGOB 4A3CJ 3CMYA 3RZDJ 3S1NJ 1XC5A 3IH3A 4XRSA 4I76A 2XB0X 2DMTA 2GM4A 1P7JA 3QBMA 4FE4A 2UXIA 1ZQ3P 5M5WJ 2K40A 4FISA 2M2EA 2LKXA 2O9LA 3Q0VA 4NELA 4DZPA 2CJJA 3HOYJ 1GVDA 3CQZJ 2R0QC 1AKHB 3G56A 5K58A 2R92J 4S0HB 3SDGA 3VVYA 4A3MJ 2UXPA 3MVPA 3NI7A 5M5YJ 5F0CA 4DZJA 1T56A 2ZOYA 4A69C 1MBEA 2K9QA 4BY7J 5FJ8J 4ICHA 4V2GA 1XS9A 5CXGA 2XDNA 4M3BA 3QQAA 4Y7NJ 3OOUA 2HOTA 3ON4A 2X48A 4FCYA 1ZTRA 1XG1A 4MXMA 1ETXA 2QOPA 2HQ5A 3O8GA 5E3MA 5FKKA 3HTHA 1BJZA 5IOYA 3S14J 3ON2A 3S17J 3ANGA 1UG2A 2B63J 2G3BA 1LFUP 3HOUJ 4MO7A 4AYBN 4M3GA 3JRHA 2IBDA 3G1LA 4C3JJ 3CJDA 2XSDC 2DMPA 3LNQA 2ECBA 5J1UA 2ID6A 4RBOA 2E2IJ 4DYQA 2LK2A 3BR3A 2EQRA 4B4CA 1VFCA 1QVUA 3TEDA 1MH4A 1NTCA 4IHYA 2QIBA 2ZCXA 3P9TA 2UXHA 1ITYA 3JR9A 4A3LJ 4MIMA 1B72A 3BG9A 5IYDJ 2LVSA 2Y0SN 4M6VA 4DYRA 3L1PA 1DU6A 4UDSA 3HGGA 3VOXA 4ACIA 3AQTA 3MNLA 3RH2A 1ETOA 1OCPA 2JWTA 3HGYA 1MSFC 2DG8A 5CXIA 2O7TA 3M3YJ 3KZ9A 1OJLA 4A3DJ 4W1UA 3FIWA 1X58A 1IJWC 5FGLA 2FQ4A 5D1RA 2H8RA 3BTCA 2JMWA 2FX0A 5FLVA 2R7ZJ 3BTJA 2IEKA 5IYCJ 5C4XJ 4BBRJ 5EG0A 2NS7A 1H88C 5GPCA 4MK6A 4PXIA 3HOVJ 1U78A 5C4YA 4CYCB 5EG0B 5E3LA 4CYCA 3ZQGA 1Q1VA 1ZR4A 3OSFA 3GTQJ 4M3EA 4JX6A 3T6NA 4ABZA 4JKZA 3K7AJ 3BHQA 2CUEA 3GTJJ 2O7OA 2TRTA 4A3GJ 1HDPA 1AU7A 3JRFA 2ELKA 3HOZJ 2RHAA 3COLA 4JX4A 2LFBA 2MW8A 3NRGA 1RESA 5AQCA 2R5YB 2HXIA 4QSHA 3GTOJ 2JA7J 3G1MA 2D6YA 1X2MA 2DA5A 2G0EA 3LSGA 3QPSA 5EGOA 2ZCMA 1LE8A 5EDNA 1MSEC 2PZ9A 4C2MJ 2PBXA 3FKIJ 4JL3A 3GZIA 5IP7J 4UUTA 1NK3P 1TC3C 5H9TA 1AKHA 1Z0XA 3BTLA 1ETWA 4BXXJ 3VVZA 1IGNA 2OPTA 4AC0A 3I4NJ 3TP3A 1YRNB 1QPIA 4A3BJ 3A03A 4LOCA 1A5JA 1BA5A 5HSZA 5M3FJ 1JTXA 1TWCJ 3UKGA 1GT0C 2CRGA 3BQZA 2DJNA 2R93J 4QIWN 2XPUA 3H3VK 3ZQIA 3SFIA 4L62A 3ANPA 5EFYA 5DAJA 3PO2J 3KKCA 5HAWA 3JRDA 2K9SA 1MBHA 1ENHA 3D1NI 4IHVA 2E2HJ 2VPRA 3PASA 2L7ZA 5JLXA 3JRGA 3G1OA 3JRCA 1FTZA 2JA6J 3EUPA 1MBKA 1FIAA 3JSJA 5M3MJ 1ORKA 3JRIA 3VIBA 2AO9A 2DA4A 1TWHJ 3VW1A 2MSYA 2CQQA 2R5ZA 3LSJA 1UMQA 2DA6A 5F08A 2EBIA 1X2NA 5F27A 1QVTA 5IYBJ 1BL0A 2E19A 4DW6A 5D19A 2W48A 2DTZA 1SGMA 2XRLA 3TW6A 4XICA 3VW2A 3K2AA 1CQTA 1WPKA 3BTIA 3QKXA 3NXCA 2EZLA 3A01A 1IC8A 1JT6A 1IUFA 3CCYA 1ZR2A 3IH4A 3ZQCA 3LOCA 4W97A 1G2HA 2CU7A 4NDLA 3BJBA 3F1BA 2QKOA 3CRJA 5HODA 2NVYJ 2VKEA 2DG7A 5K7HA 3AQSA 4IEJA 1POGA 4UUSA 4BY1J 3C07A 2ECCA 1SANA 2P81A 3SJMA 2NOGA 4FTHA 3HDDA 3S1MJ 1HF0A 3RZOJ 3BR6A 2AHQA 3BR5A 1GDTA 2E1OA 3LSPA 5FKNA 4XRSG 2Y2ZA 2JK3A 2ZB9A 4CGRA 2L7FP 3MKLA 3S1QJ 3V6GA 1GV2A 1VI0A 1B8IB 1OCTC 5GPAA 1LFBA 1B72B 3IH2A 1S7EA 3VOKA 1D5YA 1B8IA 2COBA 2RAEA 1K61A 3GBGA 3ZQFA 3KKDA 1UHSA 3WHCA 2IAIA 3BR1A 3I4MJ 3CWRA 2GLOA 3ZQHA 1LE8B 3E7LA 2G7LA 1UI5A 1JUMA 2DMUA 3HTIA 3LWJA 3RD3A 3DCFA 2V57A 4EEFG 1ETQA 3VPRA 1RR7A 1MBGA 2OI8A 3HKZN 3NAUA 3F0CA 3GTPJ 3FK7A 3O8HA 5IP6A 1JKQC 1IG7A 3S2DJ 5GP9A 1Y1WJ 1F36A 4XK4A 3PPBA 4KWAA 1JJ8C 2QF7A 1WGXA 3HOWJ 1HCRA 3LHQA 1SFOJ 2IU5A 4J19A 1FIPA 2I10A 3IUVA 2XB5A 4X6AJ 2M9HA 2F07A 2W53A 1ZK8A 2CQXA 2DMQA 3WHBA 4MLOA 3A02A 4HNVA 2WAQN 5JLWA 1DU0A 1I6HJ 2OERA 1JTYA 5D18A 2H1KA 5IPAA 3W6VA 3VW0A 1O4XA 1JT0A 4D5CA 3TW7A 2O8KA 3LJLA 1I50J 3FISA 1JUSA 4GCLA 2CUFA 3HEFA 3RQIA 3B6CA 4FE7A 2FJ1A 2LLKA 2YUSA 3QPLA 1MNMC 2EZKA 1R9TJ 2DN0A 4MFDA 2HI3A 1HDDC 3FRQA 3S1RJ 1JKOC 5FMPA 2JA8J 3G7RA 1K83J 1BW6A 3EGQA 1ETKA 2G7GA 3TP0A 2ID3A 1BW5A 2WV1A 1JJ6C 2NVXJ 1U9OA 1WCMJ 3GEUA 3BG3A 2DA1A 3KNWA 2YS9A 2Y9ZA 1MH3A 2XGDA 5DTDA 5C44J 3HB9A 3BNIA 4C3IJ 2HYTA 4IHWA 2ZCNA 3GTGJ 1WH5A 3IV5A 3HOXJ 3Q0WA 2QTQA 2XPVA 2VUMJ 5FLMJ 5E3NA 4C3HJ 5EYRA 3HM5A 3PO3J 5EZHA 3BQYA 2HOAA 2REKA 1ETVA 1P7IA 5J1RA 2D5VA 4D7MA 3S16J 1ZKGA 2DA7A 4Y52J 2YVHA 2NP5A 1U9NA 3CDLA 4JP0A 1HLVA 2HYJA 2X9DA 2ME6A 4D5FA 3HTJA 4X1EA 3S5RA 2NS8A 4G12A 4A3KJ 1Z77A 1OFCX 5K7FA 1PUFB 2NVQJ 3MN2A 2DA3A 2GFNA 2L0KA 3NPIA 1H8AC 1FJLA 2K9NA 5C4JJ 4A3EJ 2GENA 2HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKO A;  2YU9 J;  2DMN A;  3BR0 A;  1U8B A;  1FEX A;  3PM1 A;  5BNG A;  4HKU A;  1WH7 A;  1MBJ A;  1H89 C;  3O60 A;  2NP3 A;  3VVX A;  1APL C;  3S15 J;  2JN6 A;  2M0C A;  3VUQ A;  3GTK J;  2KT0 A;  4YZE A;  3HE0 A;  4NN1 A;  2EZH A;  3A01 B;  4DYC A;  4A3I J;  1RPW A;  1VND A;  1A6I A;  5EF6 A;  1ZGW A;  1JKR C;  2GBY A;  1NK2 P;  2WGB A;  9ANT A;  1AHD P;  3HTA A;  2TCT A;  2PMZ N;  4JX5 A;  1TWA J;  3RKQ A;  3DPJ A;  4M3D A;  2WB1 N;  3OIO A;  3NNR A;  3LSR A;  2YVE A;  2JA5 J;  3C2B A;  5CW8 A;  5IP9 J;  1EF4 A;  4UUS B;  3NAR A;  2MGQ A;  4V2F A;  5J1Y A;  1YRN A;  1W0U A;  1GUU A;  1T33 A;  5E3O A;  1WI3 A;  4BBS J;  2UXU A;  3BG5 A;  4JYK A;  2OF7 A;  4XID A;  1IDY A;  4AF5 A;  4AC6 A;  5J3L A;  2G7S A;  4L5E A;  3Q0U A;  2JJ7 A;  2HOS A;  4B3A A;  2LR8 A;  3GTM J;  3OSG A;  2EZI A;  2KDZ A;  1W0T A;  3ZQL A;  1HOM A;  2UXO A;  4GCK A;  2L9R A;  3BT9 A;  5EEA A;  2QWT A;  2VKV A;  3HIM A;  1JKP C;  2L7M P;  5IOZ A;  1F43 A;  1IV6 A;  2Y30 A;  2DA2 A;  4A93 J;  2GUH A;  2LY9 A;  2R5Z B;  5FHP A;  2MG4 A;  2Y9Y A;  3JRB A;  5F04 A;  3BRU A;  4GCT A;  1QRY A;  3HBL A;  2EH3 A;  2R5Y A;  1E3O C;  2ZOZ A;  2XPW A;  5M5X J;  2VI6 A;  2Q24 A;  1VF9 A;  2X6O A;  2FBQ A;  1RET A;  1MBF A;  4I6Z A;  3ZOB A;  3E7Q A;  2LD5 A;  1UI6 A;  1ETY A;  1GV5 A;  2QCO A;  1FTT A;  4ME9 A;  4XRM A;  3BCG A;  3FK6 A;  5EZG A;  3V78 A;  2RAS A;  3B81 A;  2E2J J;  2N8G A;  3B6A A;  1RKW A;  3Q3S A;  2HXO A;  2LTP A;  2XGE A;  2NVT J;  3M4O J;  1IRZ A;  2LP0 A;  4GFB A;  1IDZ A;  5FKM A;  4AUX A;  2FD5 A;  3VP5 A;  4A3J J;  2ME0 A;  4A3F J;  4GFK A;  4B1R A;  4MFE A;  2M8G X;  5HBU A;  5DS9 A;  4D7N A;  4QTR A;  1RKT A;  5K7Z A;  1PUF A;  4BKX A;  3BR2 A;  3JRE A;  1TWF J;  4M3F A;  5C3E J;  4JNN A;  2NX4 A;  1TWG J;  2Y31 A;  1JGG A;  1Y1V J;  5FKL A;  5F0F A;  2XGC A;  3DEW A;  3S2H J;  4GFL A;  4RDU A;  4IHX A;  2M34 A;  3GTL J;  3JRA A;  1I3Q J;  3H0G J;  5F0H A;  5F1J A;  1JUP A;  2HKU A;  2WUI A;  5EGO B;  4A3C J;  3CMY A;  3RZD J;  3S1N J;  1XC5 A;  3IH3 A;  4XRS A;  4I76 A;  2XB0 X;  2DMT A;  2GM4 A;  1P7J A;  3QBM A;  4FE4 A;  2UXI A;  1ZQ3 P;  5M5W J;  2K40 A;  4FIS A;  2M2E A;  2LKX A;  2O9L A;  3Q0V A;  4NEL A;  4DZP A;  2CJJ A;  3HOY J;  1GVD A;  3CQZ J;  2R0Q C;  1AKH B;  3G56 A;  5K58 A;  2R92 J;  4S0H B;  3SDG A;  3VVY A;  4A3M J;  2UXP A;  3MVP A;  3NI7 A;  5M5Y J;  5F0C A;  4DZJ A;  1T56 A;  2ZOY A;  4A69 C;  1MBE A;  2K9Q A;  4BY7 J;  5FJ8 J;  4ICH A;  4V2G A;  1XS9 A;  5CXG A;  2XDN A;  4M3B A;  3QQA A;  4Y7N J;  3OOU A;  2HOT A;  3ON4 A;  2X48 A;  4FCY A;  1ZTR A;  1XG1 A;  4MXM A;  1ETX A;  2QOP A;  2HQ5 A;  3O8G A;  5E3M A;  5FKK A;  3HTH A;  1BJZ A;  5IOY A;  3S14 J;  3ON2 A;  3S17 J;  3ANG A;  1UG2 A;  2B63 J;  2G3B A;  1LFU P;  3HOU J;  4MO7 A;  4AYB N;  4M3G A;  3JRH A;  2IBD A;  3G1L A;  4C3J J;  3CJD A;  2XSD C;  2DMP A;  3LNQ A;  2ECB A;  5J1U A;  2ID6 A;  4RBO A;  2E2I J;  4DYQ A;  2LK2 A;  3BR3 A;  2EQR A;  4B4C A;  1VFC A;  1QVU A;  3TED A;  1MH4 A;  1NTC A;  4IHY A;  2QIB A;  2ZCX A;  3P9T A;  2UXH A;  1ITY A;  3JR9 A;  4A3L J;  4MIM A;  1B72 A;  3BG9 A;  5IYD J;  2LVS A;  2Y0S N;  4M6V A;  4DYR A;  3L1P A;  1DU6 A;  4UDS A;  3HGG A;  3VOX A;  4ACI A;  3AQT A;  3MNL A;  3RH2 A;  1ETO A;  1OCP A;  2JWT A;  3HGY A;  1MSF C;  2DG8 A;  5CXI A;  2O7T A;  3M3Y J;  3KZ9 A;  1OJL A;  4A3D J;  4W1U A;  3FIW A;  1X58 A;  1IJW C;  5FGL A;  2FQ4 A;  5D1R A;  2H8R A;  3BTC A;  2JMW A;  2FX0 A;  5FLV A;  2R7Z J;  3BTJ A;  2IEK A;  5IYC J;  5C4X J;  4BBR J;  5EG0 A;  2NS7 A;  1H88 C;  5GPC A;  4MK6 A;  4PXI A;  3HOV J;  1U78 A;  5C4Y A;  4CYC B;  5EG0 B;  5E3L A;  4CYC A;  3ZQG A;  1Q1V A;  1ZR4 A;  3OSF A;  3GTQ J;  4M3E A;  4JX6 A;  3T6N A;  4ABZ A;  4JKZ A;  3K7A J;  3BHQ A;  2CUE A;  3GTJ J;  2O7O A;  2TRT A;  4A3G J;  1HDP A;  1AU7 A;  3JRF A;  2ELK A;  3HOZ J;  2RHA A;  3COL A;  4JX4 A;  2LFB A;  2MW8 A;  3NRG A;  1RES A;  5AQC A;  2R5Y B;  2HXI A;  4QSH A;  3GTO J;  2JA7 J;  3G1M A;  2D6Y A;  1X2M A;  2DA5 A;  2G0E A;  3LSG A;  3QPS A;  5EGO A;  2ZCM A;  1LE8 A;  5EDN A;  1MSE C;  2PZ9 A;  4C2M J;  2PBX A;  3FKI J;  4JL3 A;  3GZI A;  5IP7 J;  4UUT A;  1NK3 P;  1TC3 C;  5H9T A;  1AKH A;  1Z0X A;  3BTL A;  1ETW A;  4BXX J;  3VVZ A;  1IGN A;  2OPT A;  4AC0 A;  3I4N J;  3TP3 A;  1YRN B;  1QPI A;  4A3B J;  3A03 A;  4LOC A;  1A5J A;  1BA5 A;  5HSZ A;  5M3F J;  1JTX A;  1TWC J;  3UKG A;  1GT0 C;  2CRG A;  3BQZ A;  2DJN A;  2R93 J;  4QIW N;  2XPU A;  3H3V K;  3ZQI A;  3SFI A;  4L62 A;  3ANP A;  5EFY A;  5DAJ A;  3PO2 J;  3KKC A;  5HAW A;  3JRD A;  2K9S A;  1MBH A;  1ENH A;  3D1N I;  4IHV A;  2E2H J;  2VPR A;  3PAS A;  2L7Z A;  5JLX A;  3JRG A;  3G1O A;  3JRC A;  1FTZ A;  2JA6 J;  3EUP A;  1MBK A;  1FIA A;  3JSJ A;  5M3M J;  1ORK A;  3JRI A;  3VIB A;  2AO9 A;  2DA4 A;  1TWH J;  3VW1 A;  2MSY A;  2CQQ A;  2R5Z A;  3LSJ A;  1UMQ A;  2DA6 A;  5F08 A;  2EBI A;  1X2N A;  5F27 A;  1QVT A;  5IYB J;  1BL0 A;  2E19 A;  4DW6 A;  5D19 A;  2W48 A;  2DTZ A;  1SGM A;  2XRL A;  3TW6 A;  4XIC A;  3VW2 A;  3K2A A;  1CQT A;  1WPK A;  3BTI A;  3QKX A;  3NXC A;  2EZL A;  3A01 A;  1IC8 A;  1JT6 A;  1IUF A;  3CCY A;  1ZR2 A;  3IH4 A;  3ZQC A;  3LOC A;  4W97 A;  1G2H A;  2CU7 A;  4NDL A;  3BJB A;  3F1B A;  2QKO A;  3CRJ A;  5HOD A;  2NVY J;  2VKE A;  2DG7 A;  5K7H A;  3AQS A;  4IEJ A;  1POG A;  4UUS A;  4BY1 J;  3C07 A;  2ECC A;  1SAN A;  2P81 A;  3SJM A;  2NOG A;  4FTH A;  3HDD A;  3S1M J;  1HF0 A;  3RZO J;  3BR6 A;  2AHQ A;  3BR5 A;  1GDT A;  2E1O A;  3LSP A;  5FKN A;  4XRS G;  2Y2Z A;  2JK3 A;  2ZB9 A;  4CGR A;  2L7F P;  3MKL A;  3S1Q J;  3V6G A;  1GV2 A;  1VI0 A;  1B8I B;  1OCT C;  5GPA A;  1LFB A;  1B72 B;  3IH2 A;  1S7E A;  3VOK A;  1D5Y A;  1B8I A;  2COB A;  2RAE A;  1K61 A;  3GBG A;  3ZQF A;  3KKD A;  1UHS A;  3WHC A;  2IAI A;  3BR1 A;  3I4M J;  3CWR A;  2GLO A;  3ZQH A;  1LE8 B;  3E7L A;  2G7L A;  1UI5 A;  1JUM A;  2DMU A;  3HTI A;  3LWJ A;  3RD3 A;  3DCF A;  2V57 A;  4EEF G;  1ETQ A;  3VPR A;  1RR7 A;  1MBG A;  2OI8 A;  3HKZ N;  3NAU A;  3F0C A;  3GTP J;  3FK7 A;  3O8H A;  5IP6 A;  1JKQ C;  1IG7 A;  3S2D J;  5GP9 A;  1Y1W J;  1F36 A;  4XK4 A;  3PPB A;  4KWA A;  1JJ8 C;  2QF7 A;  1WGX A;  3HOW J;  1HCR A;  3LHQ A;  1SFO J;  2IU5 A;  4J19 A;  1FIP A;  2I10 A;  3IUV A;  2XB5 A;  4X6A J;  2M9H A;  2F07 A;  2W53 A;  1ZK8 A;  2CQX A;  2DMQ A;  3WHB A;  4MLO A;  3A02 A;  4HNV A;  2WAQ N;  5JLW A;  1DU0 A;  1I6H J;  2OER A;  1JTY A;  5D18 A;  2H1K A;  5IPA A;  3W6V A;  3VW0 A;  1O4X A;  1JT0 A;  4D5C A;  3TW7 A;  2O8K A;  3LJL A;  1I50 J;  3FIS A;  1JUS A;  4GCL A;  2CUF A;  3HEF A;  3RQI A;  3B6C A;  4FE7 A;  2FJ1 A;  2LLK A;  2YUS A;  3QPL A;  1MNM C;  2EZK A;  1R9T J;  2DN0 A;  4MFD A;  2HI3 A;  1HDD C;  3FRQ A;  3S1R J;  1JKO C;  5FMP A;  2JA8 J;  3G7R A;  1K83 J;  1BW6 A;  3EGQ A;  1ETK A;  2G7G A;  3TP0 A;  2ID3 A;  1BW5 A;  2WV1 A;  1JJ6 C;  2NVX J;  1U9O A;  1WCM J;  3GEU A;  3BG3 A;  2DA1 A;  3KNW A;  2YS9 A;  2Y9Z A;  1MH3 A;  2XGD A;  5DTD A;  5C44 J;  3HB9 A;  3BNI A;  4C3I J;  2HYT A;  4IHW A;  2ZCN A;  3GTG J;  1WH5 A;  3IV5 A;  3HOX J;  3Q0W A;  2QTQ A;  2XPV A;  2VUM J;  5FLM J;  5E3N A;  4C3H J;  5EYR A;  3HM5 A;  3PO3 J;  5EZH A;  3BQY A;  2HOA A;  2REK A;  1ETV A;  1P7I A;  5J1R A;  2D5V A;  4D7M A;  3S16 J;  1ZKG A;  2DA7 A;  4Y52 J;  2YVH A;  2NP5 A;  1U9N A;  3CDL A;  4JP0 A;  1HLV A;  2HYJ A;  2X9D A;  2ME6 A;  4D5F A;  3HTJ A;  4X1E A;  3S5R A;  2NS8 A;  4G12 A;  4A3K J;  1Z77 A;  1OFC X;  5K7F A;  1PUF B;  2NVQ J;  3MN2 A;  2DA3 A;  2GFN A;  2L0K A;  3NPI A;  1H8A C;  1FJL A;  2K9N A;  5C4J J;  4A3E J;  2GEN A;  2HDD A; 
#chains in the Genus database with same CATH topology
 2OCC H;  5EEG A;  2I5U A;  3BJO A;  3QU3 A;  4CDG A;  5B66 C;  1Z91 A;  5CKT A;  3L2W A;  1IRX A;  4G7H F;  1FEX A;  1X1D A;  4B3X A;  5AIQ A;  3WTT C;  1TQM A;  1WH7 A;  3O60 A;  1O3T A;  1FMV A;  2OU2 A;  2DK5 A;  4L5I A;  2KT0 A;  2EIM H;  2HZT A;  2RV8 A;  3A01 B;  4DYC A;  1ZGW A;  4KFC A;  1H9T A;  5H20 A;  9ANT A;  2WB1 A;  1KON A;  2WV0 A;  4WXD A;  3CP8 A;  1TWA J;  3DKW A;  3R61 A;  4JX5 A;  3RKQ A;  4IX7 A;  4BU2 A;  3OYM A;  2BE5 F;  3OIO A;  3LSR A;  3NS4 A;  1KYZ A;  2E7X A;  4FAS D;  2EJR A;  1KQ0 A;  1W0U A;  5HDN A;  1T33 A;  1WI3 A;  3BG5 A;  4XID A;  1IO2 A;  2DT5 A;  1JI8 A;  5AIP A;  1WJB A;  3C3W A;  1Z21 A;  5DYM A;  4AC6 A;  3R60 A;  5J3L A;  4L5E A;  4CCJ A;  2LR8 A;  3CJR B;  4XMY A;  4BXU A;  2UUZ A;  1Y6I A;  2UXO A;  2VOO A;  4PK4 A;  4GCK A;  5E79 C;  3EDP A;  4DNC A;  3KP5 A;  5IOZ A;  1E2X A;  4XLP F;  1VQ6 I;  5BS6 A;  4A93 J;  1FPQ A;  3ZMU A;  4YG2 F;  2LY9 A;  2R5Z B;  2MD0 A;  2OC6 A;  4AIJ A;  5FHP A;  2MG4 A;  3JRB A;  3BRU A;  1F4K A;  2KJC A;  1W36 D;  3SWH A;  2ZOZ A;  3KP3 A;  2F6C A;  1X19 A;  5B3S H;  2XPW A;  2Q24 A;  3EUA A;  4GYG A;  2QQA A;  2W25 A;  2DFF A;  4ETS A;  3SZP A;  1SFK A;  1RET A;  2NXN B;  1MBF A;  5H6Q A;  3IP4 B;  5FFZ A;  2LD5 A;  2E5N A;  3DTE A;  2ZBK A;  1FTT A;  1OYY A;  2QCO A;  5DUI A;  4XRM A;  4OD4 A;  2P5V A;  2QBY A;  1JGS A;  4XKV A;  3RPQ A;  3CZ6 A;  1SAU A;  4PJ0 C;  2CYY A;  2CW8 A;  3M4O J;  2J5O A;  2MC4 A;  2RDP A;  2M87 A;  1O7L A;  2EIL H;  3QAH A;  1U5T B;  4XOT A;  3VP5 A;  1ZGA A;  2ZXW H;  3K4K A;  1YJW I;  2EFP A;  4A3F J;  2IS6 A;  4B1R A;  4U88 A;  4MFE A;  2Y69 H;  4QTR A;  3RCO A;  4M9S A;  3J80 K;  1RUN A;  4RGS A;  3U1D A;  3JRE A;  4HST A;  4JNN A;  3KYL A;  3LAJ A;  2NX4 A;  1TWG J;  2OUM A;  4XLE A;  2LRE A;  3KLN A;  2DW4 A;  4BDZ A;  4GFL A;  2FRH A;  4C9Y A;  1AWC A;  5IT9 Z;  2P6S A;  4RMN A;  1W1W E;  2XUB A;  4AD9 A;  4KYW A;  5F0H A;  2Q0O A;  1SD7 A;  2HKU A;  3L9F A;  3CMY A;  1W5T A;  1XCV A;  4XRS A;  4LJZ F;  1HKT A;  2FE3 A;  2XF6 A;  3KP4 A;  2DMT A;  4MNU A;  5EJC A;  2GM4 A;  1P7J A;  2W24 A;  4HX4 A;  2OTL I;  1SD5 A;  1ZYR F;  3HRS A;  4II3 A;  2HDC A;  1SEU A;  2DXI A;  1T0F A;  4NEL A;  3GCM A;  1IUY A;  3DU5 A;  2HYG D;  1ZRF A;  3F8B A;  2R0Q C;  2LF7 A;  3BZ6 A;  3D5R C;  3O6B B;  1BC8 C;  3W6K B;  3VDX A;  1MGT A;  4UNO A;  2R7F A;  1HW5 A;  4WF2 A;  2FA5 A;  2LRD A;  5L3G A;  2MLK A;  3CJQ B;  4BE1 A;  4Q47 A;  1SVO A;  4DZJ A;  3MWM A;  4A69 C;  3DF8 A;  3K2Z A;  4V2G A;  1XS9 A;  3ON4 A;  3C18 A;  1XG1 A;  3BC8 A;  3S14 J;  3ON2 A;  1YJ9 I;  3ANG A;  2XDV A;  1WJE A;  3E5Q A;  4MO7 A;  3JRH A;  3ROU A;  2BHY A;  2IBD A;  2FEZ A;  3G1L A;  4NHJ A;  1UEL B;  2ZY9 A;  1LDD A;  2ECB A;  4RAY A;  5J1U A;  4RBO A;  1UAA A;  2BGC A;  4EJV A;  1U3E M;  1GXP A;  2EQR A;  2VBZ A;  4L9V A;  1YLF A;  2WTE A;  2UXH A;  2KP6 A;  3S2W A;  4A3L J;  5J40 A;  4XLA A;  1XDS A;  3WU1 B;  2Y0S N;  3M8E A;  4M6V A;  3CCU I;  3L1P A;  3F22 A;  5IYD J;  1DU6 A;  4UDS A;  3VOX A;  2DG8 A;  3M3Y J;  1S9H A;  2G9W A;  3CF2 A;  3FXU A;  3E6M A;  2NS0 A;  2O6G E;  5KVR A;  3L7W A;  3H3U A;  5FGL A;  2FQ4 A;  5D5X B;  2EV6 A;  1N77 A;  2IGM A;  3BTC A;  2JMW A;  5L3B A;  1R4N B;  2FX0 A;  4OOI A;  4CHU A;  1IN6 A;  4BBR J;  2KKO A;  3ZMD A;  3SEQ A;  2NS7 A;  4PXI A;  3HOV J;  1U78 A;  3AL0 B;  2FBK A;  4N4N B;  4LLL A;  2QEX I;  1ZR4 A;  1T6S A;  2DQL A;  2W84 A;  3ABM H;  1UST A;  4RB3 C;  5D6E A;  5FRM A;  2VJ4 A;  2V1D A;  5K5Q A;  3NRV A;  2F5F A;  3WTS C;  3GTJ J;  4FX4 A;  4B48 A;  2MBF A;  3JRF A;  1VQO I;  2B3W A;  1L0O C;  4DVY P;  3V8L A;  3RI4 A;  2VQH A;  4JX4 A;  2LFB A;  2MW8 A;  3NRG A;  5FRO A;  1RES A;  4LB5 A;  5AQC A;  1FP2 A;  2W85 A;  4QSH A;  2L01 A;  1IXC A;  3F8N A;  1Y0U A;  1P4A A;  4QPQ A;  4E70 A;  2WAE A;  2B9S A;  3CC7 I;  2D6Y A;  2G0E A;  5J4V A;  5EDN A;  2KIF A;  2PBX A;  4XLN F;  3AG2 H;  2OD5 A;  3SDB A;  4UUT A;  5HS9 A;  4EM1 A;  2A3S A;  2KDO A;  1NK3 P;  4CCO A;  1ZLJ A;  2WAQ A;  1FSH A;  1ETW A;  1R58 A;  2VBX A;  2QSH X;  3DBL B;  3ZMV A;  1Q1H A;  1Y8R B;  2OPT A;  4AC0 A;  4WCG A;  1R00 A;  1YX3 A;  2R7X A;  4R8H A;  3WG7 H;  5M3F J;  3BZK A;  3GFM A;  3DEU A;  3UKG A;  2CRG A;  3ABL H;  2B7E A;  2FNA A;  4JBA A;  4XKC A;  3OYC A;  4GCV A;  5FGM A;  4U7B A;  4ZC3 A;  2W4S A;  4CZZ A;  2EK5 A;  2DT7 B;  4L62 A;  2IA2 A;  3ANP A;  4R1H A;  3PO2 J;  4KIF A;  5J8C A;  2P4W A;  2ELH A;  3D1N I;  1FY7 A;  5F64 A;  2E36 A;  2E2H J;  1YW9 A;  4E4H A;  2VC1 A;  3G1O A;  4I02 A;  3AKZ A;  1FTZ A;  2JA6 J;  4M9X A;  1A35 A;  4IRI A;  3EUP A;  2V7F A;  4AID A;  1FIA A;  5JVG F;  1G8X A;  2IP2 A;  5M3M J;  2J5P A;  3VIB A;  1LPQ A;  2W1O A;  2IS2 A;  2DA6 A;  1X1P A;  5F08 A;  2EBI A;  5F27 A;  4CUG A;  3BZC A;  3QWL A;  5IYB J;  4BDY A;  3VWB A;  3I59 B;  1SGM A;  3TW6 A;  2JUG A;  1CQT A;  3NXC A;  1LVA A;  1MJ9 A;  3TBI A;  3G3Z A;  3WTU C;  1EJ9 A;  1S8N A;  3J7Z I;  3V7S A;  4ZYG A;  4C2M A;  2CU7 A;  5LHI A;  2CW7 A;  3OMY A;  1W4M A;  1ZAO A;  2OZU A;  5K7H A;  1R5H A;  4LGW A;  1HBX G;  3EYY A;  4DBR A;  2GQQ A;  4IEJ A;  4L9J A;  4RAG A;  4UUS A;  2ECC A;  2P81 A;  1MJB A;  4M9Z A;  4FTH A;  2AS5 F;  4C2U A;  3RZO J;  3CLO A;  2AHQ A;  3LSP A;  3ZQ7 A;  5FKN A;  4XRS G;  3CUQ A;  5HDK A;  4HNU A;  2K3F A;  2MFZ A;  3V6G A;  1YX5 A;  2V26 A;  3IH2 A;  3ONQ A;  1P9Q C;  1S7E A;  2EIN H;  2RQQ A;  1D5Y A;  2RAE A;  2RGV A;  4IRG A;  4A12 A;  4RB0 A;  1K61 A;  2KJB A;  3GBG A;  3ZQF A;  1ZG3 A;  1OIS A;  2CFO A;  3OYA A;  3K9T A;  1LE8 B;  1QBJ A;  3G73 A;  3RD3 A;  3HTI A;  3DCF A;  2LF8 A;  4EEF G;  1ETQ A;  5D5V B;  2V57 A;  5D5U B;  3TMO A;  5BOX A;  3GTP J;  3FK7 A;  3ZXS A;  1JKQ C;  2AXT C;  4L9T A;  3S3N A;  3KEY A;  5CVR A;  2X4H A;  3HOW J;  3LHQ A;  1SFO J;  3AAF A;  3DEE A;  4KMF A;  3GFJ A;  4A0X A;  3U9G A;  1D1B A;  4IQJ A;  2BV6 A;  1ZK8 A;  2XGX A;  2WAQ N;  1HW2 A;  3EQL F;  1WQ2 A;  5JLW A;  2KZV A;  1JTY A;  1DU0 A;  2QGU A;  2OER A;  1QZZ A;  5IPA A;  1JT0 A;  4PJN A;  2A68 F;  1YE9 A;  3TW7 A;  1MW7 A;  3VYU B;  1X1A A;  1I50 J;  3R6S A;  4GCL A;  1QZY A;  2X1E A;  3RQI A;  3M7G A;  2IA1 A;  4MHG A;  2P5L C;  2EZK A;  4BEH B;  1MNM C;  4L0Z B;  2DN0 A;  1KQ9 A;  2IA0 A;  4MFD A;  3S1R J;  4LB6 B;  3DLA A;  3EGQ A;  1PP8 F;  2LH9 A;  2ID3 A;  2WV1 A;  1JJ6 C;  1X1B A;  5HNF A;  5DM6 F;  1SMY F;  2YS9 A;  3HTU A;  2OJE D;  3DKY A;  3MCZ A;  2LDU A;  4HQM A;  5DTD A;  3ZN1 A;  1PDN C;  1VZ0 A;  4LIU A;  4C3I J;  2KRH A;  3RDI A;  4L0Y B;  3OWT A;  3SYT A;  3GTG J;  1BJA A;  2L2O A;  3JAM K;  3DTK A;  4RGR A;  4KUM A;  2CH0 A;  4EMS A;  1DPR A;  3E6B A;  5E3N A;  3MFK A;  3HM5 A;  2HPI A;  2ACJ A;  2KHM A;  3PO3 J;  4IRV A;  2A6T A;  2REK A;  1ETV A;  4CCK A;  3KEO A;  1R49 A;  3K4M A;  1ZKG A;  2BOL A;  3I4P A;  3EUK L;  2NP5 A;  1UCR A;  3RPU A;  4A0Y A;  4IOA F;  2ME6 A;  4D5F A;  1MD0 A;  1UHW A;  1LDK B;  2M7B A;  4G12 A;  5HDG A;  4A3K J;  2EPF A;  1FOX A;  3MN2 A;  4EJT A;  4RGU A;  2GFN A;  1J0R A;  5KCM A;  4PJL A;  2V4J C;  5C4J J;  4LLN A;  1LJ9 A;  2VJI A;  3IC7 A;  3Q9V A;  5FKO A;  4KT6 A;  1U8B A;  1R7J A;  3ERM A;  3S93 A;  5BNG A;  1B9M A;  4HKU A;  1P4W A;  2RQP A;  4NC8 A;  5GAD J;  5CQG A;  2A2F X;  5K5R A;  3S15 J;  1LEA A;  1C0W A;  3GTK J;  2WY7 Q;  5IT3 A;  2R7S A;  2JT1 A;  2QKL B;  4UVA A;  1VND A;  1JKR C;  3IWF A;  5EF6 A;  2WGB A;  1NK2 P;  1BR2 A;  3OL3 A;  1PP7 U;  1AHD P;  4N4O B;  3G71 I;  5L3E A;  3CDI A;  1K6Y A;  3DPJ A;  4PDK A;  2KPM A;  3DPT A;  3FMS A;  3FMR A;  2WB1 N;  3I3L A;  4ZZL A;  1BI1 A;  5CW8 A;  4BAY A;  1EF4 A;  3FHZ A;  1UG0 A;  2MGQ A;  2DTR A;  4HW0 A;  4ENM A;  2BY0 A;  4MTE A;  5DDG A;  1VQL I;  1GUU A;  2V6E A;  1O3Q A;  4CXF A;  4BBS J;  2UXU A;  4HNT A;  4H4K C;  1IDY A;  2BVL A;  4A5N A;  2P7V B;  4Y4R A;  3CF5 F;  3Q0U A;  5J6X A;  2JJ7 A;  2HOS A;  3GTM J;  3OSG A;  1NG6 A;  4HA8 A;  2KDZ A;  2R7U A;  1A6Q A;  3K70 D;  4A5M A;  5EEA A;  2VKV A;  2IGN A;  3MEX A;  1JKP C;  3OYI A;  2L7M P;  3QYB A;  1F43 A;  1Y8Q B;  1V3F A;  5ED4 A;  1T0F C;  3OS1 A;  4S05 A;  1B59 A;  5DCM A;  5F04 A;  2NVU B;  4GCT A;  2XKP A;  1QRY A;  3HBL A;  1E3O C;  2RNJ A;  1S5L C;  4EM2 A;  1TW2 A;  5M5X J;  4LG0 B;  2Y0M A;  4F55 A;  1J7K A;  2UZK A;  4PZJ A;  2KRF A;  1ETY A;  2ESN A;  4ME9 A;  1VTN C;  4F52 A;  2PLY A;  1O3R A;  3BCG A;  3FK6 A;  4F93 B;  5ILU A;  1XPX A;  4WIB A;  1O57 A;  3B6A A;  1AOY A;  5LHG A;  1FBQ A;  2YPR A;  2HXO A;  3MMY B;  2LTP A;  2XGE A;  1A31 A;  2DLL A;  4PUS A;  1WJ5 A;  4CA0 A;  2GAU A;  2LBF B;  5FKM A;  2PBI A;  1VQP I;  2H27 A;  2ME0 A;  4GFK A;  1WRJ A;  5FLX K;  5CYV A;  4IF4 A;  2M8G X;  4D7N A;  1RKT A;  5TIS C;  5LEJ A;  1T98 A;  2RKH A;  3SQN A;  3BR2 A;  1OCC H;  1TWF J;  4M3F A;  4XKW A;  2XRN A;  2PJR B;  4XLF A;  2Y31 A;  1E0E A;  5CVJ A;  5FKL A;  2OAZ A;  2XGC A;  3DEW A;  3T1B A;  3GTL J;  3K8P C;  1I3Q J;  3ZMT A;  1J75 A;  5LRR A;  5F1J A;  1XGS A;  2WUI A;  2MLG A;  4A3C J;  4U87 A;  4HX7 A;  1Z7L A;  3IH3 A;  3LFK A;  4UVB A;  3S1N J;  2XB0 X;  3OYH A;  3I64 A;  1R1V A;  3K10 A;  4FE4 A;  4M71 A;  4N9H A;  1T8I A;  2UXI A;  2F4O B;  5M5W J;  4XRF A;  2H94 A;  3VFZ A;  4R79 A;  2O9L A;  2UWM A;  1YW7 A;  4E7I A;  4DZP A;  5ERI A;  1QA6 A;  5AON A;  4HDV A;  6PAX A;  5FFX A;  4DIQ A;  3HOY J;  2O8X A;  3G56 A;  2LY2 A;  1W5S A;  2VN2 A;  1I3A A;  3F3X A;  1D8K A;  1V5F A;  1YHQ I;  1REP C;  3ZR8 X;  1DGW Y;  4S0H B;  3SDG A;  4Q48 A;  4I0B A;  2F4M B;  5HNH A;  4GDF A;  2UXP A;  3L09 A;  4L5J A;  1VQ4 I;  3MVP A;  3NI7 A;  4GGG A;  4KIC A;  2EFW A;  1JXS A;  1MBE A;  3DP7 A;  5CXG A;  4IKF A;  3PFY A;  2R7Q A;  3I9V 2;  2XDN A;  4M3B A;  3QQA A;  3OOU A;  1ETX A;  2HQ5 A;  5FKK A;  3FXJ A;  3S3O A;  1BJZ A;  1YS7 A;  3CC4 I;  3PSF A;  4M73 A;  1D1A A;  1LFP A;  5H6R A;  3S17 J;  2K9M A;  2G3B A;  2VJJ A;  4AYB N;  4JK1 X;  1H0M A;  3CJD A;  2XSJ C;  2HEO A;  2XSD C;  1SMT A;  4XSX F;  3OYK A;  4UV8 A;  2D1H A;  3HIF A;  2E2I J;  4DYQ A;  2O5R A;  3N97 A;  1D0Y A;  1NTC A;  2CSO A;  2ZO4 A;  3HG9 A;  1ITY A;  3JR9 A;  4M6Y A;  2BVM A;  3BG9 A;  4DYR A;  1BI3 A;  3HGG A;  4YFX F;  4C30 A;  1ETO A;  1OCP A;  3HGY A;  4EJU A;  4D0P A;  4A3D J;  2QSG X;  1KA8 A;  4W1U A;  2L7K A;  4YFN F;  3FIW A;  4TV7 A;  4B44 A;  3F23 A;  1I27 A;  3R4K A;  3FMQ A;  2H8R A;  3CJT B;  2BW3 B;  3SHF A;  1XD7 A;  4KIB A;  4KNY A;  1P92 A;  2CV0 A;  4LFU A;  4B09 A;  2BW3 A;  2IEK A;  3BTJ A;  5IYC J;  1VQ5 I;  1Z6R A;  4HRI A;  4WWC A;  5EG0 A;  3JTG A;  5GPC A;  4DBQ A;  3KET A;  2L9S A;  5GAE J;  5C4Y A;  4CYC B;  2IRF G;  2LKP A;  5E3L A;  4BS9 A;  2IPQ X;  3V8J A;  3LFU A;  4M3E A;  3LAP A;  1GXQ A;  4HPQ A;  4ABZ A;  2KZG A;  2CUE A;  4EAT A;  2TRT A;  3GX4 X;  2QA4 I;  3U2R A;  2ELK A;  1RC9 A;  3COL A;  3K69 A;  2YR2 A;  2H09 A;  2PN6 A;  2GWR A;  3VSK A;  2BHZ A;  2JA7 J;  3RTR A;  4HLY A;  2UV1 A;  3DWL E;  4ENJ A;  2DA5 A;  1MMN A;  4Y13 A;  3QPS A;  2ZCM A;  1LE8 A;  1MSE C;  5JHU A;  4JL3 A;  1FT9 A;  3GZI A;  2P8T A;  1WJF A;  4HF1 A;  3CCV I;  2WY8 Q;  5E18 F;  1T38 A;  5DCM B;  4IZZ A;  2P6T A;  5E1W A;  2C6Y A;  1AKH A;  4OAY A;  3TGN A;  5HOO A;  3BTL A;  4RB1 A;  3LL7 A;  3OIP A;  4XBF A;  3NEU A;  3REO A;  3LA3 A;  5JHF A;  5JR3 A;  4CYD A;  3I4N J;  1YRN B;  1UZC A;  4P9U A;  1QPI A;  3VOE A;  2R7R A;  5HSZ A;  2HTJ A;  4G6T B;  1A5J A;  3P9I A;  2VXD A;  2GIV A;  1DQU A;  1JTX A;  4UUV A;  2XAU A;  2QYO A;  1IV8 A;  3CUQ C;  1Y56 A;  3K4C A;  1RIO H;  1R5I D;  1DP3 A;  2FUG 2;  5TGT A;  2HOE A;  3L2U A;  3OIQ A;  4XLH A;  1LKX A;  2R7D A;  4QIW N;  3ZQI A;  2VQL A;  1V5E A;  5DAJ A;  2WA0 A;  1DPU A;  2HKX A;  4KN4 X;  1CF7 A;  5HAW A;  2ZSI B;  4OD5 A;  4NB5 A;  4A0Z A;  2HNH A;  2L7Z A;  4RA2 A;  1X1C A;  3JRC A;  3M1E A;  1K6O A;  1R6R A;  1YS6 A;  4OMZ A;  2K27 A;  5DD8 A;  3JSJ A;  1J5Y A;  3IRR A;  2AO9 A;  2VPL A;  4E7K A;  4FX0 A;  1UMQ A;  5E8G A;  2DYR H;  1U5T C;  4HAM A;  1X2N A;  1M1E B;  2HPM A;  2E19 A;  4PFO A;  4Z2Y A;  4B43 A;  4DW6 A;  5D19 A;  2W48 A;  4CCM A;  2DTZ A;  2XRL A;  2M4G A;  4XM3 A;  3PIP F;  1YQA A;  3K2A A;  4LK1 F;  1I1S A;  3BTI A;  3QKX A;  3ABU A;  3RYP A;  1OR7 A;  1IC8 A;  1I1G A;  3A01 A;  4PCQ A;  3GVA A;  1BIA A;  4I01 A;  1JT6 A;  2VB6 A;  2ISY A;  4E7J A;  1BI0 A;  5D8K B;  1FBS A;  1ZR2 A;  3IH4 A;  3ELK A;  3J7A Y;  3D5L A;  3LOC A;  1S7O A;  2IGO A;  3H5A A;  3FZV A;  4NDL A;  1G2H A;  4NUB A;  3CO7 C;  4DGW B;  2QKO A;  5HOD A;  3OYL A;  1SFE A;  2DJI A;  2A69 F;  3CP2 A;  3ZPL A;  3PFI A;  5DM7 F;  2JZY A;  3BG6 A;  4CGZ A;  1PYV A;  5FB2 A;  3I55 I;  1IRF A;  2LC2 A;  2X6X A;  3DU6 A;  3BY6 A;  5EEH A;  2M5W A;  2MH2 A;  2COM A;  3BR5 A;  3GF2 A;  3OYE A;  2NNY A;  4A6E A;  2IW5 A;  1KQ8 A;  3W2V A;  2K3P A;  3QP5 A;  4NQW A;  2JK3 A;  1E3H A;  3H9G A;  3QYE A;  3LWF A;  2L7F P;  5J8F A;  3DBR B;  1LVK A;  1VI0 A;  4KIS A;  1MZB A;  3TL4 X;  1TL8 A;  2IS1 A;  1WZ2 A;  3COA C;  3VOK A;  1B8I A;  2BBY A;  3A0H C;  3CES A;  3V8K A;  4B47 A;  5B1A H;  4WK8 F;  1MMS A;  3KKD A;  2EA2 A;  3R0A A;  3CWR A;  3I4M J;  2OQR A;  2GLO A;  1STZ A;  2JRM A;  1CGP A;  3ZQH A;  2RC4 A;  2EV0 A;  3GXO A;  4XSZ F;  3LWJ A;  2A07 F;  2A61 A;  3KIO A;  3F0C A;  1DUX C;  2LKS A;  3V42 A;  5GP9 A;  1Y1W J;  1F36 A;  3CCM I;  4XK4 A;  2PMU A;  1JJ8 C;  3I59 A;  4P55 A;  3IKT A;  3S3M A;  4UB6 C;  4KN7 X;  3ZCO A;  1IXR C;  4XKB A;  1FIP A;  1WJD A;  4G6D A;  1N75 A;  3FBI B;  3IUV A;  4Y33 A;  2O61 A;  2M9H A;  4Z6Y A;  2F07 A;  2CQX A;  3C1D A;  2DAO A;  3DBH B;  4MLO A;  3A02 A;  4HNV A;  4BL0 B;  1XGO A;  1I6H J;  3K1P A;  1D3Y A;  2H1K A;  3W6V A;  3VW0 A;  3D0S A;  3I58 A;  3FWE A;  4FET A;  4IO9 F;  2GIZ A;  2KLO A;  3U21 A;  1R22 A;  1OYI A;  5KNL A;  1FBU A;  3QYF A;  3LSM A;  3H1C A;  3T0Y A;  3CUO A;  1OR7 C;  3CC2 I;  3FRQ A;  4OMY A;  2V6C A;  3K70 C;  3N4M A;  4N0B A;  5FMP A;  3G7R A;  4LD5 A;  1R1T A;  1BW6 A;  2M7A A;  5ILV A;  2FU4 A;  3H0D A;  2XKO A;  2W00 A;  1BW5 A;  3QOE A;  2JRT A;  2DA1 A;  4Y15 A;  3KNW A;  1X4P A;  4NNJ A;  1MH3 A;  3MD2 A;  2IS4 A;  2XGD A;  5C44 J;  3KFW X;  1EA3 A;  1KGS A;  4MGR A;  3CCJ I;  1SAX A;  4MQV A;  3W2A A;  2ZCN A;  4DOZ A;  5B5E C;  1QHG A;  4KIT B;  2ZME C;  5D5W B;  3PUB A;  4AM3 A;  1XSX A;  2KQR A;  4MQ9 F;  2XPV A;  5FLM J;  1HC8 A;  3NWS A;  2XIG A;  2XRO A;  5EZH A;  3ZRG A;  3KP6 A;  4I99 C;  2CQN A;  3BQY A;  2HOA A;  2R7O A;  4ZTJ A;  1P7I A;  1BOA A;  2AXL A;  2L02 A;  1IN8 A;  4BJ5 C;  4ZZD A;  3JTH A;  1QHH D;  5GTI C;  3GZ5 A;  2YVH A;  2K4J A;  3ML6 A;  2DT6 A;  1ZGJ A;  2X9D A;  1OLT A;  5E1X A;  3H9J A;  1NH3 A;  4F92 B;  3WGH A;  3KZZ A;  3OYB A;  2Z16 A;  2FF4 A;  2NVQ J;  1PUF B;  3FM3 A;  4II2 A;  1XB4 A;  4AVZ A;  4M72 A;  3IKV A;  1FMW A;  1FYK A;  3NPI A;  1VQK I;  3VYS B;  2HVS A;  1FJL A;  1T2K A;  1RR8 C;  4I09 A;  3OS0 A;  4A3E J;  2DPD A;  2FQ3 A;  4EGZ A;  4UB8 C;  2ZC2 A;  2MC3 A;  3QRF F;  4UY8 I;  5KAI C;  3BR0 A;  1BC7 C;  3MZY A;  1K78 B;  1G3T A;  4I2O A;  4BJT A;  3FXQ A;  3PM1 A;  3LA2 A;  3DV8 A;  3C2H A;  4XL9 A;  2GA1 A;  2NP3 A;  4U9N A;  3VVX A;  3QP6 A;  3AG4 H;  3E5X A;  2OCE A;  2F5E A;  4XN3 A;  1APL C;  1YYV A;  2VE9 A;  4EGY A;  3AFH A;  2QUF A;  3HE0 A;  4NN1 A;  2P7C B;  3K4J A;  3ASO H;  2TDX A;  1HSJ A;  1RPW A;  3BCB A;  1G6N A;  2X1D A;  2GBY A;  3FF5 A;  5BPI A;  1ZN2 A;  2FMY A;  3E3V A;  2TCT A;  5E17 F;  2PMZ N;  1G3S A;  2ZNZ A;  3IHU A;  1LQ1 A;  5BPD A;  3P5J A;  3LSK A;  4RGX A;  3P9C A;  4CSW A;  4IHT A;  3NNR A;  2YVE A;  4OIP F;  2CFX A;  4CIC A;  1OCZ H;  3NAR A;  4V2F A;  1K4S A;  5J1Y A;  1YRN A;  5DCF A;  4NBQ A;  4IQ4 A;  3BCA A;  3OR1 C;  5E3O A;  4JYK A;  2ELJ A;  1J2X A;  4AF5 A;  5K5O A;  2GOM A;  1ON2 A;  1A36 A;  4D9J A;  4M6X A;  2EZI A;  1W0T A;  3K1N A;  1BI2 A;  1DP7 P;  4IXA A;  2ICW G;  2R3S A;  1B4A A;  1MND A;  3BT9 A;  4OIQ F;  2QWT A;  1E17 A;  4EQQ A;  1JHF A;  3QOP A;  1YTY A;  3HIM A;  3H92 A;  1T39 A;  2QZ8 A;  2CO5 A;  4BEH A;  2M8E A;  2Y30 A;  2DA2 A;  5F1R A;  3J81 Z;  5TRD A;  4GO1 A;  3I71 A;  2Q2E B;  3GME A;  2JSP A;  2GUH A;  4OIR F;  1FZP B;  2Q2E A;  2A6E F;  3J7Y J;  2R5Y A;  2PEX A;  3A0B C;  2ZME B;  1J9I A;  3BPX A;  3CMM A;  1KU7 A;  2Y48 A;  3OY9 A;  4I6Z A;  2L54 A;  2D45 A;  2V9P A;  1UI6 A;  1YOV B;  1GV5 A;  3VSL A;  2DFH A;  2HS5 A;  3H35 A;  3V78 A;  3B81 A;  2NNN A;  1IW7 F;  2N8G A;  2O0Y A;  2R4G A;  1IRZ A;  5LGT A;  2LP0 A;  4AUX A;  2BZT A;  4P96 A;  5ICF A;  4BJ6 C;  2HQR A;  5DS9 A;  5D8L B;  3WOD F;  3X2Q H;  1XMX A;  3TQN A;  1FYM A;  4AWX B;  3MZ8 A;  4BKX A;  4ANJ A;  3QU6 A;  5JI6 A;  1LNW A;  1TP4 A;  3SFZ A;  3BLY A;  3FDY A;  1XCB A;  3VYT B;  2VE8 A;  3WE3 A;  5C3E J;  1S7A A;  1IXS B;  3JCU C;  3KE2 A;  1JGG A;  4EM0 B;  1Y1V J;  5F0F A;  3F72 A;  2DOF A;  3FX3 A;  2NRA C;  1MMD A;  4IHX A;  2M34 A;  4HOB A;  2XVC A;  2ZXH A;  4NC6 A;  1VQ9 I;  1XX5 A;  5LHH A;  2I8D A;  2A5W A;  3HHH A;  2HGC A;  4BGD A;  3B02 A;  3N05 A;  5CVI A;  4I7H A;  3RZD J;  3DTI A;  3SEZ A;  3BJ6 A;  2YU3 A;  2GXG A;  3KZI C;  1ZQ3 P;  2WC2 A;  2K5C A;  2X0L A;  2M2E A;  2LKX A;  3Q0V A;  4ITV A;  2Z9O A;  4DJA A;  2LY1 A;  3KP7 A;  5GTH C;  1GVD A;  3CQZ J;  5CPR B;  1AKH B;  3IL2 A;  5K58 A;  4A2U A;  1BR1 A;  2ZJP F;  4LMY A;  1H9G A;  1FX7 A;  5DD4 A;  3KYD B;  1KU3 A;  5F0C A;  5LFA A;  4PGH A;  4U7D A;  3ECO A;  1XSD A;  1A04 A;  5FJ8 J;  4BY7 J;  2V9K A;  1RUO A;  2BY2 A;  1XMA A;  4LLG F;  5HLG A;  2HU9 A;  2HOT A;  4ON0 A;  1ZTR A;  3FXK A;  2QVO A;  3KX2 A;  2QOP A;  2MYS A;  3HTH A;  5IOY A;  3TDZ C;  1ODD A;  1V5G A;  2B63 J;  5LRS A;  1LFU P;  3HOU J;  3F9K A;  4QLC U;  4M3G A;  4J01 A;  1YJN I;  2DMP A;  3VYR B;  2L3D A;  1EH7 A;  3LNQ A;  2XHK A;  2LK2 A;  4B4C A;  1VFC A;  5HS8 A;  1QVU A;  5FD6 A;  3P9T A;  2QIB A;  3H9Q A;  4IVN A;  4MIM A;  3QOD A;  1VQN I;  2E1M B;  2K9L A;  1IRG A;  2CG4 A;  2VJ5 A;  3L2V A;  3WTV C;  1B9N A;  1HW1 A;  4PFP A;  3AL0 C;  1V4R A;  1GLN A;  2HZD A;  3BDD A;  2ZNY A;  2V79 A;  3HRU A;  1OJL A;  3GZ6 A;  2Z33 A;  3WTW C;  1HKS A;  5D1R A;  2STT A;  3V7C A;  2Z1D A;  4XN0 A;  2X6W A;  2BYV E;  2DOA A;  1UHM A;  5FLV A;  5C4X J;  4E7Z A;  2IJL A;  5JFR A;  1H88 C;  4MK6 A;  4LIV A;  3HUG B;  4BQO A;  3ERE D;  5DUK A;  5EG0 B;  3LA7 A;  5GAG J;  4WX9 A;  2R7W A;  1X4O A;  1Q1V A;  5BQT A;  3RKY A;  1R71 A;  3H5R A;  2V1U A;  1I39 A;  3ASN H;  4JKZ A;  3K7A J;  3BHQ A;  4L18 B;  4ZYA A;  4HQE A;  1HDP A;  1AU7 A;  2M45 A;  1HXD A;  3HOZ J;  1DDN A;  4F7Z A;  3HXL A;  2LOO A;  3HKZ A;  4G6Q A;  5FRN A;  2CQK A;  2CW0 F;  2JA2 A;  2L4M A;  3GTO J;  3G1M A;  2KIU A;  1IN7 A;  2FML A;  3LSG A;  5EGO A;  1SVM A;  3QPH A;  4BH9 A;  3FKI J;  4RM2 A;  1ONV A;  3KPH A;  5ICC A;  2QEN A;  5H9T A;  2Q1Z B;  1W5C C;  1UJ8 A;  3CLQ A;  3F8C A;  3GYH X;  1S3J A;  4E7H A;  3GEZ A;  1MIJ A;  4WXC A;  2MA3 A;  3E97 A;  3K0L A;  3G4S I;  1YI2 I;  4BXX J;  3FXL A;  1BM9 A;  4BQQ A;  2XAH A;  2X1C A;  3O3K A;  2PI0 A;  4A3B J;  2KIQ A;  4XNF A;  1Z3X A;  5H2F C;  4G7Z F;  3IUO A;  3ABT A;  1PVE A;  3TDU C;  1Z9C A;  1TWC J;  2HQA A;  5CVV A;  4BXF A;  5HLI A;  1IN4 A;  3W6J B;  4G7O F;  1U5T A;  2DDA A;  2DJN A;  4XON A;  2R93 J;  3GFL A;  3DQV C;  3TO7 A;  3WTZ A;  4LG3 A;  3SFI A;  3H3V K;  3F21 A;  3L00 A;  2FBH A;  1USS A;  2K9S A;  1MBH A;  3HSF A;  2H1L A;  2MD5 A;  3FXM A;  3ZQQ A;  4IHV A;  1U8R A;  1CF7 B;  1B1B A;  1BR4 A;  4D1Q A;  2JQ7 A;  3PAS A;  4ZDL A;  5JLX A;  4ZDO A;  3JRG A;  2W57 A;  3WE2 A;  4F91 B;  2VON A;  2YVX A;  1HQC A;  4NQW B;  3GLL A;  1ORK A;  2PG4 A;  3JRI A;  2VBW A;  1TWH J;  2M0M A;  3VW1 A;  3K4L A;  2CQQ A;  2MAB A;  3WU0 A;  2Q8K A;  2A6H F;  1QVT A;  3OL4 A;  2VOD A;  1O3S A;  2Z3Y A;  1UFM A;  3WGG A;  5LD2 C;  4HF2 A;  2F5V A;  3VW2 A;  1LB2 A;  1LUJ B;  3DKX A;  2EIK H;  2GA2 A;  5FO5 A;  4EVI A;  2D1V A;  4GRI A;  1IUF A;  2EFQ A;  3B73 A;  3FXR A;  2OA4 A;  2QM3 A;  3GW2 A;  4W97 A;  2E35 A;  3SXY A;  3F1B A;  1ACI A;  3CRJ A;  2M30 A;  1W7P B;  2NVY J;  2VKE A;  2ZCW A;  3K1M A;  3CD6 I;  2DG7 A;  3BJA A;  4CCL A;  2F48 A;  3AQS A;  5HVQ C;  2KIM A;  1Z1D A;  5LGN A;  1SAN A;  4CZC A;  2NOG A;  3HDD A;  3HRT A;  3I0T A;  1HF0 A;  3S1M J;  4Q5S F;  1P6R A;  3BR6 A;  3CUQ B;  3IRQ A;  2E1O A;  4FHT A;  2PMH A;  2EA4 A;  5FD5 A;  1OMI A;  4RAF A;  3T8T A;  2Y2Z A;  4RM3 A;  3GLX A;  2ZB9 A;  2WWY A;  1TZL A;  2K02 A;  4EV0 A;  1YIT I;  3MKL A;  1GV2 A;  2H6C A;  4HF0 A;  1LFB A;  5GPA A;  3W3C A;  4ENK A;  2Z99 A;  1B72 B;  1RRJ A;  1WKM A;  4XOP A;  1G3W A;  2HDW A;  1G4D A;  1UHS A;  4YEL A;  2K7L A;  3E7L A;  1YW8 A;  3RKX A;  5E20 A;  1UI5 A;  4GXO A;  1ERD A;  2DMU A;  3M1C A;  4IJA A;  3VPR A;  3I54 A;  1MBG A;  2DI3 A;  2CMP A;  2VKD A;  1KU9 A;  1SC7 A;  2ESH A;  3O8H A;  5IP6 A;  3PJR A;  3S2D J;  3HYI A;  3ULQ B;  1OYW A;  4EJW A;  3CCS I;  4KWA A;  4YFK F;  2DO7 A;  2A05 A;  2W82 A;  2LSO A;  3OYN A;  2M4K A;  1ZRE A;  4CH7 A;  2XAF A;  4E6K G;  2AQE A;  3H3Z A;  4BE0 A;  4HEA 2;  2ZXI A;  3JSP A;  2W53 A;  1BOB A;  2HTS A;  2W7N A;  3Q5F A;  4YIR X;  1U0J A;  1KU2 A;  2UXX A;  4KIG A;  4E7L A;  2EFO A;  3JAM Z;  1MMG A;  4D5C A;  1ZAR A;  1L3L A;  3PSI A;  2O8K A;  1VQ7 I;  2K86 A;  3OYF A;  1FNN A;  2B1E A;  1D0Z A;  5L3F A;  1Y39 A;  2V1N A;  3FIS A;  1OQY A;  1JUS A;  2XAG A;  2HKO A;  3CJN A;  1FOW A;  3DFG A;  2CQ7 A;  2CUF A;  4OIO F;  3M9A A;  3B6C A;  1D1C A;  2FJ1 A;  2YUS A;  2LLK A;  3M07 A;  1JHH A;  4ESJ A;  1R9T J;  2HI3 A;  4MEX F;  1PJR A;  3AG3 H;  3JW4 A;  1EKE A;  2JA8 J;  1ZRD A;  2PMZ A;  2G7G A;  3TP0 A;  2V9V A;  2EFN A;  2EWN A;  2NVX J;  2CWE A;  4HDU A;  2DDB A;  3KCC A;  3J7A O;  2X51 A;  2CV2 A;  1OCR H;  1QPM A;  4AVP A;  3FHN A;  1BIB A;  4XQF A;  3GWZ A;  5JVT A;  3IAS 2;  2M3A A;  4IHW A;  1V55 H;  3LQR A;  4XR6 A;  4HBL A;  3IV5 A;  3HOX J;  2QTQ A;  3LQQ A;  3F8M A;  1YFH A;  4C3H J;  3MAJ A;  5EYR A;  1YG2 A;  3WTY C;  4KDP A;  3MQ0 A;  3TOA A;  1B6A A;  5FLX Z;  3PIO F;  3CME I;  3I53 A;  5J1R A;  4M74 A;  3RYR A;  3LSH A;  2D5V A;  4AU7 A;  2DA7 A;  2IGK A;  1X3W B;  4QWQ A;  1U9N A;  3VB2 A;  4ESB A;  3HTJ A;  3GFI A;  2X85 A;  4X1E A;  3S5R A;  2NS8 A;  1HKQ A;  4IPA A;  1EH8 A;  1Z77 A;  1VQ8 I;  3HSE A;  5J4Y A;  4FQG A;  2X6Y A;  4QPO A;  1PUE E;  4RLF A;  2GEN A;  2HDD A;  1ON1 A;  1FLI A;  4JOM A;  2DMN A;  2E5Z A;  3MKZ A;  2YU9 J;  4BQA A;  2QLZ A;  1I5Z A;  4BHB A;  1MDM A;  2VAS A;  4IOC F;  4BNC A;  5L3C A;  2KMU A;  4U0W A;  1MBJ A;  4Y17 A;  4YRV A;  1OCO H;  1H89 C;  3E5U A;  2E60 A;  2JPC A;  1XTA A;  3HOT A;  2JN6 A;  2F5C A;  2DU9 A;  4XOR A;  2HVQ A;  2M0C A;  4U0V A;  3ZGK A;  3VUQ A;  2VT3 A;  3PUF A;  4YZE A;  2EZH A;  2WAD A;  1R4M B;  2RNG A;  4A3I J;  2EB7 A;  4KT5 C;  1A6I A;  5BMZ A;  2XAS A;  1U2W A;  3BRO A;  3HTA A;  1W7P D;  1Y0N A;  2OZ6 A;  2ZFW A;  3EUH C;  4M3D A;  4O3M A;  2STW A;  4PSW A;  4HX8 A;  2WBM A;  2JA5 J;  3C2B A;  3R0J A;  5IP9 J;  4UUS B;  1OKR A;  1TQI A;  1P2F A;  2MH9 A;  4HV6 A;  4AYB A;  4YIF A;  1WHU A;  1ZRC A;  2CUJ A;  2OF7 A;  2LBF A;  1QGP A;  2YX7 A;  3T8R A;  3F6V A;  2XAQ A;  2FBI A;  2IT0 A;  2G7S A;  3BG7 A;  4P9F A;  1J59 A;  1LEB A;  4B3A A;  1TW3 A;  3NQO A;  1F5T A;  3HPG A;  3V4G A;  4IRH A;  5LBQ A;  3ZQL A;  2H8W A;  1E3P A;  1HOM A;  3DLL F;  3V7R A;  2L9R A;  3PNV A;  1QO0 D;  2XAJ A;  2YX4 A;  5CVU A;  1RI7 A;  2M1B A;  1TNT A;  1D0X A;  1IV6 A;  4BAC A;  2PQ8 A;  1KYW A;  4ESF A;  1I6X A;  2F5D A;  3P7N A;  2CS3 A;  2CV1 A;  2Y9Y A;  3OYD A;  1N78 A;  1WVR A;  3RKW A;  3G6E I;  2EH3 A;  2QKM B;  3PL8 A;  4HZF A;  2E71 A;  2VI6 A;  1VF9 A;  5D4R A;  2X6O A;  4BHC A;  2ZXJ A;  2FBQ A;  4MEY F;  4A6D A;  3ZOB A;  3E7Q A;  1J09 A;  4Y3O A;  2FXA A;  2G7U A;  2RRE A;  4JQF A;  1XSV A;  5EZG A;  2NOJ B;  2RAS A;  2E2J J;  1R5G A;  4H0E A;  1RKW A;  3Q3S A;  2QQ8 A;  1ZG5 A;  2NVT J;  4GFB A;  1IDZ A;  2UXN A;  2OV7 A;  2FD5 A;  4G8X A;  2VC0 A;  4Q4Z F;  4A3J J;  5CJ9 A;  5HS7 A;  1SFU A;  2P0W A;  2WAF A;  5HBU A;  5CLS A;  5K7Z A;  2ZJQ F;  1PUF A;  1NG7 A;  1FOK A;  1GHC A;  2E1N A;  2VLA A;  4ZYE A;  3E0J B;  1HST A;  1Z7U A;  2EIJ H;  2K4B A;  4KJZ A;  5ICE A;  3S2H J;  2VBY A;  2LNB A;  4RDU A;  1K78 A;  2L9V A;  5J47 A;  1AA7 A;  2QQB A;  3JRA A;  3H0G J;  1JUP A;  1X3Z B;  3ISP A;  5EGO B;  4MTD A;  3T5X A;  5LGU A;  1WFX A;  1XC5 A;  1ZG1 A;  1V54 H;  3EUH A;  4I76 A;  4BQN A;  3E1S A;  3QBM A;  4OU0 A;  4O5V A;  1R36 A;  5KAF C;  5DEQ A;  2K40 A;  4FIS A;  1HA8 A;  1MNE A;  3HZJ A;  4IL6 C;  1QNT A;  4UXN A;  3VTI A;  2CJJ A;  4V19 K;  2L4A A;  3HTS B;  1IN5 A;  3EYI A;  2R92 J;  2KRC A;  2CGP A;  3FKJ A;  3WG9 A;  3VVY A;  4A3M J;  3E6D A;  5K1Y A;  1BBY A;  1MJA A;  3ECH A;  4RLQ A;  1IAW A;  2OTJ I;  5M5Y J;  1FC3 A;  1T56 A;  2ZOY A;  2HR3 A;  2K9Q A;  2V1X A;  1FOY A;  4ICH A;  3CCL I;  4Y7N J;  3HPH A;  4BUP A;  2X48 A;  1LDJ A;  4FCY A;  2GXB A;  4MXM A;  1FWZ A;  3O8G A;  2GOX B;  5E3M A;  2FOW A;  2KFD A;  1MDM B;  1WJA A;  1UG2 A;  2ZFU A;  2OBP A;  4CCN A;  3H36 A;  5HLT A;  3JSO A;  4C3J J;  3QPT A;  2QSF X;  1WWX A;  2PJR A;  2E7W A;  5B1B H;  2ID6 A;  3F6O A;  3MKW B;  2FJI 1;  5D4S A;  1W36 C;  1Z3Y A;  3BR3 A;  3OR2 C;  3TED A;  1MH4 A;  1S72 I;  4IHY A;  2ZCX A;  2VT2 A;  3TOB A;  1RZ4 A;  3E6C C;  3P9K A;  1TBX A;  1B72 A;  2VXZ A;  4XLC A;  4AIK A;  2LVS A;  1SFX A;  4PJJ A;  4ACI A;  1ZHF A;  4ZH4 F;  3AQT A;  3MNL A;  3RH2 A;  2JWT A;  2DCE A;  1T08 B;  1MSF C;  5CXI A;  2O7T A;  3KZ9 A;  1TQP A;  3LSI A;  1X58 A;  3WU2 C;  1IJW C;  1YIO A;  3M8F A;  3SZT A;  3C7J A;  3ZN0 A;  3K6G A;  5DV5 A;  3HHG A;  2JTV A;  3O2P E;  4G9Y A;  1R1U A;  2E1M C;  2R7Z J;  1O7F A;  1W7P A;  2HWV A;  2P5K A;  3HJE A;  2ISZ A;  2R7V A;  2XC7 A;  2ZJR F;  4I0A A;  1TTY A;  5IY5 H;  3M8J A;  3BP8 A;  2PFB A;  3KZY A;  3K4N A;  3GZN B;  3LST A;  2DK8 A;  4CYC A;  2BY1 A;  3ZQG A;  3GTQ J;  3OSF A;  2GXA A;  5E1Z B;  1TT0 A;  4U0Y A;  3RQ4 A;  4JX6 A;  1VQM I;  4ZDP A;  2LYC A;  3T6N A;  3HL2 A;  3A2K A;  2ETH A;  1EH6 A;  1K4T A;  2O7O A;  4UHT A;  4RB2 C;  4A3G J;  5HLH A;  3C2G A;  1XGN A;  5KK1 A;  3PNT A;  4WXH A;  2RHA A;  2HQN A;  3IAM 2;  1XN7 A;  3G2B A;  2R5Y B;  2HXI A;  4AIH A;  3HC7 A;  2F2E A;  4L9N A;  2E34 A;  1X2M A;  2KIS A;  2PZ9 A;  4C2M J;  5IT9 K;  3CDH A;  3RJP A;  5F6F A;  1K7A A;  5IP7 J;  1TT5 B;  4KMU X;  3EPZ A;  2HYF A;  1Z67 A;  3AG1 H;  2PX9 A;  1TC3 C;  1TLH B;  3A4C A;  1T95 A;  1R23 A;  2F4I A;  1Z0X A;  2L9N A;  3CCQ I;  5A2Q Z;  3ZMS A;  3W2W A;  3L2Q A;  2ZME A;  3VVZ A;  1IGN A;  1SD4 A;  4J00 A;  1SD6 A;  3TP3 A;  2RVC A;  2ZJ2 A;  3A03 A;  4LOC A;  3UNG C;  1BA5 A;  2PFV A;  2KL4 A;  5ILS A;  3RIR A;  5LEK A;  1GT0 C;  3BQZ A;  2JSC A;  2HVR A;  2L5Q A;  2DOE A;  3CCE I;  3OYG A;  1N25 A;  5KHD A;  1FP1 D;  2FOK A;  2XPU A;  5A2Q K;  5EFY A;  3MZH A;  3KKC A;  2AQF A;  4EJO A;  1WI9 A;  3FXO A;  3JRD A;  1ENH A;  4G94 A;  1QU3 A;  2VIX A;  3HRM A;  3KP2 A;  3OV8 A;  2VPR A;  4BHP A;  3GO5 A;  2O3F A;  4U9L A;  3HSR A;  3TO6 A;  1IZ1 A;  3NWT A;  3FBN B;  1DGR M;  4HG2 A;  1MBK A;  4S04 A;  2DPU A;  3J81 K;  2DA4 A;  4P5O A;  2DYS H;  2MSY A;  1D8J A;  2R5Z A;  3H5N A;  3LSJ A;  1F1Z A;  1XGM A;  4LG0 A;  1BL0 A;  2VOP A;  4HYE A;  2VQG A;  1RNL A;  2XF5 A;  4HLX A;  2IVM A;  2BXZ A;  1ZEL A;  2QWW A;  4OAZ A;  4XIC A;  2E1C A;  4ZYD A;  1WPK A;  1FYL A;  2EZL A;  2HFH A;  2XV4 S;  4RAZ A;  2ZKZ A;  3S8P A;  3KYC B;  1Z05 A;  2CUZ A;  1TNS A;  1G3Y A;  2ZSH B;  3CCY A;  1X3U A;  3ZQC A;  4OWR B;  1U6G A;  3BJB A;  4ZTF A;  4C2T A;  4CO8 A;  4E7S A;  1F9N A;  2LG4 A;  3EET A;  1POG A;  4B8X A;  2NYX A;  4BY1 J;  1BN5 A;  3C07 A;  1MKM A;  3SJM A;  4BE2 A;  1QQI A;  4KA4 A;  2XF7 A;  2YSR A;  3VEP A;  3DPU A;  3FM5 A;  2D2W A;  3RSN A;  2DFI A;  3DXJ F;  2H6B A;  4GYI A;  2K85 A;  2A5Y B;  3OYJ A;  4NC7 A;  4CGR A;  2Z2S B;  3S1Q J;  3I5U A;  1OPC A;  1YIJ I;  1B8I B;  1ULY A;  2BXY A;  1OCT C;  4LK0 F;  2COB A;  2VQC A;  2JVH A;  3DPL C;  4UVC A;  2B0L A;  3WHC A;  2IAI A;  3BR1 A;  3GUD A;  2JVG A;  4DQ2 A;  3RPU D;  1JE8 A;  2G7L A;  1XMK A;  1JUM A;  4HV5 A;  3ZP5 A;  3PQK A;  4BYY A;  1RR7 A;  2OI8 A;  3HKZ N;  2DQR A;  3NAU A;  2VKH A;  1IG7 A;  1EV7 A;  2LMD A;  3ABK H;  5CQE A;  2BEO A;  3PPB A;  3MKY B;  2QF7 A;  3TKY A;  1WGX A;  3A1Y A;  3ESW B;  3VOD A;  3CCR I;  1HCR A;  2IU5 A;  4J19 A;  3TO9 A;  1QZE A;  2DOD A;  2I10 A;  4LIT A;  1K79 A;  1ZLK A;  3BWG A;  1FSE A;  1SVL A;  2XB5 A;  3S32 A;  3UR3 C;  4X6A J;  2QQ9 A;  2DMQ A;  3L2C A;  3WHB A;  2IXS A;  1Z6T A;  2Y75 A;  5TJJ A;  4O6J A;  5D18 A;  4RS8 A;  2EV5 A;  4ASN A;  4YII A;  3SZG A;  1O4X A;  2JPB A;  4X0G A;  4HSR A;  3BPV A;  3LJL A;  4PSX A;  2OQG A;  1XDU A;  3L2R A;  3HEF A;  1ZH5 A;  4FE7 A;  2RN7 A;  5E8I A;  3D5S C;  3QPL A;  3BOQ A;  2R7T A;  2VL8 A;  3PQJ A;  1HDD C;  3KLO A;  4I98 B;  1D5V A;  1JKO C;  1KZH A;  1K83 J;  2DFE A;  1ETK A;  3IWZ A;  5L3D A;  4ZYH A;  4IHS A;  1U9O A;  1WCM J;  2FSW A;  3BG3 A;  3I56 I;  3GEU A;  4OIN F;  1WJC A;  5LLQ A;  2Y9Z A;  2NAZ A;  4N9I A;  2Z5U A;  5ICG A;  3HB9 A;  3BNI A;  2HYT A;  4P1W A;  1IF1 A;  2O03 A;  1WH5 A;  3Q0W A;  3J80 Z;  3CTA A;  4ENN A;  5D6F A;  2VUM J;  4FT8 A;  4ZJZ A;  2JUC A;  2QBY B;  1GVJ A;  3OS2 A;  3F8F A;  1S6L A;  3ZMZ A;  3WGI A;  4D7M A;  3S16 J;  4UV9 A;  1UB9 A;  5GAH J;  4F3Q A;  4K2E A;  4Y52 J;  1NHA A;  3CO6 C;  3K4B A;  2DBB A;  3CDL A;  2BY3 A;  2ADU A;  4JP0 A;  4PGG A;  1S29 A;  2Y0S A;  3HOS A;  2HYJ A;  3HUG A;  1YO5 C;  1HLV A;  3PNY A;  4YEJ A;  1MMA A;  1WSU A;  4PJM A;  1OFC X;  1P4X A;  3OOP A;  5K7F A;  1G59 A;  2DA3 A;  2PJP A;  2L0K A;  2GZW A;  3CMA I;  3U1K A;  2FNP A;  3KEQ A;  1H8A C;  2G7H A;  2K9N A;  3LMM A;  3Q9S A;  1GDT A;  3WTX C; 
#chains in the Genus database with same CATH homology
 5FKO A;  2YU9 J;  2DMN A;  3BR0 A;  1U8B A;  1FEX A;  3PM1 A;  5BNG A;  4HKU A;  1WH7 A;  1MBJ A;  1H89 C;  3O60 A;  2NP3 A;  3VVX A;  1APL C;  3S15 J;  2JN6 A;  2M0C A;  3VUQ A;  3GTK J;  2KT0 A;  4YZE A;  3HE0 A;  4NN1 A;  2EZH A;  3A01 B;  4DYC A;  4A3I J;  1RPW A;  1VND A;  1A6I A;  5EF6 A;  1ZGW A;  1JKR C;  2GBY A;  1NK2 P;  2WGB A;  9ANT A;  1AHD P;  3HTA A;  2TCT A;  2PMZ N;  4JX5 A;  1TWA J;  3RKQ A;  3DPJ A;  4M3D A;  2WB1 N;  3OIO A;  3NNR A;  3LSR A;  2YVE A;  2JA5 J;  3C2B A;  5CW8 A;  5IP9 J;  1EF4 A;  4UUS B;  3NAR A;  2MGQ A;  4V2F A;  5J1Y A;  1YRN A;  1W0U A;  1GUU A;  1T33 A;  5E3O A;  1WI3 A;  4BBS J;  2UXU A;  3BG5 A;  4JYK A;  2OF7 A;  4XID A;  1IDY A;  4AF5 A;  4AC6 A;  5J3L A;  2G7S A;  4L5E A;  3Q0U A;  2JJ7 A;  2HOS A;  4B3A A;  2LR8 A;  3GTM J;  3OSG A;  2EZI A;  2KDZ A;  1W0T A;  3ZQL A;  1HOM A;  2UXO A;  4GCK A;  2L9R A;  3BT9 A;  5EEA A;  2QWT A;  2VKV A;  3HIM A;  1JKP C;  2L7M P;  5IOZ A;  1F43 A;  1IV6 A;  2Y30 A;  2DA2 A;  4A93 J;  2GUH A;  2LY9 A;  2R5Z B;  5FHP A;  2MG4 A;  2Y9Y A;  3JRB A;  5F04 A;  3BRU A;  4GCT A;  1QRY A;  3HBL A;  2EH3 A;  2R5Y A;  1E3O C;  2ZOZ A;  2XPW A;  5M5X J;  2VI6 A;  2Q24 A;  1VF9 A;  2X6O A;  2FBQ A;  1RET A;  1MBF A;  4I6Z A;  3ZOB A;  3E7Q A;  2LD5 A;  1UI6 A;  1ETY A;  1GV5 A;  2QCO A;  1FTT A;  4ME9 A;  4XRM A;  3BCG A;  3FK6 A;  5EZG A;  3V78 A;  2RAS A;  3B81 A;  2E2J J;  2N8G A;  3B6A A;  1RKW A;  3Q3S A;  2HXO A;  2LTP A;  2XGE A;  2NVT J;  3M4O J;  1IRZ A;  2LP0 A;  4GFB A;  1IDZ A;  5FKM A;  4AUX A;  2FD5 A;  3VP5 A;  4A3J J;  2ME0 A;  4A3F J;  4GFK A;  4B1R A;  4MFE A;  2M8G X;  5HBU A;  5DS9 A;  4D7N A;  4QTR A;  1RKT A;  5K7Z A;  1PUF A;  4BKX A;  3BR2 A;  3JRE A;  1TWF J;  4M3F A;  5C3E J;  4JNN A;  2NX4 A;  1TWG J;  2Y31 A;  1JGG A;  1Y1V J;  5FKL A;  5F0F A;  2XGC A;  3DEW A;  3S2H J;  4GFL A;  4RDU A;  4IHX A;  2M34 A;  3GTL J;  3JRA A;  1I3Q J;  3H0G J;  5F0H A;  5F1J A;  1JUP A;  2HKU A;  2WUI A;  5EGO B;  4A3C J;  3CMY A;  3RZD J;  3S1N J;  1XC5 A;  3IH3 A;  4XRS A;  4I76 A;  2XB0 X;  2DMT A;  2GM4 A;  1P7J A;  3QBM A;  4FE4 A;  2UXI A;  1ZQ3 P;  5M5W J;  2K40 A;  4FIS A;  2M2E A;  2LKX A;  2O9L A;  3Q0V A;  4NEL A;  4DZP A;  2CJJ A;  3HOY J;  1GVD A;  3CQZ J;  2R0Q C;  1AKH B;  3G56 A;  5K58 A;  2R92 J;  4S0H B;  3SDG A;  3VVY A;  4A3M J;  2UXP A;  3MVP A;  3NI7 A;  5M5Y J;  5F0C A;  4DZJ A;  1T56 A;  2ZOY A;  4A69 C;  1MBE A;  2K9Q A;  4BY7 J;  5FJ8 J;  4ICH A;  4V2G A;  1XS9 A;  5CXG A;  2XDN A;  4M3B A;  3QQA A;  4Y7N J;  3OOU A;  2HOT A;  3ON4 A;  2X48 A;  4FCY A;  1ZTR A;  1XG1 A;  4MXM A;  1ETX A;  2QOP A;  2HQ5 A;  3O8G A;  5E3M A;  5FKK A;  3HTH A;  1BJZ A;  5IOY A;  3S14 J;  3ON2 A;  3S17 J;  3ANG A;  1UG2 A;  2B63 J;  2G3B A;  1LFU P;  3HOU J;  4MO7 A;  4AYB N;  4M3G A;  3JRH A;  2IBD A;  3G1L A;  4C3J J;  3CJD A;  2XSD C;  2DMP A;  3LNQ A;  2ECB A;  5J1U A;  2ID6 A;  4RBO A;  2E2I J;  4DYQ A;  2LK2 A;  3BR3 A;  2EQR A;  4B4C A;  1VFC A;  1QVU A;  3TED A;  1MH4 A;  1NTC A;  4IHY A;  2QIB A;  2ZCX A;  3P9T A;  2UXH A;  1ITY A;  3JR9 A;  4A3L J;  4MIM A;  1B72 A;  3BG9 A;  5IYD J;  2LVS A;  2Y0S N;  4M6V A;  4DYR A;  3L1P A;  1DU6 A;  4UDS A;  3HGG A;  3VOX A;  4ACI A;  3AQT A;  3MNL A;  3RH2 A;  1ETO A;  1OCP A;  2JWT A;  3HGY A;  1MSF C;  2DG8 A;  5CXI A;  2O7T A;  3M3Y J;  3KZ9 A;  1OJL A;  4A3D J;  4W1U A;  3FIW A;  1X58 A;  1IJW C;  5FGL A;  2FQ4 A;  5D1R A;  2H8R A;  3BTC A;  2JMW A;  2FX0 A;  5FLV A;  2R7Z J;  3BTJ A;  2IEK A;  5IYC J;  5C4X J;  4BBR J;  5EG0 A;  2NS7 A;  1H88 C;  5GPC A;  4MK6 A;  4PXI A;  3HOV J;  1U78 A;  5C4Y A;  4CYC B;  5EG0 B;  5E3L A;  4CYC A;  3ZQG A;  1Q1V A;  1ZR4 A;  3OSF A;  3GTQ J;  4M3E A;  4JX6 A;  3T6N A;  4ABZ A;  4JKZ A;  3K7A J;  3BHQ A;  2CUE A;  3GTJ J;  2O7O A;  2TRT A;  4A3G J;  1HDP A;  1AU7 A;  3JRF A;  2ELK A;  3HOZ J;  2RHA A;  3COL A;  4JX4 A;  2LFB A;  2MW8 A;  3NRG A;  1RES A;  5AQC A;  2R5Y B;  2HXI A;  4QSH A;  3GTO J;  2JA7 J;  3G1M A;  2D6Y A;  1X2M A;  2DA5 A;  2G0E A;  3LSG A;  3QPS A;  5EGO A;  2ZCM A;  1LE8 A;  5EDN A;  1MSE C;  2PZ9 A;  4C2M J;  2PBX A;  3FKI J;  4JL3 A;  3GZI A;  5IP7 J;  4UUT A;  1NK3 P;  1TC3 C;  5H9T A;  1AKH A;  1Z0X A;  3BTL A;  1ETW A;  4BXX J;  3VVZ A;  1IGN A;  2OPT A;  4AC0 A;  3I4N J;  3TP3 A;  1YRN B;  1QPI A;  4A3B J;  3A03 A;  4LOC A;  1A5J A;  1BA5 A;  5HSZ A;  5M3F J;  1JTX A;  1TWC J;  3UKG A;  1GT0 C;  2CRG A;  3BQZ A;  2DJN A;  2R93 J;  4QIW N;  2XPU A;  3H3V K;  3ZQI A;  3SFI A;  4L62 A;  3ANP A;  5EFY A;  5DAJ A;  3PO2 J;  3KKC A;  5HAW A;  3JRD A;  2K9S A;  1MBH A;  1ENH A;  3D1N I;  4IHV A;  2E2H J;  2VPR A;  3PAS A;  2L7Z A;  5JLX A;  3JRG A;  3G1O A;  3JRC A;  1FTZ A;  2JA6 J;  3EUP A;  1MBK A;  1FIA A;  3JSJ A;  5M3M J;  1ORK A;  3JRI A;  3VIB A;  2AO9 A;  2DA4 A;  1TWH J;  3VW1 A;  2MSY A;  2CQQ A;  2R5Z A;  3LSJ A;  1UMQ A;  2DA6 A;  5F08 A;  2EBI A;  1X2N A;  5F27 A;  1QVT A;  5IYB J;  1BL0 A;  2E19 A;  4DW6 A;  5D19 A;  2W48 A;  2DTZ A;  1SGM A;  2XRL A;  3TW6 A;  4XIC A;  3VW2 A;  3K2A A;  1CQT A;  1WPK A;  3BTI A;  3QKX A;  3NXC A;  2EZL A;  3A01 A;  1IC8 A;  1JT6 A;  1IUF A;  3CCY A;  1ZR2 A;  3IH4 A;  3ZQC A;  3LOC A;  4W97 A;  1G2H A;  2CU7 A;  4NDL A;  3BJB A;  3F1B A;  2QKO A;  3CRJ A;  5HOD A;  2NVY J;  2VKE A;  2DG7 A;  5K7H A;  3AQS A;  4IEJ A;  1POG A;  4UUS A;  4BY1 J;  3C07 A;  2ECC A;  1SAN A;  2P81 A;  3SJM A;  2NOG A;  4FTH A;  3HDD A;  3S1M J;  1HF0 A;  3RZO J;  3BR6 A;  2AHQ A;  3BR5 A;  1GDT A;  2E1O A;  3LSP A;  5FKN A;  4XRS G;  2Y2Z A;  2JK3 A;  2ZB9 A;  4CGR A;  2L7F P;  3MKL A;  3S1Q J;  3V6G A;  1GV2 A;  1VI0 A;  1B8I B;  1OCT C;  5GPA A;  1LFB A;  1B72 B;  3IH2 A;  1S7E A;  3VOK A;  1D5Y A;  1B8I A;  2COB A;  2RAE A;  1K61 A;  3GBG A;  3ZQF A;  3KKD A;  1UHS A;  3WHC A;  2IAI A;  3BR1 A;  3I4M J;  3CWR A;  2GLO A;  3ZQH A;  1LE8 B;  3E7L A;  2G7L A;  1UI5 A;  1JUM A;  2DMU A;  3HTI A;  3LWJ A;  3RD3 A;  3DCF A;  2V57 A;  4EEF G;  1ETQ A;  3VPR A;  1RR7 A;  1MBG A;  2OI8 A;  3HKZ N;  3NAU A;  3F0C A;  3GTP J;  3FK7 A;  3O8H A;  5IP6 A;  1JKQ C;  1IG7 A;  3S2D J;  5GP9 A;  1Y1W J;  1F36 A;  4XK4 A;  3PPB A;  4KWA A;  1JJ8 C;  2QF7 A;  1WGX A;  3HOW J;  1HCR A;  3LHQ A;  1SFO J;  2IU5 A;  4J19 A;  1FIP A;  2I10 A;  3IUV A;  2XB5 A;  4X6A J;  2M9H A;  2F07 A;  2W53 A;  1ZK8 A;  2CQX A;  2DMQ A;  3WHB A;  4MLO A;  3A02 A;  4HNV A;  2WAQ N;  5JLW A;  1DU0 A;  1I6H J;  2OER A;  1JTY A;  5D18 A;  2H1K A;  5IPA A;  3W6V A;  3VW0 A;  1O4X A;  1JT0 A;  4D5C A;  3TW7 A;  2O8K A;  3LJL A;  1I50 J;  3FIS A;  1JUS A;  4GCL A;  2CUF A;  3HEF A;  3RQI A;  3B6C A;  4FE7 A;  2FJ1 A;  2LLK A;  2YUS A;  3QPL A;  1MNM C;  2EZK A;  1R9T J;  2DN0 A;  4MFD A;  2HI3 A;  1HDD C;  3FRQ A;  3S1R J;  1JKO C;  5FMP A;  2JA8 J;  3G7R A;  1K83 J;  1BW6 A;  3EGQ A;  1ETK A;  2G7G A;  3TP0 A;  2ID3 A;  1BW5 A;  2WV1 A;  1JJ6 C;  2NVX J;  1U9O A;  1WCM J;  3GEU A;  3BG3 A;  2DA1 A;  3KNW A;  2YS9 A;  2Y9Z A;  1MH3 A;  2XGD A;  5DTD A;  5C44 J;  3HB9 A;  3BNI A;  4C3I J;  2HYT A;  4IHW A;  2ZCN A;  3GTG J;  1WH5 A;  3IV5 A;  3HOX J;  3Q0W A;  2QTQ A;  2XPV A;  2VUM J;  5FLM J;  5E3N A;  4C3H J;  5EYR A;  3HM5 A;  3PO3 J;  5EZH A;  3BQY A;  2HOA A;  2REK A;  1ETV A;  1P7I A;  5J1R A;  2D5V A;  4D7M A;  3S16 J;  1ZKG A;  2DA7 A;  4Y52 J;  2YVH A;  2NP5 A;  1U9N A;  3CDL A;  4JP0 A;  1HLV A;  2HYJ A;  2X9D A;  2ME6 A;  4D5F A;  3HTJ A;  4X1E A;  3S5R A;  2NS8 A;  4G12 A;  4A3K J;  1Z77 A;  1OFC X;  5K7F A;  1PUF B;  2NVQ J;  3MN2 A;  2DA3 A;  2GFN A;  2L0K A;  3NPI A;  1H8A C;  1FJL A;  2K9N A;  5C4J J;  4A3E J;  2GEN A;  2HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...