3ZQXA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
146
Chain Sequence
b'MDVKVQYLCENTQTSTQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADWSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
molecule tags Hydrolase
source organism Clostridium thermocellum
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
total genus 40
structure length 146
sequence length 146
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 3zqxA00
4JO5A 2WOBA 1G87A 4C8XA 3ZU8A 3ZUCA 1K72A 2YLKA 2WNXA 1G43A 1KFGA 2XFGB 2L8AA 4B96A 4TF4A 1JS4A 1NBCA 4B9FA 1TF4A 1GA2A 4B9PA 3TF4A 2WO4A 3ZQWA 4B9CA 4B97A 2XBTA 3ZQXA
chains in the Genus database with same CATH superfamily
2NY4C 3X11B 4APQC 2Q3XA 4I2XE 2UXVA 1K3ZA 3W2DL 5CZVL 5E00B 2Z4QA 4Z3JA 1M05B 1WFOA 4L8DB 4PGZA 1U8IB 5BPPA 3VGAB 2GY7B 1HTYA 3VFRA 4AUYA 1VGEL 4KDTA 2QSTA 5L6YH 2AK4A 1TZAA 2X6CA 3HI6L 4JY4B 3EUUA 2AXGB 4JFEA 4YDNA 4MNQA 5F7AA 2FIKB 5D7IB 5IIEA 4G80B 1JGEB 1YHPA 1U6AH 1WZKA 3C5ZA 4GRLC 1T1XA 3EYFB 3QUYC 3U2SB 4WCYL 1S7SB 1KB5B 1S2EA 3EOAB 4FI8A 4BIKA 3KMDA 3PPSA 2XTJC 4GIAA 3ATAA 1R5WA 2Z34A 2VR3A 4NQEE 4U1NA 5DZ9A 3MRJA 5HHXL 2X6BA 3JWDC 1IJNA 4NQDB 3T0WA 5INDB 2A38A 2HA1A 3HAEA 5HPMB 4Z7NE 4N6RB 4ODVL 5D7IA 2ZICA 5BV7H 2XXGA 4YBQC 1P6FA 4QTHB 4JM2D 2E9IA 4WFEE 2YAMA 4DK6A 4IMKC 2EDJA 5E56A 1KLGA 2CR3A 3IGFA 1M05A 3N44B 6FABH 2GBVA 1E9QA 3MKGA 4F3FB 1GTFA 1FNEA 5JHDB 1MSPA 3OWEA 4LNRB 3TESA 3WV0A 3ZE2B 3QRFM 4NB7A 2PYED 1H8LA 3MDJA 3MU3A 1KTDB 3D7PA 3FYEB 3G5ZA 2J6EL 1B2WL 4D3CL 2JCWA 2BVTA 3SGEH 1S78D 4H0HB 4HBCL 1E9OB 3ME0A 1AACA 1SVBA 4XVOA 3HS0A 5GSVA 4UIKL 1EERB 4N85A 2ADGB 5GSRB 4G6MH 4D94A 5KG9A 4HK0A 3T2NL 5F72S 15C8L 4ISVB 3ZBMA 1CLYL 1TOXA 5ISZB 1JNNL 3NSDA 1QVOB 2GTZB 3K80A 3P02A 3RKDC 1S7VA 3KYNA 1MCEA 2HCZX 3QUZB 2RGSA 3B5TA 3UTSA 1FG2A 5DMGD 1DLFH 2WLIA 1K8IB 4BFOA 3MCYA 2L8AA 3FFCA 4RWHA 4TNVF 2Y9RT 2ESVE 2WUCH 5I66B 1MFAH 4GW5B 3FB6B 4URTB 4BFJA 4AH2B 2WXHA 3U2IA 4L1DA 3V52H 1HKLH 3CHPA 5C09D 3UXFA 3UO1L 3T65A 3NZSA 2CGYA 3RZCA 3OAUH 4IGBD 1TG8A 1TMCB 4HS8H 4HFUL 3TBYB 1A64A 1NPNA 4F7TA 1YMMA 4HK3N 4JKPL 4QNPF 4XB8A 2XOTA 5FYLE 4PY7B 1VFAB 2E56A 3D34A 1ZANH 2A3TA 2F0CA 4DN4L 3QDMA 4B3VA 3RKDD 5GGUA 2YARA 1G9MC 1INDH 1BJ8A 2Y1AA 1OOWA 1DQKA 2XWDA 1MPAL 1NCCH 2NR6D 3BUYA 4O51A 4CADB 2WBJD 3PRZA 3OKOB 2AEIT 5HHQB 4JO2H 4RAVA 5FDWA 2IANE 4MJIB 2NYKA 1KJ3H 4FXKB 4IBZA 2VLRD 5CD3A 4WU7A 4PRDA 1AGCA 2X09A 1PDKA 4FQHB 2BSTA 4XODA 3NFSL 2MCPL 4FMFA 1IC5L 1JGEA 4NPYA 2X40A 4L05A 2Z7ZA 4HEMA 3FQYA 5E9AA 3CHXA 3FCUB 3AS3A 5I1CH 3U1SL 4HD5A 1AQ8A 3AMKA 3VTMA 3FTZA 1WV7T 1XCTB 3BAEH 1FDLH 4N0UB 4A38A 1PDKB 4Q9RL 1X5YA 5FW8A 5HYSG 3PV7A 4F33A 4M1CD 4YSPA 1TNNA 4FKKA 4C83B 4XC3L 3CLWA 2HFEA 1W0YT 3ZMEA 2JJUA 1H3PH 4U2YA 4XI5C 3RUGE 4ZNCD 3HG3A 5CWSB 2C9SA 4H1LH 2VXSH 1WD8A 4NKIL 2GPZA 5A2AA 4DPCX 1KPRA 5KVEH 2FTAA 4TUJA 3RWDA 2B1HH 4PJ9B 4QTFA 5EBLA 3T6VA 1VFAA 3RTQD 3DTDA 3ZVVA 5DD1L 3NJXA 4L4TE 2ERJB 4NZJA 5C3LD 1CDIA 1MFCL 3B83A 2AQNA 2C26A 4IJTA 4AEHL 1OF0A 4EMZA 2EABA 4R97C 2JB5L 4FFZL 1KYOJ 3TT1H 1T2QH 2PCYA 1WT5A 3SKJL 4WENB 4OZHF 4GW1B 4GKOA 4M1CC 3GHBL 5EZIH 4XNMB 3ZRCC 4QDGA 4A7VA 4ZMAT 4IW4C 4HKZB 2BW4A 1B4JL 5DGQA 2K1MA 5C0JA 2W8CA 5LJYH 1NBCA 3DRQA 4ZZFA 1K5WA 3ZE1E 1AJ7L 3BZEB 4MA8H 5GRVL 5HYEA 5I8KH 1WAEA 3BUPA 1YMME 2ZSWB 4FXTA 3QDJE 2ZXEB 5C71A 1W0WB 2FB4L 2EIMB 1OSZB 1RIHL 3RGHA 3SD5A 3ESMA 3ZR5A 2ZXCA 3W37A 4MQXD 3F04A 1AGBB 3PWNB 5F7FA 3IFNL 5CZKA 4G1EB 1Q38A 2NW2B 1XMEB 3SDCC 1RVFH 2EINB 3DGCR 2GJPA 1QFPA 1OANA 1UEYA 2CGZA 1MAML 2VN4A 5DJXB 3KW8A 3P40A 3VFPA 3ARBD 4MMXA 4U3SB 3UH8A 1KLFA 5HI3C 4JDEB 1R5VB 1SOXA 3ABKB 1ACZA 4PJHA 4YDLB 2VITB 1X5LA 3AREB 4QXTA 3G5XB 5ALBL 3NIFE 4A7GA 1NWPA 4TUKL 5E6IA 2VMEA 3D48R 4XP1L 1TPXB 3S0PA 3CLFL 5F7KC 5DUBB 2Q2EB 3RX7A 4KKAD 3TBVB 4BZ1A 2AS5M 1SOSA 2YAQA 2CCLA 4MB1A 4WEMB 3UYOD 4UOW1 3VM7A 4ZAKD 1WBXA 4LBEB 3C2SA 4X98B 5TDOA 4ZFGL 2ZUVA 3MRRB 3ZYZA 3HKZA 3FO2A 1BBJA 2YWYA 4APQA 2OAAA 2XIDA 2E0PA 2FBRA 1S7UB 4QF1B 2WVUA 3MLWH 3US0A 2PWEA 3ZL2A 4HVBA 5F44A 5HI3D 3BN9C 2PTVA 2WLYA 4G5AA 2BDNH 4JRFA 3V6BR 3THMH 5DQDL 1NIDA 2EYSA 2DLIA 3QNYA 4HS6B 5BXFB 4JFPA 4QYOB 2HVJA 4ICWA 1NCAH 3O11A 3NCMA 4ZAKA 3RU8L 1N59B 3CDGB 2EIEA 2YRZA 2EDNA 2VXVH 2E86A 3HMXL 1IKOP 1PLCA 3DI2B 5KJRH 4BQ8A 2I07B 5EC2B 5JPNB 6PCYA 1YRKA 3H4FA 3TWCH 4XN4A 1AYOA 2H5UA 1IBDA 2BP0B 3UTZA 3BGFB 1S5HA 4HIXL 3UZVB 5BUGA 5EOTA 1KZYA 2Y07L 1LE5A 2VSMB 3N43F 3D25B 4A68A 4RMSA 4HUVB 4FFZH 5DO2D 4WEEA 1CD1A 3I02B 1GGYA 4M7JL 5D2LB 5F7BA 2AJYL 4AUUA 4LSSH 4U1MA 2BX5A 1H3TA 3IGLA 1QRNB 4NWUH 1GZPA 1T66C 3B7UX 1CFBA 1OP5K 2C4FT 2E5EA 2P5WB 5JLZA 1ASQA 2NY4B 3P77B 4FKHA 4UTCA 2EVHA 1X4XA 2NNFA 4AQ8A 4UBDC 3KYKL 5B7EA 4KTDL 4JPIB 3VTTA 1CICB 4W9CC 5DYFA 4G9DA 3L1FA 1KENL 2KDGA 1QATA 2IXQA 1EO7A 3NCYS 4MX7B 3AJ7A 5DMYA 5T1JA 3HB3C 1SDYA 3OMIB 2BIIA 2F9BT 2EIJB 1AO7D 4ZFZB 3SJVE 4EJ1C 3KS0H 4WUUA 1QA9B 1RK1B 4UV7L 4TRPL 2Q3AA 4B9FA 2JXMA 4Y4FA 5T3ZH 4FEMA 1U8JB 4ZQKB 3BKJL 3VXRE 3IFOB 5DDHA 1ZA3A 5IUCA 5LG6A 4P5TB 2EE2A 4KFMA 1WBXB 1B4TA 2AVGA 1JK9A 2IGFH 4K8RL 2VSKB 1MW3A 5IHZB 1OV8A 3OZ9L 2LU7A 1MZYA 4I4WA 5JNYB 3G6JE 3M8OL 5D71L 3QJXA 3JXAA 4XN2A 4BK8A 5BO1H 4GW5A 3OJ2C 1N2RA 4U4BA 1KCBA 4HFWB 1C12A 1QZNA 2TSBA 2KC0A 2DQFB 3DVGA 1A3LL 4D0DA 4PJHB 1I85C 3EHBD 1NPUA 2V33A 4PWKA 1N7ML 4O5LH 3ECBA 5EIIB 3TNMB 4CBZA 1E65A 4YSEA 1MVUA 4HWZA 4J3VA 3T9WA 3ISRA 2LFGA 5MEQA 5LCVL 2R51A 3L6FA 3BVUA 3OX8B 1YY9C 3H0TB 1LO0L 1CT8A 5I28A 5IJVB 4YK4B 3BP7A 4Y5VC 1MG2C 4Y9EA 5EC2A 1SXBA 1I9IH 4OAWB 5JPNA 1M71A 3JWOL 2XA8H 4M02A 1AXTH 4L4VA 4ZMNA 1I7ZA 2E7BA 4Z7VF 4MNHA 5LLIC 1OHQA 3SBWC 3TN0B 3PL6D 1WHOA 1NCAL 2DICA 1HXYA 3CVHB 4WEBL 4HMEA 1RXLA 5IF0A 4H88H 3RJDA 3KH4A 1FVEB 4IBUA 2MCAA 3PWUB 5FC9A 2WXNA 2QDVA 2VZ1A 3FHQA 3TJHC 1D3CA 5KYXB 2DWXA 3S35X 4CSZA 4TNWK 1HCFX 3BGFC 1A22B 1DJZA 2ITFA 3QW9A 3VMPA 2A83B 4KZEH 1Y1UA 1QSFA 3RVWC 5FA4A 3B9EA 3IF1A 1E4KA 1JHTA 5GZNC 1PY0A 1NIFA 2MPAL 5I6KA 2Z65C 3TFKC 4GSDH 1FPTH 1WA0X 3E6FB 5JA8B 3ULUE 3QDMD 4NUJA 4I89A 3F84A 4PD4K 3KPNA 3QHZH 3T08A 3U83A 2G2NA 4WO4D 3CPLA 3CV5A 3WUWA 4JN2A 5EU3B 3PQYD 1CN4A 4P48A 5SV4A 2BVOB 1A6WH 3PL6C 2BPBA 5KYNA 1MQKL 4DAGL 1TJHH 1YNLH 2NDGA 4GRLB 3GBLA 2EDKA 2H47C 3FU9A 4AGPA 2BP5M 3V6FA 3S3JA 4ZPTB 3IJ8A 1GS6X 2X4RA 1BD2E 2GUOB 4ZUWB 2AW2A 3RVWD 3REWB 1L6XA 4L3EB 4RAUA 5CEXB 2V5TA 3PWPE 2HLFC 5HYJB 1CXIA 1ET8A 4LAQL 3GUTA 4L3FA 1H6FA 4L1LA 1VGKB 4YLCA 4JM0A 1I75A 4H0LC 4R2GC 4WTWA 4A1RA 1OW0C 4LSQH 5DEGA 4I9XA 5K33A 4OM0H 4TSAL 3MV01 4L4TA 3PNRB 2FO8A 2FYYB 2GC4C 4Y16C 4EEEA 5BQDA 1ZGLB 1SYSA 1IGFH 4OD2A 5CEZD 32C2A 3PGFH 3ETTA 1NINA 4R7NB 1Q1JH 5EN2A 3MLVH 4HPYH 4N2LA 1QSZA 1T3FA 1FE8L 2COQA 4TOYL 2XPZA 1XIWD 1A4AA 1J1XL 3RUGA 1OSPH 3D39D 3FPXA 3B43A 4LL1A 4TQEL 3TO4D 1MRCL 2P7TB 3HHMA 2VCOA 3ABLB 2OW6A 5C6WH 3QUXA 4OCYH 4NN7C 5EFIB 3WEBA 1R5VA 2W94A 2BZDA 3GMQA 1ES0A 4I0KA 1R17A 4NQTA 2XA8L 3TJEL 3L4CA 1AXTL 3MV7A 2AK1L 4W6WB 1VADB 3OQ3B 1AI1L 1CFMA 1W72H 4XXDA 3WNOA 2IAAC 1JWMB 5I0WA 5D4JA 4QR7A 1S7RA 4H88L 4P2OB 2GBAA 2DBLH 3NH7H 1DANT 1IGCL 4WW1B 1XH3A 1BJ1H 4EUPB 2R0WH 3MBWA 5T33L 2AI0L 5T1DL 2OL3A 3ARGA 4G43A 1JDAA 5JUEH 4WUKL 4XMPL 2Y5TB 4UQ3B 2ZONA 1R3JA 1NL0L 2FZ3A 2N0MA 4JPWL 2A99A 1XFPA 2HVBA 3L1EA 1JHLH 3V8CA 1HILB 1DEEB 5CEZH 4MMZB 1B2WH 3ROLA 2OMWA 4D3CH 1BAGA 2DM3A 3WTVA 1RZKH 1FPTL 3O2VL 1WICA 1SDDA 4PREA 2W65B 1A7OH 3WTYA 4JAMA 3GBDA 1X7QA 2NY4D 3HG5A 3VDAA 3H3PH 3MLUH 5EEXA 3VI3B 3M1OA 4PR5A 4R3SA 4JO5A 5FHAH 2EVFA 5LDSA 1OPGL 2G75B 2ZF8A 1L9TA 4Y19E 2ICEC 2YXWA 4K55A 4F37K 1U8PA 1JRHL 4G6JH 5JHLA 1FUNA 5GGSA 2FATL 1L3NA 4XCNA 3P9LA 4YQXH 4FQ2L 4MXWH 3BVNB 2M2DA 4Y2NA 4N2CA 3NCEB 3EDEA 2NNAB 2VDQL 3MV7D 1INQB 4X4XA 1YEJH 2RH0A 1P4IH 1M2VA 4OM1L 4Z95H 5LGJB 4LGSB 1MUJB 3FUMA 2CM6A 5J0BA 4NQCD 4AI7A 5IQ7L 2BVPB 5FUZH 1AHKA 1BD2D 5FV2A 2J25A 1R34A 2PXYC 2JNZA 4DFHA 4U6TA 2K4AA 4OUUB 4BQ6A 1NMAL 3L4ZA 2X0UA 2AFNA 1I9EA 1AS8A 2DQCL 4R4ND 2PTTB 1P69B 5GZOD 3F12B 4XVSL 4PAZA 3I84A 2XBZA 3ULVF 3SQBB 4R5XA 4N0RA 3FTWA 5D6CB 1WBZA 3CFJB 1XH0A 2AEWA 3S37H 3WUZA 4B60A 4Y5XA 4LVOC 3EBHA 1SM3H 4OUUA 3RB5A 3PCYA 1AQHA 3A3YB 1F3DH 2SEBA 3IFOA 4UTAA 3RIFK 1SOQA 4KTEH 4YR6A 15C8H 2BSBA 2F1BA 3BJ91 4NCC2 2R29L 3BP6B 4KX7A 3CFNA 1J5DA 1XH1A 4WNQA 3PABA 5ISZE 5FM4A 3S96B 3Q1SH 3GJEA 4KQ3H 4RGND 2AEQL 4R2GB 3GBNL 3N9GH 4G8EB 2W07B 5D5MB 5K9JH 2N7AA 1GAFL 3PXJA 4FCAA 4H0IA 5IMMB 2EDOA 4YBLC 4DN3H 4AG4L 4M03A 1QFUH 1QLFA 2FUQA 2H8PA 3C87A 1JGUL 2DH2A 3U0PA 3NIDF 4G9FB 4L5FE 3OKEB 3U0WH 4N26A 3BKYL 1DVSA 1P4LB 3R06B 4TQHA 2WD0A 5JUEL 4JQVA 4TSCL 1IBGL 5KVEL 4RISH 3K6FA 3TEUA 3FFCD 3ZYOA 1YPZF 1MI5E 2ZOLB 2PO6A 4J8QA 3GINA 3QCUL 2WXIA 4YEEA 4UINL 4YC2C 4XNZC 1MJ8H 4IGBC 4M48L 3ZSSA 2AV7A 3DROA 3WEOA 4DGIH 4CGTA 4MGXA 2IH1B 1RZGA 3C6SA 1A6AB 1ET7A 1Q72L 3C75A 3CMOL 3QT2A 1RULL 3VJ6A 3G5WA 3L9RA 1AO7B 4KUCD 5SWSA 5B3JF 3RG1C 3QA3A 5EV7A 5F7NC 3ZL4L 4CC4A 4AQZA 1GZHA 1OAQH 2AQ1A 5FHAL 5IJKA 3QJHB 4J6IA 3HPJB 4H5SB 2R69H 2H2SC 1WISA 2VE6A 1GL4B 2NY0D 3S8WA 4P9MH 1S7RB 2DH3A 4KV5F 4P2OA 1ZS8B 3DUSA 1GW6A 3G08A 3LVEA 3RJQB 1SY6A 3NPZB 5CKGA 3UJJH 5MEOA 3LZPA 5K39A 2ATKB 3HC3L 4BYHA 4HKJA 4NUMA 3GSOB 2P5WD 5C8JB 4HX1A 1KBVA 1JV5B 1PY4A 2EEXA 2ZJSL 2FB4H 1J12A 5E5UB 4UM9A 1G7JA 5B3NA 5I1CL 1CU4L 3ECUA 1AO7E 4BSWB 2YC1B 3KCPA 2ICEA 2V9QA 3F5WB 2NQ3A 5F71A 1G7LB 3SE4C 3G6AB 5EU6D 4QCIA 1FGNH 4GB9A 3QPXL 3K4ZA 3U0PB 5AVXB 2OJZL 1QHOA 2RCSL 3AWEA 5LGJA 2BP8B 5BS0D 1Q4NX 2CHXA 2H2SD 3B7SA 3UPCA 3MRQB 3NP4A 1GKOA 1ZT1A 2OSLB 4ETQB 2NMSA 4Q9QL 4P2QD 4UYPA 4ZMWA 4QHMA 1KB9J 4GQRA 4NZFA 2FX9H 35C8L 1LILA 1EZVY 1T5WA 4PI0A 5IVZB 1BECA 1U3HA 2F53A 5CIPA 3BC9A 2AQPA 1NCBL 3EAKA 1HEZB 3W82A 1T21A 5C08A 3CVHL 4MWFB 3OG4B 2V7HA 1CFSB 3ET9F 1IILE 1A7QH 2OBGA 4H8PA 4IBYA 4OJFH 4ODSL 3RWHB 3RZCC 4G42B 5MP6H 2DWDB 2HMIC 4F8TA 4TULL 2BCKB 3DECA 3HI5L 1BOGA 2GEQA 2WZ0A 1YJDH 1NBYA 3EZJB 3H6JA 3LXUX 3QZNA 3RNKA 2Y1YA 2O4EA 2ED7A 3GK8H 1U8IA 4KRNA 2E7LC 1RMFH 2ENSA 3US9A 2QQLH 3SYQA 3T8XB 1HHIA 3W11D 2DS4A 4E9WA 2ITCA 1X5KA 3MFGB 3N5AA 3ZZQA 3NJFA 5KYWA 5D4HA 2R0LH 4GAJH 3L3HA 3MJ7A 4NUPA 1M53A 3UO8B 4JM2F 1SUJA 1WWWX 5D1QE 1BBDH 3SOTA 2ZAGA 5EPMB 3K91A 1NCHA 1EGJH 1D5XA 2FWSA 1CK0H 1KCVH 3MV7B 1NCDL 3QHFL 4P5TC 4K15A 2XX1A 4U1LA 2YD8A 3IFPB 4FLOA 4GBXC 4JR9H 3ZTJH 2B4CH 4NENA 4XPAH 4J3OC 2BK8A 3ARBC 2FL5A 4I48B 3ARDC 1RURL 4PJ7F 4DWHA 1QBAA 4WTQA 3WE6A 5EO0A 4P9ML 3ZDZE 1M56B 3MLSL 3QUXC 4WO4B 3S6CA 4PGDA 3FO9A 2G0LA 4RGOL 5DU7A 5E1HB 1AHWB 4WWKA 2DPKA 1HILA 5TQ0L 3VFVB 1N64H 2F8VA 4KKAC 2P4AB 1ZKAA 3MODL 1MHEB 4UT6H 2W65A 3WE1A 1TQBC 3MLWL 4BD4A 5K59F 3CUPB 4JREB 4ONHA 2MCG1 5JW3H 1JPGB 4PRID 1RU9H 1JZ5A 2I27N 3QZWB 4XC1L 4P2RE 4DGVH 5I26A 2BDNL 4IOSD 2LT9A 1K3IA 5EO1B 1C08B 3FUNA 1TETL 3QK0A 3QORC 5F1IA 3T0ED 2KZBA 3O2WL 2D2CC 3B4NA 5DSCA 2IPUK 4HV8A 5KN5A 4YX2H 4ZXBD 5BCAA 3K71A 2VR7A 1KXVC 3CPUA 2YAHA 4XCFL 4RZCA 2UWEE 2AGJL 4PLJC 2NCEA 2DWDA 5E2UH 5TF1H 3C60C 4PLKC 3UTTB 3TL5A 3V2AR 2VM4A 3LN4A 3MNZB 3TWCL 2YPVA 4OBRA 4M1GL 3G6DH 4N86A 5A2LH 3NN8A 1KFAL 3T2QA 2IAMC 3INUH 3QUXB 1BSIA 2VXVL 3M17B 4M5SA 4P23B 2VMDA 2VR4A 2Z7UA 2JIXA 3TBSB 1NIBA 1ORQA 3ARDA 2AJYH 5D1QD 3CFBA 5F3HB 3T0VA 1UZ8A 1OALA 4I1PA 4JUSA 3QORD 4TQ8A 2P52A 1G1YA 3EF7A 1CG9A 5MERA 4JMNA 2A74A 2VDOL 2OMYB 3G04A 3OWRA 2GCYA 4OGXH 3QI9D 5E1QA 5I30H 1JNNH 2J88H 3S37X 4ZXBC 4A2LA 5KW9L 1G4RA 2ZYIA 1ILUA 1U2YA 1ZVYA 3VE0A 4KTDH 4QRTA 3LKOB 3KPRE 3RY6A 1BQHB 1FFQA 1T66D 3QIUD 3MNVA 3D05A 2Y4SA 4OCSH 4TTDC 5CZRA 4YHIB 3T3PB 4Y2OB 1Q9OB 2CBOA 5GS0L 1OARL 4K94C 4XAWL 1CBVL 3O4LE 3KJ4C 3R7RA 4FQQB 2WAHA 3OKNB 3QORA 4AKOA 3ZKXB 5GS3A 5J8OA 5GHWH 3EDJA 3NN8B 1X9QA 1H5BB 3ZDZB 2CXKA 4YHPB 5IB4A 3QXTA 2Q3ZA 4BHUI 5F70A 3RTQA 4JR9L 5I16A 3BLKA 1NKOA 1KGIA 2O6PA 2XICA 1UH3A 3HBZA 4HDIA 5CUSL 1V7MH 1D7CA 2EDXA 5I1LB 2NCMA 4HUWA 2UXTA 4FNLL 4KROC 4UV4H 1J0HA 4RQQA 4JFFD 3BVVA 2ZE0A 4XNQA 5CR8A 4D7PA 4PRPA 4F9LC 5DYOB 4G1EA 4FI6A 4LLYA 1CFTB 2C7FA 3X1EA 3QIUC 2J6WA 1I1RA 2YKKA 1VCAA 5IM7A 3MO1A 1MIEL 4X6EA 1P6WA 5FOBA 2GG1A 3RWJA 3MTRA 2VR6A 2V5YA 3ULSA 4BWTA 3TZVA 4JLRB 3QJZA 5LCVH 4ZMTA 3M45A 2MCPH 1E5UI 2FSEB 3NFSH 4PRHB 4J8RB 1IKFH 5C1MB 5ISZD 5KTEH 1T22B 2A2QT 3NAAH 5EBMA 3JQOB 3DO4A 1GYCA 5DURD 1YPZA 1PL3A 2C1PB 4MZRA 1DJHA 2DOCA 2Y24A 3SGJC 2GC7C 3CGTA 4BH7B 3KXFD 4YPJA 4PJ6A 1L9OA 1WT5C 3KPOA 4O02L 1S7QA 4ZFFA 2B4CC 1ZD6A 1N3NB 5MI0B 3VXUE 1KIQA 3QZMA 4G80A 3QXVA 2JJVA 3IMRA 5FFOA 1GOGA 2E9GA 2ARWA 4Q0XH 4M1GH 3WOVA 2NY2C 1FC2D 3GO1L 1A6UL 1CE6A 3JZYA 4Y5XB 3SOBL 3T0BA 3NTCL 4D8PA 2WKOA 4FTVB 4OKVB 4Q56A 4HQQL 4P46A 1GPOL 3KNBA 2Z31C 1CI3M 3AZUA 4X4KA 1MRCH 1UD8A 2EIDA 2VLKD 5EUOE 3JV6B 5IJKC 2PUQT 2O6FA 2JCCF 4KZEL 4WDIB 4KK6C 3ZJAA 2W60B 1J5CA 2G0KA 1X5AA 3S4SB 1UD6A 1QD0A 2FGWL 2WLMA 2OTWA 1ODUA 3CFDA 3JTSA 4X9HA 3K6DA 2AAAA 1JV2B 4ISVA 4P46B 3HZ3A 3ARED 1N0LA 1WITA 2JWYA 4XNZB 5H94A 4R8WL 3WKPA 5JW4R 2WYIA 3SDYL 5J11B 5B1CA 1X6NA 1BFTA 2CHWA 4MQTB 5IB5A 3O9WD 3BZFA 5IW6A 1N3NA 2W1NA 2NT1A 2O26U 2YJQA 2GFBA 4Q2ZA 3IJYA 3PDDA 2VLLA 3BPOB 4E0RA 1I3GL 4GKLA 3Q05A 1WGOA 3IJHB 2IH3B 3MOAH 1U2HA 3K74B 4GBXB 1JRHI 4I77H 4XPGL 5CCKH 1BZ9B 3L5HA 1ED3A 1IGYA 1JERA 2WXPA 4JX0A 1X9RA 4Y89A 3FUDA 1RZJH 5HHNB 5ICZB 5J6HB 3NRPA 8CGTA 2IXQB 2YKLH 1IX2A 1LEKB 32C2B 4GSXA 4LVNB 3VXTA 4EN3D 5HDBF 4QTHA 1Y1DA 2EDYA 3BQUD 4N87A 3QIUB 3AVEA 1J1XH 1FVDB 5FS5A 4PHXA 5CJ5A 5IOPA 5EEVA 1CJYA 4NNPH 2EP6A 4QRPD 3NRFA 4O2FA 1ZVSA 2F54D 4PV8B 4BXSV 1M1XA 2YPLB 3LEVL 1EXGA 3PPEA 4XHQA 4JJHA 4D0CA 5B39B 4PBXA 1RCYA 3DX8B 4GKSA 3T0DA 2HUHA 3I2CL 3BPOC 3WFHA 3CFEA 4EI5C 2VC2L 2YD2A 3IU4H 4PB0H 1GA2A 5FYJE 2O5YL 4NO0B 4XBGB 3RTQB 1IAIM 3LS5L 1FVDA 1N59A 3WDJA 1ZY9A 2BIHA 5EEYA 4DP4X 2GT9B 4OR1A 1K2DA 2B39A 3KS0J 4ABUA 3GNML 4OCRH 5DJZB 1GGIH 4Z77A 4KZDH 1W80A 1YCSA 1PZ5B 5C09A 2XWJA 4QAMB 1HCZA 3OKDB 3BH9B 1KJ2H 4JN1H 5IVXF 1NMBL 1AQMA 4L8CB 2IADB 4OLYL 3LIZL 4E5XB 4GRWE 5D7JA 5ESAB 1QFWM 3ZDYF 3PAZA 1ZIAA 2Q76A 3PYCA 4W6YB 3FB5B 3DRQB 2Z31B 1IGCH 4G9DB 3BEVA 3S37L 3WHE1 1H3XA 4ZO9A 4OF5A 2DTSA 1FQ9C 1R5IA 4ZRGA 3X2QB 1K72A 2EKSA 3MJ9A 3ZMNA 1BMGA 1NL0H 2VDML 3A4AA 3PV6B 4X98A 2R29H 5IMMA 2PPCA 4J4PA 1X3DA 4E9XA 5B38B 4Y1SA 3Q8CA 5B22A 1FC1A 5ICXB 1NKRA 3MLTA 1EO5A 4PRBB 5KZCB 4LSDA 2VXQL 2X4UB 5K9JL 4Z77B 5LXGL 3SO3C 1FNAA 1EHAA 5CINL 1JD9A 1NANH 1UJTA 4H1LA 4U4IA 4X50A 2KQMA 2QR0A 3PL6A 4TNEA 2ENJA 5FDYA 3LIUA 4JRXA 3U6XA 1R46A 2MEJB 1UWYA 3QEQA 2K6ZA 4OM1H 2B1AH 4D0BB 4JFUA 3VQ2C 4Q14A 2BC4A 4GQPH 4KNTA 4YHZL 1URLA 5CMAB 1M1SA 2WWKO 3I3EA 2F8XC 2IWEA 3FQTB 3BGMA 4X8GA 5ILTH 3D4CA 2A5UA 2OQJB 3PWLB 4DGIL 1P4IL 3BKJH 1S78C 4J6RH 1TPXC 1DBJH 4XN8A 4YDKH 4H44C 3FCSA 3WJJC 1IIKA 2R1WB 3N44F 3UG3A 4OIIH 2IDFA 4K8RC 4OGZA 3ZKND 1OHZA 2CJ3A 2B5IB 4BRJA 5C3IA 1PF3A 4DQOL 1IAKA 1QAWA 3HR5B 4ZTPH 1UZ6F 5F1OB 2BIMA 5BOPA 4PGJA 2W59A 1I8IB 1RSFA 4I5BA 3HN5A 3FO0L 3PJNA 3WGVB 5KYXA 5D93C 3WKML 2ZOWA 4JDZB 5D7JB 2CE6A 1I3RA 4NM4L 5DO8A 2KBGA 1HOCA 2XWCA 2NPLX 3WU1A 4RFEB 2YIHA 2DZEA 3GBNH 3N9GL 4Y1AE 2YEZB 5DFWH 1OP5H 4K7PH 1OAZL 2PYEB 3IJ9A 2XQYA 1ZLWH 3F7KA 4QHNA 4KVNH 3VDCA 4E42B 4Z7NB 3MV9B 4GG6A 1KB5A 2IQAB 3R4DA 4LPWA 1M7IA 4NQXA 3A24A 3VFMB 4ENZA 3R0NA 4K8RD 4JFWA 4XP5H 5LUMA 1NSNL 3JYBA 4NHUB 1JCVA 4NAQA 3VD2A 1U92A 3MI6A 4FFVC 2Y6SD 5IMKB 3VI4A 1XIWB 1VHPA 1ZE3H 2VDQB 3BESR 2VISA 1N10A 2LOEA 1F4YH 1UC6A 3EGSB 3KAAA 1YPZB 1W9XA 2C1PA 3QFGA 1CF1A 3DX8A 4GKSB 3S5LG 5TE4H 1UACL 3DTXB 3W0WB 5JXAH 2Y7QA 3QRBA 4ZMVA 3VJ6B 1I8AA 5C0AE 3U9WA 4S1SL 3ZYIA 1KJMB 3U82B 1M42A 4HBCH 3RWCB 4IDJL 5C0ND 3S5ZA 3OPUA 1E4XI 3OR6A 4BGDA 5L6YL 1PYWA 3QEHA 2EKJA 1JVLA 3G5ZB 3NCWA 1BZ7B 1K6QH 2OZ4H 1CLYH 1F18A 4FXGB 2AJXH 4F7CB 5E1GA 2I60L 1PZ2A 3EYUH 4C54A 2HVKA 4URKA 3HAEG 1CU4H 1QTSA 4F7TB 2Z7YA 1RPQA 1TQBB 3O8XB 4OTXL 1TQWA 3WSQH 1A8JH 2EIKB 5J1AB 3IS1X 2P7TA 1FNSL 3HC3H 1QFWH 3MRMB 1PYWB 4YHZH 3KPQB 4JFOA 4HK3J 1NOFA 2JKNA 4L8SA 2BH0A 2OJZH 3TBTA 2L3BA 1MDAA 4JVWA 1JZ7A 3UAJC 1I7RB 1KY6A 1PNDA 4X99A 3FFCB 3MR9A 3TH4T 1BD2A 1YY8B 3BMWA 2UUDK 3TGXA 5IFJB 4C56E 3QQDA 2X4TA 5CAYB 2OKMA 5A7EA 1IAIH 1B88A 2CKBA 3OXSA 5GQBA 5EOQH 5HGGS 4NPYB 2OFQA 3LH9A 3BAXA 4ZOBA 2QVFB 1DCEA 1DVTA 1RJYA 1YECL 4XNAA 4KI5F 2NTFA 5GGTH 3OSVA 1SJXA 5EZJB 1MJ7L 4ZD3L 4D0BA 3CE1A 5FFGA 3QQDB 3ZXAC 1VF5C 4L29B 4O51B 1T7VA 4JFZH 1G9ML 3IDJA 3SE6A 5I5RA 5TFSL 4MFHA 4BFBD 4ZMQA 5MEPA 2CJUH 2JJTA 2P8MB 1KWKA 3AT9A 3K81A 3RZCD 2ZCZA 3TPKA 4FAAB 2P8LA 5DHYA 5GZNA 4Z7NF 1JF1A 1FZOA 4WSKA 1XXFC 2BOBA 4HC1H 3WO3B 5LN8A 4AEIH 3OV6A 2FLRT 2AMGA 2X9ZA 3FTXA 3GSVB 2Y5QA 3OR7B 2Q86B 2V2TA 4KXCA 5D1XE 4XCFH 1XB6A 4GO9A 5AL8A 2XG5B 1LD9B 1G9EA 3LQAL 5E08L 1HKLL 3ZKXC 5BRZE 4JM2B 2EDDA 1NCDH 1AIZA 2QV4A 3QHFH 3OLDA 1KTBA 1UACH 3NEEA 1A3RL 4NT6A 5A2FA 2GABA 4JL2A 3L45A 4XPAL 3TO2A 4CVWA 2G60L 5CEZL 3W39A 2YEQA 2O6DA 1ULVA 3CXDL 3GS0A 4JY5L 4QGYA 5T1LA 4P5TD 4ZAKC 4NUGH 1CK0L 2H4EA 2XN2A 1B4RA 1NAKL 3Q44A 2EXTA 2FBJL 4L8CA 4LARL 1S9YB 5D7LA 3BQUA 4LLUB 1T2XA 1J9CT 2GSIB 4K23L 3CN4A 4A7GF 4OF6A 5L2KA 2IWFA 2Z0BA 3VXOB 4FE9A 1NUDA 3Q48A 1OW0A 3AC0A 3CHQA 5A3ID 2F5BL 1JDCA 1TQCB 5EH1A 3LXCA 2CCVA 3BD4A 5ESVA 4Y7OC 1U3NA 4MDJA 2AJZB 1AO7A 1ADQA 2Q86A 3GSVA 4X5LA 5DD0L 3MXWH 4JQIA 1W72B 5JQIB 3MBED 4XBMA 5E00A 4QXVA 2FO1A 4R6UA 3ZR6A 4YHKL 5B1JA 4L8BA 3MLRH 5E8NA 3UTPD 2SODB 4XCCL 1FRGL 4NT6B 1F4WL 5KSUB 4L4TD 1VENA 5DRXA 1QFWI 1E30A 5DJ0A 2UVFA 3GSWA 2HX8A 1U91B 4CW1A 3FCGA 4AJ0A 1ECYA 2NX5B 3IPEA 3PWVB 2G4GA 1HEJC 4N22A 3E6HA 3WFBH 3MAWA 1M7DA 2JELL 1T3FB 2FEJA 1OP4A 3C8DA 2X28A 5DT1H 5F6IC 3GJEB 3DJZA 3SDDA 4ODHH 1VAHA 3WL9A 4HIPA 1AKJA 2W07A 2CA3A 3ZTNH 2ZOKB 5TDPA 4KWUA 2WNWA 1S9VA 3DX9A 3P2DA 1G1KA 4M5TA 5D1QC 5EZJA 3AQYA 1Q9KA 3BJLA 5IGXL 5G4MA 3LX9A 2G5RA 2VLKE 1ZTXE 3T3MB 1D2PA 2F53B 3HB3D 1MNNA 3WL9B 4EI6A 3O45B 2YUVA 1IM9D 4OFQA 1OEZW 1KEGL 1YUHB 4BBWA 2X12A 1AJ7H 2CQVA 1QYGH 3BT0A 1QPKA 2Y72A 4Q6IC 4WFFD 1A0QL 3NZ8B 4X9IA 3VO0A 4DN3L 1A7PH 3ORJA 2AV7B 4YVUA 3HS0B 3WMQA 1SMAA 3U0WL 2HKAA 5SWZA 3E1F1 3MVSA 4NIKB 4ABQA 3IFNH 3RFZA 2PCFB 3SDAD 2Y5EA 3DV6A 4LK4A 1GIGH 2GSGB 2Z35B 3NTCH 3QJRB 4L3CA 5T5FA 5FR3A 3S48A 3L4XA 1N2RB 1BW8A 1DTUA 2BFVH 5ESQB 2RALA 2ORBH 1XGQB 4M6NL 4XTRD 5JHLL 2IH8A 2JKXA 4KGLA 3P9LB 1JBJA 2R4SL 3NZ8A 1P5UC 3FMGH 5DWUH 3GIZH 1J05A 4IOIA 4JUTA 3CBKB 1G7QB 3R18A 3QQ3A 1UTDA 3MBEA 4Z7UA 1BQKA 4LSUL 3LNFA 2WXGA 3DLQR 2EC8A 3ECWA 2NSMA 4FERA 4JRYA 4L9LA 1DJYA 3Q6FA 1NPJA 1JYVA 5ADPH 5ALCL 1WS7A 4JGUA 2NY7L 2YZ1A 1CL7L 4PJHE 1BPLB 1VERA 3DX9B 5DZLA 3DJSA 4KMLB 2OPCA 5EN2B 2YN5A 2DBJA 3VXOA 3FAWA 1HX0A 4E5XG 4F7EB 2Q8BL 3ZE1F 4HJTA 1R19A 5F3FA 4RMWA 5AG9A 3ZQXA 1GRWA 2W0PA 4KX9A 1H8SA 1M7DB 4LU5H 1UH2A 5FYJD 2IAMA 3ALXA 1NEZG 3P4NA 3OMAB 4DPBX 3AMLA 2WLZA 5FYLH 1RHHA 1OE2A 2VWEE 3SJVB 3D69A 2WTOA 3AB0B 3QDJA 4RX4D 1F02I 3HEIB 3TFKD 1DVFB 3BSZL 5E6UB 2OL3B 5CM1A 3HI1A 3QDGB 4JS7A 4RRPM 2EJ1A 3MRBA 2K7QA 2XVBA 1CE6B 3L3OC 4XP9L 3T3ME 4WKXA 7PCYA 1BXUA 5F6HJ 4BUQA 1L7TH 3QNZB 3R7QA 3VGDA 1H19A 2V2XB 3LQZB 5EU3A 3L3KB 2J4WH 1E50A 3L17A 4AE1A 4GLRI 4HU2A 4LCVA 5ABAA 3VSTA 3KE0A 3E80A 3OF6A 3CH8A 3I9GH 4JGJA 3VRIA 1QLRB 1HWGB 4JB9L 5GGQH 1OQXA 4E9LA 4G9FD 4HT1L 1OIOA 1BZOA 4FQIH 5EIQA 1EHLH 2ESVD 4NM8L 4KK6D 1OF2B 1YZZA 3SKMA 3BKMH 2XDHA 4TXVB 1OB1B 2DQGH 2PPDA 1KYUA 1JNLH 3D0VA 4R2GD 2WIIA 4JDTH 3AREC 5GRUH 1X4YA 3RGBA 1LGVA 2WINB 3VYNA 4X4YA 5ECJE 4G7VL 4QKTA 4YC2B 4LOFA 3UIZA 5DUMH 1RZKC 4B53A 1A14L 4AKPA 3K5SA 4N9GB 2H32A 1SYSB 1QRKA 2DMGA 2LU4A 4WGKA 1BWWA 2WBJB 3CFMA 3PWPD 1PZCA 1E8XA 1ZHBA 1XIWC 1T0NA 3TYGH 1SVCP 5F7EH 1B3JA 3FZUD 4YHOH 5A6LA 2ZQKA 4OF3A 5JPMB 4X8XA 5KUKA 4HS8L 2EE3A 3RGVA 3VXRB 3N85H 3B9KD 4HH8A 3U1QA 4JFEB 2BWIA 1MF2L 1NC4A 5D2NB 2EDMA 1O6SB 2IANA 3IMTA 4P0DA 5ANMB 1BFOB 5DMKB 4EDXA 2X4RB 4K9EL 5KSAC 4JFYA 3BUBA 3PF2A 4YXKH 5HYJD 4OF8A 4PRNA 3PWPA 4GG8A 1OAUL 2DLFH 4H13C 1QABA 1NCCL 1DQLL 3M86A 4MMYB 3MREA 3ZDWA 4ALAH 3QDME 1KPUA 4NQCA 4C4BA 2NOYA 5DD3H 5BOJA 2VM9A 3DIVA 5DD6A 2DIJA 3CPLB 1NFDF 4ZJ9A 3FZUC 4TN9A 3KWXA 2MHAB 4X0KB 1IFHH 3MRHA 3GXMA 5C70A 3ZE0F 1FH5H 4GRLD 4JW3A 3PWJA 4H25B 4N1HB 1T20B 1GGIL 1UZ8B 2E3VA 4JPSA 1V3JA 4ZW8A 2ZSVB 1VZHA 2XTJD 5MENB 5IFJA 2A83A 5F0PB 2H8PB 1TJIH 3D3VB 3E9UA 4UDTB 2ZCKL 2ESVA 5C0FB 4S2SB 4TVSa 4EI0A 1NLBH 3I9AA 1BM3H 4RWYH 1BAFH 1PKQA 2X1OA 4HJJH 2JSFA 1DBJL 3GNMH 4ZFOL 4X6CE 3R19A 2UZYA 1COBA 1WUZA 1D5IH 2IMMA 3WDIA 4F8QA 3O3DB 2EDLA 4JN1L 2OMUA 4LFHG 3BPCA 4P3WA 3GMRB 1S7WB 3BIKA 3HG1B 1N0XL 1FYTA 2VXUL 4TOYH 2YQBA 1YC7A 3B7TA 3WBDA 4XO5A 4QRAA 3V6FB 1EDQA 3S97C 3IJ7A 2WWMD 5AW0B 1KIPB 4OCYL 4HDIB 2JB6B 1EFXD 4NNXA 1PCSA 1Z66A 2ZSVA 1EUUA 1SBSH 1OAKH 4ZT1A 4XPHH 4Z5RA 1MAKA 1J8HB 3FH8A 3NFNA 1KBPA 1U9KA 4I3RH 1RZQA 3K3QA 4MYWB 2YSSB 2KI6A 2IG2L 4WI3A 5IMOB 1SJEA 2G30A 1ZVHA 2VDKH 1BIIB 1ZV5A 2I5YL 2V8MA 1KPVA 2ENPA 4UQEA 4PRIA 3O81A 2KKQA 5JORA 4KJYB 1X5JA 1TFPA 3KEHA 3KLQA 5DMGC 4WHTB 5D7IE 3EYVA 2CO3A 1V3KA 3M07A 4D9LH 3U36B 5F9JA 3QPKA 2B1AL 2KDYA 5D72H 4NQEA 2AABH 4OD3H 2FQDA 1V7ML 2IH3A 4JPIA 3BQUB 1AC0A 4AIZB 4DW2L 3GDCA 5E2JA 2PPAA 4LBAA 3SQOH 2CH8A 3L3GA 4N2NA 5C92A 1MNUH 2P5WE 3BWUC 4M8VA 1T4KA 1FYTB 5FOJA 4MNQE 3O3AA 3BYYA 5DI8A 3T09A 1I8KA 1K6QL 2OZ4L 3LRSA 4ANUA 1WBYB 1QASA 4G71B 3UJIL 2AJSH 3WKMH 4KPHH 4FFYA 1TSHA 1B6DA 2PP9A 2MSPA 2YBGA 4L18A 2ZX8A 5I1EH 2CUAA 1RIUH 2WBJC 3L81A 2ZOTA 5IWLC 4QTIL 3IWUA 1AMYA 4NC1C 2FATH 5LBGA 1CGWA 2R4RH 3APFA 4IIQC 3QEQD 4HIEA 3SZKC 4WW2B 4JY6A 4W9FC 4ILDA 4LASH 4Y1AD 3QUHA 4BQBA 1RH8A 2EH7L 3VFGH 3ZQWA 1CFSA 3I6KB 4QXGH 1LWJA 5CBAB 5L9DL 4XVJL 1ZIBA 5JOFA 3UP6A 3DX3A 2CBPA 4EVNA 1OAZH 1V5JA 3B1TA 3DOHA 3CH1B 3PQYA 5HHOB 4PJ5A 4O58L 4F20A 1HH9A 2DKSA 2IBGA 3KW7A 4LHJB 3FQ4A 5IB3A 1FNHA 1R1CA 4V11A 2OCCB 3HN8A 1L0XA 4P5MA 3S3SA 2DV6A 3RU8H 1BQHA 2ZAIA 3A22A 1PD6A 2PPFA 5L8KB 1VPOH 3IE9A 4Q52A 1P0SE 2A9AA 3R4RA 5LG1A 4Z5RB 5FUOL 1VA9A 4ORGB 3UACA 3GXFA 3MV9E 4PTTB 4BZ1L 1A9BB 4PJBF 1OY3B 3SPJA 2AQTA 1SOKA 2FL5B 1B0RB 3H54A 2YD1A 5AKRA 1KEML 3NMEA 4FX5A 4OCWH 3WNIA 3BZFB 3WYRA 5IW6B 4AQ1A 3D85B 3HZVA 1FVEA 5DK2B 3N50A 4AEHH 1QLFB 1AR1C 2HSIA 3LS4H 4XPHL 4ENEC 1GCFA 1IEBA 4BSWA 4NXSA 3CHOA 1EXHA 2ZSWA 4V2CB 5KSAB 3Q6GH 2H3KA 3D4GA 3KHQA 5EZIL 4B0MB 5I17B 3L3KA 3MPCA 4WTZA 5CGBA 3MNZA 3UC2A 4WK2B 5EUKB 4HKZA 5D7SL 4MA8L 1IB5A 3P0VL 4WNQB 1PZBA 4QJ4B 1J8HE 4YQXL 5IQ9A 4B27A 2Z9TA 2WOYA 3LQAC 2CA4A 3COOA 3GB7B 1KXQA 3JVGA 5JPMC 4U1SB 3FFDA 4X7EC 2I07A 4F92B 5EC1A 2VDQH 1I1AC 5LNEA 3VXMA 1NGXB 3C8KB 4MMXB 4TSCH 4YHPA 5IB4B 3SKMB 5I1AA 1GOHA 4PY8I 5A40E 1FNSH 4KDWA 3TA3A 4DZBB 4L8DA 1RZJL 4KBPA 5KAQG 1OGAB 3WJMB 4IU2B 1N8OE 4FYSA 4H8WH 1T1ZA 5IQ9B 1IAIL 2VH5H 1EHNA 1DVZA 1OD7A 1FAKT 4OZGE 3RA7L 5IEKB 2ZXWB 3K5RA 3BVDB 4QXUL 1A7RL 5L2KD 2GQHA 6TAAA 4Y5VB 4EKJA 2MKWA 2FQGA 4DNLA 5JLZB 5HGHB 2JJWA 1R0AL 1X9LA 5GGTL 4GKZB 4IQHA 4YBLB 4GUQA 4FRWA 1HL5A 3WFEH 2FJFA 5E8NB 3BCFA 3W11C 4QRBA 1NM9A 4IS6B 4XX1G 1N67A 5HYJE 4XO4A 1OGAE 4NQVB 1J86A 1A4JA 2DQ6A 1AIFA 5AEAA 3DVNB 3S3PA 4EDWH 1NC2A 1O0VA 2WVTA 3IU4L 1DVUA 1JJUA 4R4FH 2ZG2A 1OGSA 2DB8A 1AP2A 7PAZA 4QI3A 1CGUA 3EDDA 1FRGH 4X83A 2WBKA 4ZK8A 3D06A 4XXWC 2FEEL 2HRHA 5ESAA 5IEHB 4Q6IB 1FBIL 5JW4M 3LZFH 4TNFA 3UJTH 2QKIA 3T1FB 3QPXH 2FECI 2I7OA 3SY0B 3L3GB 1A4KA 3IT8D 5BZDB 1I7UB 4RFEA 1NEZA 1NCOA 3AB0C 3P30H 5C0IA 3ARDD 1UYWH 4CVUA 4KH9A 4YAQB 4F9PA 1CLZH 4LB8A 1L5GA 1A3RH 4BA0A 4A2MA 4BK4A 2VRAA 4ZOAA 5JHDE 2X5PA 1RQ5A 4LSRH 4AENB 3QUXD 3QCUH 3BFWA 4NP4L 2DQHL 3DUUA 4ODHL 3LYRA 1BIHA 3BUIA 2LABA 5DHXB 4HS3B 2BNRD 2ADGA 3QSKB 4LIQH 5MENA 3O3UN 4EZLA 2VAAA 4A39A 3FQ2A 2R1XB 3HZKA 3Q1EA 5J06A 3I6LE 2G60H 4K9EC 2WLLB 3VRLF 5KYYB 4ZS7H 3H6AA 4OCMC 5EU7E 2A6IA 4LCCA 4PRAB 4Q74A 1P9MC 4PJFE 4XP4L 1QUNA 2NQDA 1J5OL 3ULSB 5I5MA 3TXAA 1F1GA 3GLEA 4OIBA 1NGYB 1O9VA 1EZUA 4FXLA 4U1KA 3X14B 3BPNB 1EEUA 1KEGH 3W9EA 1LO2L 3ASOB 3WIFB 4X6BA 1ZWIA 3O41B 4HEME 4C8XA 2ZP0T 4IU2A 1UJ3C 3KYMB 1CGVA 3NQIA 4TQIA 2B9AA 4YL9A 4QLWA 4RMUA 2WLHA 3MRRA 1MCPH 2C9AA 1JZ8A 2X88A 5M7QA 3MYZA 4UBDD 3CMGA 2WUCL 5KS9E 5EA0L 3FK3A 2IWGA 3CVIL 1KJ2B 2ORBL 5BV7L 3J8F7 5I1IL 1EGJL 3QS3A 1PEWA 3CU1A 2YXFA 4NUJB 4BCZA 4HFUH 2QHLA 3D50A 1IAOB 3DX0A 1U8HA 3O2DA 3EIFA 4LKCB 1E43A 4QXUH 3SODB 2OM5A 3ARBB 5D6DA 5B3JE 3VUAA 3UZEC 5BVJA 3MCKA 3LDBB 1CD8A 1J9SA 2D31B 1Q1JL 2J1KA 2YGPA 3DX6B 5FXCH 4MLSA 3U4EA 2GUYA 5KG9B 2GIXA 4JJ5B 4K7PY 3HE7D 1A3LH 2PLTA 2XHNA 1UWXK 3TBBA 4YZFF 4DO5A 1EO8H 3BPLB 1S5HB 3UZVA 2J6EH 3DO7A 3QJUB 1E3FA 2ZWYA 4JO2L 1I1AB 2ZCHH 3T4YB 1SMDA 3NJKA 3V0GA 3WEMA 5KAQF 2IC2A 2XTJE 4W4OA 2HTKC 2XV3A 3A6CH 5ACZA 4BFEA 1R5WB 3QFJB 3T2NH 1BLIA 2XY1A 3AADB 4V1DB 1MVYA 1THCA 1SHWA 4M4RB 4N8UA 1UCBH 2KH2B 2IO5A 5E1AA 3GKZA 2IALB 1Y7VA 4YEFA 3TF7C 3U1SH 2EO7A 4PJCE 2Z64C 4DEUA 3EJTA 4GY4A 3GT6A 3F62A 2ZNXA 1QR1A 1A6ZA 5TGBA 4U6VH 5IBUB 1HQRA 3K2MC 2OMXA 1O7DC 2J72A 4X4ZA 5GS2D 43CAB 1HKFA 5I8OH 2VJXA 1DE4B 1I53A 2BFVL 3ZZLA 3LD8C 4QWWD 3HC0A 5EEZA 4ANKA 1S46A 4MS6A 1U8HB 2ZUYA 2QDWA 3OJDA 3OHMB 5E03A 4LLMB 1GMIA 4UDUA 4KVPA 4OZFB 3ML8A 1YEKL 1JPFA 1AY1H 1HWHB 5HDRA 4XTRC 1F90L 1J0JA 2B15A 2B8OT 5JHAA 2N4IA 2YUZA 3TJHD 2JCCA 1MHEA 2WIIB 2AXFA 1HXMB 1NFAA 2NY7H 1S8DB 2X05A 3KGSA 4DP2X 2IAND 5HHNA 2DIEA 1KNOA 1PW3A 1PVHA 5F88A 2FECL 1A4KB 4GAYB 3A67H 1J0YA 1FHNA 4P04A 5B4MD 5DJXA 4DH2A 1KJ2A 3MX0A 3TBTB 1TCRB 3KPPA 3CFBB 4R7XA 1NKGA 1WK0A 4P3DA 4U3SA 3M88A 3TP4A 5ABZA 3F05A 2P8PA 3EYUL 2FD6L 2J5LC 4WW1A 4PTTA 1UXSB 1FNLA 1LM8V 5GRWA 4PJEE 3WIFA 4IKIA 4FA7B 3SYCA 3IJEA 4FYQA 1J18A 1P1ZB 3LEXB 4XBPA 1WCQA 3U36A 2JI3A 4S10A 2X4TB 3FH5A 3KYMA 1F3JA 3QUYB 4HIJB 5MENE 1PG7W 1WAPA 2IALA 3RKPA 4FLRA 1ZHLB 5AZUA 1XGUA 2F18A 4HLJA 4Y2DB 5AQ0A 2MNJB 2I85A 3HZKB 4WJ5B 5C0GB 2JQMA 2UY7A 3NZHL 5FYLL 1ODAA 4Q9RH 3I6GA 2R7EB 4I2XA 1U0QA 1P1ZA 2Q0ZX 2V3EA 3IAQA 4UQBA 3D18A 1YQVL 2BMKA 3RDTA 5L88L 2P3YA 3BEVB 3MV9D 5B21A 4ZUUB 1CR9L 3INUL 1SQ2N 2CO4A 3CN1A 5GGRA 1J5HA 4CN4A 3EG9A 1YECH 2BY0A 3OC8A 1R24A 4BSVB 5GGQL 4P2RB 2WOBA 3BIAX 5DD3L 1L7TL 5B1JC 4YE4H 3VCLB 5LDUA 2C7UB 1MFMA 3LZLA 3QAZC 1G7HB 1H8OA 4FYRA 2RAMA 1O6TA 1YEDA 2ZPKH 3QIBA 3OJMB 4H8UA 2QQKH 4OGXL 1YEHL 2RR3A 5DJCB 4AYFB 5IFHH 4NQSA 4MD5B 2P9RA 4QHNB 1GYVA 4E42A 4RESB 5GGRB 1O75A 5C07B 1E28B 3KYNB 1NMCC 3R8QA 2GJ6D 2OR7A 1JZFA 4U6VL 1L6ZA 5E4AA 5I15H 1F3RB 5DA0B 3EFDH 1BQRA 5K69A 4NQVA 2J1WA 4AMXA 1I8IA 2X38A 2XV6B 2ZWNA 2UWEF 1GHFL 4WV1B 5C0GA 3I75A 1A9BA 1OSYA 1P6AB 3RP1A 4XO8A 4BFGA 4H26B 1ETA1 2FJSA 4X6EB 5DTFB 2CRIA 4GUOA 4FTDA 5F0LB 3GM0A 1GY2A 3CBJB 4XPBL 4FA6A 1X44A 5G4NA 3TYGL 1QTPA 2PYEA 5TE6H 4XE0A 3N91A 1X6LA 4EI5D 5J6GB 1J8HA 3NFNB 1UWEL 3UERA 4M00A 5ANMA 1KYAA 4AVKA 4KXZH 2F15A 4LARH 2OQJA 2BSRB 2Z8RA 1UWXH 1XF5B 3I9PA 5HY9A 1MF2H 1IM3A 1ESOA 1KLGB 1BX2A 5KSAD 1MEXL 2PWHA 5A7BA 1YMMB 5K9OB 1AR1B 1G43A 3ASNB 3B6SB 3VI4B 5J13B 5JIPA 2YMXL 3E8UH 4Y9CA 2O93L 1JS4A 1TYEB 5K1JA 4CMMA 3N3EA 2FAUA 4KJWC 3AGVA 2IV8A 4DJMA 4OI8A 2IBZY 5LQBL 2WB1A 4G7RB 4R26H 4M4PA 3TA3C 5JW5B 3DARA 2R0ZL 3KLLA 2XQYG 3BZEA 1GTNA 2X7LB 5E5LA 2FCBA 2VDLH 4WI0B 5H94B 2CG9X 3K6OA 3IXTA 3MGAA 3MV9A 1MOEA 3GMQB 3BO8B 4QGTA 1HS6A 2V3FA 2L4OA 3FQWA 1ZOXA 4WI2A 5DLMH 2VKXA 1DBAL 2P5PA 3U6RA 5FUCC 3TO2B 1II4E 1F1AA 3KPSE 2GW5A 5F7LB 5LGKA 2J8UE 4JZNB 1QO3A 1XL4A 2IDCA 2HWZH 2BIOA 3FQUB 3VH8B 4KRMB 3E2HB 3Q13A 4FYTA 2HG0A 5DHMC 4OFKA 5L4JA 1PX8A 5F3BA 3B56A 2IFFL 4GXUM 2PXYD 3RX5A 1UGNA 1ZHNA 4PBWD 3CC5A 4E9QA 5FYKH 2B2XL 1ADQL 1D5ZA 1HIML 5DMIH 5TK4A 5DZNA 3RFRA 3RWIB 2AQ3A 4XOCA 4I0PD 5EOCL 1JE6A 1TIUA 2HFFB 4WHCA 5ID0B 3QCVL 3QB7C 1RKRA 3ZHKA 4YZWA 2P48B 4A6YA 2QQKL 4LPXA 1G6RA 1AAJA 1IGIH 4K71C 4O5LL 1Z32X 1FV1B 2JTDA 3BFQG 1WYJA 2EE6A 1R3LB 3Q1SL 4KQ3L 1D5ZB 1M6UA 3VGAC 2B5IC 5CNHA 1OAJA 2ADJB 4Y16A 5C0AD 1SFHA 1HXKA 4K07A 2I24N 2EAEA 1T7XA 1ZXQA 2IG2H 2XN9B 3QVAA 3PP4L 4MX7A 3U4EB 3RVXD 1PX4A 2ALWA 4H1LG 3DDFA 2MFNA 1A0QH 2X41A 3KWTA 3AQXA 4AG4H 3O4OC 1O5DT 2BZCA 4PJEA 3K0YA 4LHUG 1CWVA 4I0PC 1OP9A 4OLYH 5D7KD 3FCTB 3GIVB 3QQ4B 5GGTA 2XYBA 5IB1B 4FNRA 4RISL 4GS7B 1AG6A 5ITBH 1B0GB 1YY8A 3NBNA 3E6FA 2P47B 3NGBC 3WNLA 4R5TA 5D2LE 5E9DB 2B7DT 1OCCB 5D8JH 3VH8G 1DANU 4PJDF 4KHTL 2J56A 2QHRH 1GGCH 4PRIE 4UAOC 1KCSH 5EUOF 3V7AG 3VTAA 4G8EA 5D5MA 3D2TA 3FFOA 4L9DA 3KPRB 3RVXC 4KRPC 4P46C 4MCZA 5MHSE 4HC1A 1HNFA 1MEXH 4Y16B 2BINA 5B8CB 2X6AA 4KO7A 4X5WB 5DD5L 4DKFL 1PFOA 2C9QA 2EUZA 4Z8FL 3F64A 4GSUA 2I9TB 5BV7B 3MRIA 1XB8A 3FTGA 1KB3A 5LBSL 5F93C 1RIUL 4OJEH 1ORSB 2DMCA 3PNWA 1MQKH 4PI2A 5D7SH 2XUWA 4XRCA 2YFNA 3OKDA 4MSWA 3K2UH 4GI8A 4XMVA 4L4VB 3RWEB 4D7BA 2R4RL 1FH2A 4OCXH 1FN4A 2ZXDA 2AJSL 1BQHG 3MXVL 1RJYB 2GIYA 1E3XA 4LPCA 3UDWC 2EH7H 1WWCA 2QEJA 2ZKWA 3B2XA 2GSGA 2Z35A 3V6OE 5I1EL 1DBAH 2ERJC 3MRLA 1FYTE 1SEQH 1UM6H 3TH2T 3PREA 5DUPL 5H35A 2FRGP 5MI0C 4OCRL 3BW9B 3BUQA 4YJZL 2Y2TA 3EO1B 5ELIA 4EAEA 4WK0B 3E7JA 3QUMA 1CDBA 4M8QA 3VQ1C 4J6RL 4DUWA 1SPDA 4RA3A 1REIA 3VRIB 3QQXA 4Y4KA 1QWUA 3PS6A 1U8QA 2MIZA 2NXZC 2B16A 3FUJA 4YK4C 3LRMA 4F5CA 2GBTA 4FNSA 3POCA 1IZJA 3MLTB 4PRBA 2QLYA 1BYNA 5DHVH 1JZEA 2Q6WB 1KXTA 3PHSA 4V1DD 1K4CA 4L2LA 3E1ZA 4J1UB 3CC5B 1MCFA 2GJ6E 5DC9B 5TDPB 3I9GL 4P2YA 3GSNL 1HAUA 3CN3A 3NUKA 3O3DA 4JQXC 4PJ8C 1PU0A 3OMNB 3D85A 5DK2A 4EDWL 4IRJC 1U8QB 1BAWA 3UTQB 3IE4A 2AXWA 4NQCE 4YNYB 2QPFA 4CMHB 2NX5A 4L5FH 3NJVA 3ARUA 4LVEA 3AU0A 3GMPB 3QR0A 3LY6A 4ENED 3R0MA 3L7FB 4NC2B 4YMPA 3KNBB 5KS9A 2WLKA 3FOLB 4KVNL 4JDTL 2D7TL 1G7PB 3P3TA 3TV8A 3Q6GL 5IHZA 1ETB1 4YLBA 1XTLA 1JIBA 3C6LA 2E9JA 3LHAA 2Y5TA 1BEYL 2G9KA 3L08A 1KSRA 4UZGA 4UTBL 3SCMB 1JDDA 1X5ZA 2JKRM 5ITBL 3OXRB 4M6OL 4X5WA 1JK8A 1W72A 4ZYKB 4IBWA 1BFOA 1HEZA 3O4OB 5DMKA 5SWZD 3ZDYE 3CZNA 3ZN6A 5JR1H 5T33H 4BGLA 2GJZA 3JV0A 1MI5B 1B9KA 1NDMA 4XE5B 5BZXA 4IRJD 4PRNB 5FCUH 2B59A 4BEIA 1T5KA 2OMTB 2VR8A 4PJFA 2NDFA 3FO2B 4JRYD 4LCCC 3C60A 3ASWA 3GI8L 3ELQA 1H9VA 3O45A 3RRQA 2HJKB 4JHUA 1DQQA 2BP3A 25C8L 5E9DE 3HVNA 2Q6WA 4GOSA 3KLKA 1AKJD 4FQXA 1J0KA 1EIBA 3ARPA 4S0TD 4ODUB 3MLVL 4HPYL 1SJHA 5PAZA 2W38A 3A5VA 5PCYA 3V0JA 4YDJB 5C0BB 5EBWA 1JGIA 4IKLA 4QYOA 4S0HA 3N40F 1PIFA 1JPGA 3OD3A 5B1BB 2B14A 3PGCB 1D9KA 2NSQA 3B2MA 2DQUL 3CFCH 1A4JB 4M6ML 1JXFA 1MW1A 3ATBA 4BFIA 4AXWA 4OZGB 4DKEH 4YUEH 4HSCX 1A1OB 4WFGD 3STZA 1BOGB 3BP5B 4K0OA 5BW7A 1QSFB 3GRBA 4LGRB 1XGPA 4QRRE 2KYIA 5EZLA 4U2ZA 5KVDL 4HJ0C 3B6SA 1G6RL 1ID2A 1QTYT 4NS0A 4S1QH 3WFDH 5FYKU 4G72B 3ALPA 3GMMA 5D4IA 1VGKA 2AERT 3OXRA 4ZYKA 4M1DL 4J3OH 4DEPC 4G9FE 2IGTA 2ICWI 2WQ8A 4NKOB 1IE5A 5T1MA 1U3ZA 4Q4EA 1WG3A 2PCPA 3KM1A 4ZUSB 4DP0X 5AWNH 3IDJB 1A6UH 2WYTA 4OZHB 2BERA 1KFAH 3SE3A 4HPOL 4ZPTA 5CEZE 1FLRH 3C60D 4PLKD 5F21B 4OI7A 4L3CB 3K6SB 4N9OB 1FWXA 2OXGA 1RZKL 1XR8A 4JZNA 3JTTB 4J3SA 4BQ9A 4OZGA 3SKNB 1A7OL 4LP5A 5GS1A 1OF2A 2ITEA 5I6PA 1B2YA 3H4HA 4HJ0D 3ESVF 3WUWB 4JKNA 4MZIA 3FUKA 1NGWA 3BSZA 3FQNA 2CR0A 4UYQA 1QLEL 2D7TH 1QI5A 2G3NA 5KW9H 4UTAH 4Z7QE 3UAAA 1T89C 2CO2A 1F4HA 2ZUXA 5DVPA 1MFNA 2EDWA 4UCFA 4G6JL 1G0YR 3ATDA 1W8OA 3LMJH 4KUZH 4MWFA 3MNVB 4WFFE 4LLMA 4XAWH 1CBVH 1QFWL 4B5EA 3CQQA 4F24A 3QIWD 1JGUH 1SF3A 2JV6A 3EBGA 4LDLB 5CEXA 3CFQA 2F61A 1SYVB 4K3EH 4PSPA 3UAEA 1CGSH 1UQSB 2GITA 4U6HB 5EA0H 4PTUB 4AY0A 4JFED 4MCYB 2MHAA 4DW2H 2L0DA 5HY9B 3B9KB 1Y07A 5TPWH 2W0FB 5IVNA 5BQ7B 1E67A 1UWGH 3AAZB 4N2AA 1GYUA 5E8PA 1OOAA 3TVMA 1ZA6B 1H3GA 2XKNB 3VFUA 4UF7C 4L0PB 1XB3A 5EPMA 4WW2A 1MCJA 1BBJB 1KY7A 3IDMB 4HCIA 2VLKA 4A2EA 2XBDA 2NUPA 3E3QE 2ED8A 3SZ6A 3HE7C 5EMYA 4E9SA 2PP8A 3VMNA 2DJMA 3D08A 3I9IA 5C08D 5FPIA 4YUEL 1IEAB 2HRPL 3ILQC 4WI8A 4KMTH 5ENWA 2E6QA 4I48A 4QRSA 3SDAC 3WFCH 1N19A 5BNXD 1D9KB 1FORH 4OLEA 3WG7B 3CXHJ 1JG9A 3ISYA 2WYHA 3T4AA 1W0VB 4LASL 2ICCA 3INOA 2PN5A 3L2NA 2QGBA 3KGUA 2JKTM 4PJXB 4QRRD 4HWUA 4FA8A 1HHHA 4ONOA 1LEKA 4GAFB 5I1DA 2EDHA 2ADIA 1BREA 4WEUD 1FZKB 3OKMA 4A63A 4FQXB 2NW3B 5EFIA 4U1HA 4LNVA 1UOVA 1BFVL 3THML 4KXDA 1Q9LB 5BS0A 1HOCB 2P5ED 4Y4HB 5TDNB 2AC0A 1MWAB 3VWJB 3BYTA 2A1WL 4FHKA 4YSQA 1VFBB 1MWAL 3GSQB 1F00I 3AUWB 3GPSA 1IBGH 4QLRA 5IQLA 1NC4D 3QCTL 5EOCJ 4JY4A 2W0LA 4DETA 2DIBA 1V55B 5BJTB 5FO9B 3TF4A 2QKSA 4QWWC 4Q9QH 3RI5K 3ILQD 5IK3A 1X5HA 3WXVH 4V1DE 1CIUA 3CK0L 4NN5C 5KBLA 2GAZA 4ZMLA 4A67A 3J7HA 1DBKL 2NY2D 2AANA 2ALAA 5ENWB 2P5WA 4OFYA 3N0PB 3DV4A 4A2DA 4XXWA 3V0AC 3QUML 3CFKB 4IJ3B 3MUGA 1TQSA 2PXYA 4PU2A 4K5PA 3CVHH 4F91B 5DJDA 2MCMA 2UXGA 5LVEA 3CFDB 3JTSB 1DQJB 4YOKA 5GS2H 5E99L 3MJ7B 3CZGA 1N5AB 4XO9A 2VT0A 4JFYB 4KUZL 1OCZB 3TA3B 5HYFA 1FYTD 3EOBA 5I15L 2L7UA 2VSCA 1IARB 4XNXH 3UBFA 4PY7A 5CCJA 3CLEL 2EYRA 2BLFA 2C3WA 2JXMB 3EOYG 3LSOB 5AZ2L 3ZZSA 8PAZA 2CO7B 1SFDA 1YYCA 4X9GA 2YPKB 1FAIL 4I77L 1ZWIB 3O9WC 4XPGH 1KFGA 1BZ7A 4MJID 4B96A 2E4FA 1KDIA 5KVGE 5EU4B 4AQ8C 2LV4A 3GXUB 4OJDH 1FO0A 5BRZA 1J8SA 3SGDH 2A6JB 2HPOA 1ZHKA 5DJAB 5TDNA 1OTSD 1C5DB 3VU2A 4BJLA 3MC0A 4UB0L 4DERA 1BYOA 1P5UB 1S7QB 5EO9A 4ZFFB 2VABB 1N8ZB 3FMGL 3N2JA 4AE0A 5DR5L 1JGLH 1CO1A 3SY0A 1DEDA 2Q20A 3F58H 4FNTA 4S2SA 2IGFL 4K8RH 4KH2A 3CIAA 3HC2A 3T8MA 1ICTA 1T0MB 3B3IA 1YAIA 3JYCA 3GRGA 1QQDB 4JFHD 4TPRH 3QG6A 5AZEL 1J8HD 1TTBA 4B7IA 4EI5A 5HGDA 1G7MB 4IGBB 4GFXA 1A47A 1EV2E 4FFZA 5FHBL 3VYPA 3FB8A 3WN5A 1C5DA 5A1AA 5DQ9A 2V17L 4PJCB 3W5MA 1O9ZA 1NCBH 3BN3B 2H6OA 4R26L 5HGAA 1NJ9A 3LKNA 4X6CA 4AVJA 1NGQH 3LIZA 3DIFB 3NJIA 3VFOA 3BRFA 4MA1C 2AKRA 3HAEB 2MOGA 1EJ8A 1GZQB 4PRHE 5DRWA 5FKAA 1E27B 5BZWA 5HPMA 5IHBA 4WY7H 4F8OA 1MJJA 2APFA 1F56A 2CCWA 1ZLVK 3WO4C 2DYPB 1YLBB 4NAJA 5ESQA 3GZKA 1DQDH 2F58H 4GI6A 4ELDA 3B9KC 4TLTA 5T3XD 1IGTB 2QPUA 4JO4L 5HHOA 2DMKA 2WIMA 3D4ZA 4NZRH 2E6JA 4L29A 2NW2A 3QDGE 3OKEA 1E27A 3N43B 5C7ZA 4OFDA 2ZZUT 1WFUA 2H0EA 1MCQA 1RFDH 2Q9OA 3KVPA 4FFYH 4GUPB 1YQ2A 3WS3B 4FLHA 4Y0GA 5HGDB 1BBDL 3BDYH 1XBRA 4MAYB 2UY6B 4HH9B 3AFLA 2BO0A 1GHFH 5DQ9B 4N8VA 3Q06A 2BOLA 3SY6A 2NLJB 3DMMB 5JXAL 3UPRB 3FONB 1HE8A 3M7FB 4M7ZC 3V9EA 5CHNB 3L5JA 4OQTA 1Z9NA 2DTML 3VE0B 2OYKA 3VFSA 1F13A 1HN1A 3LRSB 5TK2A 3BHBB 1QVOA 2GTZA 5AAWA 4MAYA 4PGCB 4EZJA 4B9ZA 4CSSA 1CYXA 1KCRH 3H42L 3NSYA 1RZ8B 2NW3A 1C8PA 4TVPE 3PXLA 5DJAA 1QSFD 3NFPB 2ARJB 4XNXL 1B0WA 2W5PA 4Z23A 3QH3B 4PJIF 2EE9A 3L13A 3TNNA 2GYSA 4GQZA 1RUAH 4N1EA 2QR0B 3MODH 2H1PH 2YOAA 1Q0EA 3L95B 4GEJA 5JYMA 1W8EA 4AEEA 5GS0H 1XCQA 2Q10A 4DFIA 1HSBA 3ESNA 4N90E 2EYRB 1UB5B 2OZNA 4CVZB 2NY6C 3QNZA 3L5IA 2C9UA 4DSYA 4M61A 4KKLD 4NQUA 3BP6A 3L16A 3TEXA 2GTQA 3ELAT 3EJCA 1PZ5A 5DLML 5LGHH 3QDHA 4S0SD 3VXSE 5IJDC 3LPGA 2FQFA 4Z3IA 2ROYA 2C1OA 3B7YA 3VXQB 1HI6A 5CBEB 2A6IB 3RY5A 5JOFB 2MQ0A 4F15B 2HRLA 2CLZA 4XT1C 1MXGA 2F08A 4XRCB 4XC3H 5AVTB 3PHOA 4PCKA 1HESA 2GJ6B 3FTSA 3OAYK 4X6DE 4ABWA 3RILA 1WFIA 4F2MB 1MFVA 4MB3A 3G04B 4J7RA 5E95B 3EJYC 4ZTPL 4AL8H 4YHNB 1OAUH 2DLFL 2WXQA 1AS6A 1LE9A 4RH4A 3ROOA 3EYSL 4JFTA 3QNFA 3DTUB 1HCVA 3OKOA 4CDHA 3RWHA 3MA9L 1F1DA 2LQRA 4EO5A 1H6EA 2R8SH 4X99B 1UM6L 3KPSD 3P73A 4PW3A 3D2UD 4P2RD 4BELD 1UZGA 5H4YA 2XZQL 4MAUH 3DRTB 2APBA 1KIQB 5F1KC 3BT2H 3T1FA 2D7MA 1C5CL 2NLJA 1UH4A 2F7OA 3ESPA 3KGRA 2XY2A 1T83A 4MVBC 2WO4A 5JW4N 4DTGH 1UXMA 4KTGA 3S5LA 1Q0YL 2UXFA 3HR5A 4BZ2L 1NLDL 1A9EB 5I1HH 4YH6A 3MLPA 5IBTL 1NGYA 1IZKA 3L5XL 3EJUA 3V4PA 4I5BB 3CQPA 1PZUB 5T3XH 1ZE3C 3HLAA 1MCHA 4C57C 4PR5B 4R3SB 4IRZH 5E6IB 4FFVD 3L4YA 1AGFA 2Y6SC 1LNUA 4NLAA 4HQQH 4FQLH 3BPNC 5DWPA 4DP1X 3OB8A 5IW1B 1KIUA 5C6PB 1MJJB 4P4RB 2D8KA 5C0BE 4X5PA 3DURA 2WANA 3CCHA 3IKCA 4K94L 5C0CE 4FZ8H 4PFEA 3QG7H 4TNWF 4G82A 3PXHA 3L4WA 5CSZA 4MVBD 4P46D 1P2CB 4Z0BL 3H9YA 2FUTA 3IXAB 1UT2A 3OHXB 3C5XA 4WWNA 2F2HA 1DQVA 2F5BH 1NEUA 1P9MA 3PHQB 1CD0A 4IOFC 5IUSA 3OPZH 3H0TA 1ACYL 3IDNA 5D6DC 5SWZE 5HDBE 5DRZA 4LEOA 5KVFL 1QP1A 4PJIB 5E94A 5I19H 3Q8AA 4PJ5D 5TQ2H 1KJVB 3LH2H 4OU3A 3GJFK 1J48A 3HZYB 1WGVA 4LEXL 4PWFA 5CFAA 3VCLA 5IEHA 1XF2A 2YHGA 1YDPB 1VKXB 2BRRH 5EHFA 2HLAB 3MOAL 4W9LC 1O9WA 2QTVA 3OJDB 2CJTA 2D03L 3WKYA 5HYIA 3FO1A 2ISDA 1PPIA 5H8DA 2WNXA 3A47A 1WZ1L 4FULA 5EOTB 2OL3H 1TLMA 2QVMA 1V7NH 3DWTA 2MH4A 4QO1A 1R9FA 1ZSDB 1YQVH 4IHOA 4JDVA 2H45A 4U6YA 5LAXA 5L0QB 1FFRA 1I9JL 1HFUA 3D3VD 4E9YA 1BG1A 4DF9A 3WFBL 3JUYA 2Z3FA 3KL0A 3DHMA 4MDIA 2LAGB 1SVZA 1DFBL 3O3BA 4U31A 4WU5B 4EIGB 1SXZA 3MZTA 1QUPA 2VUOA 1KBKA 4PJ9A 4M7KH 4IEFA 5I9QC 1AGEB 1TFHA 3DVIA 1HHJB 3H9HB 3HMWL 3LN5B 3LQMA 4JN2B 4XNYH 3RWJB 4POUB 3IJEB 2XKUA 1KJMA 1WQVT 1CDYA 1I1AD 2R15A 5JORB 1JD7A 2OA9A 3NJMA 1NFDE 2Q1EA 4Z7QB 1VEMA 3D9AH 3WD5H 2VN3A 5I0ZA 4LSSL 2WKLA 3KDMB 4OB5H 4I3RL 4B9IA 5EBMB 3QZPA 2V6HA 2XQYK 5TDOB 5KVDH 1WRFA 2LR4A 2OMNA 3OXSB 4KX8A 2QVIA 3RBSA 4EUPH 4JDVB 4DO6A 3PAVA 3WEAA 2GK0B 1XF4A 4G8FB 3V8OA 5T3XL 5F9OH 5HDLA 4HEPG 2K6WA 1CTNA 3G5XA 1FCGA 5AW9B 2XWXA 3FO1B 3VFVA 3VI3F 3ABMB 5F7HA 4FJYA 1ES0B 4Q6KA 4Z7OF 5C7XL 2RTTA 2GJRA 2P46B 2ZUSA 4PH8A 2EVIA 2EC9T 5J3HD 2VLJB 5I73B 4RQQB 4JFQB 4K94H 2F1EA 2RIKA 2IVFC 3IFLL 3V5KB 5MEOB 4L23A 5IIEB 4GXVH 3N04A 2HH0L 3LZNA 3L9BA 2H26A 1RSYA 3WFHB 1Z9SA 1HHGA 2QQQA 4IRJB 3MNDA 2E7CA 3PU7A 2VZOA 2A6KA 4MJ5B 1FZMB 2YOCA 4AITA 3II3A 4APXA 1THAA 5CSZB 3UBXG 3MXWL 3N55A 4AQOA 3LEVH 1NUFA 1KGYE 2X2YA 3QRLA 2DDQL 1KDJA 4PG2A 4ELKA 1F6LL 5IKCA 4F58H 3TBVA 5KVGL 2VC2H 4RETB 1LYQA 4J28A 4N2BA 1ZS2A 2WCPA 4BE6A 4LCIL 3A4FA 1MFBH 3HFMH 5DJYB 5J3HC 2CRZA 3RPKA 3WFDL 3MBEC 4BM7A 2UZPA 4ATTA 5D1ZC 1EFXB 1HSAA 4WTZG 1I9IL 1DJWA 1ZT7A 2DJUA 4LOVA 4PCYA 3WENA 4Z6AT 1SEBB 3PAYA 4EKXA 3DX7B 1CD1B 3I02A 3H7BB 5LO7A 2A9BA 3VXMB 3ZKQD 4MJ6A 5F7WC 2YR3A 1CFNB 4U7SA 3VWJD 5GJSH 3RA7H 1ILSA 4NO5B 3HNVL 1I4FB 2IQAA 2CDFA 1S9WB 5E8EA 2W0KA 4Y4KC 3PGFL 4KC3B 3W0WE 2XZCL 3A4EA 5D5MF 3IVKB 2HKFL 3PJSB 4OLXL 1Z9PA 3VB9A 1XF2B 4DVBB 5G5DA 3ESUF 5D1ZD 2G75A 2UUDH 1U41A 3BLPX 3NSXA 1Y0LB 3T71A 1PFCA 4F27A 5B8CC 5HHOE 1IBFA 4KRPB 1QI4A 2P26A 4LRNL 2YMOA 4OB5L 3D69B 4KK5D 1AZNA 3PWVA 1H15A 4MB4A 5DEJA 4Y1AB 1XXDC 2BVEA 3GXPA 5C07D 1ZVNA 3IJSB 2BXYA 1F6FB 4RRPG 3HG4A 4G8IB 4K7FB 1D6VH 3AABA 1NAMB 4ZQTA 3TJEH 3CBRA 1A7PL 1UENA 2YPLD 1LL1A 1JI2A 2GFBB 4EIBA 3PHAA 4PW9A 1SZNA 1ORSA 3BH9A 4UT9A 3DTXA 4JO8A 1DJIA 5IFAH 3TZVB 3LMJL 4FP8L 4JFDE 3C09B 4BFFA 4HU8A 4B9PA 4H26A 3GC3A 5DK0B 3QBTB 4K7PX 3BAJA 3UAFA 3GRWL 4EOWH 3MYJA 1UQSA 4LEBA 3CK0H 2DQHH 2PTUA 3QUYA 3O3EB 3IGAA 2VH5L 1EZSA 5TE4L 1NMCB 1T04B 3JZ7A 5AB1A 3TV3L 4J3WA 3ZOAA 2HTKD 3QQ3B 4NZ8A 2BZ7A 3KLAA 5CIPH 2PETA 2YD6A 3O2VH 1TKWA 3EYQD 4UWQB 4CU6A 1HQ4B 4NQDE 2UX7A 4TL4A 4Q6IA 3ML9A 1U4EA 3GFUA 4FI7A 1EJOH 3H3PL 5E4IA 2DMHA 5EIIG 2HRPH 1MPAH 1R3HB 1CFNA 1SHXA 4ZO8A 1SDDB 4AYID 3WEXA 1K85A 4JDEA 4AQEB 3QQ4A 5IESL 2Y0SA 4BUGA 4HZ1A 4HGKC 1Z0NA 4K7PL 3ZE2E 4KI5E 1ZGLM 4GG6E 3MV8A 3IDYB 3TC9A 5FA4B 2HG5B 3B2VH 3QISA 3W5NA 5HGBB 2ZWSA 1G6RB 1ND0A 5HDQH 1CDGA 3AY2A 5FGSA 4OVVA 4F7PA 4JQVC 1Y0LA 1PZDA 4OZGF 4GG8B 1NBZA 1HXYB 4AGOA 3GXIA 3ZT5A 5B4MC 4LRIA 1NA8A 4EN3A 1BA9A 4OLUL 1IBHA 1YDPA 1VKXA 4AGMA 3EYOB 1XVSA 1SJMA 3QJVB 1AD0A 1E3ZA 1N5YH 3PIQB 3BRGC 2V2XA 3LQZA 4WV1A 1PY9A 2B1HL 5G2NA 3X13A 1JN6B 2CMRL 3WS6C 1P5VA 1Z6JT 1KXHA 3MFFB 2JLPA 2XXMB 1UXSA 1QG3A 4PMEA 3MUGB 3SPVB 5BS0E 1DN0A 4XN9A 1ACCA 1ZLEA 2AXJA 3NA9L 1JOIA 2NUTB 4IDJH 4IBQA 4G3YL 1MCBA 4PW4A 3T0EE 4GI9A 3MLUL 1DFXA 4KVCL 5KBPA 3BW9A 3DUHA 5HDWA 1R3HA 2AJXL 2YRLA 3SGEI 5FA3A 3QRGH 4XMKL 4AQEA 1C12B 4P06A 1I7RA 3RIAK 2F7IA 4OD2B 2NRDA 1Z7JA 3QEQE 1BVLA 3LXBA 4NPKA 5SX5K 2VRQA 5EF2A 4OCSL 3ZTJG 1P7KB 2E8YA 3HPLA 5I8KL 4JO3H 5E7BA 3D2UA 3KPSA 1ETZB 3NCXA 1YEDB 1MY7A 3EJJX 3FOMA 2FLMA 2I7SA 5AZ2H 3VFNA 3W57A 3P54A 4ODUA 2YK1H 5ECGA 5CKAA 3UFIA 2GTWB 4UB0H 4CAGA 5I1IH 3UCQA 1FV1A 4W4NA 2M1KA 3O0RL 2QSCL 4JFSA 3Q0HA 1ZDQA 2BSCA 3IKCB 4PB9L 1AY1L 1GKEA 4YFLI 3CZUB 1P7KA 3B2UC 3F00A 5DJZA 2YO3A 3CVCA 2BNUB 3FT4A 3AITA 3NEXA 5DR5H 1Z9LA 3ZMRA 2IDQA 1YJDC 2Y06H 3GM8A 4L1BA 2V17H 3F65A 4G7QB 1X7QB 1XGQA 3CZEA 5EF0A 3FCBA 2WZPD 4JFXA 5DK3A 2ZF9A 2WCGA 1I1FA 3IDGA 4GT7A 4HISA 4F9LA 4WJ5A 5I6NA 1XF3B 3CDZB 4ZSOB 4X9FA 2XKNA 3RJOA 1BCIA 5C08E 4E9RA 3RNKB 1L0YA 3MLXL 1IV8A 1Z3GL 3OR7A 2BNUA 3FT4B 4DKEL 4JO1L 4MAZA 2XWZA 1IGMH 2AQRA 2KPNA 3RAJH 2F53E 3QNXB 1Z9OA 3UZQB 2Y3AA 4HOZA 2E46A 2ITDB 3LKQA 3IMVA 4I18B 5EU5A 1L6PA 3AT8A 1UB6B 4I9WE 4MCNA 4MA7H 2C3GA 4NKDB 1NM4A 4HHAB 4XVJH 2J20A 1R3LA 3BPCB 1T4KB 2IPTL 4OF7A 1F4XL 5EF1A 2JCCB 3IMWA 4ZSOE 2A4CA 5I71B 2X1QA 2H32B 2F8IA 4WWKB 2DWEB 3CJJA 3BQVA 4CU7A 5JZ7D 4OD1H 2ZXBA 5IB2B 1JWSA 5HHOD 3I3BA 1CDCA 2PW2B 4I18A 3QWOB 5I1DB 2WUBH 1AGEA 2NY2B 2G5BB 4OAWA 4Q0XL 4KKNA 2XTJB 1ZLVH 4PIRF 5KBMA 1MG3C 2E47A 2CHNA 2P24A 4UT9L 1BHGA 5IV2B 2MQ3A 5KJRL 3EYSH 3V0VA 3T4AC 5HHVL 1A2YA 2JH2A 2OX5B 3O8XD 3ARFB 4NSKB 3T3PF 1NAKH 4FEIA 3MA9H 2NY1C 4HJGA 1MCKA 3MGOB 5F8QC 5IMOA 3T65B 4X7CC 1QFHA 4Y9GA 3MJWA 4AMKH 4HIIB 2Z1PA 5IGXH 4U3HA 4N0CC 2WWMC 2TRHA 4WO0A 4A7QA 5I76A 2R1WA 3E38A 4DCQA 1FN4B 4GO8A 1IBZA 4EN2A 1KGJA 1LWHA 4KY1L 2KZWA 5BV7C 5I24A 4U6HA 4BDVA 1MCSA 2D9CA 5CS7A 4EN3B 1QYGL 3GK8L 1U8PB 1JPTH 4NJAH 3HZMB 1RMFL 5L4FA 4U1JA 3CX5K