3ZQXA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
146
Chain Sequence
MDVKVQYLCENTQTSTQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADWSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
total genus 40
structure length 146
sequence length 146
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 3zqxA00
3ZQXA 4TF4A 4B9CA 1NBCA 4C8XA 4B9FA 2WO4A 3ZUCA 2XBTA 2WOBA 1GA2A 4B96A 2WNXA 3ZQWA 2YLKA 1K72A 3ZU8A 1TF4A 4B97A 1G87A 2L8AA 4JO5A 2XFGB 3TF4A 4B9PA 1KFGA 1G43A 1JS4A
chains in the Genus database with same CATH superfamily
1BBDL 3LPFA 5E00A 4HC1L 1TIUA 1EAPA 3I02A 4ZX4A 3WNKA 4APXA 4YBLC 1N59B 3O6FC 1U30A 2YC1A 1BAWA 1E5YA 4HIXL 2G3ZA 5HDBF 5JIPA 3VQ2C 5KSBE 1DBJL 3UBFA 1AAJA 1I8UA 4CU8A 4OUUA 4JFUA 1A0QL 5AYTA 1KZQA 2CZNA 2Y06L 3MOBL 2DV6A 5C09E 4ODXA 3GJFA 2VMFA 2G3XA 1YEJH 4NUJA 1AIFA 4MMYA 3DI3B 2W07B 4X98B 4CGTA 5HHQB 1YQ2A 3BKJH 3UZEA 2PCFB 4K9JA 5JHLL 2LGNA 2Y6SC 1W9XA 5C0FA 4GXVH 2DYPA 4G9DA 2R4SH 3UZQB 2EICA 3VD9A 1P5VA 2DBLH 1SXBA 4KUCD 3BDXA 1TJGL 4AV5A 4WWID 1XF1A 3ROLB 3KVPA 4N9OB 4W6XB 1FNAA 2VAJA 1GAFL 3WUWG 1W0VB 2Q7AA 4DZ8A 2Z7ZA 5ALBL 5IV2B 2APTA 3FQRB 5I9QB 1R3KA 2OI9C 3VUAA 2YFNA 3VD0A 4NQVB 2CR0A 4NQEE 1HHGA 1BQHG 1SY6L 3LPGA 3IETA 3CHOA 4UTBL 4DPCX 3ARGC 1L9MA 1KXTA 2EXWD 3KPRA 3C87A 3A4DA 3B9KA 1TPXC 3ME0A 4QYAA 5ANMA 1BAFL 2WZAA 4CKVX 3S3JA 3F7YB 3WN5A 5I19L 1W0VA 1UD6A 3I50H 4TQIA 4FNLL 2XWJA 3ZL4H 2VM4A 3II3A 2GVYA 3WS6A 4PTUB 4W93A 2ARJA 1FL3A 1MFBL 5GRJL 4KVPA 3TH4T 3U1PA 5KG9B 3T0EA 1NDTA 2JTDA 4NQVA 5HDQH 4FGMA 5LGYA 3IETB 4OVUA 3WO3B 4MLSA 2EUXA 1A4BA 1WBXA 3FCSA 2WB1A 3L9RA 2R0LH 1ECYA 1FZKB 3CFEB 3PWPD 4P2QE 5JORB 2KL6A 4H44C 5FFGA 5HJ3B 4ZUUB 1I8MB 4I9WD 4P9ML 4AI7A 4UTBA 3D5OF 4PJHF 1CXFA 3UPAA 5F7EL 1ZMYA 2L7QA 4WNQB 2Q8BH 1U8KA 1A6ZB 5ADOL 2OQJB 1WBXB 3BH8B 2RCSL 1FZKA 3AROA 5E6IC 3BH9B 5GGRB 3NK4A 2CH8A 3BPLB 3W39A 2Z1KA 3ZHNA 3I9GL 2DI7A 3ERXA 1KTCA 4MJ2A 4MAUH 2BP3A 4OM1H 5CFHA 4E68A 1BJMA 3LIZA 3U6RA 4CRPA 5B1KA 1DE4A 4LCYB 2OMXB 3ZDXE 1RZKL 3MLUL 4V33A 3BUTA 1T80A 3BP7A 1ETJA 4UQCA 1G84A 2WO3B 4LEXH 4D7BA 3N9GL 4BQ9A 1Q38A 2C9RA 2ITFA 4BK4A 3SDYL 1L7IH 5FGBC 3THML 1IGCH 4IBVA 1CWVA 3L2MA 1MCPH 1G0XA 4R90H 2YAHA 4UM9D 4FCAA 5MP6H 2BDNH 5FYJU 4MQTB 1TQBB 4B7LA 4PLOB 5D9SB 4LFHG 5A2IH 5BW7C 3TBWB 3A5VA 3FSZA 2UVEA 4WFHE 2OMUA 3ETTA 3RDJA 2VL5B 3V4UL 3KYOA 4KI1A 5CMAA 2YAQA 4DEPC 5T1LD 4M61A 4MJ5B 4MAZA 3MGTB 1FLRH 4HZLA 5EBMA 2KT6A 2Z4QB 4AG4H 3B34A 3ECQA 1TJIL 2QQNL 2A0LC 2A74A 3I2CH 2Q8BL 1N68A 3C09C 1VERA 5E8NA 3IJEA 3M8OH 4X5PA 1PS3A 1OSPL 3ECVA 4BE5A 3LEXB 3TJHD 4MVBD 4LQFH 3V0WL 4QTHB 4M4RB 4UQAA 5DS8A 4OJAA 3WJMB 1W72L 3Q0HA 2A73B 2XWRA 2LU3A 3ZPDA 4LRNH 1CICA 1GZPA 5DLMH 4U1GB 5IJKA 3JSSA 4AK2A 1K3IA 3TC9A 4RISH 1ED3A 5F7MC 3QNZA 2P5WD 5DLML 4LCWE 5DC4B 2EVIA 3V4PH 5LBSL 1OT1A 5HJDA 1BX2A 1DQJB 1HIMH 3BCDA 4WWPA 3PAZA 1GJIA 5HDLA 1CXKA 1UUSA 1OGAA 2XV6B 3S4SG 4N0CC 1KBWA 4QRPB 1BD2B 4JFQB 1SZNA 1S6NA 2QDWA 1KJVB 5CLYA 4Q9RL 1QUNA 3E0GA 2G9HA 3GEWB 4R7XA 1JGUH 2ZP8A 4U1JA 3KNBB 2KZWA 5DC9B 5KANI 5B4MC 4R2GB 2WBXA 5C07D 1AZNA 2ADGB 4N2IA 5JLZB 1G7MA 2FO4A 2IDFA 3HZYA 1CE1H 1IM3B 2N01B 2ZOOA 3IKKA 2VXQH 5D96C 1BMWA 3WSQH 1BFOB 4V1DE 4PD4K 2A77L 3OJ2C 2HWZL 5IB2B 5GJSL 1MF2H 1KCBA 3WIFA 1DVYA 4JFQA 2ZXGA 3EBAA 1PYWB 2DH2A 4ZBJA 5F9JA 2FH6A 3JWOL 3LRGA 4AENA 3GJEA 5CUSL 4FYQA 4L1LA 4ANXA 5I15H 4D2NA 1SBSH 1JNNL 3NG5A 1K4DB 2XG5B 1EDHA 4IRJD 3F7LA 5MERA 4Y16C 4MXQC 4ODHL 4PLKC 3HRZA 2DLIA 3QPXH 2KMWA 2X4PB 2BSSB 1BVOA 1A3RL 3FUJA 5MEQA 2NRDA 1DBJH 4NX0A 4PGBA 2WXMA 1V7ML 3U25A 1K4DA 1I8AA 4QXTB 4JREC 2HFEB 3Q2VA 3R06A 3FTUA 4MAYB 5KVGE 4EMZA 4FMVA 3ULVE 4LDOB 1Z3GH 3U7AA 1RUKL 3FFCE 4APXB 4HDIA 4QHLB 3WTXA 3DOHA 1SDDB 2ZG1A 1J10A 3TZVC 1WFTA 1U6AH 2DWSA 4XH2A 1ZVSA 2NY2B 1LMKA 2NXYD 5AAPA 2IFFH 4A6YB 2VZTA 1WBZA 5GS1B 4S1QH 1NUDA 4EUPH 1TZGL 4YHNA 4ADGA 4MNHA 3NJKA 2VDLL 1WGVA 5AEAA 1IE4A 1OB1B 4MNGB 1F4WH 3K74B 2BJMH 4C8XA 3U4AA 4BUGA 5I1IH 2NQ3A 1E43A 2GSGA 3GXMA 4JG1H 2DQDL 4YLBA 1DEEA 4G9DB 4KZDL 1DLFL 4AV0A 4X6EB 1YEEL 5CR1A 1G6RH 4G11A 1OB1A 3MOBH 3QRBA 2Y2TA 4TVUA 3SQBA 4OM0H 1MIEL 1JZEA 2ICEB 3NIGE 3QDME 5ES4B 2HJKB 3EDFA 1R3KB 2GSMB 5D1ZI 4OZFG 4G8IA 3IDMB 1YEDA 5EN2B 5AL0A 5AQ0A 1BZ9A 2IGTA 4YHIB 4TLSA 2EADA 3UJTH 4F37F 5C8JA 1UA3A 5EV7A 4BFIA 2BHFA 4B50A 4O02H 1IZJA 3X3GH 1T5XB 3QXUA 5I1HL 4NFBA 3WDHA 1H8OA 1QRND 4X99B 4AYID 5J11B 3PNRB 3PWUB 3N85L 2DLFL 1BMZA 2YAEA 4UQ9A 1SBSL 4GXUN 1VACB 3GSUB 1HCYA 2E3VA 5FKAB 3DX2A 1IGYA 2DF3A 3HR5B 5E6UB 1IB5A 3HPJB 5HYSB 3US9A 4JDVB 5F89B 4QF1B 2ZP9A 2XN9B 1OAJA 1W2KT 3J2PA 1LO2H 4EBQH 1CICD 3LRMA 1UQSB 3GHEH 3CU7A 5CP7A 4ZS6D 5L2JA 3CZFB 3PWPB 3SYQA 4UV7H 4F7KA 3IRPX 4QRPA 4K5MA 4YDJB 4WI0B 3SDDA 3BEWB 2HRPL 4J23A 3FTYA 1EVUA 5EOCH 2ZONA 1OHQA 4QRSA 1JYNA 4H26B 3GMPA 5D7LD 4GKZA 1UWFA 2FHBA 2JV6A 1BD2E 4QRPE 1MCIA 3L8QA 2GI7A 3RUGF 1LO4L 1QQDA 4POZC 1QNZH 3K0WA 1S7TA 2H32A 4IMKC 5EZPA 4E42B 3B83A 4FERA 3VRLF 2XU9A 3QDMD 1IC0A 4FEMA 5AL8A 5T1LB 2CK2A 2OMXA 3REVA 1ZTMA 3SDDB 5I1KL 1GS6X 3D4GA 1IVTA 2QQKL 4PJ5D 3RU8L 2VLLB 5HHOB 2IFFL 4LCWB 3HE7B 2H6PB 2O6EA 4LK4A 1J48A 4GRLA 4RGND 1UURA 3IGKA 3UMTA 3R8QA 2ZYIA 3BPCB 3EZJB 4LRNL 1JPST 4OGYL 2NTFA 1EIBA 5ICZB 1OCCB 1S9WB 3QZWG 5JDSB 3ZMEA 4TLKA 2EE6A 3FXIC 4NP4H 3VFUA 3WTTA 5I1GH 3P9LA 2WY3B 4M3JA 2DICA 2YXWA 4UT9L 1AQHA 4Q6YA 4ZW8A 3M8OL 5CFAA 2Q76B 5F7UA 3ESMA 1WAPA 2VAAA 1I3VA 3A67H 3MBWB 4M48L 2X4TA 3UO8B 3V0AC 5BS0D 4X4XB 5CJOL 1SGKA 4JFPA 5D6DA 2Z8VC 3IMWA 4HKZA 4ZFOB 1KWGA 2DIEA 2JKIS 1ZK9A 1S7RB 3ARDD 2A74B 3IEAA 4QNPF 5F9WB 5IVXE 1HH6A 2X1QA 3WO4C 4AIZA 1IEHA 3H9HA 2YBRB 3SOBH 2EYRA 4XH2B 1INQA 3I6GB 3DJ9A 1WBZB 3AREC 4M4RA 3C08H 1KGCD 3QIBD 1YEKL 1LEKB 3P3YA 3ZIYA 2YC1B 3FO0L 5EFIA 2Q0ZX 1S7RA 3HCVB 5I6KA 1R34A 1QSFE 1A1OB 4RGOL 4I13B 3HG1D 4KXZH 3V0HA 5EEYA 3UAFA 3HE6B 4ZPVA 3BD4A 2YPVH 4Q4EA 2DJ4A 3RTQC 2GT9B 1RZKC 2EABA 4Y19E 2AJYH 3GBMH 4U3HA 1T7WA 4G6KL 3H9ZA 5D6CA 5JORA 1RH8A 1J1PH 2AK4E 4YHMH 5EULV 4ZFFB 2BSED 3UZVB 2PCFA 2H3XC 4Z5RA 2GI0A 5FUCC 4LEEA 4K8RH 4XNMA 3EG9A 1EAOA 1RL1A 3G6JB 5JOFB 1CLZL 3ZSTA 3KPQB 3SYPA 1JDDA 3NT0A 3W38A 3ZMNA 5BMFH 1M4KA 4Z23A 1U8HA 5DZPA 1S7UA 1A1NA 4K7PY 2OMWA 3FQRA 4GRLD 2YD9A 3GSXA 4LPYA 4OB5H 2NY4B 1ZLSH 4FFZH 5MEND 2BFVL 3P4OA 4IJ3B 1E90A 5IVNA 2BINA 2FEDC 3GSNA 4HH9A 2FEJA 3PHOB 2FX8L 4G7VL 3F7YA 2AMUA 5C0DB 3QHTC 3NSFA 2Z35A 2QMJA 3GRWH 5FYKE 4OF3A 1JZ7A 4WTQA 1YEKH 3VFWB 3ULSA 1AD0A 2MQ3A 4GP4B 3GRWL 5B1AB 3WXVH 1RJYA 1P5UB 4UT9H 1S5HB 2H3NA 3G6AA 3PGCA 1K2DB 4MAYC 2MQGA 3EGXB 1LDPH 2GBUA 5K9QI 5KYWB 2E7CA 3UCQA 3LY6A 2P28B 1UACH 1JDAA 4DP6X 2BWDA 4EXKA 4E5XB 2VDLH 3HLAA 4G8GD 4MQXC 1LE5A 1PLBA 1QQDB 4HJGB 4PY7B 3VX0A 4HVBA 3QUXA 2CCVA 2FX9H 2VQ1B 5D1ZB 4IIQC 1GGIL 2WTOA 1VADA 3RGHA 4UT7H 3NA9H 2YLHA 4YIQB 2WJ5A 5EO0A 5GGVH 4O4YH 1JG9A 4FQPA 4KHTH 1ZVSB 3EADA 1JV5B 3PS6A 2DM7A 3QULB 2LQRA 3V4UH 3HLAB 2HFFB 1U92A 3S96A 4H2CA 4KI5F 3CBRA 4LLUB 1NAKL 3J7HA 3QJQB 3C6SB 1NGQH 5DMYA 1IT9L 4FXKC 2DOCA 1V10A 3K6NA 1YUHB 1NBZA 4KH9A 1DN0A 4R90L 1Z2KA 2YPVL 3DX6A 4K3GA 3C8KA 3DGGB 1DBKH 1ADWA 1ZPUA 2FX8H 4YSUA 2FSEA 5D2NC 2K0RA 3UYRL 2ZCHH 1F41A 1FZJB 4D0BA 3GI9L 3H9YA 2BS71 2Z65C 3OMNB 5DLLA 2QL1A 2C4FT 1XMEB 1YHPA 5DD0L 5C07A 4G83A 3VYNA 1FIGL 2UZIL 4XC3L 2H4EA 4DGUA 4JFFB 3LTVA 1V54B 5TGBA 5HVGB 2HVBA 3U6XS 2ZXBA 3MLZL 4FFWC 2IH1B 3NACH 5DK0A 5BMFL 3L4XA 2YPKB 4Y5XA 5IHHA 2VSMB 1OPGH 4P2CG 1OAUL 3MGTA 4JQVA 1U3JA 5EO9B 4NFCA 4ELME 3OMZA 3UTSD 5BRZA 1PVHA 1YN6B 3L95B 5EN3A 4P2OD 4DSYA 3L3IB 3TO4D 1BYPA 1LO5B 1J7VR 2BFVH 3KXFB 3Q6FB 5KVDL 5ACZA 1N64L 2XWEA 4N8CL 4UIMB 4HALA 1GYAA 3V6OC 4PJBA 3DV4B 3TO2A 3FU8A 1Z9NA 2IBGA 4PP1D 1TFHA 3G5XB 3FL7A 2CSPA 1AZVA 3W0WA 2HLAA 2VO8A 5DS8B 4QHNA 5DI8A 2Q6WB 3AU1B 2NXZD 4GLRI 1JPTH 4IK7A 3RHWF 2GJZA 4ZX5A 3FQWB 3U83A 3FU9A 2FECI 2H26B 2XFXB 5ETUB 1FL6B 4Z7OF 5DFVC 2APWA 1TU2B 2UZYB 1FVEA 3BPNB 2GHWB 3CFBA 5TPWL 1U8OB 3BVNA 5DHDA 3STZA 1T6WA 2ZSWB 3MRCB 1OCZB 1KTBA 2OMBA 3AU1A 1JNLL 4YPJA 1GMEA 4DKDC 1JPGB 1EAJA 2C9UA 2NW2A 3ARTA 3LNIA 3S36X 5J12C 4JM2A 4LOEA 3UP6A 1XSJA 2EDXA 1VF5C 1XX9C 4QO1B 2B14A 3MJ7A 4FYSA 2DPKA 2LV4A 3KBHE 3NTCL 4JJOA 2GHZA 3ULUF 1GKOA 3Q2WA 5MEPB 4DAGL 1JN6B 4GQZA 3RWFB 4HKJA 1AHWB 1ZY9A 2E5EA 3STZB 1DLFH 3UGEA 4YDNA 2Y36L 1TETL 2UXVA 3VGBA 5IEHA 3TPUA 4UU9A 1I7UB 3OBAA 4PEEA 4E9VA 3ULVL 1MELA 2CO6B 2E9IA 3RWEA 4FZEL 4I48A 3RZWA 3JWDL 4HIIB 3MRKA 2ZUWA 1FG2A 1SM3H 4UQEA 4TM9A 2DDQL 4L3EA 4H8WC 2VRKA 4HWBH 5FYKL 3Q8CA 3P9LB 3L48A 4X4ME 1TO5A 3QIWD 5IBUB 2Q76A 1BMGA 3MO1A 4PS3A 5FUZL 3S98A 4XO5A 4U1SA 2K9FB 4YDLB 3GMQB 4XN7A 3HS9A 1WRFA 2EDHA 2ZXWB 2ZKYA 5B38B 3FFCB 2B5IB 1OF2B 2VXTL 3RGBA 5HD8C 3NIFB 1CLZH 1D7FA 3HI6H 4TTDD 4X80L 3LZQA 3NUKA 3AY4A 3SZKC 4M93C 2ODIA 4H20H 5FLVA 5IMLB 4XP9L 1LE9A 4Q0XL 4FQLH 3S36L 3IDJA 4ODBD 3SO3C 4MA8L 4PV9A 2K1MA 2YGPA 4ELKB 3NJLA 3WY1A 2Q3ZA 1FO0L 5CINL 4NKIL 5F3HA 1Z9PA 3VFTA 5BRPA 3PGDB 4KVCL 5CHNB 3DVGB 5AOIA 1I9IH 3BYYA 5EPMB 4GO8A 4JDEB 5L7XH 4KY1L 3H7BB 4WO4D 3DX6B 1I7TA 1NLBL 3OKNA 1JERA 4U3CA 5C1MB 2G75B 5JIQA 3ATAA 1SJEB 4AM0B 4PJFF 1IGFL 1MCBA 1QNIA 1UD5A 1U95B 1FZMB 3GFUA 4L3FA 1Y07A 2IAMA 4JZJC 1V3MA 3UO1L 4D0BB 3BDYH 4FHJA 1RJZB 2IGFH 2VL4A 4WEMB 1NMBL 2YPLD 1JF5A 3AGWA 2WGXA 4P2QD 3DMMB 2D7MA 2ZJSH 3FB6B 4OM0L 4Y9GA 4JQVC 2QPDB 4JS7A 1YEIH 5IBTL 3VCLB 4CJ1A 1L0PA 4GMSL 2MSPA 2ZX5A 3O45B 1EEZA 1BIIA 4FXGC 2QKIC 3UDWC 2FEEL 4AYEC 4K3EL 4MNQB 4PJAB 4Z3HA 5BXFB 1RCYA 3UEZA 4NENB 1DVZA 4C57C 3KLHD 5EBLB 4HUVA 2HXAA 4QRFA 3SIKA 5BRZB 4E41A 2BRQA 2NUPB 4PJCB 5LBVA 1U91A 1TTRA 5A3IC 1KTKE 2IIJA 2WKOF 3A4EA 3BRGC 3WEAA 1VHPA 2QQNH 4LOUD 1I1AD 4NENA 5FECA 1FVCB 4ADJA 2Q8AH 3VMPA 4YEFA 1QYGL 1VJSA 1KDJA 1QFWM 1CF8L 3KYMB 4ZDHA 2VDQL 3OPZH 2AW2A 3EYUH 3LSOA 3HNTL 4J8RB 3F6JA 1OAQL 3OR6B 5HGDA 4PJDF 1ASPA 2NR6A 3TGXA 4GW5A 1NBQA 3KH3A 4HIEA 4KO5A 2OXHB 5FKAA 1VPOH 5DRZB 5IJKC 2VH5L 1P4UA 5C0GB 1RD6A 1NGYA 2IMMA 3DUSB 2COVD 1CFVL 2WBJD 2K6WA 4OIBA 3ZT5A 3QDGE 3CFNA 5H8DA 4AYFA 5HI4C 1VDGA 1BZ8A 3CU1A 3FDWA 1GIGL 2IV8A 3I85A 5E6SB 3UPCA 2V4LA 1AQDB 5JHMA 5KZCB 3D33A 4OBSA 4J1UA 1A6WL 4OIIH 4PY8I 1I31A 5FGRA 5A2KH 1OF0A 1MHHA 1VGKB 4YXHH 1LEIB 1AZUA 3VMOA 1KIRB 3M46A 4UDUB 3WFBL 4S1QL 3MNWA 4AQZA 4AW7A 1YJDH 1HZHH 2G60L 3U2IA 3KGRA 5E1IA 3U4KA 4CBZA 2JCCF 3GSNH 3S96B 4LOVA 3PDGA 3HBPA 2R0KH 5GS0L 4JHAL 4OV6F 4Z7WE 4KK5C 1NFKA 5ECGA 2R0KL 1DR9A 4U1MA 1LEIA 3T0ED 3BSZA 1MLCA 1XSIA 1BPLB 1DANU 1QLFA 2YPLA 3PP3H 1IQDB 4ZQKA 1T7YA 4NWTL 1E6JH 1WTGT 1KWKA 2CDFA 2XXCB 4DZBA 5I15L 4U2YA 4Q9QL 3BP6A 1AKJB 2HFTA 4KRPD 1FZJA 1IQWH 3FRPB 3SCMD 3DPBA 2OMZB 2O6PA 4DP4X 3KGSA 4G72B 3HAEB 3HC3H 3NZ8A 5J12B 1DVFD 1EBPA 4XMWA 5AOLA 4NM8L 5DMKB 3ENEA 2X70A 1RHHB 2YPLB 4Y2OB 3F05A 2F1AA 3QWOA 4IHOB 4D9RE 3FHQA 3LEVH 1XB8A 2VE6B 1PY0A 2WXRA 1MW3A 2LOEA 4NAJA 3LXCA 3NGBC 3TJEL 3BZFA 3SYCA 5HYJD 1X6NA 5F3HB 3L95A 1AO7E 2IBZX 1RIVL 3JV4A 3QDGD 1W8EA 2W0FB 3H54A 1CMOA 1AG6A 1UJTA 3MRMA 1GJUA 1Q72H 2F19H 3MGOB 1KB5L 3U30B 5EC2B 1FAKT 4MJIE 1QHOA 3CCHA 1F3DH 1Q9KB 1XXDC 2R9HD 5KSUB 4KMTH 1KB9J 1QYGH 3OB0K 2Y3NA 1XSOA 3IU3A 4FZEH 4N28A 1OCWH 2BOBA 4WUUD 3ARPA 1FP5A 5DS2A 2XRAL 4L8SB 3QJSB 4M48H 2XY1A 4B27A 5B3NA 4WFEE 2EYSA 1EMTH 1ETA1 2A6JA 3QEHB 3CQPA 3O81A 2XWCA 5JXED 1I82A 1LK2B 1GTFA 1TKWB 3CCHB 2JKSA 1ZLUH 3D50A 2NY0B 2FJHB 5JMOC 2UZYA 3TYFB 4BFNA 4ZPVB 3IDYB 3LZNA 4A7UA 4PJCE 2HT3C 3W5MA 4JFYA 1J5IA 1ZXKA 2IADB 3KPMA 4F37K 5EBLA 2OP4H 3HNSL 1FGVH 2YJQA 4UTAL 5BRQA 2W81C 3AQXA 3NCYP 4AQAB 2GITB 2UY7A 2WLZA 4OGAC 2R9HC 2P4AB 2NPLX 4HG4J 2YA0A 4OCLC 1KG0B 5CCHE 1QG3A 2JKNA 4DP7X 3F83A 4KOCA 4ODWB 1DBML 2Q10A 3FFCD 2YD5A 5FCUL 3RTQB 3S3PA 1PZSA 2DLHA 3BJ91 3MACH 4PJ9A 3EOBA 4J3OD 1A3LL 4ENEC 4LKXB 5HYFA 1I53A 1DQKA 4YHML 4MCZA 3AG1B 3DDFA 1QEXA 4N2GA 3NSXA 3Q3GB 4GINA 3OVUB 4KROC 1D5IH 1G9NC 5JNYA 2NX5E 5JUEH 5KN5B 4NUQA 1WHOA 2NY5L 2FJUB 4X7EC 1D7DA 4AIXA 3WAJA 3GSRA 1LVEA 2ZP0T 4MA8H 5KSBB 5F70A 1U33A 3PQYA 1Q9WB 3COOA 4NN6C 3AUVA 3QJFA 5JIDA 5JHDD 4FNLH 4UAOB 3ZL4L 3FUMA 3Q43A 1UHVA 2MHAB 4LLWA 5LN4A 5CBEA 5E4AA 3TASA 4EN2A 4HMCA 1ZHLB 4AEHL 1TSRA 2OR9H 2WWOA 3AGVA 5IBLC 2BY0A 4FRWA 1A14L 4UQDA 2OX5A 1CI5A 2IANE 2ZPKH 3I75A 3SDDC 3QI9D 5FYJE 3LDBC 1MJUL 4KTDL 3CVHH 3ZRSA 1AZCA 2GK0B 3WHXB 4P4KA 4FN0A 2R29H 5BZWB 4NO0B 1YECL 2WJ7A 4ZMQA 3ZZSA 1J0KA 1NC2B 4W4OC 4YJZL 5IQMA 4KKRA 3VTAA 3HAEG 2WLMA 3D1MC 2EEBA 1KTLA 1MCEA 4W9HC 5F6IC 1QRNE 1M6OA 4TULL 4A2GA 4M8QB 2CG9X 5E56A 1NGXB 2CDFB 4WNSA 5D7SH 5SV3A 1G6RB 4LHJB 1NDGA 4M3HA 1G4RA 4X0KA 1NFAA 1KB3A 3KWWB 5GHWL 5AZ2H 5A2FA 2FBJL 1JFQH 5JW4N 3V55A 3IDIA 1GGIH 1KTLB 1X5GA 1CYXA 3M1OA 4A1RA 1PKOA 4KI5D 4WK4B 1OSEA 2FEEI 4A2DA 2CWRA 2YMXH 1G6RA 2AK4A 1ORQB 4O2EB 1U2HA 3B9AA 2WWKO 4KNQA 3JTSB 1A6TB 4NZUL 4WWKD 1WWBX 5KYUB 1I1AC 2PWFA 4OB5L 2LLGA 4EEEA 1KPUA 1MDAA 1BECA 3IDIB 3KHOA 3W3BA 4OY9A 3NZHL 4IHBA 3IFLL 1JZ8A 4KHXH 5IROA 1PY9A 4G6FB 3ARGD 4LASL 1Q9KA 3T2NH 2HT3D 4CNIA 2J5WA 2F61A 3NSYA 2C3VB 4I0KA 5IK3A 2BMKB 5LXVA 2DQIH 1U0QA 2GK2A 3APCA 3MMEB 1YEFH 1PZ2A 2DMGA 5DZVA 3O2DA 4AVHA 4HUUA 4M7KL 4GW1B 5CZXC 2WVUA 1E28A 3CE1A 1BOGB 2V2WB 4F8LA 3VGFA 2I69A 3C8HA 4OLVH 3RWGB 4X6CE 1WZ1L 2VDKH 3OJDA 3I9IA 4M7KH 3KXFE 4P2RD 4Z95H 1FNGB 2FR4B 5LGKA 1DVUA 2GJ6B 1GL4B 1MIEH 4N68A 3QYCA 1E42A 4F8PA 1R9FA 2NYYC 1M05B 3LN9A 2ZCZA 4QY8A 1PEZA 1G9EA 2L4OA 5SX4H 1OAKH 2JIXA 4GNKB 5I5IA 5DD6B 3B7UX 2HSIA 5BS0E 1EZVY 2WC7A 1E5BA 2WYTA 3VXSB 5E2UH 5T3XH 2GBTA 2YXFA 3AT9A 3VVVA 1NLBH 3ABZA 3MNZA 3VI3F 1P6AB 5JW3L 2X4SA 4FQXA 3ATBA 3MCLL 3IKCA 4HETA 1JE6A 2X4UB 4HJ0D 2BH0A 4V2BA 2VLJB 3CC5B 2MIZA 4QY8B 4R4FL 4BZYA 4KKNA 3M86A 1MFMA 3KCWA 4J6IA 1EXGA 1C12B 1MFCL 5E08L 5I8KL 3EJZC 1QSEA 4LCVA 3MA9L 2IBZY 5GS3A 5J6HB 5JZ7C 5DZ9A 5L6YL 1IKFH 4Y88A 5D7SL 4FLOA 4DZBB 3M7OA 4M7LT 4HIIA 2YD2A 1UCBL 1YEFL 2Y1VA 3H53A 3P4MB 4HPYH 5C0AA 2Z7WA 1HOEA 4NRZA 1FI8C 1KLUB 2AK4D 3U0WH 4XOAA 3F58H 1MCWM 2FBRA 3RI5K 3QR2A 4NCC1 4XB7A 5ICYB 1MHPH 1G9MH 4PRPE 2IWKA 3F64A 4M03A 4OF0A 2BOCB 3TVMB 2DQHH 2ZXQA 5IHUL 3LKNB 5ABZA 3TBTA 2C5DC 1CS6A 5IESL 1YYLH 2AI0H 3ULAB 3AUWB 3LV3B 3FRUB 2VMCA 1T7ZA 2NZ9D 4N8VA 5CXPA 3QUXC 3GIZH 4B53A 4GW4A 4HHAB 2H1PH 4IRJC 4PTTB 4R2GC 3FO1B 4W1TA 4W9GC 1U8MA 3QI9A 4L8SC 2Y23A 4DGIL 4I3GA 2DI8A 4MBOA 5L7XL 3KLKA 4M9OA 2XOTA 3MJWA 5D5ME 3GZQA 1JZ4A 3GJFK 3BGMB 4JR9L 5L9DL 2LLNA 4AKPA 5CD5D 4H25B 4J39A 1NJ9A 1I85C 2FE0A 1UM5H 2IGFL 1MHCA 1QWNA 2PTUA 3IFPB 5I1JH 3MRRB 1I75A 2CCLA 2O72A 4LBEB 3GM0A 2Q3XA 3MCKA 1OVZA 4KOBA 2WXNA 4PP2A 4FXKA 4QXUL 4A04A 4ABWA 2HLFD 4R5XA 5D7KE 1NKRA 3MACL 3MR9B 4FP8L 1CFMA 3APMA 3F7VB 3L7EA 2D3LA 2CHWA 1QBML 3OR7B 3O3AA 4L4VA 5IB4B 4Z6AT 4EOWH 1D5ZB 2W1NA 1UB6A 1MPAH 1QASA 4XXCA 5BOZG 4P06A 1A14H 2XTJD 3EO9L 3FW6A 4FFYL 4FABL 4HUKB 4ODWA 4PP2B 2BIIA 3O6KH 5BXFA 3RPBA 4U2ZA 2ZX6A 4LLMA 3OR7A 2XPZA 1CGUA 3HG4A 3DJZA 4TLUA 4WWKA 3VXUE 3FCTB 3HS8A 2WXKA 3N50A 3NIFF 1KXHA 2WQUA 3MUY1 4MCYB 1PD1A 4OD1L 4WJ5B 3N85H 1XZ0A 2PUQT 1IBYA 1H15B 1S9YA 2JE8A 4JG0H 1MCHA 1V5JA 5F0PB 3RKPA 4ELDA 5KUKA 2G5BA 5FUZH 3RWIA 4PI0A 1I3GL 3BKYH 5JW4R 1NLDL 1RPUA 3VI4F 2HN7B 4Y9BA 5KSBA 4X5WA 2VR4A 4KC3B 4ZTOH 2A6DB 3N42F 4X7CC 4MMXC 1U8CB 3P73B 2ED6A 4Z7UA 1J9CT 3K6SA 4EI5A 4P4RB 5BVJB 5F6HI 4HMEA 4JZOB 4KX9A 1B3JA 4M1GL 3FQXB 3QO0A 5I1EL 2NY3C 5HYQA 8FABB 3B5TA 4RMTA 4TKWA 3FYIB 1HS6A 3L1FA 3QIBB 1Z5YD 4YFEA 4UB0L 3MV7E 1SYVA 4Y4KD 4PJXF 2A83A 3WEMA 4YSOA 2AQ2A 4NHCL 5I73C 2KDYA 2L04A 4IS6B 1BVKA 3L3HA 4JPVL 5DR5H 1NFDB 2OULB 4P5TC 1FE8H 1N2RA 4EZJA 3S5YA 3IMBA 2XTJE 4R5TA 3HS0A 5K9KB 3GC3A 1PW3A 1O7DC 2BERA 3QCUL 1O6TA 4PYGA 4U1LB 2E27L 4X6BB 4K55A 1OD9A 2JJWA 5DVMA 2Y7SA 4IU2B 5KVFL 5GZOA 5AALA 4OU3A 1CD1B 3GZKA 3Q1EA 1NUFA 3LD8B 1BDYA 1S9XA 1MEXL 3E1F1 5DQDH 3VXUD 1SDYA 3CFIC 1KDIA 2AV7A 2VIRB 1QBLL 2DQJH 3TT1L 2ITDA 4EO5A 4I0PC 5DEFA 4DVRL 4PJBF 2DJUA 1PGRB 3V7AG 4PV1C 1YY9D 4K71C 1KB5H 1M57B 2J5LC 4NFDA 3VSUA 3WJLA 4AKQA 4BK5A 1L9PA 1P6FA 4MSWB 5I75B 1IBZA 1WPCA 2CBPA 5EH1A 1D5BB 1B90A 1UWXH 2VYRE 3TA4D 5EEUA 4FQJL 5IJVB 2NNFA 2J8HA 4JFWA 3JTSA 3U7WH 5CNHA 5ITBL 2IO5A 3VQLA 4TSAL 2FLBT 3F7QA 3H3PL 4OCSH 1ZPLA 3SE9H 3T4AB 3L13A 2W59A 2YD4A 5EU3B 3OC5A 5T5NF 5TFSL 3DV6A 1UXWB 2X4RA 4HJUA 4NO5A 2X89A 1XGPB 4CVXA 5IGXH 5DTFB 4JM2F 4PRDA 4Z77A 3MV7D 1OWWA 4L3ED 3BOVA 4U6VL 3SJVA 4UTAH 2PTTA 3FN0L 3QJTB 4HHGA 3VXTA 3K2UH 2WINA 5IMKA 4A2LA 5IHZA 3ZYZA 1JSYA 5KYYA 1RJLB 1FE8L 3PHSA 4YDIL 2PPFA 4U0RC 5DA4A 3L4CA 1RURH 3MCKB 2DBJA 5T1MB 4PI2A 3SPGA 1DBKL 4K3EH 4U6XA 2BOBB 4M7JH 4TOYL 2BW4A 5H94B 2JCCB 2GJ6A 3SJVB 4GG6B 2X1OA 3GIVB 5C0IA 5LLIC 3F6IA 3UL4A 3IRZA 1YG9A 5ELIA 4RDQG 1RJLA 3D85D 2WNWA 1XR8B 1RZFL 3Q1SL 4OTXL 1WA0X 3K2MC 2BVQB 1XH1A 2W88A 5EIVA 5EU6D 3IE4A 5GRVL 2EUWA 1JF6A 5KW9H 4UILL 1OTSC 5J0BA 3IE9A 2ALAA 2ZG3A 1H6TA 3FU3A 3FCTA 3HB3D 4Y9FA 4XO4A 3ARYA 4XPGH 3OKLA 4WEEA 5JIIA 2VDMH 3ZJAA 1SDAB 1D9KA 2H41A 1F90L 4HUXB 3FU0A 2ILLA 4KFMA 5DDHA 2WLJA 1P4LB 3ZE1B 3L45A 2A74C 5F9WC 5B21A 2OAAA 3L3DB 1JGIA 2PO6B 5I18H 4P3DB 3PJNA 1KCUH 2PO6D 1CLCA 1QMUA 2GJPA 1IAIL 4L0YA 1FUNA 3T08A 2O5YL 3E8VA 4JZOA 5FGBA 3RIAF 4ZTEA 1P4LA 4A55A 3BVVA 3RU8H 2X10A 5JQHC 4FP8H 1L7IL 3PFUA 4I1RA 4DGYL 2LAGB 1GTNA 3WFEH 3OKDB 2CXKA 1SOKA 1YJDL 4H5SA 1AGDA 1NC2D 4U1HB 3VXPA 4AOFA 2HUHA 4HC1H 4XNBA 4ZMXA 3TBVB 3S5ZA 2Y07H 1QTSA 2V7NB 5FFLA 5DYFA 4YMPA 1U3YA 5EU6B 5ECJE 4HPOH 2VR8A 5HVHC 3B6SA 1A0QH 3PP4L 1OTUC 1LJMA 2X9WA 2X12A 3O9WD 3B4NA 2DS4A 4LAQL 2LVEA 4FLQA 4ECNA 2FJGB 3ULUE 4JEGB 2Y7LA 5DYOA 3C5ZC 2YGOA 1SY6A 3QQ4B 5EHFA 1OP3K 4HWBL 3GSNL 4C59B 3IFOA 4K7PH 3RL1A 3VX1A 3EFFB 2XWBB 2HCZX 4HWZA 5IROC 4XHQA 3ZN6A 3WNPA 3UEQA 1BF2A 5CCKL 3OMAB 3WMPA 1HQ4A 1HKFA 1B4JL 1PJ9A 1DUZB 4P23A 1DL7L 2CBMA 4ZX3A 4KK8C 3V0IA 4HJTA 4LSDA 3I6LD 3C9NA 1AIFB 3FTGB 4MMYB 2OTUB 5E9AA 4NKDA 2AGJH 1SPDA 1T22B 3QWRD 3B9VA 2H8PB 3AWEA 4OLYL 4PGDB 1TEYA 4XHJD 5TE6L 4YHYC 1XT5A 1R19A 2KS0A 1E3ZA 4QIRA 1RFDL 5AZEH 5D70H 4FI7A 1UT1A 1H5BA 1JCKA 2WTRA 4DGYH 5HSFA 1EJ6A 5IM7A 4NNXA 2GAZA 3RAJH 4PJ7E 2HJLA 1K4CB 1RVFL 2R2CA 4HULB 4L1BA 4XMTA 1YPZB 4G6JH 4JVWA 1ZSDB 3DSFH 2O5XH 4HOXA 2ZOUA 5D1QB 3ZT6A 4UM9B 1GVIA 1W72A 1H5BB 2WTRB 3QQXA 4P9HH 4PRHE 4DKTA 1KGJA 3UO1H 1GGYA 2BSBA 4L8BA 4QAMB 1UWGL 1NMBH 3PWNA 3RFZC 5AOJA 5C0IB 3T0VA 4HUUB 1G7HB 1SLWA 2FECL 1P84J 3P3TA 4Z7UB 3VFMB 4E0RB 1AGCA 3UAJD 4TUKL 4UUJB 1UADC 2LFGA 5FA4A 3MRLB 1IGML 3QEUB 4L37B 4MGXA 1NSNL 4L4TE 4F9LA 4HEMA 4KNTA 1IIKA 1XCQA 1DQDH 3CFMA 4KX8A 4OKVB 2YMTA 4TN9A 3WUWA 4S1RL 5DO8A 2V9TA 1MXDA 5AOKA 1DQIA 2E9GA 2XDHA 4WFFE 5T5FH 4CC0A 4U05A 4Y4KB 5DHVB 5EBWA 4AM0Q 2NY1B 4ODSL 5DHVH 3MV9A 3QORB 1HSAB 3OKKB 3TT3L 2CGRH 3T3PB 3SDYH 1MVFA 3DOSB 3WV0A 2IBBA 2ROYA 3IGLA 2Y0SA 1U4EA 4GUQA 2Q7NA 3SHSA 3NCMA 2NUTA 3HR6A 1IKNC 4MA7H 5C0CD 2VIRA 5K9OB 1AHMA 4X2UA 2JXMA 2O4EA 4LCYA 3BVUA 4N20A 3BC9A 2YSTA 4RGNC 4PJEB 1V7MH 4KXDA 3V7AE 1BV8A 2O6FA 3PAUA 4GAYB 4TVPE 4ZSOB 4MXWH 1PU0A 2PLTA 4H8WL 2VXSH 4RFOH 1JVLA 2R69A 3GWJA 2NQDA 2JB5L 1F3JA 4I3SH 4HBCL 1XGTB 5KBLA 5EUKA 3BPNC 1IGMH 4GUPA 3WEBA 3PAVA 2B2XL 3U46A 3T4AA 1YEEH 4QYOA 1JMZA 1CI3M 1ETZB 4QJ4B 4P2OC 3T6QC 4GAYA 3B8YA 4DP5X 1JK9A 5G5DB 4DP1X 2QLYA 5C71A 1ERNA 5FO8A 4AV4A 1NM4A 3T1FB 1H6FA 2XZAH 4EJ1C 3CHSA 1QKZH 3SPCA 1F11B 1B3IA 3MXWL 2FWSA 2WVSA 4JRLA 1IBDA 4QYOB 5CP3A 3CVDA 5D7LE 5HY9A 1XQ4A 2PCXA 1DVTA 3NCJH 4N5EC 2ATKA 4DHLA 3QUGA 2DWEA 3BUYA 2EO9A 3HC4L 4U6HB 1JBJA 1UKQA 2QGDA 3GIVA 2L0DA 3CD4A 3TEXA 2BNQA 2X4OB 1CQKA 1ZT4B 5CR8A 5EU7E 3KPSD 3U4BH 1QLRB 1ZLVK 3EZ8A 4UI2A 4RGNE 1T66D 2IALB 4XCCL 1PZCA 1KN2H 3P0YH 3VD4A 3OKYA 3TS8A 1E4WL 3ATFA 1UGNA 3INOA 1AGFA 3JWNE 3KWXA 4JY4B 3IBOA 3ZMRA 4UINL 5JPMB 2R8SL 4P5TD 1MVYA 5DC2A 5D7JA 5AW8B 2BY2A 3VFGH 3UXFA 4FG6C 3MI6A 2YGNA 1AS6A 4JM0A 4BQ8A 1KMGA 4PCTA 1SMAA 1ZE3C 5JHLA 2EKJA 2DQGL 3BW9B 4PUBH 3VFOB 2ITCB 1FNHA 1NBVL 2ZWLT 1H9VA 1UVQA 1AGFB 2WQRA 4MQXD 1IEAB 4R9HA 4YXKH 1CDYA 4Z9KB 3OLIA 5ESQA 1U93B 2FWLB 5DJXB 3T0XA 2BVYA 1NANH 2BNRB 4LSUL 1S7WA 2Z31B 2MH4A 4N5UA 3BE1L 1KLGB 3QAZC 2L8AA 5IB2A 3QJXA 3NOIA 4GT7A 2XA8H 2OYPA 1QEWA 4AL8H 1CFNB 4IEFB 3BN3B 1E2ZA 5ENWB 1MI5E 3LPPA 4X9YA 2UWEE 3QCUH 4CU7A 3EHBB 2WWMD 3FUFA 5IW1B 4GOSA 3ESVF 3EGDB 1KLGA 3ORJA 3HG1E 3UX9B 1JXGA 5IFJA 3OPZL 4G2AA 4AGQA 5HHPA 5L8JB 4U1NA 5ALBH 1JGDA 1ZLWH 2DQJL 3NGBB 1Y18B 4Q14A 4Y5XC 3VRIA 5E6RB 1FNSL 2BHZA 2CJ3A 3PABB 4QRAA 1H3XA 2A9CA 3O8XD 4IW4C 5HJ3A 1QWUA 3B37A 2DQTH 2WXLA 3HI1B 5INCB 1H8LA 5K9OA 3T2QA 4P2RA 3EW3B 2GJ6D 3ZRCC 1UTDA 1QSVA 4Q4IA 3ECBA 4WNQA 2YA1A 4Y1AE 3TBYB 3VNZA 4HJJL 3HC4H 1OANA 2VZOA 1MFNA 4OGQC 2O6CA 5AW4B 3KXFD 1CDJA 4P2RE 5CZVH 3KS0J 3QZBA 2IQ9L 4PVLA 5AW5B 3GKWL 2XJLA 3T8XB 3VJ6B 1AE6L 3CZSA 2MJWA 4NM8H 3TLRA 4NM4L 2PW1A 1V7NL 4X0NA 3I6KA 2LAAA 3EYUL 4PGCA 5GIRA 1R0AL 1JHTA 4LLDB 3S35X 1R5WB 2JLPA 2BHUA 4AQ8C 4I87A 4JFFD 2I32A 2H9GB 2C1OA 5IJVA 1GAFH 2DWDA 2EZ0D 2Z7UA 1DQQA 5DEGB 2JB6A 1NCUA 3FQNB 3CDFA 2X4NA 3L6FA 4YE4H 2OL3H 3KYKL 1TEFA 4D8OA 1FGNH 4JKLA 1TENA 5F3BA 1EVTC 5EDSA 1XB6A 4FQQB 3NVQA 3U9UB 4RSYA 4QXUH 1BM3L 1KYOJ 2HX7A 5KVEL 4AGMA 2WZ0A 4L5FL 5SWZB 4BCYA 4PRDB 4JY5L 3JZYA 5J1SC 2NW3B 3EHBC 4S1RH 2P5EA 4EI0A 5DVOA 3RG1C 5D2LA 1NFDF 3MODL 1Q0EA 3RY6A 2Z4QA 3L6FB 3VXTB 5IHZB 5MP6L 3MRFA 4GJTB 1O9ZA 3EO9H 4FFYH 3GMNA 2Y6SD 4OGXH 4HJ1A 4MD0A 1DBAH 1T1YB 2OPCA 4PWFA 1WBYB 4PVNA 4MD4B 4PB9L 3TXAA 2GC4C 3DIFA 2WZPA 2BNQD 1F4YH 3FB7A 4W81A 3FT9A 3HC0B 3JTTB 4TS6A 5KAQG 1WAAE 4BE6A 5F7EH 3UYPB 4ABVA 3KBFA 4G8GB 4C4KO 1BHGA 2ZCKL 2ZUTA 1SM3L 3CLFH 2QT6A 1SEQL 3SE4C 4OT1H 3MV9B 3QORA 3FCSB 3QCVH 4Q52A 4OQTL 5FGCB 3JTTA 4NOBA 4YUEH 1NCBL 5HGBB 4TQHA 1CO1A 4CVZA 1CYWA 5E8DL 4F2FA 5GRUL 3FQ1A 2R1XB 1OGAB 3FJTA 3GBDA 3VMNA 4EKJA 32C2B 2Y24A 5KWYC 3NJVA 1SOSA 1F1DA 1Z3GL 1BD2A 2JKTM 2VMDA 2Z31D 1I4FB 4F3FB 1J0JA 2YAOA 1TMCB 3MBEA 5I0ZA 2QV4A 2CUAA 3SOTA 2UVFA 4QGTA 1G7MB 2FO4B 3HZYB 3N5AA 5A6LA 2DQ6A 1KIPA 4GRLB 1UWXK 2XN0A 1CDCA 4MYPA 4PY8J 4BQCA 3LHPH 3FF8A 1F4XH 2CO7A 4F7PB 2VN4A 4U6TA 5CJOH 3BAYA 5IFJB 4UQ3A 1XGTA 3D9AH 1QRKA 2X42A 4I7ZC 5CZRA 5GS2D 3MNVA 5T3ZD 2DLEA 1FG9C 4DCQA 3APFA 3BP7B 1ETZA 4XBGA 1PD6A 4YHPA 4E5XG 1OARL 3G6DL 2F58L 3PABA 1UENA 4P3CH 4XE5B 43C9A 2W9EL 4QPEA 3WTWA 3P40A 3TIDA 3B8SA 4DPBX 1G6RL 4OUOA 3QXVA 1CDHA 1U58A 4OFIA 4GKNB 1F00I 3ZL1A 4HOWA 3UAAA 2C9VA 4O58H 3VGGA 5J6GA 1J8HE 4GFTB 4ZZFA 4PGBB 4DJMA 3NEOA 4RAVB 5CJBA 1OPGL 1KIQB 3E2HB 5AG8A 4O58L 3GLDA 4R83A 1B4RA 1WFJA 3KPNB 4YDVB 5ESVB 1CGYA 1KPRB 3FQ2A 4FQJH 2W38A 5AVTB 5GS0D 3U0TB 1FFNA 5KSAB 3QEQD 2YUZA 3RL1B 5CKGA 3CX5K 1DBAL 5D7LA 4JM4L 4PB0H 1MCQA 2MNJB 4XNYL 4TUJA 4N1EA 4AE1A 1SDDA 3V4PL 5TH2B 3PJSB 4XPFL 2IGLA 1JPTL 1FH2A 3C5SB 1QSFA 4JN1L 5CJXC 1BAGA 3CFCL 1J11A 1E5UI 1HDMB 3A6BH 4NSKB 4MRBA 4XCFH 1N59A 1AXIB 3NZHH 3BX7C 3NCFB 3NJIA 2CJUH 3U7YL 2FO8A 4KITB 4DEUA 5EUOE 3FCGA 1Y1UA 1ILSA 2VSKB 1ZHKA 4N9GA 3EG9B 4GAFB 4F9LC 3ZHFA 3AS0A 4IJ3C 1CC3A 4PN6A 1DDHA 3LEYL 1UM6L 3UCRA 1HDMA 3CHQA 4PJXA 4JHWL 4LMQE 4ILDA 4YE0A 2QTVA 4F2MA 3S35L 4KGJA 2BNRA 2VZUA 3RBSA 3O0LA 4JHZA 4DAGH 2EC9U 3C5JB 5FA3B 3ZIMA 3FQUB 4U7KA 4N6QA 4W9JC 1NCCH 1YQVL 1BVZA 4GIPD 1CB4A 3T0EB 5FO7A 5KG9A 5LNGA 4HWBA 3QYNA 3Q48A 1XIWA 3V52H 4IMKA 4Y9CA 1D7BA 2YQGA 4EN3B 4DWHA 1GZHA 2VLKA 3IMUA 3WKYA 1CE6A 1G5GA 4PRID 2ZCLH 5F7LB 2FX7L 3S4SB 4JM2C 2O93L 4QAWA 1RMFH 2IAMC 2YAPA 4FD0A 4JZJA 4NZFA 2CJTA 5C7XL 3LKOA 3QEUA 2VC2H 5HHPB 4QHKI 1JGDB 4J3OC 1S3RA 2HRGA 5AZ2L 2AK1H 1CL7I 1KIUA 5ANMB 1AQKL 3Q1SH 4P0DA 2VLKB 2OLDA 2CDGA 3ARFC 2MPAH 4PG9B 5KZCD 4CDGC 2CRZA 1GMIA 4M6AA 1KPVA 2PCPB 1C1EH 2B3RA 2PO6C 4IJTA 5GGQH 5IIEB 3K1DA 5T33L 1DO5A 1WFNA 2F8IA 4N90E 5KSAD 5I71B 3L3GB 2J6EH 5L4IA 3K4DA 4F3FA 3I9GH 2MTAA 1F56A 1HOCB 1L9TA 4TNGA 5FDWA 1M1XB 3MFFA 5JIMA 4LSPH 1M2VB 3DJSA 3BP5A 1T89C 4WEUD 2VM3A 4XNXH 4PJIA 2V5SA 3CDZA 1I7RA 3ZDYE 2LW3A 1MFDH 3PE9A 1R5IA 1UXSA 1KSRA 4XC3H 2FO1A 1E27B 2B1AH 2GJRA 4NZDA 2C3XA 3WELA 3QORC 3OX8B 4BWUA 1BQLH 1OSYA 1TYRA 2WXJA 3F12B 3P77B 2J55A 2E7HA 3OAWA 5ISZE 1BLIA 1QPXA 4OZ4B 2CBQA 1VKXA 3RVWC 4JGUA 4Z3IA 3CDZB 2Z7YA 4Z7QB 1E9PB 4LSUH 5GS1A 2K4AA 2QGBA 4GT0A 2YS4A 4MVBC 2WLKA 2B4CC 2YBGA 4EQ3A 4PRIE 3V6OA 1C16B 1DE4B 3SQRA 4X6FB 2D0GA 4NKQB 1X6LA 3MRQB 2A5UA 4OLXH 5G55A 1ML0A 4Y4HC 4XO3A 1GOFA 1IBHA 4H4NA 1P6WA 1ASOA 3AG4B 4P5RA 5B8CC 1GKEA 5ESVA 2W9LA 3DMMD 1SXNA 2OZ4L 3T1FA 2D03L 4O9HL 2BCKB 3ZL2A 4UINH 3AACA 4XRCA 3SDCC 2NZ1A 4G1MA 1HI6A 3BT0A 2K78A 2XV0A 2ZF8A 1MREL 1I9RL 4GPVA 5T33H 3RY5A 3VFRB 3BSZL 4S2SA 7FABL 1PF3A 1KCSH 4IRZL 2XPGB 2J6EL 1FFQA 1RUPL 2EVFA 1IILE 1BBJB 4MWFB 1Q9LB 5F1IB 3BLBA 2BCKA 3BSHA 2J1XA 1BLNB 2Z91B 3ARRA 2DMCA 4CVUA 3L5WB 4OJDH 5F0MB 1RZ8B 3GB7A 2ZD0A 4H8VA 1RK1B 1YMHA 3AM8C 1XGZA 3SPJA 3AAZB 2EC9T 2DM2A 1H9DA 4UBDD 1CFQB 3DVNA 3JV6B 1MRDL 2XWTB 4ZXBB 3ZO0A 1ZS2A 4N9GB 3KJ4C 1ET5A 3UTTA 1C08B 4RQQB 3CFBB 4XO9A 3LEXA 4U1JB 3CC1A 1BLNA 1FLTX 2HKHH 2Z91A 1T5KA 4M6OH 4TNVK 4KKZA 4I1PA 3LN5A 1OAXL 5JLZA 4D0DB 4R97C 2CKBL 2EE0A 1HAUA 5HI4D 2AP2A 1UACL 2JJTC 3CVBA 3GSWA 3OKMA 3P3RA 4XXDB 3HNTH 3SQOH 2J2ZA 2Z64C 4RCAA 4DZ8B 4CL7A 5DFTA 4GSDL 4EIZC 1IKOP 12E8H 2DL2A 4OCYH 4PS8A 1NLDH 2MCPH 1VB9A 2YRZA 2YKKA 4EN3A 2A9MH 2BXZA 4OLZL 2Z31A 3WN5B 1X4YA 1JPEA 2CO6A 2ICEC 4WHYG 3CLEL 5D71H 2AQQA 3MRKB 1NFIA 4MJID 3BWAB 4CN6A 2BSRB 5FWRA 4HF5H 2QVKA 2A4EA 3WNJA 4X8XA 5I2IA 3P4OB 4CN4A 4G7RB 4GAJH 4XP9H 3BKML 3VXMD 4QOKB 1R3IL 3WFBH 1LO0L 2CDGB 2FT7A 2ITEA 1CTNA 5C0DA 2NY3D 2YEZA 4PR5B 2KERA 3H8NA 3HVDA 3P0GB 3R06B 1MWAB 3BWAA 3EO1B 4AZ8B 2JELL 5L8LB 4WUUA 5F0LB 3R1GL 4PJ8D 1KXVC 3H4HA 1OF2A 1QLEB 5LAXB 1PJWA 1UJ3B 4N24A 3FBQA 1Q0XL 2FAUA 4F2ME 4DP8X 2H3NB 2W0KA 1A6ZA 1WCBA 1EXHA 4WRLA 5EZLA 5CGYC 1F58H 1PLGL 3VI3B 4FJZA 2A6IA 2VDOH 3D0LB 4JFXA 4B9CA 1KPRA 2HJFB 2VSCA 1MLBA 5TF0A 2N56A 2AJXL 5IESH 1TZ8A 4YHOH 5FYLH 3FU7B 1MJJA 4RESB 4PJHE 3RZCC 1I8IA 3VH8G 1KBVA 3PGDA 5CHNA 5EZLB 3N44F 5DGQA 1P7QD 2FD6H 4OZHE 4UT6A 5I6LA 3M1CA 2RCSH 4WKZA 4OGZA 2F8VA 2KLRA 4WO4C 2JNZA 4JG0L 3TO4B 4Y1TA 2EUVA 4ANVA 3GJFB 1DANT 5AKVA 3Q2CA 4P2OB 2FUQA 1BWMA 2Y25A 4DTGL 4YPGB 4J3OH 1X7TA 3BZ4A 2JKWA 5H4ZA 3GTTA 4LDEB 4PGCB 4NZTH 5C0FB 1AD9B 5FB8B 3K8KA 3NYKA 4WV1B 2FQGA 5D4QA 3T6WA 1BD2D 1EO8L 1E8WA 4LIQE 4P2OA 3NSCA 2SODB 4LNRB 2JF1A 4IBUA 3B1TA 1NDMA 2E7LC 3KD4A 4MQSB 3PUCA 4HSAC 2XETA 4B9YA 3MUJA 3VFRA 3EXLA 4GXFA 3ZQXA 5E9DB 4MHHI 2CDEB 4X6EA 3IJEB 5SWZA 1YEHH 1WO2A 3UJIH 1N18A 1TETH 5IW6A 1U3ZA 4HXAH 4H0GA 3IVKB 5AVVB 1WT5C 2GSIA 3WS3B 2F6AA 4MKMA 4NO3B 4A68A 1FYTA 3IU4L 3W0WD 3IRCA 3ZDZB 3CG8A 2D7QA 4PSPA 2XWTA 3ARVA 4CVWA 3ZQ9A 4LQ1A 3IGAA 3T3MF 1UA6L 5I75C 4GEJA 4ZZKA 4YHKH 4YWGH 5TDOA 4GKZB 4J2QA 1FYTB 2BP0B 5BVPH 1RIUL 3H9SB 1OQXA 4XXDA 1FL6A 5SX4I 2XVBA 3S37L 3OG4B 2HX8A 4UYQA 1FVEB 2ZYSA 1IAOA 4DIXA 3IDNB 1IGYB 1AANA 3K72B 4JW3A 1TTCA 3NCBB 3UJTL 3V5KB 3JWOC 3IN2A 3L1EA 3FO2B 3MNWB 3MBXL 4I77H 4PJIB 1A3ZA 4OCRH 4JO1L 2XBZA 2EH8H 1JGVL 4ZO9A 5LWYH 1I4FA 1HHJA 9PCYA 4NUPA 2O26U 3V5KA 2Y5EA 3BO8A 5SWQA 4I18C 1A6UL 3LKQA 1AP2B 2IWEA 1DP0A 5IEHB 4F7CA 1YY8B 1QVOB 1NANI 1U92B 4I48B 5I18L 2WNKA 5DD3L 3N42B 1E8ZA 5CJ5A 1NBYB 1A7BA 2FGWH 5F96H 3NTCH 3MRDA 3QNXB 5B8CB 1ETB1 4GAAA 4PBVC 1Y7VA 4ICXA 4PRAA 5GGTA 3NCWA 5D9SA 2N3JA 3VH8B 3OXRB 1AP2A 4L05A 4M6OL 4BWTA 1RUPH 5AAWA 3KYAA 2ICCA 2YZ1A 3QWOB 1QFOA 4YGVA 3US0A 4TUUA 2AQ1A 2J8UE 4BM7A 1G7LA 1E9QA 5CEXA 4CADB 1MLBB 1VFMA 2XNAB 1S9WA 1G87A 3HS0C 4IIQA 4C83A 3ABGA 2O30A 1E3FA 1G9NL 2R2BB 3FZUC 4NQXB 1T1WB 2VDKB 4Q9RH 4WO4A 4OGXL 5IW3A 2BVPA 3IJYB 1VZIA 2OMTA 4RDQF 2JIXD 4ZX6A 4IRSD 4NLAA 1OALA 3MRPB 5I1AA 5EZOL 4ZT1A 5C0BE 1OTUD 5E24E 2YPKA 3LCYA 3GS7A 3D25A 4HQQH 4JJ5B 5LJYH 1I8LC 1FBIL 5FYKD 2M2DA 1OQOA 3O6LH 1JGEB 2WO4A 3SGKA 3U9PH 4C83B 1FFNB 1NEZG 3EIFA 4DN3L 3QS3A 2CAKA 1S9KC 1ESOA 3DVGA 3BAKA 1YMMD 4J3OG 1IUZA 1U3HB 4YR6B 5DWUH 1JYVA 5B1JC 4N0UA 1CU4H 4H1LG 4ZXBA 4XNMB 5TH2A 5JXAL 4HCRA 1J05A 1KYDA 1MOEA 4LASH 5GRZA 3K5SA 5E1AA 2OSLA 2QLVB 4OW6A 5DJ6B 1F86A 1HCVA 1ZT7A 1GJWA 5AG9A 4YBLB 3P9MB 4IRZA 2B08A 2HJKA 3I3BA 4WSJA 3MC0A 3Q2NA 3UZQA 1I7ZA 2JWYA 4F7TB 1QUNB 1BIIB 3X1BA 5JTWA 2GT9A 5I26A 4HOZA 4PJXB 4ZFGL 3RTQA 3KW7A 3ROLA 3GSNB 2P1YA 3D06A 3AU0A 4KRPC 3BWZA 2ZUQB 2OYLA 1KY6A 3UZVA 4F15B 1T5WA 2F08A 1MJ8H 2QKIB 3B43A 3C5JA 4QKXB 5FA3A 3X12A 4XNZC 4QXVA 4JLRB 3PGFH 4ZUVB 4XP6H 3DRTB 3DTXA 5J6SA 4HEPG 4KKLD 1OTSD 4HKJB 4IMLA 5H37H 3WS6C 3GXTA 4KBPA 4XBEL 3QIUB 5FWQA 1DJWA 3CN3A 3WENA 3TPUB 2DRUA 5JPNA 4IKKA 5D93C 2R8SH 4N6RB 1ZS8A 1JRHH 3O3UN 4PJFB 3VD1A 3A24A 2GBAA 3LKSA 1FYTD 3D18A 2QZQA 3DSNB 2VXQA 1AC0A 1YECH 1CE1L 4YNYA 3DXAB 5BUGA 3HA0A 4LXFA 3V5DB 1CT8B 3A47A 3DX1A 4QTFA 5ICXB 4CMMB 4BXVA 5F8RC 1YMME 3V0FA 1SHMA 2WBJA 3GMLB 3ELAT 4YIQA 1AFVL 2DMHA 4W9LC 2QZ5A 1SBBA 1L7TL 3BFQG 4PJ8A 1XSKA 2XVLA 4RZCA 2QEJA 3QPKA 5DJDB 3ULSB 5D8JL 2PCPA 5CEZD 1CBVH 3T9WA 5B38A 3V4PA 3RGVA 4O4YL 5DJAA 4XVUD 4MQ7B 3VXUA 3MV8B 3BRFA 4KUZH 3VQMA 4LSVL 1JMXA 2P48B 2EE2A 2W65B 3BAXA 3DHUA 1N3NA 4PJ8B 3LKQB 4K3HA 4XVSL 4UDUA 2YRLA 3QAQA 4GBXA 2F5BL 3GS4A 2YN3A 1NGXA 1UXMA 4QLRA 2CNZA 4YHNB 3Q06A 3QUXB 2RAMA 3U6RB 2V8MA 3TZVA 3RVXD 2FDBP 3KPTA 2DWXA 1MQKL 3F5WB 4XP6L 2BNQE 4LOUC 4OGAD 2VMEA 3MV8A 1ZVHA 4R7NA 3V10A 4J4PA 4WW1B 4HFWA 3TNNA 3W56A 3CHXA 3QQ9D 5JPMC 1Q4NX 3AG3B 4Y7MA 1Q90A 4BGDA 1DEEB 1F2XK 3LEYH 3CFKA 3TVMC 1W15A 1IFHH 2VR3A 4UCFA 4KY2A 3MUUA 3GNMH 2UY6B 2BIOA 1PG7W 3TPKA 1RAMA 3SQBB 4LCCB 2IH9A 1TFPA 4JFPB 1CVRA 4XN8A 1B4TA 3WIHH 1JVOA 3CXHJ 3B2PA 1RK0A 3R7QA 3AY4C 4X9FA 4JHUA 3SGJA 3TEUA 5HYJE 3X3FL 4I18A 4JJHA 1XF2B 4L1SA 4XMXA 4PJBB 5LN8A 1YUKB 3L3OA 2EYRB 4HGWA 4HKBB 1XF4A 3FCBA 5CSBA 2C3VA 5IK3B 3VQ1C 3RWHA 4OZGB 4KKLC 2X4QB 2D3JA 3TJHC 1VLXA 4XX1E 5I1KH 1F42A 3ESUF 1IGJB 3RTLA 4N2EA 3V0JA 4A39A 3RIAK 2WXFA 4KKBC 4OZHA 1UA7A 2K3TA 2Y7OA 4P23D 1QTPA 1SXCA 3MXWH 1O7DE 2ZT9C 12E8L 3B2UD 5JMRA 3SO5A 2XC8A 2GTZB 5E1AB 2PXYC 3LRLA 4QTHA 4BK5C 3LIZH 4WHCA 2DI9A 4ZMTA 2VXVL 1P2CA 2YRPA 2ZXDA 3U79A 3LZFL 4WI9A 1RK1A 2ADFL 4JB9L 3FB5B 4QRQA 3TV8A 1J86A 4JM2B 4NNPH 2WLIA 3HG1A 3QB7C 1WFIA 1H3PH 3QUML 1C8QA 1M7XA 4JPWH 4LGRB 4MAYD 4N3TA 2OCFD 4S11A 4FKHA 4IOSD 5I0VA 3DROB 1U9KA 1CL7L 1ZHBB 5E2WH 1T0NA 1L0QA 4K9EH 4PBDA 2IDQA 3WIAA 4GMTH 4XR8C 1BBDH 4DOHE 4UTBH 4GSQA 4UOW1 3AWFA 1NCTA 5C08D 5IR1A 2MNUA 5JDJA 3GSWB 1LP9A 1PFOA 4W9FC 2FEDD 2FGWL 5F96L 1G94A 5T8IA 1NUGA 2X1XR 3DRTA 1N6QH 5AFAA 4ZXBC 2ICWJ 2P5PA 3F58L 3POHA 2GB2A 5DD5L 5CEZL 3T77A 4L1DA 1DO6A 1LDSA 1MHPL 2VLLA 4E41D 1L9NA 1NL0L 3PQYD 3TCLA 3QIUA 4FQCH 1KIRA 3B2VL 1BF5A 1HSBA 3T4YA 3EOBB 1LP9B 1YDPB 4R4BB 2W0LA 3ESNA 4XP4L 1D7CA 5JOPE 1BFTA 1A21A 1R33A 3MJ6A 5E6ID 3UTQB 3D09A 5ICXA 4ZAKA 5C0AB 2IXQB 4WJKB 1RUAH 4NQCA 4QT5B 3LD8C 4YUEL 5DQJA 1KEGL 1OD7A 1N6UA 1TQVA 4P4KD 1ACYH 4V11A 4G7SB 3A3YB 2Q87A 4BQ6A 4CN1A 4J12A 1T0MB 4HJGA 4PY7A 3U6XA 3GMMA 2BSSA 3BD3A 3T6XA 3R4RA 1T1WA 4IQHA 1W16A 3JWNG 1PTZA 3K71A 4G6AD 1FCCA 3Q13A 4LVOB 1BQLL 5AKSA 4AGNA 4G6MH 2CGYA 2XYBA 3FULA 3NAAL 3MA7B 4JFHD 3LH8A 4D7PA 1WLHA 4GKOA 1IC1A 1JCVA 4AVJA 4WCYH 4YAQB 3STBA 4HDIB 1AYOA 1NC4D 3PWJB 1RJZA 4JFDB 2HB0A 5D2LE 2E0PA 2W0FA 5MI0C 5EFIB 3Q6GH 2CLVA 2CLRB 4FYRA 4UV7L 3TNNB 3NFNB 4IOIA 1YUHA 4BD4A 3D0AA 5DD5H 1JXDA 5CIPA 4JFEE 4PJEF 3L2LA 3IU3B 3V9CA 4FQHB 4LSSH 5C9JB 4D3CL 5F6IB 1ROCA 2C4XA 5AYUH 3ZSSA 1EO5A 1VFOA 1Y0LB 2ESVB 3IDXL 3VFTB 4XP4H 4BFGA 3QP3A 4C56E 4YE4L 5I0XA 2IQ9H 4FNUA 5JOPD 5IBLD 4Z5RB 5JW5B 1SMOA 4TQEL 3O41B 3EYSH 4J7RA 3RFRA 5F7AA 4Z0XB 4I2XE 4PWEA 4KRPB 4F7TA 2BIHA 5J3HC 4N8PA 1SJEA 4AM0A 2YOCA 4C56A 4HGWB 3QBTB 1Y0LA 2ESVA 4R84A 5BQ7A 2VLME 1P7KB 4LZKA 2ZUYA 4IBQA 5ACLA 1XB3A 4M7ZB 5CP3H 3DDGA 3CQQA 4YSAA 2IJ0C 4YVNA 2WCPA 1H6UA 5E8OA 1E9OA 1JPSL 3CFJB 3T0EE 5HGDB 3T3PF 5EF1A 3A4FA 1OSZA 4LE8A 1UCTA 4POZD 3PHOA 2HLAB 2G5BB 3IVKA 1ILUA 1PKQE 3A67L 3BN9D 3NIDE 1ZGLP 4XTRD 4P23C 4Y2LA 1SVZA 2NUPA 3DO3A 3O4LB 2C3WA 2Q86A 1MKFA 2VXUL 2C9SA 1IC4H 3LNDA 1MFEL 3V5DA 2G30A 3FMGL 4AYFB 1HWGB 2I7OA 5LQBL 4P4RA 5D7IE 1IRAY 4NC1C 5HVWA 2WBJB 2VJXA 2R69H 1HNYA 3RVUD 4ZG1A 5IMOB 1OTTC 1XH3B 2VJ0A 4CW1A 1GC1H 1HJCA 1NKGA 2BVTA 5ILTH 2CKBA 2K4WA 2D0HA 4XPAH 1JRHL 3BAIA 3TN0D 1K3ZA 4C47A 4DK3A 5LGJA 4OD3H 3NSDA 3JWDC 3FT2A 2ZAGA 3BEVB 2CR3A 1JWMA 5FAAA 1ITCA 1A5FH 3T0DA 4LQFL 3V0WH 4CW1B 5AB2A 1AJ7L 4X4YB 1JNNH 1IQDA 2BOLA 4U7MA 1J1PL 3OB0H 3SE4A 3UGXA 2H32B 1CUOA 3B9KD 4E42A 3BLKA 4R0LB 5TE4L 4EI6B 4MA3A 5T1LA 4MJJA 4AMXA 3LYRA 4H1LH 4LDCA 1NC2A 4HFWB 1Z66A 4KVNH 2BZCA 3BO8B 3KWTA 5TE4H 5SWQB 1AGBA 5LVEA 2VXVH 4P5MA 3V6FB 2TAAA 2BY3A 1GS8A 5FC9A 1AZRA 4YZFE 3H0TA 2RTTA 3SGKC 2F54D 3B9DA 2OZ4A 1L3NA 2NTSP 4JRYE 4P9MH 3SZ6A 5I0WA 2QDVA 2AF2A 2UX6A 4JFZH 4XI5D 2AJSH 3K71B 3C2AH 1KLUA 1AXSA 3TURA 2GTQA 1AHKA 4ZW5A 1MLCB 1LP9E 2ESVD 2APVA 2VWEE 2D4FA 2HP4A 1SJMA 3MLRH 4K73A 5FCUH 3T3MB 3JYBA 5E4OA 1OGAD 2CQVA 4AX3A 3BP6B 1GC1L 3HFMH 4J3SA 4X6DB 4X4XA 1IM9D 1HQRB 4FTVD 3UROR 2D3VA 3CH8A 4G6JL 4M62H 5EMYA 4Z77B 4AKOA 1B2YA 4HQQL 1S4IA 4WO4B 4JPIB 4NYLA 3SY6A 3WIHL 2VDNL 1RHHA 3MRPA 2X87A 4HHAA 4ESKA 3H9HB 1G0DA 3ARFA 4MCMA 2ZIDA 1INQB 3NDZE 1THAA 4MA1C 4E9XA 3I2CL 1CFBA 2D7OA 4UOJA 1JGEA 2B7DT 1BJ8A 3BZFB 4B96A 2BZDA 4JFYB 4DP0X 4NQTA 1NM9A 3QZNA 2C7UB 3A23A 1A25A 1HILB 2DD8L 4B0MM 2FX9L 3NESA 5K33A 2DEXX 2FYVA 3OJDB 3AADB 1HEZB 3HHSB 3PLYA 1WICA 1HILA 1P7KA 4WI6A 4A2FA 4HLZH 3BSZH 1ZJBA 3TBBA 4G82A 4G9FD 3U1QA 3BRDA 4YHLH 4OSUH 4AEEA 5E8OB 3MJ9L 1FQ9C 1C9SA 4JPSA 3TT3H 3V79C 4ADIA 1CU4L 4HUXA 2WQXA 4GI6A 4ODTH 2AEQL 1QX1A 4HK0B 5DZLA 1MIML 5G2NA 4NBZB 5AVRB 1NIEA 4FFZL 4BZ1H 1HZKA 3VFNB 4N0FA 4AQEA 5L2KA 2VR5A 5GS2H 5KEZA 4A37A 3DGCR 5HGHB 4BKTC 4KRLB 2VRAA 5BUAA 3VG0L 1RIHL 4FTVE 4XZUB 4MDRA 3UZEC 5IHBA 3GSXB 4X4ZA 3AS2A 4FQIH 3T0AA 1FFPB 1MH5A 5A3ID 5DHYA 1TQCC 1AXTL 3LN4B 5A6MA 4KKCC 2QGEA 1JK8B 5FW7A 3NQKA 1E65A 3PDOA 3MO1B 4NPYA 4JO2H 1YN7B 4PB0L 5AENA 3ELQA 2X1PA 3OKDA 3I75B 4YQXL 5JXEC 4U1HA 4NQCD 1IGTB 5I1DA 2WLHA 5JNYB 1EPFA 5KN5A 2D8KA 3GRBA 4XPHL 1N8ZA 3GMLA 4X9BA 3VACA 3Q2LA 4G6KH 5HI3D 5T5FA 3KPSA 2XBTA 5DUBB 5HYIA 1KELL 5C0CA 5ID0A 3LKRB 2E56A 4JQXC 1XGYL 3EH3B 2PABA 5DYOB 1EHNA 2WUBH 4IOFD 4OF7A 4PW4A 5DEZA 1BVNT 4L8DB 3WFDH 3QEGL 1ZV9A 1WG3A 4GW4B 4JG1L 4ABUA 4CJ0A 1JHLL 4UIKL 2X0WA 1PLAA 5D70L 3UTSB 1RFDH 1JV5A 2QPEB 4PD4J 5D72L 5LO7A 1NIDA 1RZGB 3WFCL 4P5KB 5I66A 2ZKMX 1L7TH 2I07A 4PV8B 4Z7NF 5C9JA 2FWUA 1ZLSL 4U1GC 5HYEA 2IAMB 4PIRF 4TNWK 3HN3A 1X9UA 5ICUA 1G9NH 3CMOH 4R7NB 2UWEA 3GMOA 1FJ1B 4IGBA 3RVUC 1KN2L 1UOKA 3MU3A 3PREA 1E4KC 2MOQA 1COBA 4RGMB 2X70B 3MTRA 1YEGL 5JO5A 5HD8D 1FZOB 1QLEL 2VDRL 3W2DH 1AI1H 5DJ8B 2CD0A 3HZMA 2R0ZH 1BP3B 2KZBA 3VD7A 1EEQA 1SHXA 3HIZA 2WOYA 1AQKH 1QTYT 2TSAA 1N26A 1F4YL 2UWEB 4IGBB 1DVFA 5DU7A 1RK0B 3WE1A 5I71C 2GUOB 3K6FA 4QHUA 4RIRA 3MA9H 3QUMH 4JPWL 2COQA 1QFPA 3CSBA 4HUMB 4OJEH 5D5MA 4Y5VB 3TBSA 3G5WA 2Y9RT 1SEQH 3OZKA 3TBCA 2ZX9A 2YO3A 4WGKA 4Q9BA 4OZGA 4URKA 3ZKMC 4PJ5A 3RX7A 4YLCA 5I5MA 1ET7A 3OAZK 3CSPA 4YFLI 4HAKA 4OLVL 2HMIC 1D5XA 2P24B 4Q8BA 5ITBH 2L7JA 1HXMA 5IUSA 4GRMA 4X80H 3PG2A 1YC7A 4BXSV 5ADPH 4F57H 2FJHA 2BVOA 4FLSA 2EACA 5IMOA 1RZQA 1XCQB 3I9PA 4OFKA 5IEKB 1OAKL 3GZOA 3B2VH 2F7QA 3LZRA 3OHXC 3MZTA 4RETB 5SV4A 2M26A 3N9GH 4WW2B 3H4FA 1CTMA 4G1EB 4U4IA 4LOFA 3GUTB 1YYCA 3SE3C 3SKOB 1DZBA 3D2UD 3MLXH 1RZJL 3ARZA 2FVNA 4I89A 4XPTL 2ZSVA 2C7FA 1OKEA 2A6KA 2E27H 3BEVA 3SDAC 2SEBB 1KACB 1VIWA 3TN0A 4CMHC 1RZJH 4G8FB 1E3XA 2VABB 2ZOLB 3QFDA 3HFFA 4N2KA 3OKKA 4PJ9B 3G5VB 2A83B 3LJ3A 2D7TL 2ID5A 4MDJB 5C0BD 1BZDA 3K2KA 4GKSB 3W9DB 4HJ0C 3EYVB 4XNQB 1L5GB 4FX5A 1JD7A 1YYMH 4JO5A 2ZKWA 1WZMA 1U8QA 5IQ7L 1WQVT 5KJRH 4TNEA 4UU9B 3IWUA 1UA6H 5DZJA 4NC2B 3ZLQC 2MCG1 1WIUA 4YSRA 3W9EA 3OAYK 2DYSB 3L1OH 4QMEA 3TVMA 3V0VB 4GG6F 2HX9A 2VT0A 4UNIA 5JW4M 2V3EA 5DK2A 3LKNA 2J88H 1V27A 5DSCB 4IKNA 1SYSB 2HTLD 3DYPA 2A9BA 5HDQL 2VM9A 3NZ8B 4JG9A 1UM4L 1AGEA 5LXGL 3S34L 3KVDD 5DQJB 5H35B 4MSWA 3KPSB 2DQDH 4PTTA 2DM4A 2ZX7A 4JKNA 5D1XA 1LHZA 2D4DA 5LXGH 3EXJA 1MVUB 1N12A 4DQOH 1HWWA 4GRWE 1YNKH 2XIBA 1N8OE 4O5LH 4S1SH 4MMZA 2NY0D 1SYSA 2H47C 3CN0A 5CILH 3SY0A 4NRXB 1KV7A 1AOHA 5AZUA 3U2SB 5EB9A 1MCDA 3MRMB 3CSTA 3MLXL 3RVTC 5EU6A 3SPIA 4WGVB 5AW3B 1A3RH 3IFPA 3DSFL 2ZWKA 3ZE1F 1OV8A 4X8JB 3LVEA 4G5ZL 2RH0A 1TF4A 2PYEA 2ZPKL 2IV9A 5I73B 2I26N 2HKFH 4C58B 2D03H 1KXQA 2DQUL 4O9HH 3F7VA 4BFKA 1VFUA 3OLGA 3PWJA 4IRSB 2FTAA 3HG3A 4R4FH 3X11B 1S8DB 3DA0A 5E9NA 3O3AB 4L4VB 3BPLC 1H3GA 1FYTE 4RMSA 3H42L 4GQQA 5CJ8A 4UMSA 5ANHA 4PUBL 4QD2E 2VN5A 3AJ7A 3OKNB 4TSBL 5FM5M 2EP6A 1QI4A 3GMRA 3TJPA 4GIOA 1DJYA 3LXBA 2AJ3B 4OIFA 1OEZW 4X9HA 2YKLH 4O2EA 4G3YH 3T04D 4BSWB 3GNML 4LCUB 3IPBA 1DVFB 4BINA 1XIWD 3O41A 2JCWA 1QFUH 2PETA 4ODHH 4AVKA 4NNYA 5CEZE 4LBEA 4A7VA 2F53E 1MRDH 2YD8A 4LLYA 3SCMB 4KZEL 1FHGA 1S9YB 5LDUA 2OK0L 3NFPB 1CLYL 2WXQA 4NDMA 2AJ3A 5IM7B 4AGPA 4OD2A 3PNWA 2OCJA 1IEAA 4TVSa 2Z6FA 1BPVA 3KL0A 5E9DE 4YQXH 1HIML 3QNYB 1CGVA 2AEPL 4QCIB 5E5MB 1MY5A 2ZYRA 4R7VA 1GY1A 5DWUL 4KKAC 4XB8A 4U1KA 5L2KD 2M8XA 5D1QE 4GQPH 2VRQA 3K46A 4KHXL 2ENQA 4C54A 3NN8A 1BM7A 1A7QH 4OD2B 5E7FA 8FABA 4AIOA 2N1TE 2E74C 3L7FB 3LHPL 3QEQE 3WNNA 2R69L 3CMOL 3VXRB 5C0AE 5I1LB 5GSVA 4EDXB 5T3ZL 1RU9H 3EJCA 3RX9A 3F7RA 4DERA 4WJ5A 2X9ZA 3CXDH 1X5LA 3ZTJH 1XH0A 3NPZB 1EXUB 2EZ0C 4MS8D 4V1DA 5DVNA 2OXHA 2CJSA 2ZSVB 1AI1L 3KLDA 4UIKH 3RWIB 4BFEA 1FRGH 3W11D 2ICES 3HS0B 4PGEA 2WKGA 3BCFA 2PYFB 4B9GA 3VGDA 1CL7H 5I1LA 4HZ1A 4E36A 3O2DH 1LO3H 1U8CA 1ZSHA 4P99A 2XVKA 3CFDA 3D2UA 3X13B 3VW3L 2ZKXA 4O2CA 5BVJA 4XNQA 4Z76A 3ZTNH 3MXVH 5GGSA 2VWEC 3A0OA 4PJ5E 3K3QA 3B7YA 3RVWD 1F90H 3B6SB 4HIQA 4DOHB 5JHLH 5T3XE 1I3GH 4QRUA 1CLYH 2VDOL 1SJHB 2WXHA 1NPNA 4J3TA 2B59B 4MXVF 3BMVA 1ES0B 3GI9H 4QHMA 5KANG 3L4ZA 1SHSA 4FNQA 5GJSH 1HU8A 1QSED 4RFEA 4X0KB 1E7VA 3TJEH 4EI6A 3HG2A 2NUTB 4BA0A 4OZHF 3RPKA 3TIEB 5E0FA 4MZ3A 5F9OH 4R26L 1PCSA 4MD5A 1JGVH 3DURB 2D31B 5BRZD 5LWYL 1SQ2N 1A4KA 5KYNA 4I0PD 4RX4D 2BSDA 2X7LB 5BV7B 2G9KA 5C08A 2RA1A 2P45B 1KZYA 1LWRA 2A2QT 1SVBA 1MW0A 3BGFC 4YFLF 1P1ZA 3WGUB 5HBBA 1IU1A 1DSYA 1FYHB 2OMZA 2UYLA 5C0AD 5C6TH 2RFXA 3N40F 3HC2A 3TIEA 2R0WH 2UV3A 3KL5A 5C08E 3HJEA 5E2VL 4WFGD 3QUMB 1Z0MA 2OZNA 2WWMC 4K8RL 5C08B 2NX5A 1T7XA 3T5WA 1CDUA 2V9UA 3R18A 4PJBE 5E2VH 1EZVX 1FSKC 3ARBD 4U7SA 3C08L 1AR2A 3OAZH 2BMKA 2D7PA 3FTXA 1TOXA 2FBOJ 2F2HA 3ZRFC 4Y4KC 2NY2D 5BZDB 1J5HA 1MRFH 1D5XB 2P24A 3MLPA 1A6WH 2OCCB 4X7DC 1OAQH 1NCDL 1XIWC 3O6FB 5DJ0A 3BZEB 4LPXA 1QSFD 4UOQA 4JM2D 3MV9D 4EPSA 5FUOL 1EGJA 3IDUA 4P57A 4AUUA 5MHSD 1A47A 4NO5B 1ZTXE 4MD0B 3RVVD 4HUCA 2BVQA 2AS5M 1EO7A 2FR4A 1CDIA 4NWUL 1TSHA 4XAKD 1OZUA 5IHWA 1MZYA 4JHBA 1IJ9A 2HPTA 4LHUG 2BNQB 2WINB 1J0ZA 2YSSB 1O5PA 3ARBC 3PL6B 5C0EB 1RLWA 3IF1A 3VB8A 3VG9B 4JMXA 1URLA 3O0RH 4PJ9C 5BOJA 2KHAA 3HBGA 4I88A 3EJRA 4U1IA 5LBSH 4FNPA 3OD3A 1NCHA 4LF3B 1FC2D 4D0CB 1D6VH 3WIIH 2UUDK 1CR9H 5E7BA 4FA6A 1PSKL 3K0YA 3CK0H 3AY2A 2DB8A 2A38A 5SWZD 5MENE 2NY0C 1RZIA 1UEMA 1PIFA 1UOVA 4L4TA 3BAEH 4UQBA 1ZT1A 4MJIA 1DBBH 1GR7A 1JTPA 2EECA 1IGFH 1B2WH 3N1MC 3VFNA 1GSMA 3WO4B 4TV3A 2Q3AA 1ONQA 3VXRE 3MLSL 2R1YB 2FHFA 4I77L 3RKDC 3MRBA 2CPUA 3UPRA 5DD1L 3TNMB 3SPHA 1ZAGA 4N0YL 4NN5B 4RFNB 3FCUB 3VWJD 4PJ7F 4AG4L 1F18A 2EIBA 2XFGB 1RKRA 4RSVA 3ZDZF 4C56D 3SD5A 3QJVB 4PJEA 2BM3A 1NUNB 3S36H 4XBEH 1SLVA 4OI9A 3RFZB 1H6EA 4Z3EA 3NSJA 5TK4A 4M8VA 4ZTOL 2P5WB 3FOLA 2LE9A 1OE1A 2VW7A 1SN2A 2EEFA 3H2WA 3W11C 5HHXL 1OP5K 4AQ1A 3VM5A 1TQUA 2D7NA 4LLQA 4KY1H 4OD3L 5AKTA 3DTUB 4KH2A 2DIBA 1PZ5B 4GQ9L 3TH2T 4XPFH 3VWKD 3VD3A 4X8JA 5I16A 1UD2A 4BQBA 5JR1L 1JZHA 4Q0XH 3V0GA 1NAML 5AVZB 1Q1JL 1ZVYA 3QQ3A 5E5RB 1CPUA 2G0LA 2AV7B 2D3NA 3I02B 1QWHA 3C9NB 3FTGA 4XPTH 3NH7L 1A4KB 4PPTA 1DBBL 4JO3H 2YD0A 5IQOA 5J56B 3E6FB 3MNMA 3B56A 1ZHNA 3VA6A 4H0IA 4OGYH 2AGJL 1HH9B 4Y8AA 4DGIH 3WE6B 3MBED 3E9TA 2G2RA 2IH3B 1DQLL 4H2AA 5IQLA 5I8KH 4RWHA 2AZAA 1RERA 2EQDA 4G6ML 6FABH 4POYA 4PFEA 5DJ2B 1M2OA 2XKNB 2YD3A 3IMSA 3NRFA 4HWEH 4MASA 1WITA 5DJZA 3SGEH 4Q58C 4DEPB 2H9GA 4JRWA 5DO2C 2H2PD 4GRWB 4LNVA 1KJ2B 4OAWA 5A2CA 3AC0A 3ZUNC 1UKTA 4PLJD 3ZZQA 2ZZUT 3AREA 4NBYB 4Y89A 2CRMA 2WSDA 4U1KB 2VC2L 4LPCA 1Q1PA 3M7FB 2WCSA 5BO1L 2J8UB 1UFGA 4KZDH 1BVLA 3MRGA 4HPOL 4KDWA 5T1MA 1YNTB 4HC1A 1WCQA 1TCRA 2BNUA 5H37G 1A6VL 2JCCA 4HKXB 2A3TA 3FH8A 3OGCA 3ULVC 3HC3L 3NABH 4EZKA 1X5JA 3PL6A 4U3SB 2CCWA 5D1QA 1OW0C 2I25N 5DHVA 2RHEA 5EBWB 2QR0A 4JO4L 3GM8A 3QO0B 1X5MA 3D3VD 1DJSA 2AJVL 4R8WL 2R29A 3QE5A 4M3KB 2PYFA 1M56B 2BIPA 2JELH 3U7WL 4J28A 4P3WA 1EA9C 5BZZA 1GGCL 3MRNB 3EYFB 3GUTA 1GC1C 3G08B 3GPEA 2PXYA 4ODSH 2PYED 4LVNC 4U1NB 1T0OA 2F7RA 1HHKA 3WY3A 3NRQA 2B0SL 1A8ZA 5JA8B 1VZGA 3CVHB 1CGSL 3D4CA 4OIIL 5KYXB 1RUQL 3ARDB 2IPKB 4XBPB 3NACL 1QOKA 5F1NB 3ZE2F 1QHQA