3ZQXA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
146
Chain Sequence
MDVKVQYLCENTQTSTQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADWSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 40
structure length 146
sequence length 146
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 3zqxA00
2L8AA 4B9FA 3ZUCA 1TF4A 3ZQXA 3ZQWA 2XFGB 4B96A 1GA2A 1JS4A 2WOBA 2XBTA 4B9CA 2WNXA 1G87A 4B9PA 4B97A 2WO4A 3ZU8A 4C8XA 3TF4A 1KFGA 1NBCA 4JO5A 4TF4A 1K72A 2YLKA 1G43A
chains in the Genus database with same CATH superfamily
2BNQB 1ZK9A 4Z7QF 1CXLA 3UADA 1CTOA 4E42B 3WTYA 5DMKB 1CDGA 2LU5A 2PYED 5FO9A 1B0GB 5CP7B 1J1XH 3IF1B 3HUJE 3GJEB 4HUWA 1SHMA 4L5FH 1T04A 4G2AA 1MFNA 2VDOB 1M9SA 3AB0C 1V55B 3BPNB 4PGCA 1OTSD 1CTMA 3C5XA 1K8IA 3B2UC 2WN3A 4H1LA 4O00A 1BG1A 2C9AA 4YZWA 2PNDA 1QSFE 1R3KA 4IBZA 4KUZL 4YK4B 4DESA 3LSOA 2VN5A 1A7PL 1YYLL 3VSVA 3WUZA 2OAAA 1BMWA 1EQWA 3I6KB 3QZWA 1QTYT 4JG9A 4TPRL 3X14A 1A4KA 1NINA 3O6FB 2VDRL 3VSTA 1JZJA 4AKPA 2UY6A 5B3JF 5DK2A 3VW3H 1PD6A 3KLHC 2F19H 3BUYB 3QDJA 1DN0B 1FO0L 3VRJA 1E9PA 4B9CA 3VI4E 1G87A 3ULUD 1Q4NX 3U6XA 3CPLA 5C08B 3DC0A 1DQKA 2CO7A 3V7AE 4APQD 2VUOA 3OR7A 5KSAA 5KVFH 3L81A 5CUSH 2YXWA 5J13C 4O5LH 1FLTX 2ZWSA 4L4VA 4XBPB 1B3JA 1CLOH 1J86A 5D9SA 5DHYA 5FKPB 1R0AH 1Z7JA 4G59C 5I66A 4DFIA 4JG0H 1GYWA 3FT2B 4HIHA 5LN8A 2DBJA 4XO8A 1T7XA 5JW4Q 3FB6B 3DMMC 3S37L 3H9SA 4B96A 3EGDB 5IVXE 3T6XA 3R06A 4MVBD 4BK5A 2CXGA 1QA9A 1I8KA 1X5YA 1TTAA 1RP9A 2VQ1B 4AGQA 3B4NA 3D2UD 2GHZA 4M6AA 4M4RA 5T1KA 4AW7A 2YQ3A 3BH8B 2B08A 3P4MB 2ZSWA 3L54A 3NABL 3TN0B 5KTEL 1MCIA 3C60A 2QSQA 2V9UA 3KR3H 3FB7B 3MUGA 1QO3B 5FHAL 4RQQA 5AW8B 3KBFA 3SDCB 4BD4A 2N01B 5A7EA 2HA1A 3KLAB 4M8UA 1D6VL 1IV8A 4MNQA 4L4TA 1E42A 5IEKB 3QJHB 5C7ZA 1TJMA 1N68A 3CMOH 1V7NH 4L1DA 1ZAGA 3GSNB 5BXFA 4NP4L 4U2ZA 1O7DE 4E9VA 1OHZA 3Q6GL 3K2MC 2IAMA 3EYFB 4LBEA 2AK4B 4HS8H 4B9PA 5EF2A 5HYJA 4K8RL 4Z0BH 3RTQB 4KQ4H 3FT4A 4FQXA 5ICYA 3T2PA 5BUGA 3FO2B 4IHOB 3GRWL 3SDAD 1WFTA 4JRYE 1XTLA 2DEWX 2HFFB 2ZWKA 2Q6WB 2E8ZA 1KIQB 1VEOA 4TUKL 4OLWL 5D2NE 2FEDC 3RZCB 1KV3A 1IB5A 3PUUA 4C4UA 4QJ5B 1XF5B 2VLMD 4M61B 4MBOA 3WY3A 1QKZH 1W72B 1KXQE 2Q87A 5F8QC 3UZEA 4XPTH 3ABGA 5CWSA 2IGFL 1BZDA 4I89A 5GZOC 3T77A 3HI6H 4LLYA 1UWEH 4HJTA 2NCEA 2KZ1B 1G5GA 1O6TA 3EH2A 3TEYA 1SF3A 2GC7C 5E2UL 5DURB 3VJ6A 1AGFA 4Y1AB 3ARZA 4P23A 3QHZL 4NZFA 1UB6A 5IJKA 4GO8A 4OQTH 3GXNA 3MN8A 2VW7A 4CU6A 2O5YL 2BS71 2XYCA 2XYBA 1NCDH 4G6KH 2RA1A 3IMVA 1QWUA 4ZRGA 5BV7L 1TUPA 4E9YA 5DD6A 2EE3A 1DJHA 3N04A 3IJYB 3GIZH 3KD4A 5E9AA 5T5FA 1AGDB 1T6VN 3K0YA 5JZ7C 3TV3H 4RWHA 4HVBA 2CIIA 2NTFA 3KPQA 1G9NC 4YL4A 2OA9A 4IU3B 4QD2E 5E1AB 3RLSA 3TFKC 2QPDB 2BWQA 3LPWA 5HHPB 1A6UL 3DNKA 3OAYH 4L29A 3ESNA 1AHMA 4TVPH 2H0JA 4NT6B 4KMTL 5CFHA 4PJIA 2NYYC 1FGVH 1FWXA 1Q9OB 1P6AB 3IJSA 1J7VR 4K3HA 1RUPL 4S10A 3CLFL 3ZDXF 5GRJL 3QP3A 3BCFA 2CNYA 4UZGA 5FW6A 3VGEA 2J43A 1HZHH 2VR5A 4X4KA 3HG4A 2PWGA 1N6VA 3UTZA 2X42A 1HH9A 2BSDA 2DL9A 2P8LA 2YXMA 1FYTE 4FLRA 4JR9L 1KGXA 3V8CA 1GJIA 4HWBL 3WFCH 3MFFB 3VXME 1C5DB 4D8PA 1EHXA 1S7XB 3F00A 4JM4L 3O2WL 5EU3B 1TQBC 1U91B 1T5XA 3DJRA 5ABDE 1HI6B 2VERN 2W0FA 1Y6MR 2FLRT 5FYJH 1ZLUH 4HFUL 2HRPL 4L3EE 4F7CB 3CZJA 3O6KH 4P2RD 4DGVL 4BRVA 4TVPE 3FO9B 5EOCH 4MLSA 1MRCH 4QHPA 3MC0A 5HVWA 5ISZD 2K0RA 2B16A 1O7DC 1PKQA 5I5RA 4AQ1C 6PAZA 5HHNA 3AREC 3WY2A 1UM6L 2B1HH 3QHFH 1Z3GH 1IGMH 2Z7YA 4RGMC 1BM7A 2I25N 1I1YB 3BKJH 3CFNA 4RWYH 3W39B 4AENA 2JLPA 4N90D 1CUOA 1CGSL 4ODXA 4UT6A 4QHMA 1TEGA 4H0HB 2HWZH 1DSWA 2XZQL 4LVOC 1DBAH 3P3UA 4MB4A 1BLNA 4OUOA 1EAOA 3HFMH 5EZIH 1UCBH 1UJTA 4OSUH 1DVFB 5EC1B 5D2NC 4PGEA 1A22B 5DC0A 2OR9H 1VZHA 4YWGL 4FG2A 2ZZUT 1DJGA 1I8MB 2BNQA 3U9PL 3K0WA 3K4DA 4YXLL 1BLIA 3QIUB 1XGTA 5D7KE 5FYJE 1YY9D 4ZSOE 5GGRY 3TT1H 3KZ8A 3HS8A 3DX7A 1AQMA 2IH1A 3ZHDA 2DEXX 3LN4B 3GZPA 3IF1A 4C47A 3U0PB 2KT6A 3MRRA 4HMEA 4I77L 4JFTA 1OAQH 2YMXH 3ZHLA 3ZO0A 2A9ML 2EZ0C 35C8L 4ANUA 3B5TA 5CZXC 4TTGA 4HAGA 1NCIA 2WP3O 5DC9B 1H3VA 2GCYA 1OAJA 2HX8A 5B38G 2NT0A 3HRZA 3MROB 4L1SA 1P0SE 4XN1A 5AOJA 1YEIH 3M8OH 1FO0A 2PCPB 3QDJD 3FTWA 4IS6B 3SKJL 4OFYD 2LOEA 1PAZA 2K7PA 3TU6A 4PRIB 3QRFM 4PJHF 4RSVA 3D18B 1NIAA 3SJVA 1FJ1B 4X98A 4W9HC 2RCSH 3O11A 3VI3B 3MJ7A 1OB1A 4PRPE 3L3OC 5CD3A 5IIEA 4ZT1A 4CVZB 4LSUH 1EFXA 4TULH 3GBML 1T20A 5D93B 2VR9A 1X5FA 3S8WA 3OC5A 3H9SD 3WDJA 1VFOA 5I8OH 3TWCL 1I8LA 1C5CH 2IH9A 5G4MA 4XBMA 3NDYE 4GMSL 3RWCB 3SPVB 5E7BA 2R1WA 5IEHB 1YEHH 3IRCA 3VWJA 2IXQA 1EANA 3FT2A 1G4MA 1R3HB 4H8QA 4HQQL 3QIWA 3ULVE 3FB6A 5D7IA 2YKLH 4J3UA 4M7ZB 4MNQD 3VFOB 1JV2B 3WJLC 5DO2C 1YC8A 3HC3H 3C5SB 1A8JH 3AWFA 4HUMB 2B1OA 2OL3H 2WMPB 3E8UH 1RV6X 2YD2A 3GB7B 1IGIL 1A5FH 2Z7WA 3CFCH 3O81A 4PWKA 4ERSH 3RY6C 3HNTH 1HL4A 2VDPL 4HD9A 4PCSA 2EINB 5E4EB 5IHWA 4LSRL 2IAMD 2JJSC 2CNZA 3MRDB 2Z65C 5LGHL 1WV7T 2R23A 3UTQA 3WDHA 5I1DA 4U3XA 4ONGL 3VH8G 4AK2A 1LJMA 2X9ZA 3QJHA 1TFPA 4L8DA 5C6TL 3LKPA 4ZODA 1NEZG 3GRWA 2UV3A 1CURA 3GXDA 2WM0A 2XZZA 3ZYJA 4Z7VA 1I8AA 1KCRL 3PHOB 3TTYA 4Y1SA 4IRZL 3OMNB 2CJUH 4Z7WE 4DEUA 4OCYH 4LF3B 3QFGA 3M7FB 2DWYA 4IM8A 4IHOA 2OMXA 2QVFB 1GRWA 1EMTH 5DJYB 2B15A 1MXGA 1SHSA 2ADFL 5FC9A 3ZTCC 4HF5L 4FJ6A 1PG7L 2EYSA 3AG2B 4MAUH 2D0FA 4ZX4A 3N41B 4NHUA 3I9GL 1NKOA 4Y8AA 5H4ZA 3L3DA 5D1ZA 4JPKH 2VSKB 3EJYC 4DK5A 3SPIA 3OAUH 4YHZH 4BFKA 3PDDA 3MCG1 3Q13A 5E2TL 3PREA 4ETQB 3VMPA 1NSNL 4TLTA 1FDLL 4YBHA 4UQ9A 4A55A 3FCSA 3HS0C 4L37B 4P2YA 3WI9A 3EW3B 2FATL 4E36A 4FERA 3EFFA 2WQWA 2VZ1A 1XO8A 3B9KA 2GJ6E 2NXYC 2CDEB 4KTDH 4KV5E 2MPAH 3WKMH 3F64A 2DIEA 2GUOB 3MTXA 2QEJA 1DJWA 4CILA 3NQKA 5KVDE 4AG4L 2FQEA 2DLTA 5MEPB 1AGDA 5IZ7A 4B3EA 1GS7A 2BLFA 5J7CC 2BNRE 4G6AD 2ZWNA 1V5JA 4LSPH 4IU3A 5E1AA 1T1ZA 3WBDA 2NR6A 4UNUA 5DHXB 2AANA 3RQ3A 2BVYA 2BSRA 4N9GA 3LXUX 4RISH 1WAAA 5KVGL 1JGLH 1T3FB 3VU1A 4R97B 1RHHB 2LLLA 3EH4B 4NBXB 1CBJA 1S9XA 2Q9OA 3SPJA 1ACZA 3TNMA 4P5RA 1QRNE 5CSZB 3WNKA 3OPZH 4RIRB 3RVXD 1Q9OA 3KDPB 4I5BB 5DD3L 1UWXH 2J8UB 4HWBA 4MD5B 2EICA 1KFAH 2HN7B 4TXVB 1ONQA 2KI6A 4GI9A 3GMPA 2VTFA 2X6CA 4MAYB 4GXVL 4XAWH 1IZJA 1HL5A 1KDJA 2BS9A 2WQRA 4RA3A 2YGOA 1K85A 2R56L 4WI9A 4KC3B 3MFFA 4QHUB 4Z7NE 3U79A 1W8EA 1Z9SB 4NQDB 4WI2A 4HD5A 4WKXA 3KPNB 5C0RH 4OBSA 1S7XA 5DT1H 3MV8E 3IJ7A 4YDKL 3UZVB 2H0EA 5J5EA 5ENWA 5BS0E 3RU8H 3WNPA 4E68A 3NTCH 5J57B 2QLVB 1NANH 3HB3B 2O1AA 1CQYA 5HGBB 4GAJL 5AZEL 3IKCB 4TQHA 4LZKA 1ORQB 4JO2H 4LASH 3VWKB 5E4IA 3KJ4C 4OD1H 2PCFA 1SEQL 5PAZA 4YSUA 3HG1D 4KRPD 1K5WA 1M7XA 2B4CH 2ZXEB 3ETBJ 4X5PA 5DJ2A 1B88A 4F1SA 4X6DE 1ANUA 4JO8A 1AQKH 3QEHB 3HI1B 1XQ4A 5CEYB 5KEZA 4LKXA 1I1YA 3VMOA 3QJFB 1NAMA 3RDTC 2OCFD 2PN5A 1IM9A 2BNQD 2ZG2A 3WG7B 1XGQA 5EN3A 2QMJA 3KPSE 1P4BL 2F54E 4PY7B 3FONB 1A6TA 2R59A 3KWTA 1XDTT 4JFXA 3ISYA 2B39A 2BP0A 4ZTPH 5E0FA 1EHNA 1IBFA 2NYZA 1SM3L 5T1DH 5ADPH 4E9LA 1GOFA 8CGTA 2CSPA 4PG2A 5ACMA 2OZNA 3TBCA 1QEWA 3QAQA 4DIXA 3ZYOA 4CC4C 2E76C 4JK0D 5DRXB 2P45B 5EUOA 3L4UA 3LZFH 4M5YL 3RNKB 1UWFA 6PCYA 4DK3A 1U33A 2DWEA 2JIXA 1NANI 1JPST 5D7JA 1YEJL 1QACA 1T5WB 3UABA 4R4FH 3QGVA 3IU4L 1YQVL 4OTXH 4L3AA 4BJLA 2YWZA 3GSVB 1P4IH 2YXVA 2GJPA 4UQEA 3ARSA 3MJ9H 4PJDF 4JUSA 2F53E 3RL2B 3W0WA 3H54A 4DOHB 2YLHA 3DBSA 4LE8A 4RMUA 4J3OF 4P2OB 1SBBA 4RFEA 3DWTA 1CGYA 4KK5D 1ZGLA 3H9HA 5AW2B 2EXTA 1KXTA 3Q44A 1J5OL 2IV9A 4APXB 4GUPB 4CVZA 5K39A 3ARDC 2MIZA 1AGEA 1FA4A 3VGGA 5C9JA 5EZOL 1JPGB 3PF2A 2ENSA 4ZTOL 3QNZA 2APVA 4MA3B 3FAXA 3L3HB 1JD7A 2WZ0A 1EV2E 5T33L 1TZ8A 3THMH 3MRQA 4QRQA 1DANT 3SO3B 1S8DB 5FEBA 3DYMA 4UBDC 5DJXA 3US0A 4Z7OE 3O2VL 1CBVL 5AB2A 5F1KC 4P57A 4NQVB 3UP1A 3SDCD 2BFVH 4JVPA 5ICZB 3NIGE 4DGYH 3P02A 4CN4A 3VFOA 2GJJA 2IWGA 2WZAA 4HIXL 4P9MH 1E8XA 4WCYH 4Y16A 2F68X 4FQJL 2BRRH 4QXTB 5DGRA 3WNMA 3QARA 5KS9A 3U46B 2WMPA 2ZJSH 3BN9D 5B39G 4WV1B 5B7FA 1E9QA 1JBJA 2YJQA 4H2AA 4HG4J 2WCGA 3WJJC 4FNSA 1OAKH 2WWKO 4X80H 2R9HD 4LSQL 4O9HH 2AK4D 4EPSA 4D3CL 1U3HB 2HKFL 1SYSA 2FEEL 1HZLA 4E41E 1ET7A 1MFVA 3IDJB 4G6JH 2FIRT 4C56B 1NCWH 1RZIB 3RZCD 1GOHA 1MHCB 1GTFA 1EAPB 3FHAA 3ZE1E 1LDPL 1MUJA 3NCWA 5AOMA 4AW4A 1L4IA 5JW3L 1RCYA 2WPGA 4IGBC 4OF0A 4XPHH 2QQKH 3RIFK 3K3QA 3DURA 2NY4B 3CVCA 3QXDA 4NRZB 4DO5A 4I1PA 5IROA 3OL2A 2YGQA 4NCC2 3VGFA 5CZVL 5ECJE 1N10A 4B5ZA 1FNHA 1L9QA 4OVUA 2DRUA 2I9LB 4OD2B 2HFEA 5HHME 3ZDZE 2XNAB 5DURD 4M43L 4WZ9A 4P49A 1T1YB 2XWXA 1TYEB 4WENB 4JY4B 3B9KD 2ZUYA 4AK1A 2BIPA 3TA3B 3VFTA 1ZLVK 1XF4B 3GMNB 1AZCA 4L37A 3HE7C 3SE4C 3KLLA 2C5DC 2A99A 4TNGA 1Y0LA 1SMAA 3JTSB 2PWDA 1KOAA 4IMKC 5D1QE 1E28B 4AVHA 2B4CC 1UKQA 1IAOA 2P26A 5CGBA 3G5WA 1ZA6A 1BJMA 4KY1L 3WMPA 2HCZX 3GM0A 1AHWB 3QUZA 1CVRA 4XXWC 1FFOA 2CALA 4HXBH 3TJEL 5F3BA 3TEWA 1NA8A 3K1DA 3TBYA 3BKCH 1KPUB 2CUIA 4GO9A 2HMIC 4O51A 5HGHA 4U1KA 1N6QH 4XPAH 4KY2A 2OMYB 1S3KL 4PU2A 4YHML 1HHIA 2P42B 1DBBL 1PDKB 4MBRA 4UNVA 4O4YL 4OZFH 4U1MB 3QORB 3JVFC 3BAKA 4AJWA 3ZKSD 1HNGA 4ENZA 1JHLH 4LCWB 5CN2A 3GZOA 4FG6D 3L4VA 2AJVL 3CH8A 4NJ9H 1IC7L 1NEUA 3ARGC 1IAKA 1QFWH 5AKVA 4Y9GA 5T1LB 4PBVC 3WIHH 1Y6KR 4XN5A 4GW5A 5IF0A 4FXKA 1XIWB 1NBVL 1KB5H 1MRDH 5KW9L 1BHGA 4JQIL 2BVTA 3OR6B 2A0LC 2QGDA 3FQXA 5DJ8B 2FE0A 3LRSA 3SB3A 1KT2B 3JWOH 3TASA 4X99B 1X9UA 4PUBL 1WHOA 3M6DA 5CJQL 2IDCA 1ETZA 4LEBA 1Z9SA 3NMEA 4OD3H 4WI8A 4BKLB 1MWAL 3QDGE 5DJCA 3O41A 4QEGA 4ZS7H 3I84A 3EYSL 1WG3A 3E80A 5IG7B 1D9KB 4FFYL 4O2EB 4XN2A 2YEZB 3EXLA 4NUPA 3LH2H 1UGKA 1SFDA 3MLYH 2CLZA 3Q06A 3IE9A 1ORQA 2VLRB 3VWKA 1BD2B 3PDOA 4F58H 3EYVB 2L7UA 4NXKA 2GK2A 3FTZA 5LG6A 1BBJB 2VUYA 3RNQB 1EHAA 4EUPH 4G9FE 3FS9A 4HCRA 4P4KB 5CEYA 2NDFA 4CC1A 4BGLA 4FXGC 2DLFH 3T2LA 1QFWI 3D85B 5F0LB 3KPMA 4WEBL 2A5UA 3QFJB 1ZHBA 1WYJA 4Z7UA 4DT2A 1H9DA 1RIUH 3TNNA 4DZBA 2W38A 4EI6A 3QIUD 1OSEA 2XRAH 2ZWYA 5DRNB 3QUML 2YA2A 5H2BA 3QYNA 4UOJA 3N2JA 1BXXA 2SEBA 1K8DB 4ZXBC 4TOYL 3VG0H 1YJDL 3LZOA 4RH4A 3QCVH 2JIXD 5HSFA 1QR4A 3DGDA 3DUUB 4QCIB 2EDBA 1EGJL 5D7JD 3JUZA 4PJ7E 2XTJE 2HRGA 4PJEA 1PCSA 5ANMA 1PJ9A 2OI9B 2X6MA 4N3UA 4FF9A 3LXAA 4OI9A 5HXMA 3B3IB 2GITB 3CBRA 3L7EB 2VDML 5EWIH 1CXEA 2PW1B 5GRYA 5JDJA 2BJML 3W0WD 5JHLL 4ZW6A 1H3PL 1VGKB 4Y0GA 3OXSB 1ZEAH 1AD9A 4YUEH 3JWNH 1AD0A 5D1QC 4QT5A 4IRJB 2H45A 2EEAA 2YLKA 2ZCHL 4TQIA 1Q94B 4BH7A 2NY2B 4MXWH 1DP0A 1NDMB 4LCUA 1TZHB 4EIUA 5IMMA 4WW2F 2K3HA 1SYVB 3G5VA 3OB0K 4P2OA 5F9WC 4ZI8A 1PLAA 2YUVA 4A04A 1OSPL 3PHQB 1HH6B 3U9UA 3L5IA 2YPLA 3U36B 4QXUL 4XRCA 2AVGA 2VITB 4LOEA 2UZXB 1AQDB 2UZPA 1CQKA 1NTDA 4FI8A 1CXHA 3CK0H 4JFQB 1S5HA 1KCUH 1K6QH 1LWHA 4JREB 4U1GB 4A2HA 4HPHA 2WLIB 4GIAA 5CCGE 5MERA 2J71A 4UDUB 1YCSA 3MJ6A 4MZIA 3EYOA 1JK8B 2QADD 4HKXB 2ZXDA 1ES0B 3UTPE 3NBNA 4DN3L 2BZ7A 2CPCA 3UAJC 4HDIB 5F93C 4AYFA 1R5IB 4HEMA 2WAQA 3HJ0A 5EIIG 2NLJB 4WK2B 1P84J 12E8L 5JQ6L 3L95A 4NM8H 1J8HB 1J87A 1NGQL 2GBVA 4LRIA 3EYQC 4KJQC 2M83A 3ZRFC 3FSVA 4UINL 3LCYA 1OAXH 5TPWL 6FABH 2BW5A 1P9MA 3Q2WA 2E7MA 2NQDA 1BF2A 3HPJA 5CF3A 1M71A 4ZZKA 5C0GA 2ZKYA 1QI3A 4HUXB 3IDJA 1T0NA 3LIZH 5A2IH 4WIQA 1TJIL 5E2VL 3P4LA 1FUNA 2AJ3A 4BKSC 2OMWA 5IFHL 1EAPA 1QR1B 1L6XA 1AI1H 5DJAB 4FTVE 3HHSA 3ROLB 1FZOA 4JDZA 3MU3A 4RAVA 5E9DE 5KUMA 2LLNA 2EEFA 2YD6A 3IXTA 4FXLA 4XP9L 2PR9A 1IC4H 2D7TL 5KSVB 1PZCA 4Z0XB 1L7IH 4L4JA 3JWOC 3KBEA 1U6AH 2C7UB 4FAAB 1KB9K 4Y19A 5IJBC 1XF3B 2ZXAA 3DV4B 1EEYB 2YD7A 3STZB 3O3AB 4ZNEA 3W81A 3DI2B 5I15H 1V3MA 1L7TH 2VMJA 5CAYB 4ZS6D 1KTLA 2GTZB 2X5PA 1UH2A 1OPGL 3ML9A 3JZYA 4JCWA 2A6KB 2G0LA 2P5WB 2IADA 2XTJC 3ZMEA 1QUNB 3O6LH 7PAZA 3LEYL 3S5LG 3W57A 2N1TE 3ALPA 3IDXH 1WT5A 3HZMB 1DQLH 5C1MB 4X4ZA 1E50A 1E9OB 2D03L 4YBLB 4N0UB 2ICCA 1FL3B 2VDNL 3QUZD 1U4FA 1KELH 2RR3A 4QAMB 4Y4FB 2QMKA 3JTSA 2L8AA 3QNYA 3NDZE 2DYPB 5E51A 3PGCA 4PR5B 4V1DA 4KVNH 4JFPA 4LRNL 4LCCA 5T3XD 3T8XB 3FT3B 3PIQA 3CVHA 4PV1C 2FX7L 2H9GB 2WCSA 3ZIYA 1JWMA 1A7BA 5F6HJ 1KNOA 2APXA 5INCB 1IE4A 3ZKXB 3MRMA 2WKGA 5M94B 2Q3XA 2GJRA 4MASA 2PYEE 4IRSC 4WRLA 4ZMYA 5BJTA 5K69A 1EEZA 2WKOF 4NQSA 2WTRB 4OCWH 4UQIM 1AZRA 1RIHH 2JI3A 3F6LA 3FB8B 5FFGA 5BRPA 2Y36L 2R29L 1EEQA 4NKQB 5IJVA 4WVRA 1E5ZA 4JQIA 4U1MA 3SQOH 4TSCL 1B0WA 5SWSE 3AXLB 5DQ9A 4ZFFB 1HAWA 3V4PA 1M1XA 3MCKB 4G9DB 4TUOA 5AZ2H 5ICXB 3TBWB 5J9PB 5FUZL 5IFJB 3I3DA 3PWPB 5IHUL 3MRNB 3CFQA 4KOCA 2CK0L 2Y7LA 3DTXA 4NZTL 2JB5H 2I69A 1JV5A 4X7TA 1M6OB 1U8QB 1SJXA 1XL6A 2Y24A 4R4NC 1MWAA 1BVZA 3QJXA 5D7LE 5DS1A 2DQTL 1CT8A 1F02I 2OYMA 4NIKB 5CEZD 2ZYIA 1KT2A 4OLXL 2V5MA 4Z78B 1KXHA 2BSSB 1UGNA 4FFYA 3RWEB 1SBSH 3JWNC 1PX3A 4MA1C 4DO4A 2H6PA 4CNIB 4WU7A 3L6FA 2ZXQA 3MYJA 4TVSa 2OMTA 4WWKB 1ZLSH 3VWKD 2FJFB 4S1SH 2VR6A 3CSBA 4LOVA 1TKWB 2Q1EA 1D9KA 5H8DA 1ZGLM 1XGYL 1DL7L 1AIFA 5GGQH 4B3VA 3A6CH 1R46A 3EYVA 3IGUA 4HC1H 3ARFB 5EBGA 1B0RB 1ETB1 2OTPA 1U93B 1VA9A 1DHKA 2DPKA 2WNWA 3CBJB 5AVWB 3TF4A 2XG5B 1OAUH 2V7HB 3FQTB 1TTBA 3VH8B 4FL4B 2GSMB 1WICA 5DHVA 3SQBA 4JFEA 1XF2A 1MAML 3C6LA 5F7MC 2E27H 1KLFB 5KYYA 3M45A 3GSWA 4D9RE 4X42A 3NH7L 4OZHE 4MD4B 3WS6C 3UZQB 2EILB 2V8MA 5KVEH 1MFAL 1TO5A 5ITFB 4JKKA 1OCZB 2HB0A 3GJFK 1NFKA 3BH9B 3D5OF 2GHWB 2HT3D 4CL7A 4QNPE 3C5ZC 5C09E 4CAGA 3BW9A 4YR6B 4GKNB 3KYNB 4DP9X 3NK4A 2WIIB 3CDGB 2X4RA 4IIQC 2EDEA 4EF3A 5FGRA 4LOUC 5CLWA 4GBXB 1TF4A 1XXFC 3EO1B 3KW7A 3LB6D 5EA0H 2ZG3A 3WIIH 2X1QA 2OLDA 5MP6H 5B3NA 1DQQA 4K23L 4P2OD 4GUCA 5KBLA 5I1GL 5ID1A 1P7KA 4LLWB 4BWWA 1DE4A 2EADA 1W0VA 2AJUH 3QEQB 3MGOB 3UROR 1QP1A 4JRWA 3UGXA 4F37K 2UWEB 1NDMA 1F11B 3OJMB 4PGDB 4KUCD 3TBSB 1R9FA 2XA8L 1YPZF 3T8MA 1CDCA 3GFUA 4JRXA 5EEUA 1HXYB 4BSWA 5KVEE 5TQ2H 3Q1SH 1VFAB 4PB0L 2WXJA 3EFDL 4S11A 4Y2DB 2CM5A 2FJSA 3Q5TA 1FPTL 4HLZG 3C08L 3X3FH 1ASOA 1FORH 3Q3GB 5LG1A 3UMTA 2YAFA 4MCYB 3P0GB 1NCUA 5SWZB 1FLRH 1DVUA 2VAAB 3T1WA 4UQAA 5PCYA 3PHAA 1OTSC 4EBQH 1YEKL 1DZBA 3TXAA 3NIDB 3IFNH 4M8QB 3ZY7A 1JK8A 3DX9A 1T7ZA 1JK9A 4FYTA 3HTLX 4KQ3H 1EUTA 4DGIL 4LIQH 4NQCB 1SY6L 3NCMA 3OJDA 1O5PA 5FA4B 2X9YA 3SPHA 5EH1A 5TDOB 3MZGB 1P4UA 5J12B 4YJZL 2CGRL 1MI5A 2HUHA 2VSDA 3KMDA 3WUWB 4IJTA 1LEKA 3OQ3B 3ATAA 1EXUA 2X4QB 1U3HD 4X2UA 5AZUA 3K8LA 4M8RA 4QLWA 4KI1A 3LYRA 1BGXL 3SGKC 1VFMA 4H5SA 4WI0A 1XGZA 3J07A 2DWTA 3K6IA 2NT1A 3KLDA 2X89D 1NOAA 4PRHB 3BWUC 6CGTA 4N6RA 4Q14A 3GLAA 5KANG 4C56D 3D0LB 3SDYH 3UC0H 2YRLA 1QBLL 4Q52A 2DQUH 2ID5A 4QGTA 4YXKL 3PABA 1FNFA 1I9IL 2ZX9A 2QL1A 1M2VA 3A3YB 3EYUL 2EEDA 4GRWF 4LSSH 3IVKA 1IGTB 1R1CA 4MVBC 1EO8H 4G3YH 4FQQA 3K6SA 3RFZB 4X7SL 4XNXH 1UC6A 2VH5L 2BC4A 3V7AG 3AAZB 2I9TB 1NCAH 4K4KA 5CN1A 5KSVA 4LIQE 2HVKA 3FCBA 4GQQA 4NNPL 4Z0XA 2WO2B 3NSYA 3A67H 2J1ZA 2CH8A 2JKTM 4JAMB 2XJLA 2DKUA 2BCKA 4I9XA 1UASA 3LEVL 5DVOA 3TVMC 4AGOA 3STZA 4YSSA 3TA3D 3WY4A 4JJ5B 1ASQA 4KMLB 5FV2A 4AL8C 4BZ1H 1ACYH 1M7IA 2IBBA 2ZF8A 3PP3H 4BM7A 5LKNA 2OULB 5EC2A 3N9GL 4U7MA 3KNBA 1QTSA 4AGLA 2A2QT 4MMZB 4JCMA 4V1DD 5FAAA 2HKHH 5BZDB 2KHAA 3LNHA 2L7QA 1N9PA 3RIAF 1E9OA 1XZ0B 5C0DB 1BAGA 1AIZA 2ZUWA 4NUGL 4LLVB 3FB5A 1HJCA 4R7VA 3BKMH 5KYNA 5C0FB 3K7UA 1RUQL 3G5YA 3IKKA 4PJCB 5HDOA 7FABH 3FMGL 5L8JB 1KBGH 3JV6A 4AEIH 1H8OA 4ZUSA 2GTWA 4CMHC 3X1BA 4H0LC 4GRMA 3HMWH 3G7TA 4XMPL 1IEAA 1JIBA 4WGWB 5B38A 4GRWE 3OM3B 1VJSA 1FNAA 3T0EB 4D0DB 1URIA 4R8WL 2CA3A 1G1OA 3EBHA 5DJDB 4OCSH 3UJJH 5GS1B 4LLQA 2A6IB 1XIWD 3IPFA 3OXRB 1AFVL 3BJ91 3GK8L 3IS0X 3WJMB 2PP9A 2YD9A 5DTFB 4G9DA 4OZGE 1JZIA 3F5WB 4HIJB 4BQ8A 2PW2B 4M00A 4NKDA 3UAAA 4MXQC 1TZOA 3WTUA 1HKLH 2DIAA 4F7MA 1A6AA 2Z8RA 2WNKA 3EXJA 1BFVH 2VDLB 1P5UC 3BUBA 2XVLA 5AVTB 5IQ9A 1T89A 4O58L 5F9AC 4ZMNA 3RWEA 2FH8A 4A6YL 4IBUA 1D9KD 2Q2LA 3UPRA 2IANB 3TONA 2V2TB 3FTYA 2I60L 3K91A 4KOBA 3ZDYB 3C8DA 2F74A 5IBTH 1P1ZB 2J2ZA 2DBLH 4P3CH 5KYWB 3A24A 2VLRD 3BPLB 1HSBB 1BD2D 5INDB 1U2HA 2FJFA 4DGWC 3F7VA 1RZKH 4LCYB 1WGOA 4E9TA 3BI9X 2UXGA 1U2CA 1YEEH 3BD5A 5EOCJ 5HYEA 4LARH 1ZHNB 1HHKB 1J12A 1SN5A 1TTRA 1W2KT 3C6LD 3NFSL 3GPSA 2VCOA 4EN3A 2P24A 1I1AA 2ZUXA 1QABA 1NCCL 4OLZH 5KAQG 2MTAA 4R7NA 4PJFE 2AMGA 4OKVA 3AUVA 2NNAB 1NEZA 4I0PA 2AVFA 2OR7A 3QIBC 4FXTA 4WK4B 4PRBA 4BQ6A 2J4WH 5EUKA 2G60L 4Q7DA 3FUKA 2CHXA 3ARRA 1TQWA 1QZNA 5MEOA 4KHTH 4NBYB 1N0XL 4P3DB 3O3EB 3VXOA 3KWXA 4KK8D 5FO7A 1LP9F 2DMGA 4AM0A 2H2SD 2Z1PA 5CBEB 1AGBB 4QJ3B 1WC7B 4HETA 2XHNA 4OGYL 5HVGB 1FZMA 4MNGB 3G6JA 3GSQB 1AAJA 5DYOB 5BPPA 3EOAB 1RJZB 4MDIA 5L8KB 1QUPA 3CDGA 2Z31A 2ADJA 4HJSA 3B2VL 4YO0B 2EXSA 2OJZL 1UOWA 4W9LC 3F84A 5E8EB 5A6MA 3VYNA 1BYOA 3BWAB 3TPUA 4RMBA 4KROB 3W11D 5JPMC 1VZIA 5HHOA 3VFVB 3ESVF 1UXSB 2W81C 3I2CL 5D6CA 5TQ0H 3MXWL 3U30C 1TQCB 1J11A 3QDME 1LWJA 2YEVB 4FNLH 3L48A 4MQTB 3V6OE 5E24E 2R2BA 3KWWB 1FH5H 5IQ7H 1EFQA 4YSPA 4MMXA 3OKKB 1R75A 3QJSB 1PQZA 5IW1B 2PR4L 1UJ3C 4PBXA 1Y18B 1HXYA 3QRLA 4G5AA 3VG9B 2C7FA 1NCBL 2HFGH 3QUYB 2Y07H 2Q7YA 4C54A 5IB4A 5FR3A 5FIEA 5TE4L 2NXZC 3GMRA 1BOGB 4DHLA 3QWRA 3WMSA 2WANA 4G8IB 1TVHA 2X6UA 3REWB 2VAJA 4FNRA 4BA0A 1AHKA 1G6RL 3LRMA 3I74A 4KJPC 3PDGA 4OJDH 4WUKL 2FZ3B 1MI5D 1IKFH 1OGPA 1J8HD 1YUHA 3MRIA 4QY8A 4A7UA 4R7DA 2OYPA 4LPUA 2VL4A 5FA4A 2CCVA 5AUMB 4GJTB 3C09B 2NUPB 1BZ9A 4MJ6A 3RWGA 5TDOA 4WJG3 5EEXA 3ZZQA 2E7LC 4JKPH 5E94A 1BVOA 2BHUA 3IXAB 2OCCB 4IOIA 4N85A 1ZOXA 4XZ4A 1ETJA 1M56B 4ELMF 4NO2B 1T0MB 2G75A 1J5IA 1IGJA 1MHEA 3QXWA 4QRUB 2UZYB 3HCVA 4UT6H 1R3JB 4L9LC 4OM0L 5EOQL 4I9WD 3Q43A 2J88H 1ZE3H 3FQ2A 4L8SC 1TSRA 4NRYB 5E5MB 1T2XA 4NERA 2YSTA 3MLZH 1XSOA 3FKUS 4MMYB 3BHBB 3MX0A 1K4DB 3DLQR 3W56A 4BHUI 3EJJX 4G7SB 2DD8H 1LEIB 2D2CC 4PRNA 3CZSA 1E7UA 5A2FA 4NJAH 3KLKA 4AQEA 1PZ5A 4CDHA 3RUGE 4FD0A 3RPBA 1HINH 1NM4A 1URLA 3AQDA 2XV2A 2Z8SA 3DJ9A 2WXQA 3PWNB 4NWTL 3HBZA 4WNSA 5E6IA 5LBGA 4N25A 3VFGL 1A25A 3GJFA 4JZNB 4PJGE 3V0WH 1BVNP 3T2NH 4ZFZB 2VDOH 1ZTMA 2N4IA 4PJXF 1QFUL 4X4MA 5JYLA 1BQRA 2WJ5A 4HKJB 4Y2OA 1X5ZA 2IV8A 2C1OB 1BIHA 4Z3FA 1JMZA 4LCVA 4GYBA 2XT1B 4TM9A 1UB5B 1MCWW 2FGWH 3VFWB 5I18H 5MENE 2FYYB 3JT0A 3MNVB 4JZJA 4YE0A 5CLTA 3MUZ1 4RFNC 3MLTA 3CDZB 4UAHA 4P5SA 1RZKC 4Y4FD 3EUDA 4M1DH 2YSSB 2DYPD 1IC1A 3F8UB 1IX2A 1WBZA 3SYAA 2F8OA 1OP9A 1NFDB 4AV0A 4HBCH 4Q8BA 1TU2B 2XFXA 3NCJL 4I18C 1C5BH 2JQZA 3KL5A 2IQAB 4JVUA 2MSPA 3KYKH 3WKNA 4A7TA 5I76B 4PJCA 5C2BL 2WUCH 3GIVA 3T0VA 1U58A 1U3JA 2OSLB 4DW2L 1KC5L 1Z9PA 3MLRL 4Z8FH 4BDVA 1BVKA 3V5HB 3V6OC 3EDDA 5TE7L 1R3LA 2DQJL 3OKOA 1ET8A 2YRPA 1K72A 4D0DA 3ROOB 2XN9B 5I6XC 3VTAA 1J0IA 3ME0B 4HWZA 2VLJE 2CE6A 1I3GL 3PWPD 4UUJB 3C9NB 1OD7A 2A6IA 3OXRA 3T3PF 3QEUB 4L48A 1LWRA 3PU7A 1KZYA 4PCTA 4LXFA 1KJ2B 2W91A 2GBAA 3UTTB 1CFQA 1UZ8B 3FFCB 4HIJA 4A6YA 5JNYA 4GG8A 4YOKA 3N85H 2MOGA 4B97A 1RMFH 1KY7A 5DUPH 1A6VH 2VR8A 5BO1L 3V4VA 5I74B 3KXFA 5AB1A 5I1AA 3GF8A 3VXRE 2QV4A 4N9OB 4GUQA 3MRJA 3OSKA 5C08E 5C0JA 2ZE0A 3NCYP 4WWKD 4A2MA 5I71C 3TS8A 1JXKA 1UD8A 2WBJC 3GNML 2WZPA 5IQNA 4JFZH 1AQHA 1JF6A 3BXNB 3L5WA 4QHLB 4XTRD 3IFPB 1G7QA 4U6YA 1U30A 2OZ4A 1KJMA 4Y5XC 3OKEB 1RZGB 3SE6A 4P5TC 4WDIA 4WO4A 1JVKA 3ARFD 4LCYA 3FUIA 5BQDA 1I1AD 5HYQB 4ZW7A 3RVXC 4WAFA 4P9HL 3GTVA 2VXQA 5GS2D 1ZT7B 3WYRA 2A4CA 1HESA 5B39A 4I0PD 2DKMA 4RMTA 1W72H 3D34A 3RDJA 3ABMB 3OKDA 2DWDB 3GUFA 2EDFA 2ZOLB 3LV3A 1S9VB 1HXKA 4NP9A 2YC1B 2APSA 3I6LD 4KH2A 5ALCH 2ODIA 3S34H 3ORJA 3DRQB 2EDKA 4HMCA 4JJOA 4PMFA 3FFOA 2G4GA 1ODUA 4W9ZA 4W6YB 2MOQA 1YNKH 4G1EB 2IMMA 3T4AA 3H7LA 2RIKA 3SZKC 3JV0A 1MW0A 3MR9A 5E95B 4WEMB 1U36A 4PBDA 3RFRA 2V3EA 3LS5L 5I1EL 2IOOA 4DN4L 2Z31D 5JHDB 1TFHA 1CDUA 2YFOA 3EH3B 1HQ4B 1K3IA 4MNGA 5DXWA 5DWUL 4N0FA 1ID2A 1BFSA 4OCXL 4ZFQA 4J7RA 3AG3B 3EOAA 5J0BA 3MRPB 4KRPC 2H3XC 3BO8A 5JHBA 1TCRB 1ZE3C 2D4DA 4IKJA 4U0RC 3D48R 1RXLA 3QEQD 3E6FB 3N91A 1UFUA 2HAZA 3Q2VA 5AVYB 3BAWA 1ZDQA 4OQ1A 3N55A 1BPVA 3B7YA 4Q9QH 2I5YL 2ITEA 3D8MA 3OQRA 5LBSH 2ZP8A 1FG2A 2ZXCA 1A47A 4LNVA 4Y2DD 1UTDA 4ABUA 4ZD3L 4JFWA 3G5ZA 4Y1AE 4CSSA 3GBDA 4QO1B 3VO0A 5SWZD 3T5WA 4I48B 4WU5B 3CE1A 3BPNC 1CI5A 2JJVA 1PLGH 2H7WA 2VZSA 2VQUA 4ZUTA 4F2ME 3D4ZA 3LHPH 3MRKB 3BVNB 1U92A 3HAEG 4A7GA 3FSWA 1Z3RA 3PQYB 2GSIB 3SBWA 4OM1H 5ADOH 4NQEB 1RZQA 4BIKA 4NN6B 3T09A 5DFAA 5JA9A 2GBTA 3O6FC 1FIGH 2R1YB 4G8FA 4OGXH 3EGXB 5JOPE 1I85C 3BDXA 3CGTA 5CKAA 4PJBF 1C8QA 3ZQXA 2EUWA 4FQCH 2ITDA 3QVAA 3MLVH 3MLUL 3HN5A 4A7SA 5I8CB 1KCWA 4ZUWB 3LPGA 4O02A 2G2NA 1YMMB 2OQJA 1N3NA 4KKCC 5DFWH 3X13B 1I3RA 3RWHB 4WFHD 3CG8A 4AMKH 5AENA 1JP5A 1MVFA 4B6ZA 1KUMA 3O8XA 5DS8A 2A74B 1AACA 3SDXB 3ZHFA 2JK5A 4FYRA 2DDQH 2QVMA 4NUQA 4XXDB 2UZYA 4PIRF 3V8OA 3TTSA 5MEQB 1E4WH 1K5NA 3KPRB 1YECH 1FAKT 4WSJA 3P0VL 1C1EH 3NFNA 4MMYA 1MCFA 4XT1C 1CTNA 5E6ID 1GSKA 3V95A 1PYWB 3K2UH 2PTVA 4GAAA 3TN0C 4CVXA 3FO1B 5ESVB 4JKMA 3NACH 1LO5A 5IK3B 1YHPA 3CFTA 5FCSH 1FV1A 4F57L 3S9DB 1X5LA 3IDUA 3PWNA 4ZAKA 3V6BR 4F1ZA 2NY6C 4NO3B 3CBKB 4WNQA 4XN9A 1DSFL 5D2LE 5FCUH 1CICB 2BXZA 3HMXL 1IE5A 1QI5A 4I7ZC 4XVTL 3BAEL 4ELKB 1EHLL 2APFA 1CD9B 1HKFA 3CZNA 4ODTH 1PZDA 2R9HC 4JFOA 3MBWA 3IMRA 3GS7A 1UB5A 4XO9A 2CBPA 2JTYA 2BY1A 1UD3A 3NUKA 4OI8A 4OLVL 3RTQC 4U4BA 3CH1B 4WKZA 3HOGA 3MRLA 3BZFB 1P6WA 4Q2ZA 1FGNL 1E5CA 3CX5K 1AXSA 4ZO9A 2Y0SA 5GJSH 4GG6F 1PFCA 2JQMA 4I8DA 3RZCC 1ZCRA 5I6NA 1F4XL 2CHNA 3CDCA 4KK6C 5B22A 2DQCH 4OZIF 1TMQA 1XH3B 3BGFB 5AOIA 3ZPDA 5D5MB 2FO8A 2OP4L 3JTTA 2IQAA 2V7NB 3PXLA 5AW4B 1JHKH 3D4CA 3WXWL 1ZGLP 1EJOH 3T0ED 5ESQB 2G3MA 4N3TA 4PMEA 4YSAA 1H6UA 2FBRA 3FT0A 4J3OG 4LAJH 4ACTA 3V5HA 3WXVL 1J0HA 3DA0A 1YEFL 3EOBA 4L0PB 4RA0C 1E4HA 4YL9A 4DPBX 1JZ3A 2NZIA 5TDPA 5T3ZL 1JG9A 5FYLE 5IJCC 3VFPA 4D7BA 3ROOA 4PP2A 4MSWA 2DKSA 1AZUA 1V3KA 2AV1B 3C9NA 4HJ0D 2C9UA 2YN3A 4JO5A 2AJXH 3GKWL 1Q9WB 2DMBA 3SKUD 1H8NA 1KJ2A 4PRIE 2WTPA 5C07B 5E0QA 1IBGL 1UZ8A 1PZSA 2GC4C 4HISA 5D96B 3VU2A 3QJTB 3ARBA 4XNMA 3CFDB 1E7VA 1G7LA 5C0CB 3KW8A 1DBML 4N2AA 5C0BB 2WZPD 4L0ZA 2IAND 3VI3E 2WVTA 1HHGB 3ASOB 2O6CA 1S7SA 2H1LM 4GRLA 5I1IL 1YNTF 3CFJB 5AW5B 3EDFA 3QRGL 3MJ8A 1OF2B 2HT2D 2EUZA 1N8ZB 1GZQB 2FB4L 1WBXB 4WO4D 1KY6A 4B9GA 2G3XA 3BXNA 5JPNA 3IFPA 3TEXA 1CFSA 3O6ML 3T6QC 1JN6B 1X5GA 3IMWA 3OKEA 4MA7H 1LNUA 3HEIB 5IUCA 5ERWA 1G4RA 5EIIA 3VDAA 2WVVB 5GSVB 3X3GH 1I9EA 1ZXKA 3N6YA 3V7MA 4U3SB 3HZVB 3BZDA 3QQ3A 4YGVB 1FL6B 4JO4H 3KBHE 4BRJA 3BPOB 1R6VA 4DP6X 3V0IA 4AVIA 2VM4A 1BYNA 3JYBA 3U0WH 4PQXA 4Z95L 2DWDA 4M5SA 4KTYA 1OP3K 4JFDA 5A2BA 2R0LH 2IEPA 1N2RB 1NGWB 3BGMA 2EO9A 3FAWA 2EYRA 3ARQA 3D9AH 3FUMA 4FQ2H 1RZFH 4AYDC 4J39A 4KDWA 3RL1A 4PJAF 3PPEA 3GSOA 3GBNH 4G1EA 3VI4B 4UB0H 5FGSA 3L1OH 2QPFA 5F88B 4K5NA 1WAPA 2VABA 2VXTH 3AADB 3IAQA 2D7NA 4KZDH 4KROD 3DPBB 2XG4B 5EIVA 5CBAA 1BZ7A 2AMUA 2ADGB 4ZO7A 4KNQA 1Z9OA 5TF0A 4Z7QB 3HZYA 5JA8B 1ECZA 1NFIB 1U3YA 4WFFE 3QUKB 2XWCA 3NN8B 1J1XL 1J1OL 1PD1A 2Y23A 2Z1KA 1DVFC 4L5FL 5C0IA 1JFQH 2VM9A 4FHBD 4P2QB 2C3VB 4YQXH 2GY5A 5F7LB 3S5LA 3QIUC 1MCEA 3QISA 3O4LA 3QUYD 2Z64C 2AHIA 3S36X 1WCQA 3GO1H 4X5LA 4HWUA 4UIKH 1OT4A 3F85A 4F9PA 1Q9LB 5HP5A 2DEYX 1JNLH 3WGUB 4ZQTA 1JGDB 4LNRB 3VW3L 3OD3A 2F19L 1Y1UA 3OAYK 1T21A 3T4YA 3MRKA 4HIIA 5SWQA 2UXTA 3VQLA 7TAAA 1JERA 1AE6H 1UG9A 4E9RA 1A3ZA 3M88A 3VSUA 3PQYA 1T6WA 4OCRH 5CEZH 4LEOA 4LDEB 4PG9B 2LFEA 3RGBA 1EH9A 3WFBH 5HY9B 1WUZA 5ETUA 2E9BA 5KVFL 1CS6A 5CUSL 3T3MF 4O5LL 2EJ1A 2R1YA 2YUXA 2OR8A 4XXCA 1R0AL 2MNWA 3LKSA 4NZ8A 1ADWA 4JG0L 4FA6A 4R7XA 5E8PA 4QRPB 2EXYD 3HR5B 3H55A 2WLLA 5D93C 1F5WA 3X13A 3OMAB 1BFOB 2AV7A 4X9IA 4EUPG 4HCRH 1EZUA 2CDGB 2ICWA 4QTFA 3D4GA 1XT5A 5GIRB 2EDJA 1A64A 2X12A 4X6BA 1BF8A 3KR3L 1UXWA 2A38A 1C08B 1ZLUK 4PTUA 3X1EA 2J6EH 3K1KC 1UQSA 2C4FU 4H8WH 4YS4A 4M7ZC 2X40A 4L18A 2HG5A 4PJ8B 2OJEA 1DANU 4NQDE 3CMOL 3TO2A 1V7NL 4LVNB 3HMXA 5CEZE 3DSFH 5AVVB 4QJ4B 3VVVA 3NFPA 5ESVA 1QFPA 4ZW3A 5HVHB 2ZUUA 2FT8A 4NOBA 5CJ8A 5E4EC 5DA4A 2X9WA 4N8VG 4NO3A 5FGCB 3ZTEA 1UOLA 1XAUA 1YY8A 4Z0BL 4DVBA 3B6SB 4KQ4L 5CSGA 1CICA 2XA3A 1A0QL 1J9RA 2PUQT 5L2JA 5E8NA 3SHSA 3EH1A 1U95A 1YNLH 3VNZA 5I2IB 4ZTEA 5LVEA 3QJRB 4NN5B 3E3QE 3T3ME 3P1VA 1M05B 4NAMA 1F58H 4GQ9H 1QKZL 4P5MA 3U4EB 2DTMH 2K1MA 1KBPA 4XPTL 1BF5A 4K7FA 3A4DA 3DMMA 4G7QB 2N56A 4OF5A 5HGDB 2ED7A 3QA3A 4U1NA 4XGZA 2QDWA 2JCCA 3GWJA 3TPKA 4IBVA 1UWEL 3IFLH 1UUNA 1BEYL 4NXSA 1JMXA 2NY0B 2EDRA 2FVNA 2N1KA 1CIDA 1XGRA 1FYTB 1I9JH 3W9DA 1XSKA 3OKLA 1R4XA 1R24B 1G9MH 1MH5B 1MLBB 3BRDA 4OQTL 1ED3B 4F9LC 3R1GL 4B9ZA 2UZIH 1X9LA 2XN9D 4G6KL 2PP8A 4OGQC 5AOLA 1N5AB 2MQGA 5KBPA 2WBXA 3PWVA 1ZLDA 3PV7A 4L3EB 1V7MH 3G5XB 3GLDA 3QAZB 3GIZL 4ZS6C 4FZEL 1CE1H 4NQQA 3AZUA 4GS7B 3TV3L 3EUUA 4G1MA 2W8CA 2WWNA 3FBQA 2V5YA 4JDEB 1Q9WA 5EO1A 4GRLD 3GBLA 4BINA 4EIBA 4TVPL 1G7MA 2ODHA 4YVUA 2XPZA 5C0BA 3BPCB 4NRXA 3I75B 4F7TA 2ZPKL 3BUPA 2RFXB 3CFJA 2OMUA 1JNNH 5F7EL 1HZHL 5T1MA 1U41A 3QUMB 1GZQA 4R97C 3MACH 4K9JA 2WOYA 4QOKB 5CJ5A 2QQQA 2XPGB 4S2SB 3I3EA 4U1HB 1ZMYA 4U3CA 3WKPA 2IALB 4I13B 1BOYA 1UA6H 3WO4B 1IU1A 1SDDB 3GKZA 5DQDH 3ULSB 5C3LD 4P06A 3HUJA 3R19A 4N87A 2O26U 3AT9A 1T0PB 2QHRH 3GSXA 1QZ1A 4MAYC 4XPFL 2YD5A 4YAQB 3ECQA 2YZ1A 3C75A 4XVOA 4DKAA 1HWWA 2DH2A 4XB7A 1QSFA 4GSQA 5E8DH 3O0RH 1X5HA 2WXGA 3JVGC 3O6KL 1GCYA 5AW1B 1I7TB 5EOCL 2VW6A 4UANA 1MRCL 2H26A 4KFZC 1KIUA 3DYPA 4NPYA 1U8LA 4DP5X 4X5WB 4IMLB 4AQAA 4ANWA 1SUJA 2B1HL 5F1OB 2AW2A 1A9BA 1Z3GL 3HB3C 4S1RH 4X6CE 2VN7A 5FHBH 2FGZA 3BKJL 4DKTA 4RWYL 5EULV 4PRPB 3VWKC 4E5XG 1VSCA 2X4OA 3REVB 2HWZL 2KKQA 3KL3A 1DBAL 4C56E 3HFML 5EZIL 1VEPA 4F7EB 4OSUL 4PLOB 1GS8A 4PW3A 5IBLD 3BVDB 3E3QC 5FFOA 1FC2D 1JJUA 1KYDA 4WTWA 5HDLA 2F7OA 2OR9L 5FW8A 1RU9L 4RFOH 1ZLWH 4EDXA 3AROA 2CPUA 2G3ZA 4PREB 2DQHL 3TT1L 5DGQA 1WQVT 2DI9A 5IVXA 1IJNA 4H8WC 3DYOA 1R5WB 2APBA 2KS0A 1V10A 3O4LD 4L8BA 5DUBB 5T5NG 3I9AA 2LR4A 3IGLA 1OAQL 2YMXL 3MRHB 2EIDA 3E0GA 4KH9A 1ITCA 5E08H 3PUCA 1BZ8A 1FH2A 2RACA 3ILDA 2W9LA 3L8QA 3H2PA 3MSPA 1W0WB 2P8MA 1YEIL 3M8OL 1N67A 3WTXA 2K9UA 1MDAA 1KENH 3KJ4B 1HL8A 2HT3C 1LP9A 1T22B 1T66D 2VSMB 4A2DA 3M1CA 3PQYD 1KPVB 2Y06H 1U8HB 1I7ZB 3D39B 1AKJB 5G5DB 1WO2A 4PJHB 1ZHLB 5E1GA 3UBFA 4AEHH 4AQ1A 4AYID 2Y5TB 3AREA 3QXAB 3V55A 3V6FA 5I1HH 3TIEA 4PLKC 3Q6FB 2Z7UA 4WJ5B 4LDLB 4KXDA 1FBIH 2MEJB 4TULL 1YAIA 3F12B 3L45A 5EEZA 5EEWA 5I6KA 1UWXK 2GIMA 4JRYA 5F96H 4YDMA 4P2OC 2RMNA 5I8OL 2VMDA 2LAAA 4WWID 1C5CL 2AK1L 5D2NA 3ZGIA 2DJUA 1YMMD 3D06A 5FDYA 4EDWH 2EDNA 4YHKH 2GJZB 1KXQA 1G9MC 5FGBC 1HDMB 1PIGA 4RMRA 3B7RL 4LCWE 5GGUB 1KYOK 1UFGA 4XMKH 5BOJA 3ZTNH 1I7RB 2DN7A 2O4EA 2UXFA 4MGXA 1MN4A 3HC3L 1A9EB 2V8LA 3SO3C 5L88L 1A3LL 1XD1A 3EF4A 3DSNB 1HXMB 1QX1A 1D5ZB 3IGAB 2OL3L 3E8UL 4AMWA 2WYTA 3CFCL 4ERSL 2COVD 3HNTL 1HN1A 3RY4A 3VCLB 3FCGA 4HJUA 3FCTB 3KLHD 1PLBA 5IW6B 2R39A 2WNXA 1T03L 1KCBA 4L3CB 2WWMC 4OAWB 3S4SG 5ACLA 5IV2A 1V3JA 5DVNA 3VXTA 1CICD 2XWRA 5GJTH 2G4EA 4ECNA 4LDCA 1CFVL 1JE6A 2Z7ZA 4ODVH 4WV1C 2BNUA 1JHTA 3BUQA 3F7YA 4OLYH 2BIMA 3ULUF 1LE9A 5GSRA 1FVEB 1EERB 2CJUL 3ULAB 3SCMC 2X4SB 5KSBF 1AC0A 3L3OA 1BD2E 3C8HA 1U3HC 3V4UH 1BV8A 4J4PC 3MV9E 1S3RA 1EMTL 1CF1A 5AVQB 2WUBH 3FQYA 4OT1H 1U8OA 4ZG1A 2EO7A 4OCMC 1NMBH 2OFQA 1KEGH 2Z92B 3BQUB 3BVTA 3ZJAA 1QRNB 3AACA 4XVUC 3VFNA 5AOKA 4MAUL 3D69A 3VD1A 1IL1A 4YFEA 4P5KA 3QFJE 1V05A 3CSTA 4JPKL 4OQTA 4LVEA 4YHZL 3NCFB 1MCOH 2NY4C 1JNJA 5DLLA 4LHUG 1UH4A 2DM4A 2A6JA 3PNWB 4HEPG 4U1JB 2K6ZA 3B9EA 1L5GB 4YHLH 1FYTA 1W6WA 3TYFA 3FYIB 1ZHKA 4JCLA 2CUHA 2O5ZH 4C83B 4JQVA 5EU5A 4X9BA 5HDWA 1JS4A 3VXMA 1I1FA 3RY6A 3H3PH 3FUNA 3CQPA 2JJSA 4NUJB 4KTDL 4OV6F 2YZ8A 5DK0B 5AAWC 5BS0B 3FUEA 2MPAL 3WKML 1BVNT 3TA3C 1NLBH 4GAGH 5DZ9A 3ZXAC 2WXLA 2GUYA 3KLSA 1P6FA 1S7WA 3GGWA 1WCBA 4R3SB 3FRPG 3FUJA 3KCPA 4U1LB 3HE6B 5C0CD 2OXHB 4IIZA 4P59H 2C8NA 5C0BD 5FW7A 2OMVA 2BVOA 1J48A 1H5BB 4RISL 1JGLL 2N7BA 1ZIAA 1AHWC 3FQRA 1F2XK 3MMEA 5I5IA 2CR6A 3OPZL 2F08A 4ZPTB 5EU5B 3HAEB 3P9MB 4HFWB 5FYKU 4PB9H 1KFAL 3GS0A 1D5XB 4XH2A 1BCIA 2BPBA 1Q9KA 1FNEA 1H0DA 2IPKB 4KWUA 3NIFF 4NPJA 4WSKA 2OW6A 2GFBB 5J56B 4HIEA 4TN9A 3ARYA 3QORC 1F6AA 2NW2B 3NRPA 2XPGA 2WHVA 4QRRE 4U1HA 4ZSOA 2C34A 3P73A 1BDYA 2CO2A 1RURH 2WQXA 1SVZA 3HS0A 1SDDA 1KG0A 1WP6A 5C0RL 1XIWC 3NPSB 1E6JH 2EC9U 1C16B 2WQAA 2AQQA 3G04B 2WXRA 3IM1A 1BVLA 1PVHA 3EBAA 3U0TA 4JO2L 4OD1L 4B9FA 2AJSH 3NJHA 4J1UA 2F53B 3QCTH 3GQFA 3TT3H 2B4CL 4HWNA 1FZJA 1BJ1J 4X5WA 5B8CB 5KYXA 5DEJA 1D9KC 3ECVA 1AQKL 4FEIA 5D4HA 4NB7A 3PGFH 4ZUUA 1OCWL 1DBJH 2AITA 2X9XA 3BZ5A 4G80A 4HKZB 4PJ5E 4R26L 4YDJB 1A7QH 4KO7A 1KYFA 2JKLA 3L16A 1HEJC 2IDUA 3JV4A 1XGUA 5GGVL 3WY1A 4B50A 3ARGB 4S1DD 3FTUA 4F7EA 3L4TA 4W9JC 2AI0L 3TCLB 4Y4HB 3OB0H 5DCCA 3S2AA 4P4KC 4ZTPL 2KZKA 3ILEA 4ZNCD 1FVDA 2D9CA 2W65A 3FH7A 2VGLM 5T1DL 5ADPL 2AS5M 4UV4H 1SJMA 4Z7OB 3ZQ9A 2DJSA 3VFSB 1A3QA 5I0WA 3K4ZA 4LMQE 3RILA 3K8KA 4YGAB 1L9OA 4DUVA 1QASA 3GHEH 2V9TA 4UM8A 3L3IA 1QSEA 1U8PB 3QQ4A 1NBYB 3MRHA 4I85A 43C9A 3WS3A 1MVUA 3W9EB 3B9VA 5F3FA 4LLDB 1JNHB 3B5HA 5TFSL 3BVVA 4R4FL 3X12B 2P5WE 43CAB 1M53A 3EJQA 2J7LA 1THCA 5JHMA 2OI9C 1P4IL 2H2SC 4B9JA 3MJ9L 3CQQA 1GJUA 4N0UE 3FO0L 4PEEA 1GKEA 4PJDB 2IDSA 2BOCA 1S2EA 3FQNA 5KSUA 1HAUA 4HT1L 4E41B 4XP1H 5G5DA 2YO3A 3UPAA 4EI5B 3GI8H 1TTFA 4JRYD 1JGIA 2B2XL 2IJ0C 3DHJA 4H4NA 3ZX1A 4YHPA 4Z7WA 4IRJC 5E00A 8FABB 3U6RA 2WO4A 1X9QA 3ZE1B 2VZ3A 3RDTA 3W11C 2NY2C 1MY7A 1ZXQA 3MYZA 4QRPD 4ZJ9A 4ALAH 3SKMA 2P5PA 2XN2A 3THML 4PVNA 3DO3A 3HNVH 3D4YA 4JN1H 2V9RA 4IBLT 5DEGB 3B34A 3R7QA 4XBGB 2NRDA 3DVNA 4B9KC 1IT9H 2OL3A 3RHWK 1VPOH 1L3NA 4CC4A 3C2AH 5EU6E 3V5DB 3SEPA 4G7YH 3CFEB 1UWYA 1EVUA 4PRAA 1QQDA 3FU6A 3R0NA 4JREC 1CCZA 2YD1A 4OGZA 4WCYL 3EZJB 2HFTA 3G6AA 2BRRL 3HG3A 4PJ8D 3RI5F 4OF3A 1TLMA 1B2YA 2ZJSL 2XLLA 4QWWD 4X5XA 2ADYA 1T7YA 2WVUA 5GISH 2Z35B 2GJ6A 1J9TA 1OAKL 4X80L 5D1QB 1JRHH 4O9HL 4U6HB 5FX3A 2K3TA 5EOTA 3TH3T 1G7JB 2OX5A 4HAFA 5E1IA 1BXAA 5J6SA 1NPNA 1GC1L 4KMQA 3P2BA 1FN4B 3BSZH 3GXFA 1INEH 3ECBB 1SQMA 5LGJB 1X5XA 3T6ZA 4GY4A 3UJIH 1ZS8A 4UYPA 3VQ2C 4YX2H 4K0OA 2BNRA 5DJ6B 5E56A 1ZV5A 1YA5A 2A83A 1DDHB 2X4SA 3MRGB 3MA9H 3ARDA 4UV7L 1B0IA 4XPHL 2QQKL 2FJUB 2ZXBA 3RVTD 1UH3A 1LILA 2ZNXA 4FADA 1I4FA 3BFOA 4F8TA 5C8JB 1NCOA 3CVIL 2SODB 4FFWC 4LO9A 2Z93A 3DXAB 3ABKB 3FSOA 3MI6A 3QZPA 4HH9B 4JN2B 3VE0B 4AY0A 5A1AA 1QSVA 3V6ZB 5H35B 4HK0A 1FYTD 5LWYH 1SOSA 3VXMD 2E9GA 1FNGB 1R3IH 2WZ5A 4H25B 4FFTA 3ESMA 5FUCE 4PFEA 3MV7B 4H7VA 4PPTA 4UZSA 2VL5B 3KYMB 4NIYE 4X7FC 3SBRA 1RUMH 3RX9A 4Q9CA 1OALA 3C8KB 3QCUL 1JRHI 4NCDA 4FFZH 4L3ED 4ZX6A 2WLJA 2K4AA 4JPWL 4Y9CA 3QDGB 4GKLA 3MV8A 2YOAA 4MD0B 4TNVK 1MLCA 4BFIB 5H94A 3WJJA 2GT9A 5L0QB 5F7HA 2Z6FA 2HX7A 2C3WA 3H53A 4AYBA 3POHA 2YPKA 3CSPA 5CFAA 5I19H 2CLVB 3RPIA 4RMQA 4W93A 5IB5A 4WGKA 1HK6A 4UTBH 1FZKB 3GMOB 4YBLC 4AI7A 3MNZA 2H6UA 1UA7A 1F1DA 3P77A 2CBQA 4XC3H 4ORGB 4KJWD 4L4VE 3BKCL 4Y4FC 1G7PA 4U1LA 2VXSH 3WOVA 2OXHA 4XPAL 4YPGA 3QEQE 4X6DA 1JI2A 4G9FB 3PP4L 4W9IC 3VX1A 4IGBA 3K71A 3WFZA 1F13A 3IDMB 4MCZB 5E2WH 1F8TH 5IW3A 3EJYD 4UT9A 3ZKXC 1JHLL 1F4YH 1Y6NR 1KGWA 1JZ4A 4NJ9L 3WKYA 3KPSA 1QFWL 1ORSA 1PEWA 4JPIA 5FYJD 5D7KD 2F54A 1KGCE 4U6TA 4AMXA 4AWJC 1KB5L 3B7SA 2OTWA 1WWAX 2ZP9A 1MRDL 4Q6IB 5T1JA 2B20A 1G7HB 1GYCA 1PF3A 4RGOL 2JKIS 5A43C 3JWOL 5AOZA 2RTTA 3NJJA 4G6MH 4GQRA 3GUTA 2NXYD 1OW0C 5IMKB 2OYLA 5F7NC 1IM3B 4OJAA 3SE4A 4OD3L 4GKZB 2EDHA 2LU4A 5HI5D 3BLPX 5F21B 3CSYB 1J5HA 1IKOP 1HWHB 4NQCE 4IMKA 1F3RB 5DZNA 3JWDH 4AT6B 1BIIB 1V27A 6TAAA 3M1BB 3LH2L 1HSAB 5ECGA 2KZWA 4Z3JA 1G1KA 2ZSVB 4PJIF 2CDFB 2J73A 4XXWA 2Z91A 4F58L 4PSRA 5C2UB 1ZS2A 1BMGA 1XFPA 3KPPB 5DHMC 4PRPD 2F53A 4WWKC 4M62L 4ALAC 3KVQA 1A14H 3B1TA 4JRFA 4AZ8B 4RVBA 4PRHE 4PWEA 1SJEA 2DLHA 1A02N 2VDQL 4XTRC 4WFHE 2H1PH 2KC0A 4HIQA 2DLFL 4HKZA 5I6PA 1DLHB 3H0TA 4DTGH 2FWUA 1XWVA 2YGNA 2PTTA 3L3JA 4HAKA 4NNXA 3ARFC 5CP3H 3TZVB 4MZ2A 2ZUSA 1X44A 2XRAL 1QHOA 3ARGA 3ULVD 1N12A 4N2CA 4EN2A 3VG0L 1OL0A 5DDHB 2EACA 1AJ7H 4FL4C 2IFGA 5HDBF 1KWGA 3CDYA 4WI6A 5DJ0B 1IQDB 2IQ9L 1JSYA 3VFSA 1G6RB 4KXBA 1GIGH 2J1XA 1PFOA 4XMZA 3K5RA 5C0EA 4HJGB 1URZA 3IS1X 3LY6A 2DQDH 5FKAA 3VGBA 3MJ9A 1ZRUA 2IG2H 5F1NA 5EWIL 3VXSE 4XCYB 3KM2A 4OBRA 1BFTA 2VLLB 4KXZH 3X12A 1ZEAL 43CAA 3D39D 1AKJD 3OAWA 5EO0A 4RGNB 4C8XA 3GMLB 4GBXC 2PMZA 3I02A 2VDLH 2E7DA 4PWHA 2EIZA 3OVUB 2XX1A 3N06B 4J2XA 4WW2B 4UTAL 4LKCB 4ZMWA 2YAEA 3DIVA 1S7RA 4RNRA 1T4WA 3Q48A 4PBWD 5KBKA 1FC1A 5DK3A 5CGYD 8FABA 5BMFH 1SOKA 4Y8DC 1OTUD 2CLRA 3CK0L 5EZPA 1XR8A 1KCUL 2JE8A 2NNRA 4RCAA 1K6QL 3RYMA 4GMTH 1IGYB 4N2IA 4ZXBA 1Z66A 3MLPA 4Y2DC 5LQBH 4EE2A 3O4OB 2VXQH 2YARA 4TS6A 2H0PA 2APWA 5JW4M 3BUTA 4U6VH 3WV0A 1F4AA 5AALA 3VDCA 1SJHA 3C5ZB 4GINA 4XMVA 4JHZA 3PV6B 1EDYA 3F7LA 5DEFB 2EYTB 5DRWA 3UXFA 4EJ1C 5HHXH 5IVZA 4HCGA 3AGWA 2ZOOA 1OE2A 4HK3J 3D0VB 4KUZH 1HCFX 1IEBA 4AQ8C 2OTUB 2GJ6D 4NM8L 4KXZI 3L4ZA 2MQ3A 1H15A 3FOMB 5F0JB 3VUAA 1KCVL 1CLZL 1F3JB 4R7LA 5EBLB 4F5CE 1WFMA 3DROB 3EBGA 5B1KA 2AQ2A 3IFOB 4FQHB 1XB6A 1WBYA 4FQLH 4IKKA 2AC0A 2ICEB 4LL9A 5D1QA 2X6VA 3KDMB 3ZDYE 2CHWA 3JXAA 5J12C 4TKWA 3BFQG 3MXVH 4G43B 3ARDD 3NCBB 5IREA 2EIBA 3LIZL 3AQZA 3P11H 2E6JA 5CM1A 2B9BA 1F45A 3U6XS 4EEEA 3FN0H 1QRND 3PWJB 1S7VA 4G8GB 5D7IF 3A22A 2Y7OA 3T65B 1O75A 3S37H 3F01A 1IC4L 2NUTA 1RK1B 4QRTB 1L7IL 5LLIC 5SWSB 4PWJA 2WCPA 2R2EA 2YMOA 1VADA 3SIKA 5CXPA 2VNCA 1OEZW 5I15L 5KTEH 3RFZC 1L7TL 4M3JA 1XCQA 2JELH 4E5XB 4Z1PA 3WL9B 2HPOA 5GRXG 5H37H 4PS7A 3UAJA 1JAEA 4UM9B 2JKWA 3CHQA 4H25A 3IYLW 3JWDC 1XCTA 3HHMA 3MV8D 5IUSA 5DUMH 3F58H 2JMRA 1BQHG 2Q2EB 4NQTA 5BS0D 2E9WA 1S4IA 3LKNB 3IDXL 4LOFA 4M03A 4EZLA 1DQLL 4Z7VF 1JGEB 1JWUB 3Q6GH 3ZHKA 3QDGA 1KELL 4MZRA 1AP2B 4MD0A 3VRLF 4JZOB 5GGSB 4KVNL 4R6UA 1YDPA 1A4AA 4K8RH 3DVIA 4MMZC 2D7QA 3HE6D 4K94L 1SLUA 1W80A 5K9JL 3FOLA 3RRQA 4JLRA 4O2CA 5CJXC 4BA8A 4DKDC 3ULUL 2X70B 4OZFA 4IGBD 4OZ4B 2W60A 2ZWZA 3N43F 5JXEC 3VXPB 3GI9H 1ROWA 4LLMB 3TFBA 3APCA 3MRBA 4UF7C 3VFUA 3WIHA 3RKDD 5B21A 1RIHL 4G9FA 4XZUB 1LEGA 1KB5A 2F54D 2L7JA 2JB6A 3II3A 2IGTA 4MWFB 1E2ZA 1TETH 2CGZA 1OTTC 1YLBB 2IGFH 4HZLA 3SQOL 5F70A 4B27A 4YDVA 1MFDH 4OZHB 2M1KA 4FJZA 3T0EC 1I7UA 3GMMA 1MNNA 1WZ1H 2JB5L 1ZLEA 4HS3B 4C58B 5GS1C 3QZOA 5EU4A 1YMHB 4MNHB 1CE6B 2FSEB 5BZZA 4BZ2H 4I3RH 5GZNC 2FIKB 1EX0A 1LE5B 5FFLA 3B2XA 1R33A 5HJBA 1TZIA 2Q3AA 4PJ7A 1I8IB 4ZOCA 3AXIA 5CINH 3OLEA 5IGXH 1IM3A 1N5YH 4P04A 5EFIB 1K4CA 1JF1B 1M7UA 3OX8B 1ZLSL 1M3IA 3QG6A 1MFCH 1XZWA 1M2OA 3QULB 4S1SL 3S3PA 1ZSHA 4NGHL 2F53D 2GBUA 4K3DH 4GXUN 4EUPA 2X4NA 1HSAA 2ZOKB 4PS4H 4CC0A 3BGAA 3OWRA 1SVCP 1S9WA 3LXCA 3LKOA 3OMZA 5GGQL 3A6CL 4NI6A 4ODWA 3H9YA 3BT0A 4HC1L 1BYPA 2XETA 3BPLC 5D72L 2HT2C 4IRSA 1FFTB 3L5JA 3MKGA 3FU3A 3RA7H 1OAUL 5I1JH 3MCLL 2CCWA 4NSKA 2VRQA 3ARGD 5E6UB 3FTVA 3S4SB 4GAYA 3U82B 4Y4HD 1FRGH 2E27L 3HIZA 1HILB 3DVGA 3DK0A 4HS6B 4TF4A 2F5BL 2R4SL 4KKAC 4XCNA 5F1IB 1X3DA 2Z4TA 3WMQA 4N8VA 3LQAL 1UURA 2TRYA 2GQHA 1DEEA 3MRCA 5AW0B 5I73B 3PP3K 1DUZB 2A6DB 3A6BH 4JM4H 4JDVA 3O2WH 3WD5L 1XEDA 2IH3A 5I17A 3IDIA 1O7SA 1T4KA 4PGJA 4BCYA 2F7QA 3N0AA 4HFUH 2D31B 1N26A 2W94A 2XTLA 3G08B 2AAAA 1NMAL 3QUXB 5FM5M 2EDOA 3TBTB 1PPIA 1O6SA 5J6GA 4O2FA 3NZ8A 3T1FB 1NGXA 4GXUM 3WIIL 1P5VA 3K4AA 4PV9B 2R0KL 1KJ2H 3RVUC 3CHOA 2DQEH 4E41D 2FWOB 1BXVA 2V17L 4P8QA 1WAAE 4EI5D 1NFDE 4J3OD 3HRPA 5I16B 2AJUL 4GXFA 5K1NA 2GI0A 1HIMH 4H44C 3HG0A 2Y2TA 4FA7B 4KROC 2XZQH 1ZWIA 4KPHH 4IDJL 3ZE2F 5TQ2L 3Q1SL 1AR2A 2XVBA 1YPZB 3WLBA 1W8OA 2RB8A 2OMZB 1TQCC 1GZHA 3FFDB 2NX5B 3WU1A 1KWKA 3UG5A 4WI4A 4WI3A 4DWHA 4FOMA 4HJJH 1HHHB 2CU9A 1I82A 4FTVA 4YDZA 2AJZA 3QH3A 4YXLH 5EUOF 4TQ8A 5E9DA 3FRPB 1VKXB 1RI8A 3WS6A 1FL5B 4EBQL 2C4XA 3B2MA 5CJBA 3VG9C 3G9VA 4FYQA 2UXVA 2VJXA 5M95B 3QUYC 4DO6A 2X4PA 4GH7B 3HLKA 4X6FB 4RZCA 3C5ZA 4W1TA 3UTTE 4KQ3L 2G5BA 4JVWA 3DX6A 4J3TA 4HU2A 2EDDA 3F05A 3FFCE 2CG9X 4LHQB 4ONFH 5IESH 1HOCB 3JUYA 4ORZC 3AWGA 2BVQB 1S9YA 4JMNA 4IIQA 3X17A 2ROYA 3DO7A 1LK2B 4K8RC 4R0LB 5D1QD 2J3SA 5JO5B 2KDYA 4KKBD 4ZK8A 3RWIB 3LQZA 1K9TA 1X4ZA 3T08A 1CK0L 5A6LA 1F3JA 1VERA 3KGSA 2ZX8A 3Q9QA 3IJEB 3DROA 2Y7SA 3LIZA 4U6XB 3ETTA 4YBQD 1MHPH 2ICEA 3R18A 4DUWA 1ND0B 2PXYB 5CKGA 3UGUA 3BWSA 3SDYL 4OFQA 1OAZL 2MPVA 3UC0L 3ZE0F 1YN6A 5GHWH 2DQUL 4K9EH 1ZT1A 5C0AE 2X2JA 2EXYC 32C2A 2NZ9D 1NCGA 1TITA 5HD8C 2PYEA 3RWDB 4GRWB 4WHTA 2OBGA 1EO8L 4G3YL 3RKPA 1A6ZB 2F7RA 4GKOA 4DQOL 4XNXL 1WZLA 5KYUA 4BK8A 1UYWH 1NCAL 2NXZB 4XWGH 2Z34A 4BXSV 3CMGA 4QF1B 2O5XH 5EO9B 5EUOE 4D0BA 1U8IB 4H26A 3WFHB 4MJJA 5K9OB 4OZGB 1WA0X 5C0NC 3MV7D 3NGBB 3IWUA 3N1MC 5CD5D 1AZNA 4ZO6A 3EJZD 4BZ1L 1ACYL 3VD5A 3RZWA 2G9HB 5D7LA 2VM3A 4JO3L 1OT1A 3QDGD 4XOAA 2CRZA 4G5ZL 5LGHH 4ONGH 3VXQA 2DMKA 2HKHL 5JHDE 2BOBA 5EORL 3NCYS 1CL7H 4HBQA 2FTAA 4UIMB 5DJZA 3SGKA 1HEZA 2WWOA 1HQRB 4BGDA 2DI8A 5AQ0A 4UQBA 2E0PA 2M8XA 3ZTJH 2A9NH 2D3NA 3BKML 4G71B 4IRZH 4P46B 5KSBA 4IQHA 2YD3A 4LDOB 7FABL 2Y6SC 3HC0A 3KPOB 3L3KB 4G9FD 1AXIB 1B2WH 1E0OB 3A21A 1X7QB 2X70A 3S3JA 2FYVA 3TFKD 4PP1C 1OAYL 5BZWA 1LM8V 3ATBA 4IHBA 3JBG7 2EDWA 4JEGB 4JFYB 4OCSL 3V5KB 5LAPA 2IPTH 3UJJL 4PJFB 1KGUA 3O0LA 2A9AA 4HA1A 2R4RH 4MB3A 2NOYA 4V11A 3ZVVA 2QTEA 1YEWA 2DY2A 2HX9A 5E7FA 4RDQF 3N1GC 1XMEB 4EKJA 1WH0A 2LU7A 3B2PA 4BWTA 3IMBA 2H4EA 1FDLH 3DI3B 3L5XH 3TVMA 3T0DA 5KS9E 3KPTA 1FNLA 5C71A 1IM3D 2CKNA 1BFVL 4Z76B 2BWIA 3QQNA 2LQRA 1CL7I 4NQEE 5C09A 4PYGA 4DZ8A 2NY1B 3UYRH 3QWQB 1GTNA 1TVBA 4MQ7B 4J8RA 5EFIA 5IBTL 3LEXB 4P3CL 3VXNA 3CFBA 4HC1A 1N7MH 2HJFB 4MB5A 5DLML 4X4YB 5DU7A 2H32B 3CCHB 4Y4KB 3DK2A 3J27A 4OV5B 2XC8A 2BHYA 2ADIA 3QDMB 4LARL 1ZPLA 3NEOA 3SDXE 2Q0ZX 4PGBA 1N0LB 1TNNA 4WO0A 3BP6B 2I85A 4OLZL 4K5LA 2QVIA 4Y9EA 2ICWI 1RY7B 3KPRE 4HWEH 1A1NB 2YK1H 2BP3A 1ULVA 2QHLA 2J1KA 1OY3B 1L0YA 3H4HA 3SKOA 2VN6A 3ALXA 4GXVH 2C26A 3NSJA 2BP8A 5J4MA 1MFMA 3UTPD 4M1GL 2VO5A 1W16A 2VRKA 4XBEH 3WENA 3LPPA 4KHTL 4NLAA 4AV4A 4YHNB 2OXGA 1AGCA 3MGTA 2WW8A 3B8YA 2Y7NA 2UX6A 1JPFB 4A2GA 5TDNA 5K1VA 1RJLA 3FU9A 3CUPA 1CDIA 2GIYA 1P5UA 5LXVA 3FC8A 1XGPB 2JNZA 1Q72H 5CIPB 4OIIH 2XFGB 2YPVH 5KVGE 1NL0H 1S7TA 3AU1B 5IMLB 5AZEH 5LO7A 4CW1A 5EZJA 5EN2A 1JTOA 4JFVA 2G2PA 3FPYA 4K9EC 4Y5XB 2A9DA 1SEQH 5FA3A 3X1FA 1LD9B 3KG5A 3RWFB 1ETA1 2GSGB 4LHUA 2B8OT 4JS7A 3I6GB 3BP7A 1TT6A 1UCTA 1QMUA 5TQ0L 3W5NA 4KTEH 2HLFD 4FNLL 4HLZH 5D4JA 3PWUA 4P07A 4AGPA 5IBLC 4Z7UF 3H7BB 5IQ7L 1UVQB 5F71A 3CN1A 5J3HC 5D5ME 1B4JL 1JZEA 1LO3H 3EJCA 2QDVA 4KAQH 2AXFA 5E9DD 1P4BH 5HHQB 3E6HB 4AUJA 4N0CC 5HJ3A 2HFGL 4LLUA 2VDKL 5FM4A 4HGWB 1QLFA 3QIBA 5JOEA 3MBEB 1EZVX 1JVLA 2ATKB 3C6SA 3CLEL 2IBZY 1ZA3A 5DD1H 1T1WB 1AY1H 1NMCC 4G42A 3C5ZD 4H0IA 1HS6A 2GAZA 4YPJA 5AD0B 4JGUA 2W80C 4UAOB 1G1CA 3W1ZA 2FECI 4N8PA 4CKQA 3M17A 5FOBA 4N2FA 1IKFL 4PRDB 5DVKA 5B39B 4P2RA 2QJDA 3DO4A 1DVTA 2AJYH 3GHPA 4MX7B 5C07E 3BEWA 2FNBA 2XN0A 1T66C 3C5JA 3LN5B 4CA4A 1HOCA 3HZKB 4D0CA 2DAVA 4DGUA 2VXUL 3D25A 4NN6C 3RBGA 1HJBC 4JKPL 1JUFB 3BP5B 3PJLA 3RWIA 1SXAA 4ZDHA 4XXCC 2NQ3A 4PIBA 3IETA 5ANHA 5F89A 1UM5H 4UT6L 1QFWM 1MW2A 4U33A 2J88L 1GXEA 4KUCF 3JQOB 3UYPB 4XNDA 1A7RH 1AOHA 1KGYE 1CFMA 2WVSA 3MLZL 4M7JL 1UJ3A 1QHQA 1MFBL 2DD8L 1R5VB 5HHVH 1UZ6F 2A74C 1FFPB 4NJAL 3K74B 2HJKA 1RZ8A 4NKOB 2CCLA 5SWSD 4BEIA 4UQ3A 1EVTC 5ESAB 1HINL 1E67A 4E0RB 2EKSB 2O72A 4F2EA 2VLJB 1PCXA 4EXKA 1F90H 1X9RA 2ZYHA 3PAYA 4NQXB 2JXMA 3PGDB 4PJEE 3V0WL 4BZ1A 5IOKA 1UUSA 5ANME 3T2NL 3ERXA 5DI8A 2VDOL 3WFHA 2UYLA 1DLFH 1GZPB 5D7LD 2ITCA 4B0MM 5K9OA 2BVEA 1DJSA 4HIXH 4PJXB 5AB9A 3IAGC 1IIKA 3BDBA 3BKYH 4FQJH 4POYA 1WS8A 4NC2B 3K6OA 3RGVB 4DKEH 5DD0H 5KANI 2FGWL 5I18L 4OFYA 1UD4A 1Q90A 2G9HA 3VXRB 1CICC 4R84A 1CFNA 3DUSB 4M1DL 2ESVB 2IOIA 5IQLA 2E7LA 4KJYB 1XBDA 4EO5A 4XP5L 3MJGX 1ASPA 4WY7H 4HBCL 3ZKNC 3DOSB 1KLUB 4EVNB 2XKUA 1HQRA 1C5BL 2BW4A 3S36H 3QO1A 5TH2A 3Q8CA 2YPLE 3CQFA 4P46A 3KYKL 1N59B 4L9LA 4FNQA 4Z7QE 4IEFB 4L8SA 2WUCL 2IFFL 5IB3A 2ETWA 1HTYA 1V8HA 4WTZG 4Z8FL 3ZHNA 1S7UA 3OGCB 3NJXA 3NZUA 2MWCA 1NGPH 4J3VA 4P2QE 4Q97A 3BGFC 1KIRB 2H8PB 3SDDB 5E99H 1NUNB 4D9RD 2W07B 5FOJA 3V0GA 1D5BB 4K15A 4A2FA 4PJFA 3TVMD 5EBWA 2NY6B 3AT0A 3LTVA 1ADQH 4A2LA 4HEME 3CC5A 3T3PB 4Z7IA 3KVPA 2BSTB 4FZ8H 3RURA 1H6EA 3CTTA 3MV01 2VE6A 2I32A 5L8LB 5C09D 3N85L 3EG9B 3HG2A 4GP8B 2OSWA 1E3XA 3PL6B 5B3JE 2LE9A 1OP3H 5J1AA 1A6VL 1A1MB 3U2JA 2QSCL 4KVPA 4A37A 5AEAA 5K9KA 2WTOA 1NGZA 4L8CB 3P30H 1MG2C 3KBPA 1Z1WA 4JFZL 5D96C 4ZYKB 2DQFA 3U2SA 4XNZB 4JPQA 3K5SA 4RAUB 4UTCA 1LYQA 4I18A 3L9RA 2YRBA 3QUHA 4QRPE 1XSIA 1UT2A 1WDAA 5BVPH 5EZLA 4BKTC 1HU8A 2YAOA 4PAZA 4PJ9B 4ILDA 3S96A 5JORA 3AS3A 4YHIA 4OV5A 1S3KH 1RJCA 2X2YA 5JOFA 3V6OA 5F7UA 5FWQA 1W72L 3K6DA 1TZAA 4XNYH 1U3ZA 1ZANH 2KL6A 4Y19E 5LHDA 2IWFA 4A1RA 4X4XA 5IJDC 1F2QA 1IC7H 2VJ8A 4NYLA 5ALCL 3S34L 4YN3A 4PS3A 1OLZA 3FQUA 3MRFA 1A1NA 1NBVH 4MXQD 4KGJA 4X6EB 2HYMA 2B14A 2XWTB 2Q86A 3BPOC 2BVPB 4F2MB 1X4XA 3MOBL 3PAUA 4QHNB 3WE6B 3QRBA 3WHXA 4K3JH 4KITB 2QV2A 2G3NA 3EO0A 1YNKL 2HRHA 3LNIA 3BEVA 2VLKB 3L3GA 5TJWK 2B0SH 1KTKE 1GGBH 3AWEA 3HPLB 1YEDB 3QC6X 4XHQA 3QUXD 5FGCE 5CHNA 2R2HB 5EU7E 1FF5A 3LNEA 3W37A 1TQUA 2YS4A 3FQ4A 2C1PB 2WYIA 1CFBA 3CZFB 2WBJA 4LHUD 4XNQB 2W9DH 4AIZB 1CR9H 2FO4B 3IRZA 4ABWA 1EDHA 5G4OA 4Y5XA 3RIFF 1XR9A 4NFDA 2O93L 4P5TA 4WWOA 2GSGA 2XWZA 3D52A 1QVOB 4D8OA 3MZTA 4HKBA 1BQHB 1DQIA 4JANB 2B1AH 4Q9QL 1JXJA