3ZQYA

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16a variant at 1.03 a resolution- non-restraint refinement
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 54
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3zqyA00
1YZCA 2XLOA 4CIPA 1A7VA 1LM3B 1GQAA 1YYJA 2XLDA 2XL6A 1CGNA 3C63A 3M15A 5JRAA 1YZAA 4IB4A 4U9EA 1CGOA 4JEBA 3M79A 4JEAA 3QW1A 1E86A 5JLIA 3QVZA 4ER9A 1CPRA 3TOMA 2XL8A 4CDAA 3U8PA 4NC3A 3QW0A 4IAQA 1S05A 256BA 2XM4A 2YL1A 4CJGA 1M6TA 3DE9A 1E85A 4WGYA 4JKVA 4CJOA 1CPQA 2J9BA 2XLEA 2YLIA 4CDVA 2YKZA 5JT4A 3HNIA 4WGZA 2XLVA 1JAFA 3DE8A 4D4NA 3HNLA 5JS5A 1QPUA 2YLDA 1MQVA 4JE9A 4N4WA 1E83A 3L1MA 4CX9A 2YL3A 5JSLA 2XM0A 2YL0A 4N6HA 3ZTZA 4IARA 2CCYA 3HNJA 4EIYA 3ZWIA 4L6RA 5JUAA 5JP7A 3HNKA 3NMIA 3M4CA 3FOOA 4D4XA 2XLHA 3VRCA 1E84A 3NMKA 1BBHA 3QVYA 2YLGA 3C62A 3M4BA 5B3IA 1QQ3A 2XLMA 3ZQYA 2QLAA 4U9DA 1NBBA 2XLWA 3ZQVA 2BC5A 1YYXA 3IQ6A 3TOLA 3FOPA 5JVEA 4ULVA 3NMJA 1EKYA 4CDYA 2J8WA 1APCA 3IQ5A 5AGFA 3ZTMA 2YL7A 1RCPA
chains in the Genus database with same CATH superfamily
1WN0A 2CNWA 3MBGA 4CIPA 2L6GA 4X0RA 4EBJA 1EI7A 2DB4A 3C8GB 3KL4A 1Q0KA 3NYMA 3U5SA 5EHHA 2EPMX 3K6BA 3JT1A 3PMRA 2XL6A 2LCHA 5GPGB 4HFKB 4MW8A 3RKOF 5F5FA 1OW8A 5E3CA 5A69A 5A6AA 3C18A 5COMA 3U2LA 4PJJA 3F47A 2LK4A 4WABA 4XLNF 3TJ5A 3DM9B 3QW1A 1JOGA 1E86A 5JLIA 2OJED 4IWBA 1XZPA 2J46A 3N0TA 5BUOA 2L6FA 2HJMA 5COGA 1ST6A 1NFOA 5F5HA 3C8GD 4OIRF 2XL8A 4G7HF 4YL0A 3SP1A 1ZHYA 3ATPA 4IAQA 4NTAA 2A0UA 1AEPA 3SZRA 2O9XA 5A6JA 1RMVA 1OKKA 3SXYA 5HV9A 1RKEA 1E2XA 2LFDA 4PJLA 2EPKX 3DE9A 3O55A 4C3BA 4YT4A 3ZIBA 2GFHA 4H54A 1TFOB 2Q4FA 2Y3BA 4IAOA 5F28E 1LKXA 1U0BB 4XEVA 4QI2A 4E0HA 2DI3A 2IM8A 2KSFA 2WB7A 1Z63A 1BR4A 1PD1A 1PD0A 2WL8A 2YHSA 3EH2A 4K0DA 2CNWD 4LDKA 3AG1C 3VM6A 2UUHA 4CS9C 1FNTc 3N24A 3C8ZA 1JPJA 4K1OA 3L8IA 4JC7A 4MVUA 3ASOC 3NDBB 4P9TA 3VYWA 5KYYA 1D1AA 3DE8A 4I1MA 3EFOB 3BEHA 1Y4CA 4PFOA 2L9JA 2DGJA 1TWAA 2YLDA 1FFTC 1OCRC 2VH3A 3SEOA 3CQZA 5DLJA 5KYWA 1D0YA 2PX0A 4DRHB 1JPNA 2HSBA 2OEVA 2H7OA 3L1MA 2PX3A 5CIVA 4OIOF 2HS5A 1FR0A 1Z7Qc 3HJCA 3RQEA 2Y3DA 4C7OB 3K1IC 3EGXB 4MTOA 3GWLA 3DMDA 5AC4A 1OKKD 3JSEO 3ZTZA 4XPWA 1RKCA 3GEIA 3Q6MA 4EIYA 2EIJC 2CYDA 1VLTA 4MVSA 3T9OA 3VAYA 2HZ8A 4L6RA 3ZWIA 4BJ6A 1WTYA 2A68F 4J30B 3U0CA 2KQ9A 1UG7A 2LP4A 4PR9A 2KJGA 4W8KA 2D4UA 3O39A 2HJ3A 5KYWB 2RD9A 2OEXA 3DXJF 3U3BA 3RIPA 2XLHA 2IXNA 2CW0F 1O5HA 1E84A 3NKEA 2R25A 1QSPA 2YLGA 2A1DD 1FMWA 4ONSA 2TMVP 3AGUA 5T3TA 1HE9A 1OW7A 1TWCA 2R7WA 5L3VA 2XLMA 1OCZC 1HMDA 2ZXWC 3AG3C 5L0FA 2P61A 3JCUQ 3U3FA 1YYXA 1Q0FA 1T9KA 5KYNA 4DOZA 3LESA 2L7AA 4ULVA 1WWPA 2J8WA 1TWGA 4CSAC 1M2OA 1YA9A 2EILC 2A69F 2AP3A 4FX5A 2YVKA 2HMZA 1A0BA 3H2UA 1ZHWA 1BR2A 2RSEB 4MS2A 3K7DA 1QZXA 5AGFA 4CS7A 1XWJA 1WOLA 3GANA 4B6IA 5BQHA 1JMWA 2XLOA 3EZIA 2Q7RA 2BL2A 3I5PA 5KYXA 1A7VA 1LE4A 1LM3B 3DD7A 3GM3A 4IJJA 4LLCA 1SYQA 4BJ1A 1W2WA 2XLDA 2H7VC 4C3DA 1F1MA 2G62A 3MX3A 3C7JA 2YWAA 3JRMO 3QTHA 4J7YA 4EHPA 4AE4A 3RYLA 4DXWA 4IB4A 4U9EA 4OD5A 1OXKA 1TFKB 2WZLA 4JEBA 3ABKC 1MNEA 2Q3TA 3FAPB 4U5FE 1BDJB 4P9FA 3QVZA 2ZXRA 4Z9JA 4MW3A 3TOMA 5L0GA 3S84A 1LS1A 3LLIA 2YEVA 4CDAA 4NC3A 4BEMJ 1T01A 2Y39A 3QW0A 5D92A 3JZ0A 2J0WA 2QY9A 5KYXB 2HV6A 1QVXA 256BA 2WVOA 3I4UA 4IRUA 1TKNA 5KYUA 1UFBA 5DVWA 3OWTA 4I3MA 3S90A 1Z6AA 4Q4ZF 2I8BA 2H7BA 1DOWA 2H8AA 3KYIA 1M57C 4AE4B 4BPMA 1IW7F 3UR3C 1QKRA 3DAGA 3JTLO 3WG7C 3GORA 4JKVA 4P6IC 1FMVA 1ZYRF 4CJOA 3DKAA 3B71A 5CI8A 1V54C 3A9CA 3V5XA 5A6KA 4U5DE 2YLIA 5E3AA 4XQ1A 1MMGA 3NYLA 2KW3C 2W4MA 4WGZA 4OD4A 2XLVA 4U5EE 4MQ9F 2A6EF 5AC5A 1D0XA 5COFA 2OU6A 3NG1A 3Q7LA 5KYUB 3NYJA 2NSFA 4HE8D 3FAJA 4GYTA 4O6YA 1D0ZA 3SXZA 1VYKA 3S0XA 2XSEA 3LNMB 5B3SC 1Q0GA 5TJ5E 2M64A 1J8MF 3JSZA 5DQTA 1MQVA 4U5GA 3W4YA 4JE9A 1Z3IX 2MWQA 4N4WA 4PFPA 3SNHA 3EFOA 1G4WR 3EZHA 3K33A 1E83A 4H4KC 2R7UA 1LIHA 2IXPA 3O10A 4YJWA 4PACA 4CX9A 4NTFA 4PJNA 3EHMA 1ZU4A 2YL3A 3UMKA 2EPOA 1V4AA 2GWWA 2ZXPA 2NUTA 4KC9A 2R7SA 3KH2A 2G3VA 1VYIA 3LNRA 3B29A 2OKUA 1WATA 4JW1A 3V7OA 1ZZPA 4IARA 3RH3A 4JURI 2FAPB 5L0HA 3EGXA 1R5ID 3HNJA 3ZVRA 1H9GA 3G4XA 3S27A 4A2NB 2A6HF 4A4AA 1D1BA 1EQ1A 3RQGA 2NG1A 2AWYA 2KC3A 3DAFA 2IOQA 3IQCA 1J8YF 1QLEC 2PFDA 3F46A 3FVYA 3GWNA 1M56C 2UUIA 4RBNA 5JP7A 3S28A 4UDVA 3FOOA 1OQCA 3DWWA 1SR2A 3OA1A 2A0BA 2P0NA 3OEOA 4I44A 5L0CA 1VTMP 5L3QA 1G5ZA 4F4BA 3SXMA 2NUTB 3S9OA 1VK5A 2JX0A 4DBRA 1YARO 2PF4E 2VCCA 3ZQYA 2E87A 2EINC 4O7GA 2QLAA 2AU5A 1K04A 4JTCB 3ZQVA 1O3UA 2XLWA 1T6UA 2BC5A 2LD6A 3NRHA 2X51A 4MVRA 4MVMA 4Q7CA 3EGDA 2GAQA 4DVYP 3GEHA 3TOLA 1A7DA 1NZEA 4KNWA 4OINF 1RXQA 2P1AA 3U9MA 2EPNA 1HW2A 1ORYA 1YDIA 5EGYA 2PP4A 3ZC4A 4R32A 1NSGB 3HLZA 4O79A 3PCVA 1HY5A 4CBEA 1C02A 3GM2A 4GEHA 3AQCA 3CAXA 1WGWA 3IQ5A 3H2VA 4XWJA 3DJNB 4BJ5C 4FAPB 3ZTMA 2J0XA 4M63A 1YLMA 2R9RB 2OOCA 1GM5A 1FFHA 2YQYA 2LSEA 3AQBA 3FDQA 3U9JA 1OCCC 1YJGA 3ITFA 1YYJA 3R7CA 4MVZA 5B1BC 3FMSA 2XXAA 3W8IA 4J7TA 2R7TA 2XRHA 3C63A 4JCZA 3EGDB 3CEXA 1YZAA 2W4BA 3RVZA 2R7QA 1CGOA 1TR2A 1HE1A 1SF8A 2PBEA 4JEAA 4JCHA 1U89A 3T6BA 3DZAA 4N06A 4ER9A 3IQTA 3EPVA 1CPRA 1D1CA 1LI7A 2Q9AA 2R7OA 3X1OA 4C3EA 5CI9A 2NSGA 4HFFB 3AG4C 3U8PA 1NG1A 4RD9A 1HMOA 3RVYA 4JIOA 3S29A 1H7IA 3QMKA 5E2QA 1K40A 2BE5F 2J45A 2B0JA 1OR2A 2XXAB 1ZHXA 1TQGA 2Y3GA 1M6TA 1SMYF 3LUTB 1C17M 1VOMA 2C03A 4Z9HA 4ANJA 5DS4A 3PDMP 2Q9CA 2ZD9A 4PJMA 4DJ9A 1GS9A 3G4ZA 2AWCA 3HKKA 4O6NA 4DRJB 5A6BA 1CPQA 2V26A 2YZSA 1ZHTA 1T5OA 2XLEA 1M2VA 2L6HA 1NFNA 4G7ZF 4CDVA 4JTDB 1NU7D 4XEKA 2YKZA 4PK4A 3LEOA 3UMHA 3HNIA 3LS1A 5T1DB 4EWCA 2CGEA 5JT4A 3DJUB 2KYHA 4AL0A 4XLPF 3X2QC 3EG9A 2DYRC 2R05A 1AUEA 2L81A 2Z15A 2KNHA 1H9TA 3W8HA 2HMQA 1NU9C 2DYSC 4JVSA 4D4NA 4G0HA 1ZHZA 3HNLA 1I5NA 3J06A 1V74B 5FZTA 3WODF 4WJ0A 4YN0B 1ZW3A 3RQFA 4BJ6C 4CS9A 3LAYA 1A7EA 3TJ6A 3B0VC 4DRIB 3TULA 1CGME 2IXOA 5DS5A 3U8VA 4KNVA 2AVKA 3AGTA 1M2VB 1KU2A 4JJGA 3EHNA 2R03A 4YL3A 2IBFA 2XM0A 2OQMA 2YL0A 3WAQA 4E7SA 4AK9A 4Z9IA 2CCYA 2EIKC 3EG9B 2Q9BA 1YA7O 3FHDA 4EBBA 3RFYA 3ZG1A 4G7OF 2YRFA 2JD3A 3W2WA 1LVKA 4AX2A 5JUAA 2W9YA 5D91A 4O6MA 5E33A 5FCLA 2LIGA 3GODA 3NMIA 3M4CA 4U5CE 4I1OB 5A6BD 3L34A 3V5YA 3K1IA 4MVQA 3RW0A 1OR3A 4U5HA 2HKVA 2XS1A 2ASRA 3DM5A 3GM1A 1K05A 4D4XA 4EBKA 2V3CC 3IPMO 4FWVA 3SYNA 3Q6NA 2VASA 1FAPB 1RJ9A 1C03A 3QVYA 3M4BA 2Q00A 5B3IA 1QQ3A 2KGOA 1LS4A 1FTSA 1NBBA 4JTAB 4C7OA 4BJ5A 4YT5A 1WASA 4LLEA 2W45A 1N1CA 3E70C 4CS8C 1I4ZA 3MFNA 3NMJA 3POVA 1EKYA 4NY3A 1APCA 4BEJA 4QI0A 2M4EA 3B9QA 1L7CA 2VB6A 3DI5A 4IGGA 2JPUA 5DS6A 4NTBA 1R4TA 4YL1A 3EQLF 2IXMA 3EH1A 3ZDLA 3GEEA 1BR1A 1B68A 1JR8A 1YZCA 1G8XA 3EJNA 1RJ9B 2R7XA 1VLSA 4GQHA 4XPXA 2J9WA 3LS0A 1GQAA 3U2MA 4YK5A 4JRZA 4J32B 3LJBA 1VB5A 4XPYA 3PHF2 1CGNA 5JRAA 3M15A 3N2ZB 3SXKA 4CSAA 2WVQA 3UGOA 3KMIA 4LERA 5HSWA 1T6QA 3JYYA 5K0IA 3KKBA 4MNDA 4K7BA 2VCAA 3T6GB 1OXBA 1PV3A 2P6VA 2QTVA 3JYHA 3LLKA 3M79A 2HUJA 1JRAA 4XEFA 3RF3A 3ZSUA 5L0IA 4KBLA 1MMNA 1ZU5A 3ABLC 3MLGA 1AVOB 3T4RA 1TWHA 1Y6DA 4NQFA 4OIQF 3QZCA 4JZAA 3KPHA 2WVNA 3JRTA 2OG2A 2G3KA 1RKEB 3TK0A 1ORJA 2PNOA 4BJTA 2MYSA 2FGYA 1S05A 1YAUO 2P7VA 3LEVA 1Z23A 2XM4A 2CDQA 3FXHA 2D5RB 2YL1A 3ABMC 3TD7A 4YWQA 4CJGA 2ZXOA 3CZ6A 3O6XA 4EUKB 1E85A 1VMAA 1GGQA 2R7RA 3V5ZA 3B0UX 1I4YA 5B1AC 4WGYA 3R2PA 5DQZA 1KTMA 2B0HA 3UNGC 3WHNA 2IYLD 3KYJA 2J9BA 3T6JA 1T6IA 3AG2C 3MYFA 4JJFA 1KNYA 2ICWG 4N6CA 5KYYB 3US6A 3ECSA 4EKWA 1LI5A 3H65A 2XL4A 4YT2A 1JAFA 4E17A 4MTGA 1BZ4A 2J7PA 5JS5A 1Q0MA 4QDLA 1QPUA 1SZIA 2F22A 2KK1A 3K1HA 1ZW2A 3M1CB 1LE2A 5L0JA 1G4US 4HEAJ 2LFFA 1PCXA 1HW1A 4FESA 1ORSC 3K66A 4BG0A 2R02A 4LDQA 4E0IA 3E9VA 1V55C 3G50A 4Q5SF 2GA0A 2GDCA 4MTFA 5JSLA 4ULWA 4XTKA 1IZMA 2HSQA 4NCQA 2ETSA 3CSKA 4N6HA 2OJQA 5L0DA 2FFHA 1XZQA 2NUPA 3Q7GA 2X0CA 5IY5C 4W8PA 1MMDA 2ZPAA 1EA8A 2EPLX 2QNLA 4DVZA 3IEEA 1DOVA 3ASNC 1Z5ZA 3IHUA 2EIMC 2C04A 3VF0A 1ZVZA 3HNKA 2VC9A 2QE9A 1RCPA 4RDAA 2MHRA 2LQGA 1OCOC 2XS8A 4LACB 3VRCA 1LPEA 4CS8A 3NMKA 1BBHA 3B0PA 2HFIA 3C62A 2NPUA 2I15A 1Q0DA 2QUPA 3AJMA 3L8JA 3NKDA 3C8GA 4AL1A 3HTKC 4DBQA 4YT8A 2J9VA 5BQIA 1L3PA 2WZGA 2HV7A 3AOUA 1YVIA 1A41A 4MVOA 4U9DA 2J7PD 4ZLCA 3UGPA 2Y69C 2NUPB 5EK0A 3MYIA 4E7ZA 4ZLDA 3IQ6A 3UMIA 3A11A 3FOPA 1H6GA 4G78A 5JVEA 2J9UA 2OCCC 4OIPF 3L0IA 4CDYA 1MNDA 2VCBA 5BQGA 5T3WA 4E18A 1S7ZA 3TQOA 3I5QA 4CIHA 2R7VA 1U6HA 2WZFA 1NLXA 4KI2A 3W2VA 3BRJA 1OW6A 4U5BE 4LDRA 1O87A 2Y3HA 2YL7A 1MMAA
chains in the Genus database with same CATH topology
1YZCA 2XLOA 4CIPA 1A7VA 1LM3B 1GQAA 1YYJA 2XLDA 2XL6A 1CGNA 3C63A 3M15A 5JRAA 1YZAA 4IB4A 4U9EA 1CGOA 4JEBA 3M79A 4JEAA 3QW1A 1E86A 5JLIA 3QVZA 4ER9A 1CPRA 3TOMA 2XL8A 4CDAA 3U8PA 4NC3A 3QW0A 4IAQA 1S05A 256BA 2XM4A 2YL1A 4CJGA 1M6TA 3DE9A 1E85A 4WGYA 4JKVA 4CJOA 1CPQA 2J9BA 2XLEA 2YLIA 4CDVA 2YKZA 5JT4A 3HNIA 4WGZA 2XLVA 1JAFA 3DE8A 4D4NA 3HNLA 5JS5A 1QPUA 2YLDA 1MQVA 4JE9A 4N4WA 1E83A 3L1MA 4CX9A 2YL3A 5JSLA 2XM0A 2YL0A 4N6HA 3ZTZA 4IARA 2CCYA 3HNJA 4EIYA 3ZWIA 4L6RA 5JUAA 5JP7A 3HNKA 3NMIA 3M4CA 3FOOA 4D4XA 2XLHA 3VRCA 1E84A 3NMKA 1BBHA 3QVYA 2YLGA 3C62A 3M4BA 5B3IA 1QQ3A 2XLMA 3ZQYA 2QLAA 4U9DA 1NBBA 2XLWA 3ZQVA 2BC5A 1YYXA 3IQ6A 3TOLA 3FOPA 5JVEA 4ULVA 3NMJA 1EKYA 4CDYA 2J8WA 1APCA 3IQ5A 5AGFA 3ZTMA 2YL7A 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZC A;  2XLO A;  4CIP A;  1A7V A;  1LM3 B;  1GQA A;  1YYJ A;  2XLD A;  2XL6 A;  1CGN A;  3C63 A;  3M15 A;  5JRA A;  1YZA A;  4IB4 A;  4U9E A;  1CGO A;  4JEB A;  3M79 A;  4JEA A;  3QW1 A;  1E86 A;  5JLI A;  3QVZ A;  4ER9 A;  1CPR A;  3TOM A;  2XL8 A;  4CDA A;  3U8P A;  4NC3 A;  3QW0 A;  4IAQ A;  1S05 A;  256B A;  2XM4 A;  2YL1 A;  4CJG A;  1M6T A;  3DE9 A;  1E85 A;  4WGY A;  4JKV A;  4CJO A;  1CPQ A;  2J9B A;  2XLE A;  2YLI A;  4CDV A;  2YKZ A;  5JT4 A;  3HNI A;  4WGZ A;  2XLV A;  1JAF A;  3DE8 A;  4D4N A;  3HNL A;  5JS5 A;  1QPU A;  2YLD A;  1MQV A;  4JE9 A;  4N4W A;  1E83 A;  3L1M A;  4CX9 A;  2YL3 A;  5JSL A;  2XM0 A;  2YL0 A;  4N6H A;  3ZTZ A;  4IAR A;  2CCY A;  3HNJ A;  4EIY A;  3ZWI A;  4L6R A;  5JUA A;  5JP7 A;  3HNK A;  3NMI A;  3M4C A;  3FOO A;  4D4X A;  2XLH A;  3VRC A;  1E84 A;  3NMK A;  1BBH A;  3QVY A;  2YLG A;  3C62 A;  3M4B A;  5B3I A;  1QQ3 A;  2XLM A;  3ZQY A;  2QLA A;  4U9D A;  1NBB A;  2XLW A;  3ZQV A;  2BC5 A;  1YYX A;  3IQ6 A;  3TOL A;  3FOP A;  5JVE A;  4ULV A;  3NMJ A;  1EKY A;  4CDY A;  2J8W A;  1APC A;  3IQ5 A;  5AGF A;  3ZTM A;  2YL7 A;  1RCP A; 
#chains in the Genus database with same CATH topology
 1WN0 A;  2CNW A;  3MBG A;  4CIP A;  2L6G A;  4X0R A;  4EBJ A;  1EI7 A;  2DB4 A;  3C8G B;  3KL4 A;  1Q0K A;  3NYM A;  3U5S A;  5EHH A;  2EPM X;  3K6B A;  3JT1 A;  3PMR A;  2XL6 A;  2LCH A;  5GPG B;  4HFK B;  4MW8 A;  3RKO F;  5F5F A;  1OW8 A;  5E3C A;  5A69 A;  5A6A A;  3C18 A;  5COM A;  3U2L A;  4PJJ A;  3F47 A;  2LK4 A;  4WAB A;  4XLN F;  3TJ5 A;  3DM9 B;  3QW1 A;  1JOG A;  1E86 A;  5JLI A;  2OJE D;  4IWB A;  1XZP A;  2J46 A;  3N0T A;  5BUO A;  2L6F A;  2HJM A;  5COG A;  1ST6 A;  1NFO A;  5F5H A;  3C8G D;  4OIR F;  2XL8 A;  4G7H F;  4YL0 A;  3SP1 A;  1ZHY A;  3ATP A;  4IAQ A;  4NTA A;  2A0U A;  1AEP A;  3SZR A;  2O9X A;  5A6J A;  1RMV A;  1OKK A;  3SXY A;  5HV9 A;  1RKE A;  1E2X A;  2LFD A;  4PJL A;  2EPK X;  3DE9 A;  3O55 A;  4C3B A;  4YT4 A;  3ZIB A;  2GFH A;  4H54 A;  1TFO B;  2Q4F A;  2Y3B A;  4IAO A;  5F28 E;  1LKX A;  1U0B B;  4XEV A;  4QI2 A;  4E0H A;  2DI3 A;  2IM8 A;  2KSF A;  2WB7 A;  1Z63 A;  1BR4 A;  1PD1 A;  1PD0 A;  2WL8 A;  2YHS A;  3EH2 A;  4K0D A;  2CNW D;  4LDK A;  3AG1 C;  3VM6 A;  2UUH A;  4CS9 C;  1FNT c;  3N24 A;  3C8Z A;  1JPJ A;  4K1O A;  3L8I A;  4JC7 A;  4MVU A;  3ASO C;  3NDB B;  4P9T A;  3VYW A;  5KYY A;  1D1A A;  3DE8 A;  4I1M A;  3EFO B;  3BEH A;  1Y4C A;  4PFO A;  2L9J A;  2DGJ A;  1TWA A;  2YLD A;  1FFT C;  1OCR C;  2VH3 A;  3SEO A;  3CQZ A;  5DLJ A;  5KYW A;  1D0Y A;  2PX0 A;  4DRH B;  1JPN A;  2HSB A;  2OEV A;  2H7O A;  3L1M A;  2PX3 A;  5CIV A;  4OIO F;  2HS5 A;  1FR0 A;  1Z7Q c;  3HJC A;  3RQE A;  2Y3D A;  4C7O B;  3K1I C;  3EGX B;  4MTO A;  3GWL A;  3DMD A;  5AC4 A;  1OKK D;  3JSE O;  3ZTZ A;  4XPW A;  1RKC A;  3GEI A;  3Q6M A;  4EIY A;  2EIJ C;  2CYD A;  1VLT A;  4MVS A;  3T9O A;  3VAY A;  2HZ8 A;  4L6R A;  3ZWI A;  4BJ6 A;  1WTY A;  2A68 F;  4J30 B;  3U0C A;  2KQ9 A;  1UG7 A;  2LP4 A;  4PR9 A;  2KJG A;  4W8K A;  2D4U A;  3O39 A;  2HJ3 A;  5KYW B;  2RD9 A;  2OEX A;  3DXJ F;  3U3B A;  3RIP A;  2XLH A;  2IXN A;  2CW0 F;  1O5H A;  1E84 A;  3NKE A;  2R25 A;  1QSP A;  2YLG A;  2A1D D;  1FMW A;  4ONS A;  2TMV P;  3AGU A;  5T3T A;  1HE9 A;  1OW7 A;  1TWC A;  2R7W A;  5L3V A;  2XLM A;  1OCZ C;  1HMD A;  2ZXW C;  3AG3 C;  5L0F A;  2P61 A;  3JCU Q;  3U3F A;  1YYX A;  1Q0F A;  1T9K A;  5KYN A;  4DOZ A;  3LES A;  2L7A A;  4ULV A;  1WWP A;  2J8W A;  1TWG A;  4CSA C;  1M2O A;  1YA9 A;  2EIL C;  2A69 F;  2AP3 A;  4FX5 A;  2YVK A;  2HMZ A;  1A0B A;  3H2U A;  1ZHW A;  1BR2 A;  2RSE B;  4MS2 A;  3K7D A;  1QZX A;  5AGF A;  4CS7 A;  1XWJ A;  1WOL A;  3GAN A;  4B6I A;  5BQH A;  1JMW A;  2XLO A;  3EZI A;  2Q7R A;  2BL2 A;  3I5P A;  5KYX A;  1A7V A;  1LE4 A;  1LM3 B;  3DD7 A;  3GM3 A;  4IJJ A;  4LLC A;  1SYQ A;  4BJ1 A;  1W2W A;  2XLD A;  2H7V C;  4C3D A;  1F1M A;  2G62 A;  3MX3 A;  3C7J A;  2YWA A;  3JRM O;  3QTH A;  4J7Y A;  4EHP A;  4AE4 A;  3RYL A;  4DXW A;  4IB4 A;  4U9E A;  4OD5 A;  1OXK A;  1TFK B;  2WZL A;  4JEB A;  3ABK C;  1MNE A;  2Q3T A;  3FAP B;  4U5F E;  1BDJ B;  4P9F A;  3QVZ A;  2ZXR A;  4Z9J A;  4MW3 A;  3TOM A;  5L0G A;  3S84 A;  1LS1 A;  3LLI A;  2YEV A;  4CDA A;  4NC3 A;  4BEM J;  1T01 A;  2Y39 A;  3QW0 A;  5D92 A;  3JZ0 A;  2J0W A;  2QY9 A;  5KYX B;  2HV6 A;  1QVX A;  256B A;  2WVO A;  3I4U A;  4IRU A;  1TKN A;  5KYU A;  1UFB A;  5DVW A;  3OWT A;  4I3M A;  3S90 A;  1Z6A A;  4Q4Z F;  2I8B A;  2H7B A;  1DOW A;  2H8A A;  3KYI A;  1M57 C;  4AE4 B;  4BPM A;  1IW7 F;  3UR3 C;  1QKR A;  3DAG A;  3JTL O;  3WG7 C;  3GOR A;  4JKV A;  4P6I C;  1FMV A;  1ZYR F;  4CJO A;  3DKA A;  3B71 A;  5CI8 A;  1V54 C;  3A9C A;  3V5X A;  5A6K A;  4U5D E;  2YLI A;  5E3A A;  4XQ1 A;  1MMG A;  3NYL A;  2KW3 C;  2W4M A;  4WGZ A;  4OD4 A;  2XLV A;  4U5E E;  4MQ9 F;  2A6E F;  5AC5 A;  1D0X A;  5COF A;  2OU6 A;  3NG1 A;  3Q7L A;  5KYU B;  3NYJ A;  2NSF A;  4HE8 D;  3FAJ A;  4GYT A;  4O6Y A;  1D0Z A;  3SXZ A;  1VYK A;  3S0X A;  2XSE A;  3LNM B;  5B3S C;  1Q0G A;  5TJ5 E;  2M64 A;  1J8M F;  3JSZ A;  5DQT A;  1MQV A;  4U5G A;  3W4Y A;  4JE9 A;  1Z3I X;  2MWQ A;  4N4W A;  4PFP A;  3SNH A;  3EFO A;  1G4W R;  3EZH A;  3K33 A;  1E83 A;  4H4K C;  2R7U A;  1LIH A;  2IXP A;  3O10 A;  4YJW A;  4PAC A;  4CX9 A;  4NTF A;  4PJN A;  3EHM A;  1ZU4 A;  2YL3 A;  3UMK A;  2EPO A;  1V4A A;  2GWW A;  2ZXP A;  2NUT A;  4KC9 A;  2R7S A;  3KH2 A;  2G3V A;  1VYI A;  3LNR A;  3B29 A;  2OKU A;  1WAT A;  4JW1 A;  3V7O A;  1ZZP A;  4IAR A;  3RH3 A;  4JUR I;  2FAP B;  5L0H A;  3EGX A;  1R5I D;  3HNJ A;  3ZVR A;  1H9G A;  3G4X A;  3S27 A;  4A2N B;  2A6H F;  4A4A A;  1D1B A;  1EQ1 A;  3RQG A;  2NG1 A;  2AWY A;  2KC3 A;  3DAF A;  2IOQ A;  3IQC A;  1J8Y F;  1QLE C;  2PFD A;  3F46 A;  3FVY A;  3GWN A;  1M56 C;  2UUI A;  4RBN A;  5JP7 A;  3S28 A;  4UDV A;  3FOO A;  1OQC A;  3DWW A;  1SR2 A;  3OA1 A;  2A0B A;  2P0N A;  3OEO A;  4I44 A;  5L0C A;  1VTM P;  5L3Q A;  1G5Z A;  4F4B A;  3SXM A;  2NUT B;  3S9O A;  1VK5 A;  2JX0 A;  4DBR A;  1YAR O;  2PF4 E;  2VCC A;  3ZQY A;  2E87 A;  2EIN C;  4O7G A;  2QLA A;  2AU5 A;  1K04 A;  4JTC B;  3ZQV A;  1O3U A;  2XLW A;  1T6U A;  2BC5 A;  2LD6 A;  3NRH A;  2X51 A;  4MVR A;  4MVM A;  4Q7C A;  3EGD A;  2GAQ A;  4DVY P;  3GEH A;  3TOL A;  1A7D A;  1NZE A;  4KNW A;  4OIN F;  1RXQ A;  2P1A A;  3U9M A;  2EPN A;  1HW2 A;  1ORY A;  1YDI A;  5EGY A;  2PP4 A;  3ZC4 A;  4R32 A;  1NSG B;  3HLZ A;  4O79 A;  3PCV A;  1HY5 A;  4CBE A;  1C02 A;  3GM2 A;  4GEH A;  3AQC A;  3CAX A;  1WGW A;  3IQ5 A;  3H2V A;  4XWJ A;  3DJN B;  4BJ5 C;  4FAP B;  3ZTM A;  2J0X A;  4M63 A;  1YLM A;  2R9R B;  2OOC A;  1GM5 A;  1FFH A;  2YQY A;  2LSE A;  3AQB A;  3FDQ A;  3U9J A;  1OCC C;  1YJG A;  3ITF A;  1YYJ A;  3R7C A;  4MVZ A;  5B1B C;  3FMS A;  2XXA A;  3W8I A;  4J7T A;  2R7T A;  2XRH A;  3C63 A;  4JCZ A;  3EGD B;  3CEX A;  1YZA A;  2W4B A;  3RVZ A;  2R7Q A;  1CGO A;  1TR2 A;  1HE1 A;  1SF8 A;  2PBE A;  4JEA A;  4JCH A;  1U89 A;  3T6B A;  3DZA A;  4N06 A;  4ER9 A;  3IQT A;  3EPV A;  1CPR A;  1D1C A;  1LI7 A;  2Q9A A;  2R7O A;  3X1O A;  4C3E A;  5CI9 A;  2NSG A;  4HFF B;  3AG4 C;  3U8P A;  1NG1 A;  4RD9 A;  1HMO A;  3RVY A;  4JIO A;  3S29 A;  1H7I A;  3QMK A;  5E2Q A;  1K40 A;  2BE5 F;  2J45 A;  2B0J A;  1OR2 A;  2XXA B;  1ZHX A;  1TQG A;  2Y3G A;  1M6T A;  1SMY F;  3LUT B;  1C17 M;  1VOM A;  2C03 A;  4Z9H A;  4ANJ A;  5DS4 A;  3PDM P;  2Q9C A;  2ZD9 A;  4PJM A;  4DJ9 A;  1GS9 A;  3G4Z A;  2AWC A;  3HKK A;  4O6N A;  4DRJ B;  5A6B A;  1CPQ A;  2V26 A;  2YZS A;  1ZHT A;  1T5O A;  2XLE A;  1M2V A;  2L6H A;  1NFN A;  4G7Z F;  4CDV A;  4JTD B;  1NU7 D;  4XEK A;  2YKZ A;  4PK4 A;  3LEO A;  3UMH A;  3HNI A;  3LS1 A;  5T1D B;  4EWC A;  2CGE A;  5JT4 A;  3DJU B;  2KYH A;  4AL0 A;  4XLP F;  3X2Q C;  3EG9 A;  2DYR C;  2R05 A;  1AUE A;  2L81 A;  2Z15 A;  2KNH A;  1H9T A;  3W8H A;  2HMQ A;  1NU9 C;  2DYS C;  4JVS A;  4D4N A;  4G0H A;  1ZHZ A;  3HNL A;  1I5N A;  3J06 A;  1V74 B;  5FZT A;  3WOD F;  4WJ0 A;  4YN0 B;  1ZW3 A;  3RQF A;  4BJ6 C;  4CS9 A;  3LAY A;  1A7E A;  3TJ6 A;  3B0V C;  4DRI B;  3TUL A;  1CGM E;  2IXO A;  5DS5 A;  3U8V A;  4KNV A;  2AVK A;  3AGT A;  1M2V B;  1KU2 A;  4JJG A;  3EHN A;  2R03 A;  4YL3 A;  2IBF A;  2XM0 A;  2OQM A;  2YL0 A;  3WAQ A;  4E7S A;  4AK9 A;  4Z9I A;  2CCY A;  2EIK C;  3EG9 B;  2Q9B A;  1YA7 O;  3FHD A;  4EBB A;  3RFY A;  3ZG1 A;  4G7O F;  2YRF A;  2JD3 A;  3W2W A;  1LVK A;  4AX2 A;  5JUA A;  2W9Y A;  5D91 A;  4O6M A;  5E33 A;  5FCL A;  2LIG A;  3GOD A;  3NMI A;  3M4C A;  4U5C E;  4I1O B;  5A6B D;  3L34 A;  3V5Y A;  3K1I A;  4MVQ A;  3RW0 A;  1OR3 A;  4U5H A;  2HKV A;  2XS1 A;  2ASR A;  3DM5 A;  3GM1 A;  1K05 A;  4D4X A;  4EBK A;  2V3C C;  3IPM O;  4FWV A;  3SYN A;  3Q6N A;  2VAS A;  1FAP B;  1RJ9 A;  1C03 A;  3QVY A;  3M4B A;  2Q00 A;  5B3I A;  1QQ3 A;  2KGO A;  1LS4 A;  1FTS A;  1NBB A;  4JTA B;  4C7O A;  4BJ5 A;  4YT5 A;  1WAS A;  4LLE A;  2W45 A;  1N1C A;  3E70 C;  4CS8 C;  1I4Z A;  3MFN A;  3NMJ A;  3POV A;  1EKY A;  4NY3 A;  1APC A;  4BEJ A;  4QI0 A;  2M4E A;  3B9Q A;  1L7C A;  2VB6 A;  3DI5 A;  4IGG A;  2JPU A;  5DS6 A;  4NTB A;  1R4T A;  4YL1 A;  3EQL F;  2IXM A;  3EH1 A;  3ZDL A;  3GEE A;  1BR1 A;  1B68 A;  1JR8 A;  1YZC A;  1G8X A;  3EJN A;  1RJ9 B;  2R7X A;  1VLS A;  4GQH A;  4XPX A;  2J9W A;  3LS0 A;  1GQA A;  3U2M A;  4YK5 A;  4JRZ A;  4J32 B;  3LJB A;  1VB5 A;  4XPY A;  3PHF 2;  1CGN A;  5JRA A;  3M15 A;  3N2Z B;  3SXK A;  4CSA A;  2WVQ A;  3UGO A;  3KMI A;  4LER A;  5HSW A;  1T6Q A;  3JYY A;  5K0I A;  3KKB A;  4MND A;  4K7B A;  2VCA A;  3T6G B;  1OXB A;  1PV3 A;  2P6V A;  2QTV A;  3JYH A;  3LLK A;  3M79 A;  2HUJ A;  1JRA A;  4XEF A;  3RF3 A;  3ZSU A;  5L0I A;  4KBL A;  1MMN A;  1ZU5 A;  3ABL C;  3MLG A;  1AVO B;  3T4R A;  1TWH A;  1Y6D A;  4NQF A;  4OIQ F;  3QZC A;  4JZA A;  3KPH A;  2WVN A;  3JRT A;  2OG2 A;  2G3K A;  1RKE B;  3TK0 A;  1ORJ A;  2PNO A;  4BJT A;  2MYS A;  2FGY A;  1S05 A;  1YAU O;  2P7V A;  3LEV A;  1Z23 A;  2XM4 A;  2CDQ A;  3FXH A;  2D5R B;  2YL1 A;  3ABM C;  3TD7 A;  4YWQ A;  4CJG A;  2ZXO A;  3CZ6 A;  3O6X A;  4EUK B;  1E85 A;  1VMA A;  1GGQ A;  2R7R A;  3V5Z A;  3B0U X;  1I4Y A;  5B1A C;  4WGY A;  3R2P A;  5DQZ A;  1KTM A;  2B0H A;  3UNG C;  3WHN A;  2IYL D;  3KYJ A;  2J9B A;  3T6J A;  1T6I A;  3AG2 C;  3MYF A;  4JJF A;  1KNY A;  2ICW G;  4N6C A;  5KYY B;  3US6 A;  3ECS A;  4EKW A;  1LI5 A;  3H65 A;  2XL4 A;  4YT2 A;  1JAF A;  4E17 A;  4MTG A;  1BZ4 A;  2J7P A;  5JS5 A;  1Q0M A;  4QDL A;  1QPU A;  1SZI A;  2F22 A;  2KK1 A;  3K1H A;  1ZW2 A;  3M1C B;  1LE2 A;  5L0J A;  1G4U S;  4HEA J;  2LFF A;  1PCX A;  1HW1 A;  4FES A;  1ORS C;  3K66 A;  4BG0 A;  2R02 A;  4LDQ A;  4E0I A;  3E9V A;  1V55 C;  3G50 A;  4Q5S F;  2GA0 A;  2GDC A;  4MTF A;  5JSL A;  4ULW A;  4XTK A;  1IZM A;  2HSQ A;  4NCQ A;  2ETS A;  3CSK A;  4N6H A;  2OJQ A;  5L0D A;  2FFH A;  1XZQ A;  2NUP A;  3Q7G A;  2X0C A;  5IY5 C;  4W8P A;  1MMD A;  2ZPA A;  1EA8 A;  2EPL X;  2QNL A;  4DVZ A;  3IEE A;  1DOV A;  3ASN C;  1Z5Z A;  3IHU A;  2EIM C;  2C04 A;  3VF0 A;  1ZVZ A;  3HNK A;  2VC9 A;  2QE9 A;  1RCP A;  4RDA A;  2MHR A;  2LQG A;  1OCO C;  2XS8 A;  4LAC B;  3VRC A;  1LPE A;  4CS8 A;  3NMK A;  1BBH A;  3B0P A;  2HFI A;  3C62 A;  2NPU A;  2I15 A;  1Q0D A;  2QUP A;  3AJM A;  3L8J A;  3NKD A;  3C8G A;  4AL1 A;  3HTK C;  4DBQ A;  4YT8 A;  2J9V A;  5BQI A;  1L3P A;  2WZG A;  2HV7 A;  3AOU A;  1YVI A;  1A41 A;  4MVO A;  4U9D A;  2J7P D;  4ZLC A;  3UGP A;  2Y69 C;  2NUP B;  5EK0 A;  3MYI A;  4E7Z A;  4ZLD A;  3IQ6 A;  3UMI A;  3A11 A;  3FOP A;  1H6G A;  4G78 A;  5JVE A;  2J9U A;  2OCC C;  4OIP F;  3L0I A;  4CDY A;  1MND A;  2VCB A;  5BQG A;  5T3W A;  4E18 A;  1S7Z A;  3TQO A;  3I5Q A;  4CIH A;  2R7V A;  1U6H A;  2WZF A;  1NLX A;  4KI2 A;  3W2V A;  3BRJ A;  1OW6 A;  4U5B E;  4LDR A;  1O87 A;  2Y3H A;  2YL7 A;  1MMA A; 
#chains in the Genus database with same CATH homology
 1YZC A;  2XLO A;  4CIP A;  1A7V A;  1LM3 B;  1GQA A;  1YYJ A;  2XLD A;  2XL6 A;  1CGN A;  3C63 A;  3M15 A;  5JRA A;  1YZA A;  4IB4 A;  4U9E A;  1CGO A;  4JEB A;  3M79 A;  4JEA A;  3QW1 A;  1E86 A;  5JLI A;  3QVZ A;  4ER9 A;  1CPR A;  3TOM A;  2XL8 A;  4CDA A;  3U8P A;  4NC3 A;  3QW0 A;  4IAQ A;  1S05 A;  256B A;  2XM4 A;  2YL1 A;  4CJG A;  1M6T A;  3DE9 A;  1E85 A;  4WGY A;  4JKV A;  4CJO A;  1CPQ A;  2J9B A;  2XLE A;  2YLI A;  4CDV A;  2YKZ A;  5JT4 A;  3HNI A;  4WGZ A;  2XLV A;  1JAF A;  3DE8 A;  4D4N A;  3HNL A;  5JS5 A;  1QPU A;  2YLD A;  1MQV A;  4JE9 A;  4N4W A;  1E83 A;  3L1M A;  4CX9 A;  2YL3 A;  5JSL A;  2XM0 A;  2YL0 A;  4N6H A;  3ZTZ A;  4IAR A;  2CCY A;  3HNJ A;  4EIY A;  3ZWI A;  4L6R A;  5JUA A;  5JP7 A;  3HNK A;  3NMI A;  3M4C A;  3FOO A;  4D4X A;  2XLH A;  3VRC A;  1E84 A;  3NMK A;  1BBH A;  3QVY A;  2YLG A;  3C62 A;  3M4B A;  5B3I A;  1QQ3 A;  2XLM A;  3ZQY A;  2QLA A;  4U9D A;  1NBB A;  2XLW A;  3ZQV A;  2BC5 A;  1YYX A;  3IQ6 A;  3TOL A;  3FOP A;  5JVE A;  4ULV A;  3NMJ A;  1EKY A;  4CDY A;  2J8W A;  1APC A;  3IQ5 A;  5AGF A;  3ZTM A;  2YL7 A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...