3ZR0A

Crystal structure of human mth1 in complex with 8-oxo-dgmp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
154
Chain Sequence
b'ASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-8-OXOGUANINE TRIPHOSPHATASE
publication title Crystal Structure of Human Mth1 and the 8-Oxo-Dgmp Product Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 40
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3zr0A00
1X84A 3A6TA 1NFZA 2DSDA 3I7UA 4MPOA 3COUA 4ICKA 1NFSA 3H95A 3ZR1A 1V8IA 1NQYA 1V8LA 3E57A 1MR2A 3SHDA 4JZUA 3GZ6A 4K6EA 1U20A 2Q9PA 3A6SA 1KTGA 3GWYA 3HYQA 3N9UA 1V8VA 1V8NA 3BM4A 3J7Ye 1VC9A 3O6ZA 1SZ3A 3CNGA 1RRSA 3GZ5A 3GRNA 3FJYA 3X0IA 4YPRA 1VCDA 2A8QA 1KT9A 2DUKA 2QKMB 3EESA 3DKUA 5GHPA 5GHIA 3X0RA 5ANUA 3X0NA 1I9AA 5C8LA 5CFJA 4YOQA 2YVNA 1HZTA 1X51A 2DSCA 3P5TA 2I6KA 3G0QA 3P6YA 1K2EA 5DD4A 1SU2A 1JKNA 2B06A 2A8SA 1VIQA 5GHJA 1VIUA 2O5WA 3MGMA 4N1TA 5DEQA 1Q27A 3HHJA 3X0MA 5DPKA 5ANVA 4S2WA 1MP2A 2B2KA 3RH7A 1MQEA 3A6UA 1NQZA 3FK9A 3SONA 3WHWA 3SMDA 3X0PA 3I9XA 3GG6A 4JZSA 2YYHA 3BHOA 1KHZA 2CL3A 4KYXA 3DUPA 4DYWA 1VK6A 2R5WA 2FMLA 3Q93A 5ANSA 2XSQA 2PQVA 1IRYA 3X0OA 2VNPA 4IJXA 2I8TA 4C9XA 1K26A 2VNQA 5LPGA 1V8MA 1PUSA 4NFWA 3MDIA 1MQWA 1X83A 3BAPA 3F13A 1VHGA 3O52A 3O69A 2ICKA 3F6AA 3Q2TA 2A8TA 3R03A 3X0KA 5BONA 1PPVA 1R67A 3L85A 3FSPA 2O1CA 5ANTA 5FSLA 2KDWA 2G73A 3FFUA 1Q54A 4KG3A 5CFIA 2G74A 5FSIA 3ZR0A 1SOIA 2YVPA 3EXQA 4HFQA 5GHQA 1RRQA 1HX3A 5FSOA 2GT2A 3X0QA 1TUMA 3Q2SA 5IW5A 2FVVA 4S2XA 1F3YA 3FCMA 1G9QA 3O8SA 3Q91A 2PNYA 2FKBA 3QSJA 2AZWA 1VHZA 3EEUA 3I7VA 5C7QA 1OW2A 3AC9A 2DSBA 1MUTA 3N77A 3MCFA 5GHOA 2JVBA 2W4EA 5FSNA 2A8PA 1VC8A 1V8SA 1V8WA 2A8RA 1XSAA 4ILQA 1SJYA 1QVJA 3X0JA 4HVYA 5IW4A 3OGAA 3A6VA 3ID9A 2I8UA 2RRKA 1MK1A 2DHOA 2A6TA 2ICJA 4KTBA 4ZG0A 3Q1PA 3ACAA 5BS6A 1Q33A 3EF5A 5GHNA 5GHMA 5FSKA 2J8QA 5I8UA 2QJOA 4S2VA 1V8UA 4JZTA 3X0LA 2O5FA 1V8TA 3O61A 5C7TA 1V8RA 3U53A 3X0SA 1GA7A 2KDVA 3KVHA 5ANWA 4C9WA 3MDGA 2YVOA 1RYAA 1XSBA 3GZ8A 5DDGA 4YPHA 2GT4A 1PPXA 4N1UA 1JRKA 1VRLA 2GB5A 4V14A 2B0VA 4NFXA 1XSCA 5FSMA 1PVFA 2QJTA 1PUQA 4KG4A 3Q4IA 5HZXA 4S2YA 4JZVA 1G0SA 5ISYA 1PUNA 1V8YA 1PPWA 2YVMA
chains in the Genus database with same CATH superfamily
1X84A 3A6TA 1NFZA 2DSDA 3I7UA 4MPOA 3COUA 4ICKA 1NFSA 3H95A 3ZR1A 1V8IA 1NQYA 1V8LA 3E57A 1MR2A 3SHDA 4JZUA 3GZ6A 4K6EA 1U20A 2Q9PA 3A6SA 1KTGA 3GWYA 3HYQA 3N9UA 1V8VA 1V8NA 3BM4A 3J7Ye 1VC9A 3O6ZA 1SZ3A 3CNGA 1RRSA 3GZ5A 3GRNA 3FJYA 3X0IA 4YPRA 1VCDA 2A8QA 1KT9A 2DUKA 2QKMB 3EESA 3DKUA 5GHPA 5GHIA 3X0RA 5ANUA 3X0NA 1I9AA 5C8LA 5CFJA 4YOQA 2YVNA 1HZTA 1X51A 2DSCA 3P5TA 2I6KA 3G0QA 3P6YA 1K2EA 5DD4A 1SU2A 1JKNA 2B06A 2A8SA 1VIQA 5GHJA 1VIUA 2O5WA 3MGMA 4N1TA 5DEQA 1Q27A 3HHJA 3X0MA 5DPKA 5ANVA 4S2WA 1MP2A 2B2KA 3RH7A 1MQEA 3A6UA 1NQZA 3FK9A 3SONA 3WHWA 3SMDA 3X0PA 3I9XA 3GG6A 4JZSA 4J7GA 2YYHA 3BHOA 1KHZA 2CL3A 4KYXA 3DUPA 4DYWA 1VK6A 2R5WA 2FMLA 3Q93A 5ANSA 2XSQA 2PQVA 1IRYA 3X0OA 2VNPA 4IJXA 2I8TA 4C9XA 1K26A 2VNQA 5LPGA 1V8MA 1PUSA 4NFWA 3MDIA 1MQWA 1X83A 3BAPA 3F13A 1VHGA 3O52A 3O69A 2ICKA 3F6AA 3Q2TA 2A8TA 3R03A 3X0KA 5BONA 1PPVA 1R67A 3L85A 3FSPA 2O1CA 5ANTA 5FSLA 2KDWA 2G73A 3FFUA 1Q54A 4KG3A 5CFIA 2G74A 5FSIA 3ZR0A 1SOIA 2YVPA 3EXQA 4HFQA 5GHQA 1RRQA 1HX3A 5FSOA 2GT2A 3X0QA 1TUMA 3Q2SA 5IW5A 2FVVA 4S2XA 1F3YA 3FCMA 1G9QA 3O8SA 3Q91A 2PNYA 2FKBA 3QSJA 2AZWA 1VHZA 3EEUA 3I7VA 5C7QA 1OW2A 3AC9A 2DSBA 1MUTA 3N77A 3MCFA 4J7HA 2JVBA 5GHOA 2W4EA 5FSNA 2CZRA 2A8PA 1VC8A 1V8SA 1V8WA 2A8RA 1XSAA 4ILQA 1SJYA 1QVJA 3X0JA 4HVYA 5IW4A 3OGAA 3A6VA 3ID9A 2I8UA 2RRKA 1MK1A 2DHOA 2A6TA 2ICJA 4KTBA 4ZG0A 3Q1PA 3ACAA 5BS6A 1Q33A 3EF5A 5GHNA 5GHMA 5FSKA 2J8QA 5I8UA 2QJOA 4S2VA 1V8UA 4JZTA 3X0LA 2O5FA 1V8TA 3O61A 5C7TA 1V8RA 3U53A 3X0SA 1GA7A 2KDVA 3KVHA 5ANWA 4C9WA 3MDGA 2YVOA 1RYAA 1XSBA 3GZ8A 5DDGA 4YPHA 2GT4A 1PPXA 4N1UA 1JRKA 1VRLA 2GB5A 4V14A 2B0VA 4NFXA 1XSCA 5FSMA 1PVFA 2QJTA 1PUQA 4KG4A 3Q4IA 5HZXA 4S2YA 4JZVA 1G0SA 5ISYA 1PUNA 1V8YA 1PPWA 2YVMA
chains in the Genus database with same CATH topology
1X84A 3A6TA 1NFZA 2DSDA 3I7UA 4MPOA 3COUA 4ICKA 1NFSA 3H95A 3ZR1A 1V8IA 1NQYA 1V8LA 3E57A 1MR2A 3SHDA 4JZUA 3GZ6A 4K6EA 1U20A 2Q9PA 3A6SA 1KTGA 3GWYA 3HYQA 3N9UA 1V8VA 1V8NA 3BM4A 3J7Ye 1VC9A 3O6ZA 1SZ3A 3CNGA 1RRSA 3GZ5A 3GRNA 3FJYA 3X0IA 4YPRA 1VCDA 2A8QA 1KT9A 2DUKA 2QKMB 3EESA 3DKUA 5GHPA 5GHIA 3X0RA 5ANUA 3X0NA 1I9AA 5C8LA 5CFJA 4YOQA 2YVNA 1HZTA 1X51A 2DSCA 3P5TA 2I6KA 3G0QA 3P6YA 1K2EA 5DD4A 1SU2A 1JKNA 2B06A 2A8SA 1VIQA 5GHJA 1VIUA 2O5WA 3MGMA 4N1TA 5DEQA 1Q27A 3HHJA 3X0MA 5DPKA 5ANVA 4S2WA 1MP2A 2B2KA 3RH7A 1MQEA 3A6UA 1NQZA 3FK9A 3SONA 3WHWA 3SMDA 3X0PA 3I9XA 3GG6A 4JZSA 4J7GA 2YYHA 3BHOA 1KHZA 2CL3A 4KYXA 3DUPA 4DYWA 1VK6A 2R5WA 2FMLA 3Q93A 5ANSA 2XSQA 2PQVA 1IRYA 3X0OA 2VNPA 4IJXA 2I8TA 4C9XA 1K26A 2VNQA 5LPGA 1V8MA 1PUSA 4NFWA 3MDIA 1MQWA 1X83A 3BAPA 3F13A 1VHGA 3O52A 3O69A 2ICKA 3F6AA 3Q2TA 2A8TA 3R03A 3X0KA 5BONA 1PPVA 1R67A 3L85A 3FSPA 2O1CA 5ANTA 5FSLA 2KDWA 2G73A 3FFUA 1Q54A 4KG3A 5CFIA 2G74A 5FSIA 3ZR0A 1SOIA 2YVPA 3EXQA 4HFQA 5GHQA 1RRQA 1HX3A 5FSOA 2GT2A 3X0QA 1TUMA 3Q2SA 5IW5A 2FVVA 4S2XA 1F3YA 3FCMA 1G9QA 3O8SA 3Q91A 2PNYA 2FKBA 3QSJA 2AZWA 1VHZA 3EEUA 3I7VA 5C7QA 1OW2A 3AC9A 2DSBA 1MUTA 3N77A 3MCFA 4J7HA 2JVBA 5GHOA 2W4EA 5FSNA 2CZRA 2A8PA 1VC8A 1V8SA 1V8WA 2A8RA 1XSAA 4ILQA 1SJYA 1QVJA 3X0JA 4HVYA 5IW4A 3OGAA 3A6VA 3ID9A 2I8UA 2RRKA 1MK1A 2DHOA 2A6TA 2ICJA 4KTBA 4ZG0A 3Q1PA 3ACAA 5BS6A 1Q33A 3EF5A 5GHNA 5GHMA 5FSKA 2J8QA 5I8UA 2QJOA 4S2VA 1V8UA 4JZTA 3X0LA 2O5FA 1V8TA 3O61A 5C7TA 1V8RA 3U53A 3X0SA 1GA7A 2KDVA 3KVHA 5ANWA 4C9WA 3MDGA 2YVOA 1RYAA 1XSBA 3GZ8A 5DDGA 4YPHA 2GT4A 1PPXA 4N1UA 1JRKA 1VRLA 2GB5A 4V14A 2B0VA 4NFXA 1XSCA 5FSMA 1PVFA 2QJTA 1PUQA 4KG4A 3Q4IA 5HZXA 4S2YA 4JZVA 1G0SA 5ISYA 1PUNA 1V8YA 1PPWA 2YVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X84 A;  3A6T A;  1NFZ A;  2DSD A;  3I7U A;  4MPO A;  3COU A;  4ICK A;  1NFS A;  3H95 A;  3ZR1 A;  1V8I A;  1NQY A;  1V8L A;  3E57 A;  1MR2 A;  3SHD A;  4JZU A;  3GZ6 A;  4K6E A;  1U20 A;  2Q9P A;  3A6S A;  1KTG A;  3GWY A;  3HYQ A;  3N9U A;  1V8V A;  1V8N A;  3BM4 A;  3J7Y e;  1VC9 A;  3O6Z A;  1SZ3 A;  3CNG A;  1RRS A;  3GZ5 A;  3GRN A;  3FJY A;  3X0I A;  4YPR A;  1VCD A;  2A8Q A;  1KT9 A;  2DUK A;  2QKM B;  3EES A;  3DKU A;  5GHP A;  5GHI A;  3X0R A;  5ANU A;  3X0N A;  1I9A A;  5C8L A;  5CFJ A;  4YOQ A;  2YVN A;  1HZT A;  1X51 A;  2DSC A;  3P5T A;  2I6K A;  3G0Q A;  3P6Y A;  1K2E A;  5DD4 A;  1SU2 A;  1JKN A;  2B06 A;  2A8S A;  1VIQ A;  5GHJ A;  1VIU A;  2O5W A;  3MGM A;  4N1T A;  5DEQ A;  1Q27 A;  3HHJ A;  3X0M A;  5DPK A;  5ANV A;  4S2W A;  1MP2 A;  2B2K A;  3RH7 A;  1MQE A;  3A6U A;  1NQZ A;  3FK9 A;  3SON A;  3WHW A;  3SMD A;  3X0P A;  3I9X A;  3GG6 A;  4JZS A;  2YYH A;  3BHO A;  1KHZ A;  2CL3 A;  4KYX A;  3DUP A;  4DYW A;  1VK6 A;  2R5W A;  2FML A;  3Q93 A;  5ANS A;  2XSQ A;  2PQV A;  1IRY A;  3X0O A;  2VNP A;  4IJX A;  2I8T A;  4C9X A;  1K26 A;  2VNQ A;  5LPG A;  1V8M A;  1PUS A;  4NFW A;  3MDI A;  1MQW A;  1X83 A;  3BAP A;  3F13 A;  1VHG A;  3O52 A;  3O69 A;  2ICK A;  3F6A A;  3Q2T A;  2A8T A;  3R03 A;  3X0K A;  5BON A;  1PPV A;  1R67 A;  3L85 A;  3FSP A;  2O1C A;  5ANT A;  5FSL A;  2KDW A;  2G73 A;  3FFU A;  1Q54 A;  4KG3 A;  5CFI A;  2G74 A;  5FSI A;  3ZR0 A;  1SOI A;  2YVP A;  3EXQ A;  4HFQ A;  5GHQ A;  1RRQ A;  1HX3 A;  5FSO A;  2GT2 A;  3X0Q A;  1TUM A;  3Q2S A;  5IW5 A;  2FVV A;  4S2X A;  1F3Y A;  3FCM A;  1G9Q A;  3O8S A;  3Q91 A;  2PNY A;  2FKB A;  3QSJ A;  2AZW A;  1VHZ A;  3EEU A;  3I7V A;  5C7Q A;  1OW2 A;  3AC9 A;  2DSB A;  1MUT A;  3N77 A;  3MCF A;  5GHO A;  2JVB A;  2W4E A;  5FSN A;  2A8P A;  1VC8 A;  1V8S A;  1V8W A;  2A8R A;  1XSA A;  4ILQ A;  1SJY A;  1QVJ A;  3X0J A;  4HVY A;  5IW4 A;  3OGA A;  3A6V A;  3ID9 A;  2I8U A;  2RRK A;  1MK1 A;  2DHO A;  2A6T A;  2ICJ A;  4KTB A;  4ZG0 A;  3Q1P A;  3ACA A;  5BS6 A;  1Q33 A;  3EF5 A;  5GHN A;  5GHM A;  5FSK A;  2J8Q A;  5I8U A;  2QJO A;  4S2V A;  1V8U A;  4JZT A;  3X0L A;  2O5F A;  1V8T A;  3O61 A;  5C7T A;  1V8R A;  3U53 A;  3X0S A;  1GA7 A;  2KDV A;  3KVH A;  5ANW A;  4C9W A;  3MDG A;  2YVO A;  1RYA A;  1XSB A;  3GZ8 A;  5DDG A;  4YPH A;  2GT4 A;  1PPX A;  4N1U A;  1JRK A;  1VRL A;  2GB5 A;  4V14 A;  2B0V A;  4NFX A;  1XSC A;  5FSM A;  1PVF A;  2QJT A;  1PUQ A;  4KG4 A;  3Q4I A;  5HZX A;  4S2Y A;  4JZV A;  1G0S A;  5ISY A;  1PUN A;  1V8Y A;  1PPW A;  2YVM A; 
#chains in the Genus database with same CATH topology
 1X84 A;  3A6T A;  1NFZ A;  2DSD A;  3I7U A;  4MPO A;  3COU A;  4ICK A;  1NFS A;  3H95 A;  3ZR1 A;  1V8I A;  1NQY A;  1V8L A;  3E57 A;  1MR2 A;  3SHD A;  4JZU A;  3GZ6 A;  4K6E A;  1U20 A;  2Q9P A;  3A6S A;  1KTG A;  3GWY A;  3HYQ A;  3N9U A;  1V8V A;  1V8N A;  3BM4 A;  3J7Y e;  1VC9 A;  3O6Z A;  1SZ3 A;  3CNG A;  1RRS A;  3GZ5 A;  3GRN A;  3FJY A;  3X0I A;  4YPR A;  1VCD A;  2A8Q A;  1KT9 A;  2DUK A;  2QKM B;  3EES A;  3DKU A;  5GHP A;  5GHI A;  3X0R A;  5ANU A;  3X0N A;  1I9A A;  5C8L A;  5CFJ A;  4YOQ A;  2YVN A;  1HZT A;  1X51 A;  2DSC A;  3P5T A;  2I6K A;  3G0Q A;  3P6Y A;  1K2E A;  5DD4 A;  1SU2 A;  1JKN A;  2B06 A;  2A8S A;  1VIQ A;  5GHJ A;  1VIU A;  2O5W A;  3MGM A;  4N1T A;  5DEQ A;  1Q27 A;  3HHJ A;  3X0M A;  5DPK A;  5ANV A;  4S2W A;  1MP2 A;  2B2K A;  3RH7 A;  1MQE A;  3A6U A;  1NQZ A;  3FK9 A;  3SON A;  3WHW A;  3SMD A;  3X0P A;  3I9X A;  3GG6 A;  4JZS A;  4J7G A;  2YYH A;  3BHO A;  1KHZ A;  2CL3 A;  4KYX A;  3DUP A;  4DYW A;  1VK6 A;  2R5W A;  2FML A;  3Q93 A;  5ANS A;  2XSQ A;  2PQV A;  1IRY A;  3X0O A;  2VNP A;  4IJX A;  2I8T A;  4C9X A;  1K26 A;  2VNQ A;  5LPG A;  1V8M A;  1PUS A;  4NFW A;  3MDI A;  1MQW A;  1X83 A;  3BAP A;  3F13 A;  1VHG A;  3O52 A;  3O69 A;  2ICK A;  3F6A A;  3Q2T A;  2A8T A;  3R03 A;  3X0K A;  5BON A;  1PPV A;  1R67 A;  3L85 A;  3FSP A;  2O1C A;  5ANT A;  5FSL A;  2KDW A;  2G73 A;  3FFU A;  1Q54 A;  4KG3 A;  5CFI A;  2G74 A;  5FSI A;  3ZR0 A;  1SOI A;  2YVP A;  3EXQ A;  4HFQ A;  5GHQ A;  1RRQ A;  1HX3 A;  5FSO A;  2GT2 A;  3X0Q A;  1TUM A;  3Q2S A;  5IW5 A;  2FVV A;  4S2X A;  1F3Y A;  3FCM A;  1G9Q A;  3O8S A;  3Q91 A;  2PNY A;  2FKB A;  3QSJ A;  2AZW A;  1VHZ A;  3EEU A;  3I7V A;  5C7Q A;  1OW2 A;  3AC9 A;  2DSB A;  1MUT A;  3N77 A;  3MCF A;  4J7H A;  2JVB A;  5GHO A;  2W4E A;  5FSN A;  2CZR A;  2A8P A;  1VC8 A;  1V8S A;  1V8W A;  2A8R A;  1XSA A;  4ILQ A;  1SJY A;  1QVJ A;  3X0J A;  4HVY A;  5IW4 A;  3OGA A;  3A6V A;  3ID9 A;  2I8U A;  2RRK A;  1MK1 A;  2DHO A;  2A6T A;  2ICJ A;  4KTB A;  4ZG0 A;  3Q1P A;  3ACA A;  5BS6 A;  1Q33 A;  3EF5 A;  5GHN A;  5GHM A;  5FSK A;  2J8Q A;  5I8U A;  2QJO A;  4S2V A;  1V8U A;  4JZT A;  3X0L A;  2O5F A;  1V8T A;  3O61 A;  5C7T A;  1V8R A;  3U53 A;  3X0S A;  1GA7 A;  2KDV A;  3KVH A;  5ANW A;  4C9W A;  3MDG A;  2YVO A;  1RYA A;  1XSB A;  3GZ8 A;  5DDG A;  4YPH A;  2GT4 A;  1PPX A;  4N1U A;  1JRK A;  1VRL A;  2GB5 A;  4V14 A;  2B0V A;  4NFX A;  1XSC A;  5FSM A;  1PVF A;  2QJT A;  1PUQ A;  4KG4 A;  3Q4I A;  5HZX A;  4S2Y A;  4JZV A;  1G0S A;  5ISY A;  1PUN A;  1V8Y A;  1PPW A;  2YVM A; 
#chains in the Genus database with same CATH homology
 1X84 A;  3A6T A;  1NFZ A;  2DSD A;  3I7U A;  4MPO A;  3COU A;  4ICK A;  1NFS A;  3H95 A;  3ZR1 A;  1V8I A;  1NQY A;  1V8L A;  3E57 A;  1MR2 A;  3SHD A;  4JZU A;  3GZ6 A;  4K6E A;  1U20 A;  2Q9P A;  3A6S A;  1KTG A;  3GWY A;  3HYQ A;  3N9U A;  1V8V A;  1V8N A;  3BM4 A;  3J7Y e;  1VC9 A;  3O6Z A;  1SZ3 A;  3CNG A;  1RRS A;  3GZ5 A;  3GRN A;  3FJY A;  3X0I A;  4YPR A;  1VCD A;  2A8Q A;  1KT9 A;  2DUK A;  2QKM B;  3EES A;  3DKU A;  5GHP A;  5GHI A;  3X0R A;  5ANU A;  3X0N A;  1I9A A;  5C8L A;  5CFJ A;  4YOQ A;  2YVN A;  1HZT A;  1X51 A;  2DSC A;  3P5T A;  2I6K A;  3G0Q A;  3P6Y A;  1K2E A;  5DD4 A;  1SU2 A;  1JKN A;  2B06 A;  2A8S A;  1VIQ A;  5GHJ A;  1VIU A;  2O5W A;  3MGM A;  4N1T A;  5DEQ A;  1Q27 A;  3HHJ A;  3X0M A;  5DPK A;  5ANV A;  4S2W A;  1MP2 A;  2B2K A;  3RH7 A;  1MQE A;  3A6U A;  1NQZ A;  3FK9 A;  3SON A;  3WHW A;  3SMD A;  3X0P A;  3I9X A;  3GG6 A;  4JZS A;  4J7G A;  2YYH A;  3BHO A;  1KHZ A;  2CL3 A;  4KYX A;  3DUP A;  4DYW A;  1VK6 A;  2R5W A;  2FML A;  3Q93 A;  5ANS A;  2XSQ A;  2PQV A;  1IRY A;  3X0O A;  2VNP A;  4IJX A;  2I8T A;  4C9X A;  1K26 A;  2VNQ A;  5LPG A;  1V8M A;  1PUS A;  4NFW A;  3MDI A;  1MQW A;  1X83 A;  3BAP A;  3F13 A;  1VHG A;  3O52 A;  3O69 A;  2ICK A;  3F6A A;  3Q2T A;  2A8T A;  3R03 A;  3X0K A;  5BON A;  1PPV A;  1R67 A;  3L85 A;  3FSP A;  2O1C A;  5ANT A;  5FSL A;  2KDW A;  2G73 A;  3FFU A;  1Q54 A;  4KG3 A;  5CFI A;  2G74 A;  5FSI A;  3ZR0 A;  1SOI A;  2YVP A;  3EXQ A;  4HFQ A;  5GHQ A;  1RRQ A;  1HX3 A;  5FSO A;  2GT2 A;  3X0Q A;  1TUM A;  3Q2S A;  5IW5 A;  2FVV A;  4S2X A;  1F3Y A;  3FCM A;  1G9Q A;  3O8S A;  3Q91 A;  2PNY A;  2FKB A;  3QSJ A;  2AZW A;  1VHZ A;  3EEU A;  3I7V A;  5C7Q A;  1OW2 A;  3AC9 A;  2DSB A;  1MUT A;  3N77 A;  3MCF A;  4J7H A;  2JVB A;  5GHO A;  2W4E A;  5FSN A;  2CZR A;  2A8P A;  1VC8 A;  1V8S A;  1V8W A;  2A8R A;  1XSA A;  4ILQ A;  1SJY A;  1QVJ A;  3X0J A;  4HVY A;  5IW4 A;  3OGA A;  3A6V A;  3ID9 A;  2I8U A;  2RRK A;  1MK1 A;  2DHO A;  2A6T A;  2ICJ A;  4KTB A;  4ZG0 A;  3Q1P A;  3ACA A;  5BS6 A;  1Q33 A;  3EF5 A;  5GHN A;  5GHM A;  5FSK A;  2J8Q A;  5I8U A;  2QJO A;  4S2V A;  1V8U A;  4JZT A;  3X0L A;  2O5F A;  1V8T A;  3O61 A;  5C7T A;  1V8R A;  3U53 A;  3X0S A;  1GA7 A;  2KDV A;  3KVH A;  5ANW A;  4C9W A;  3MDG A;  2YVO A;  1RYA A;  1XSB A;  3GZ8 A;  5DDG A;  4YPH A;  2GT4 A;  1PPX A;  4N1U A;  1JRK A;  1VRL A;  2GB5 A;  4V14 A;  2B0V A;  4NFX A;  1XSC A;  5FSM A;  1PVF A;  2QJT A;  1PUQ A;  4KG4 A;  3Q4I A;  5HZX A;  4S2Y A;  4JZV A;  1G0S A;  5ISY A;  1PUN A;  1V8Y A;  1PPW A;  2YVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...