3ZR5A

Structure of galactocerebrosidase from mouse
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into Krabbe Disease from Structures of Galactocerebrosidase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 218
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zr5A01
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3zr5A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zr5A02
1ZJAA 1H3GA 2F8QA 1LJYA 3ZOAA 1BYAA 1C90A 1GVYA 1MQQA 3LXCA 3WBAA 4ACZB 2WSPA 3TA9A 4AD4A 4NZFA 1CPUA 1KWGA 4J3UA 4MAVA 5IFTA 3H3LA 3VMNA 4P7OA 4BF7A 4PTMA 5FK8A 1KR0A 2WVSA 1VFMA 1H41A 3VIHA 5D8ZA 5ABFB 4AIUA 5DFAA 2F2HA 4RL3A 4PSRA 1H2JA 3EBVA 3WDIA 3BMWA 3TV8A 2YBUA 1CXKA 1UH3A 1GOKA 1LG2A 2WMIA 2DH2A 4Q7NA 4FFFA 3HJEA 2D24A 5AYBA 5IDIA 1W2PA 4X9YA 2VC9A 1ESWA 3A4XA 2CITA 3RIKA 1O7AA 3WKZA 1F4AA 3AIRA 4UQEA 4Y7EA 2CCRA 3AXXA 4QDMA 1MXGA 1QNRA 1V0LA 3EMZA 3FAWA 4AZCB 5A95A 2G3MA 3WENA 1B3WA 2J8FA 4CD4A 3PIGA 5CSUA 3WNOA 1E6XM 1J0YA 1US2A 2XM1A 2UWFA 3FXYA 3S2CA 4PYSA 3F5KA 3GNRA 1E71M 3CHDA 2XGIA 3AMLA 1DWIM 3NCOA 3F5LA 1GOMA 4AZBA 3WFLA 1PS3A 3DYMA 4IPNB 4WK9A 1WB0A 4EAMA 1V6XA 1GQIA 1W3HA 3N13A 2ZUMA 3FW6A 2PWEA 2VCBA 3I3BA 1HJVA 3WELA 5A2BA 2BXZA 3EJUA 2QQVA 1NWRA 3K8LA 1BYDA 3CZEA 1TA3A 2A3AA 2X0YA 2D2OA 2EPNA 4CD6A 1UR8A 3POHA 1W1PA 4NI3A 1J18A 2E9LA 2WZIA 1V3HA 1T0OA 4OGZA 1BVNP 2DSZA 2VRQA 1OD0A 2D1ZA 4FLSA 3W29A 1H4PA 4JZ5A 1HX0A 4XB3A 1OD8A 3EJPA 3WMBA 5D9MA 2CETA 2DSVA 4GINA 1OGBA 1W3LA 2QMKA 1BQCA 5JIWA 1UKQA 4F9JA 1QPKA 4N0RA 3WNLA 3ARQA 3GTNA 3CHFA 2PWHA 3PZIA 5E9AA 4NX0A 4M1RA 3T2PA 3GXPA 2ADEA 3ZR5A 1CXLA 1E9LA 4TVDA 1VBRA 4AD3A 5F7UA 1QBBA 5A6AA 2JF6A 3CUGA 3DYOA 2W91A 3WDJA 2PC8A 3CZKA 4HA4A 1UQYA 3BVWA 4IISA 3W28A 1CLXA 4P8WA 3DX4A 3SUSA 3EJSA 1C92A 1Q6DA 4FFIA 2MANA 1MQRA 2JEQA 1HN1A 3WF3A 1CGUA 1XH2A 4BQ4A 4BZYA 1I75A 3T0BA 1BHGA 2D3NA 3T2QA 5IFPA 3U57A 1GOIA 2AEZA 4AIOA 2W61A 2Z1SA 1CYGA 5DO8A 1V3IA 2ZUVA 4CN6A 1VAHA 1KB3A 3A6OA 1BGGA 1EO7A 3AS1A 1UZ1A 3W53A 1W2TA 1I1XA 2Y2WA 2AAAA 4QHZA 4AEFA 2A3BA 2XWDA 4C7FA 3A5VA 4CN1A 4JHOA 1J01A 1PZ2A 2OSYA 3UG4A 1WKYA 2BFGA 2UY3A 5IXEA 4WSJA 2ZX5A 4GZEA 3BAIA 3WNPA 2EXOA 3VUPA 1NWSA 3WQ6A 3ECQA 4FK9A 4D6CA 1WAWA 1JF5A 1HKJA 1JZ4A 1ZL1A 1JNDA 3T0AA 3VO0A 3AHZA 3SUTA 1GORA 3EDFA 3EJTA 4C7DA 4U5KA 3HN3A 2XHYA 1ODZA 1GOOA 1Q6FA 4YHEA 3H53A 5CPTA 1MW0A 4JIEA 1A3HA 4MAZA 1GJUA 3VDCA 1A47A 4B16A 5ABEA 3VMOA 3KLLA 3HU7A 3RILA 2F7QA 1UH2A 3IGUA 4FFGA 1HT6A 2CBJA 1L8NA 4MNKA 3WN6A 2C8NA 2VO5A 1VEMA 1CXFA 2FGLA 3FHAA 4D6GA 5CXPA 1W9BM 2XIBA 1W1YA 1DTUA 4MNJA 4XV0A 3WNMA 1MW1A 2VX6A 3BMVA 3CZNA 2BVTA 4HA3A 5GPRA 4HZ7A 4TTGA 3E1F1 3A23A 3N12A 2V3GA 2OLHA 2J8GA 2G3NA 3VM7A 3SCTA 5C8BB 5ECUA 2O9OA 4AEEA 3QGVA 4JL2A 1QNQA 1XYFA 1BGAA 1V3JA 5A6MA 5FK7A 3U14A 2EBNA 4V2XA 3RCNA 1H1NA 4UFIA 1E4LA 1EDQA 1KXTA 3SUWA 4TVUA 1UKOA 2WLYA 5A6BD 5TD4A 4D6HA 4ZFMA 4HMDA 1K6AA 1ISVA 2GFTA 3AROA 3H54A 3K46A 3WEZA 1W3KA 1B9ZA 1E5NA 2XFFA 4F8XA 2IXVA 2W67A 3VILA 3W81A 3K1DA 3H55A 2WANA 1K9FA 4V27A 4GZIA 3B9AA 2XTKA 5A8PA 1DEDA 1W91A 4AMCA 1SR0A 2YLAA 4W89A 4PMZA 2VI0A 5CPQA 2BHZA 5DMYA 3LPFA 4AZ5A 4JCMA 2IGTA 1UKTA 5E09A 2BNJA 2ZUUA 2OSXA 4HMEA 4ZXOA 5A69A 2J7EA 3B9EA 2VURA 3GZAA 3OSDA 2X8RA 1XH0A 1TQTA 4B1MA 2XVLA 1XD1A 2VCCA 4UFHA 3VX1A 3M7SA 2X0HA 5ABFA 1K9EA 4FLOA 3GNOA 5LA1A 3UESA 3AISA 4NSBA 6TAAA 4GXPA 4Z2IA 1UD2A 4LYQA 1CECA 1UQZA 1BFNA 1UR4A 4E8CA 4X0VA 1V0MA 1UKSA 3LIGA 2XG9A 3A21A 1M03A 2D20A 3UCQA 1ECEA 3IAPA 1HTYA 3A4WA 5A2CA 4AW7A 2JF7A 1ODUA 3SEPA 3ZT7A 1LL7A 4FF5A 2EEXA 2WVVB 4GI8A 4PTVA 2YFOA 1UH4A 1NM9A 5A8MA 4BQ3A 1NARA 2YL5A 4U31A 2J7HA 3VD4A 1ZS2A 2CKSA 3L4XA 2DT2A 5EB8A 1WCGA 1PIGA 4AMXA 2DSKA 1CGXA 1GW1A 1KXHA 1DWAM 2J79A 3SCOA 3I3DA 3WNNA 3WF2A 4JFTA 3VD7A 3CV5A 3DX2A 4FNQA 4X0NA 4PMYA 2DQXA 5FMBA 3AQUA 2V3EA 1OINA 4HOZA 3OGVA 1QX1A 2O92A 2CBVA 4FNPA 4DWSA 3MUAA 4HU0A 1WNOA 4NXKA 4CCDA 4PMRA 1V6WA 1V03A 3D3AA 2E4TA 1HVXA 4PSPA 1D3CA 3BC9A 7CGTA 1FOBA 1H0IA 4H8UA 3BAYA 4CN4A 4QLLA 3NDZA 3NJ3A 2WMHA 3N9KA 1KXQA 1CGWA 3GH7A 1R7AA 3L4ZA 3CUJA 1EOKA 3WH8A 3SUUA 2BVDA 4M81A 3WF1A 1WZAA 3BAWA 5BCAA 2BXYA 3SCWA 4HP5A 1BVZA 3VM5A 2BS9A 1JDCA 3NIYA 4B9ZA 4QP0A 4U2YA 1Y9GA 4CD7A 5CLTA 5KZ6A 1NOFA 1QHPA 3PTMA 1V0KA 4B15A 4AWEA 3A47A 1MXDA 4JHZA 2WK2A 2WBKA 1UWUA 3CZ8A 5AC5A 2D0GA 4JCLA 2XWEA 4WIWA 1W9PA 1VF8A 5A6JA 3N1AA 2WVVA 4LGXA 4OUEA 1W3JA 3EMCA 3RM4A 3IMMA 3VOCA 5M03A 3FAXA 3VIGA 4LX4A 4HOWA 3WQVA 3UGHA 2FHBA 4IPLA 2WHKA 4U2ZA 3S6TA 3BXWA 2YOCA 1HNYA 2JEPA 1ITCA 5ABGA 2A3HA 5CJ5A 3A4AA 4DM1A 2VNCA 4AZIA 3SCUA 3U5UA 1Q4NX 1JYVA 4AZHA 3B9DA 1LL6A 3ARZA 1V08A 2UY4A 5CZKA 4TVCA 4M80A 1F4HA 3MUZ1 3D4YA 2GK1A 3VIJA 3AS2A 4AMWA 1PX4A 1GQLA 2ZICA 1JI2A 1GZJA 3MUY1 2C0HA 1PEZA 2VZVA 3VINA 3NSNA 4MPKA 3VPLA 1X6LA 3LEMA 1JZ3A 4J3XA 3VKKA 3SCSA 2XYLA 2QHAA 3ALGA 2CBIA 3ZJKA 5A6SA 1UD8A 1JL8A 3QOMA 4NRRA 3ZSTA 2ESCA 5M3WA 1E70M 4OKDA 3TOPA 1D7FA 3OA5A 2F7PA 4MDPA 1VIWA 1XRVA 4YN5A 3BVVA 1PJ9A 4UZSA 1UD5A 3VSUA 2AEYA 2XVPA 4A3HA 1LWJA 2VX5A 1GVIA 2ZWZA 3ARVA 3VDBA 4HU8A 1QNSA 1DWGM 4EANA 5A2AA 2DIJA 1R86A 3BLKA 1GONA 1GOWA 2PBGA 2Y4SA 1C7TA 3EJQA 3QHNA 3GH5A 4OZOA 1M53A 3TTSA 1OM0A 3PZGA 1E6RA 3DX0A 3OIHA 1PZ3A 4JQTA 4KWUA 3MANA 3BSHA 3F4VA 1JFXA 2EABA 3VIIA 5A8QA 1QOXA 5ANNA 1FHDA 4KRUA 3CH9A 4DWSD 2F1AA 3POCA 3AXIA 2EACA 1Z32X 4U3CA 3JUGA 3ZJ6A 4FMVA 1E73M 2J7DA 4GI6A 2J7FA 1B31A 3UG3A 5EFDA 1ITXA 4AZGA 1JAKA 4CKQA 4LYPA 1TFVA 4MB4A 4UFLA 4KMQA 1DHKA 1UYQA 3BUDA 2XPKA 4FNTA 4D1IA 3CZGA 4LYRA 4UQBA 1B3VA 2WHJA 3KZSA 3AMCA 4P8XA 4QAWA 4ZE4A 3II1A 2IUZA 4TX8A 1J0IA 1QW8A 4W88A 2FHFA 1HXJA 3WQ5A 3ZR6A 3ZMRA 3S5YA 1HJUA 2VZUA 3WY4A 2XM2A 4UNIA 3GXFA 2WMJA 4WF7A 3ZM8A 1PPIA 4B3LA 2ZUTA 1AQMA 2OW7A 1Y9MA 2J77A 2DEPA 1E1FA 3N15A 3EDKA 4AD5A 1MQPA 2X2IA 2QLYA 5HOSA 1UR1A 1G0CA 4DO5A 1ZB5A 2G4FA 2YDRA 4M29A 5BRQA 1M7XA 3AS0A 3LRLA 4URIA 5JIPA 3NUKA 5FKYA 1KBBA 1U33A 3UETA 1JYNA 4L4OA 4Z2GA 1E4NA 3HMCA 3WY2A 4JAWA 2EPLX 3SCQA 2XFYA 4CUCA 4PMNA 3BVTA 4J7RA 5FIPA 2V3DA 1V6VA 4BS0A 6A3HA 3W37A 1H5VA 3VX0A 5HPOA 3NSMA 4B1LA 4H8HA 3NMBA 2D0HA 2C7FA 2F18A 2WMGA 5LYRA 1R47A 4S3KA 3T0DA 5CGMA 5I0DA 1BPLB 3L2MA 3WNKA 1Q6EA 3AI0A 1V3KA 4F9DA 2D73A 3AIUA 2CHNA 3NYDA 1BYBA 1E40A 4KRTA 2X2HA 3ARXA 1S46A 3RM8A 1V6UA 3DHPA 1LLOA 4UFMA 1E3ZA 3QHMA 1LF1A 1B3ZA 1LG1A 3LFIA 2VOTA 9CGTA 1UHVA 2X05A 1KQZA 5EBAA 2G41A 2PF0A 4CCCA 1G9HA 2PBOA 4JKKA 5A6KA 3LXBA 4A3YA 2ZOXA 2VR5A 2RGLA 1VBUA 1UUQA 2WVTA 2UY2A 3N18A 5DT5A 1NOWA 1C8YA 3WBEA 4L4PA 1EQCA 3K8KA 4GQRA 3EDEA 1UWTA 5GQBA 3M46A 3A22A 3DX3A 4H04A 4MADA 1WPCA 1UWRA 3CUHA 5FL1A 3WY3A 2V5DA 3AFBA 5BYWA 3B8SA 3VIPA 5CLWA 4UQAA 2XGBA 3W38A 3GYCA 1GCYA 4DUWA 1UZ4A 2WCGA 3WD0A 4YPJA 5I79A 3TONA 3K4DA 3W25A 2WZEA 3VGHA 4RE4A 2JALA 3NSXA 5GNXA 4J3WA 1QW9A 4GIAA 2D3LA 3L4TA 4D6EA 2ZXAA 4CGTA 1JXKA 1CEOA 3CZJA 4M82A 2BY2A 3L2LA 3DHUA 4JFSA 4TOQA 3WUBA 4K68A 3BVUA 1TQSA 1TE1A 1YQ2A 1V3LA 3CO4A 2XVNA 3CGTA 3THDA 3BAJA 1W9VA 2PB1A 5FL0A 4B9YA 3ARWA 1UOKA 1JZ2A 1GNXA 1KXVA 3APGA 4OOUA 4M8UA 3SIMA 2PWFA 2UY5A 3NDYA 3KWXA 1Y7VA 1EIBA 1W1VA 5D9NA 1E0VA 4NXSA 3A24A 1HKMA 3KEHA 2QPUA 4AZ7A 3AHVA 3WMCA 3HG5A 4W87A 5A94A 5D9PA 4D1JA 1OCQA 1J0KA 4B3KA 3TTYA 2V5CA 1TCMA 3WFZA 1R33A 2XN1A 4TTUA 4OBRA 2CPUA 4LXFA 2YBTA 4ATDA 3BCFA 2D23A 3AIQA 1QNOA 3GM8A 3AXHA 1B0IA 2EPMX 3BLPX 3KLKA 1MVYA 3AZSA 3BUPA 4GQQA 4J3SA 1MFVA 2BHUA 1UWIA 4PMQA 3VDHA 4BQ2A 1E15A 2J47A 1XSIA 4IM4A 3ALFA 3BLBA 3TTQA 3SCNA 3OBAA 8A3HA 5FIXA 3ZJ7A 2WMIB 2FGZA 1BG9A 3PN8A 4S3JA 1WZLA 2YL6A 5M17A 2OWXA 3VIKA 1BAGA 1UYPA 3L4UA 3L4VA 4OJYA 2VCAA 2YDSA 3W24A 1AQ0A 3AS3A 2Y24A 3BUBA 1SZNA 3UGFA 1BG4A 4W5ZA 3RPMA 3IANA 3MI6A 2GJRA 3RDKA 1XC6A 3SC7X 2YIHA 5A1AA 2PWDA 4AIEA 1K9TA 1B30A 1C7SA 4EK7A 4W8AA 5CGTA 3MSDA 4NZJA 5BXPA 1VJZA 2CEQA 1W9UA 3UERA 3BUIA 2AC1A 1R75A 1RP9A 2WWDA 5E6ZA 5I78A 3W82A 1XV8A 2CKRA 5I77A 2YJQA 3VU2A 3UGGA 2GVYA 3WDRA 4OBSA 5KEZA 5I3DA 1QI3A 4R27A 3CC1A 1CGTA 4W84A 1CTNA 1JDDA 3GXTA 1GPFA 1ZU8A 1JGIA 2W66A 2DSWA 4W7WA 1HVQA 1KFWA 4AC1X 3PTKA 1L0PA 3VD9A 4CU6A 3LPOA 1HP5A 2J7CA 3S5QA 1P6WA 1O6IA 2ZXDA 5JBEA 3SUVA 2WLZA 1ISWA 1AVAA 1HKIA 1KTBA 2WNWA 3OLDA 5BXRA 4EE9A 2OWWA 3RO8A 4AZZA 1BTCA 1VENA 5HPCA 4QLJA 3FN9A 2WHLA 2WMFA 5A6BA 2BY1A 3S5ZA 4KGLA 3WEOA 3LMYA 3QOKA 1E3XA 1OT2A 4PCSA 4HMCA 2OYLA 4DUXA 1PIFA 4WKFA 1BF2A 1QHOA 1W1TA 1IZJA 1FP8A 4RE2A 5D9OA 2GJPA 3WIJA 3AJ7A 1QNPA 2ZUWA 3M6DA 2ZUNA 3BAXA 4WJXA 3VDAA 2ZX6A 2DIEA 2E8YA 3W0KA 5M5DA 4AISA 1ZJBA 4AY1A 6CGTA 3LDRA 4GO9A 1ZBWA 3U1XA 4PTXA 3G6LA 4AZ6A 1G01A 3CZLA 1GHSA 3A3HA 2YL8A 3VNYA 4PCTA 1W9DM 3F5JA 1HWWA 1OSEA 1FA2A 2QQUA 3CPUA 1AMYA 3RM9A 3T2OA 4AD2A 4HTYA 2D0FA 3AOFA 3TTOA 4DM2A 5FKCA 5E1QA 1JD7A 5FKBA 1UR0A 2DT1A 1JZ6A 3EMQA 1E6ZA 1H49A 4FNUA 4CD8A 1NP2A 1KTCA 1E6NA 2FDMA 4P8VA 4ATWA 1D2KA 4PTWA 1HKKA 2G3IA 3LRMA 5CG0A 3MV01 2FHCA 1B90A 1KGUA 2ZWYA 3KL3A 1KWKA 1JYXA 5BRPA 1OIFA 1SMAA 1QBAA 1B1YA 3CMGA 1TZ7A 3GXNA 2YL9A 1FFRA 1X6NA 3WH7A 5BXTA 4LQ1A 2Q8XA 1PX8A 5CPSA 1PAMA 3WDPP 4HPHA 1E6PA 3KL5A 1QI0A 1EA9C 2WXDM 4W86A 2A3CA 3G6MA 5BROA 2XQRA 1EHNA 2CYGA 3MKKA 1JNEA 2EQDA 2EADA 4M24A 2HISA 2QMJA 1EXPA 4U5IA 1V3MA 1DWHM 5E0FA 2ZXBA 3FY1A 3MSGA 1CXHA 1H09A 1UD6A 2G8ZA 3W6MA 2NT1A 2JFEX 8CGTA 1CDGA 1CXEA 5BWFA 3U75A 3HG2A 1GQKA 3AHTA 3TP4A 3VNZA 2IXUA 3WUEA 1JD9A 3OGSA 4IUGA 3OZOA 2WYSA 4NF7A 4ZENA 2PI6A 1HXKA 4V28A 4U3AA 1V6YA 1JYWA 2XN0A 4MB3A 2WB5A 4PBGA 5FMDA 5AYIA 4DO6A 4UOZA 4UTFA 4GZJA 3KF3A 1MYRA 4AYGA 2E9BA 1N82A 3ARTA 1BYCA 2E3ZA 1E4IA 2X2YA 1G5AA 1OBAA 3AMGA 3ZT6A 4HZ8A 1QVBA 3DDFA 1SMDA 3PZOA 4PN2A 3VGDA 1WZMA 4JKLA 4QCFA 2Y8VA 4H8VA 3VGEA 1JI1A 3I3EA 3CUFA 1OIMA 4D72A 1CNVA 3N17A 4KH2A 2ZXQA 3DECA 4W93A 3AHYA 3ZO9A 2VMFA 5CQ1A 2DT0A 4EKJA 2YFNA 2EJ1A 3BUQA 1XSKA 2W4XA 4H7VA 4GPNA 4UFKA 5I24A 2CHOA 2GJXB 1RP8A 4MJ2A 1TUXA 2VR4A 3ARSA 4MNLA 4AXNA 3ZJ8A 3OLIA 2X09A 5DEZA 2QV4A 3W26A 5ABHA 4HZ6A 1HJWA 3UEQA 1VEOA 2CNCA 4AD1A 2CIPA 3D4ZA 3SURA 2EPOA 3VTRA 1CXIA 1R34A 1BLIA 2FH6A 3QR3A 4P7QA 1E6SM 3ARRA 1Q6CA 4TX6A 1HF6A 1KQYA 2FH8A 1MFUA 1C8QA 3PTQA 2J25A 3CUIA 1J11A 3UG5A 2VRKA 2BVYA 4ACZA 1VFUA 3AIBA 4MNMA 3SCRA 3MU7A 1WZKA 2WBGA 4A4AA 4QCEA 5JUVA 1NWUA 1G1YA 3WY1A 1E0WA 2A3EA 4FFHA 4PMDA 1XHGA 1NH6A 5GNZA 2VTFA 4WKAA 2F1BA 3PIJA 5E0CA 2OW6A 4GI9A 2PWGA 1C91A 2X1IA 3ARUA 3MMWA 1GJWA 4R5EA 3D51A 3PHAA 3MO4A 1MW3A 3N04A 4RE3A 4JFVA 4MTVA 1VEPA 2WHMA 1E6QM 3HBKA 4Z2JA 3WDQA 5C70A 1CGVA 3WQ8A 2TAAA 2D22A 3THCA 4PMVA 1EGZA 2J78A 3RMEA 1E43A 2E8ZA 1ZBCA 3WD4A 3WUGA 1XD0A 2J7GA 4U33A 2JIEA 4HXCA 2RGMA 2YDQA 2XJ7A 5E6YA 1XGZA 4DO4A 3VVGA 2WAGA 2WC3A 1IT0A 1FH8A 1UWSA 2OYKA 3AZRA 2BV9A 2O9TA 3VD5A 3LX9A 1E5JA 2FYVA 4UFJA 2XSAA 1R85A 1QWUA 3D5HA 2ZIDA 2OXBA 2VZTA 2V3FA 4ACYA 1JAEA 1WDRA 4MDOA 1OGSA 3GXMA 1DWJM 1TR1A 4BQ5A 1MWOA 5LA0A 3LIHA 3SCVA 1B2YA 4W8BA 1J0ZA 4C7GA 3BGAA 5E70A 1ISXA 2J4GA 3CHCA 5I2UA 3MS8A 1E4MM 2EPKX 1VFFA 5FMCA 2DT3A 2V38A 1UR9A 3VGFA 2W62A 1KR1A 3ZT5A 5A3HA 4BCEA 1JF6A 2J74A 1J0HA 3WF0A 1H0GA 4J3VA 3BSGA 1B3YA 1NQ6A 3GDBA 4CU7A 2WCAA 1JG9A 5HNNA 1EOMA 3AZTA 3IJ8A 1IV8A 2ZX9A 1TVPA 2QF8A 1YHTA 5A8NA 1SFSA 1M01A 3PZTA 1JZ7A 2G3JA 2QPSA 3LDKA 1K9DA 1HIZA 1ZBKA 1E72M 1M04A 3FHQA 4W7VA 4W8LA 1E56A 1CIUA 3ZSSA 5I23A 2NW0A 3IJ9A 1R7OA 1E1EA 2DPEA 1UA7A 3KF5A 1GHRA 1RPKA 3VGGA 1J12A 1HJXA 4QLKA 4QFUA 1CENA 3D52A 3WH5A 3CTTA 1LQ0A 2WPGA 1U30A 2VQUA 2WW5A 4UQDA 2GDUA 3PZQA 1G94A 4AZCA 3FNDA 2ADDA 3DDGA 2WSKA 2O9PA 1ST8A 5HXMA 1HP4A 1E55A 2VT0A 1OWQA 1DWFM 2XVKA 4JFWA 1W32A 4MB1A 1RH9A 2B31A 3EYPA 4TUFA 4PUDA 4N42A 3N11A 4CVWA 1KBKA 4DWSB 1KGWA 2Z1KA 1WE5A 2CBUA 3ZQ9A 3D50A 2J62A 1FHLA 4XZWA 1B3XA 3AYSA 3L4WA 2HVMA 3KL0A 4XX6A 1O7DC 1JXJA 1BSIA 3MUIA 1JFHA 4TXEA 4HA1A 1U2YA 3BCDA 2YLLA 1WDSA 4UOJA 3PZMA 1R87A 1W9XA 1WDQA 3U5YA 4PMUA 5CSYA 3WDHA 4J3TA 4FNRA 2CESA 1E0XA 3U7VA 4ZXLA 1V02E 1VFOA 2VRJA 1XH1A 3HG4A 2WMKA 5AY7A 1V02A 1EH9A 1WP6A 3LPGA 4FLQA 2F7RA 4P7RA 1JIBA 1KCKA 3CMJA 3WH9A 4AD0A 2CERA 3W4RA 3WL1A 5LA2A 2XVGA 2AMGA 1TMQA 4LPCA 3VMPA 1TQVA 2QQWA 4ATLA 1EQPA 3VIOA 2NSXA 2O9RA 2J7BA 1XSJA 3ZIZA 4F66A 1QI4A 2JE8A 1NP0A 2BY0A 3HG3A 4W5UA 4UCFA 2GJXA 4W85A 1FH9A 1UR2A 2VVSA 4D71A 5BXSA 1JZ8A 1UD4A 3LF7A 4NRSA 2EO7A 4WSKA 1GOQA 1PBGA 3WD1A 5JBDA 1SYTA 3AHXA 1XCWA 3GH4A 3EJRA 3OB8A 3WEMA 3WQWA 2WC4A 3GNPA 3GXDA 3RWKX 3CZSA 2E40A 4AYSA 4ML4A 3UR8A 1Y4WA 1J0JA 1XYZA 3K8MA 4NZCA 3MMUA 2W63A 3PZNA 1UASA 2Y5EA 2BHYA 5HDRA 4CU8A 4J27A 5IHSA 2WC7A 4UQ9A 1IZKA 2X2JA 3UR7A 2FE0A 2OSWA 5I5RA 3CHEA 4D6DA 2GDVA 3U7BA 1UKPA 1EHAA 2DSUA 2E0PA 4OIFA 3WL0A 1UG6A 1KGXA 1VRXA 2YA2A 1QI2A 4GO8A 1LWHA 1RD6A 3OGRA 2W5FA 3J7HA 3VIMA 4DUVA 3DC0A 5FOOA 2GSJA 2OYMA 2YKKA 5FCZA 4DWSC 2E9MA 3WMSA 4UOQA 3OZPA 4JFUA 4WKHA 4Z2HA 4ZEPA 5JBFA 1CBGA 1C93A 3OLEA 1AQHA 5FD0A 1HJQA 3WUFA 1ZBVA 3W27A 2J75A 4F79A 1H11A 1HL9A 2GUYA 2VJXA 1UA3A 4H41A 1CWYA 1HL8A 3VSTA 4E2OA 1C3FA 3AICA 2WVUA 3AIWA 3GXIA 1NWTA 2DDXA 3PZUA 2VX7A 2XFRA 2XSBA 1LL4A 5D4YA 4J28A 1R8LA 3VD3A 2VUYA 4D6FA 4BA0A 3O9NA 3PZ9A 1QI5A 2VX4A 1WO2A 4PUEA 1ISYA 2AOSA 1WDPA 1UWQA 2CXGA 2WKLA 3WQ4A 4W7UA 1QWNA 4Z2LA 4XZBA 5DT7A 4CVUA 1TQUA 2OWCA 1OB0A 1US3A 3GBEA 2WCSA 4D6JA 3K4AA 4M56A 2ALWA 1R46A 3CLWA 3WD2A 4PMXA 1UD3A 4WLCA 1MW2A 1Q6GA 1HJSA 1VJSA 1QHZA 2XN2A 4EQVA 3ARPA 3IAQA 1ISZA 3RJYA 3DX1A 2VZSA 2WWCA 5EFFA 3CBWA 5DF0A 2YA1A 3AIVA 4E4PA 3KE0A 7A3HA 2W92A 1J9YA 3BH4A 1V0NA 3T08A 4P8UA 5D8WA 4PMOA 2NT0A 2DH3A 3M07A 1TA3B 4ZE5A 3ARYA 4UZUA 4YHGA 4OOZA 2ZX8A 1DP0A 1EO5A 2ZUSA 3BVXA 3VGBA 5EMYA 1C8XA 2BY3A 2WZHA 2ZE0A 4PRWA 2XUCA 5A6LA 3PBGA 1CZ1A 1OGGA 3AMDA 3LXAA 3EDJA 1W2VA 1GQJA 3W6LA 4JL1A 3WD3A 3AIEA 3WSUA 2Y8KA 4E8DA 4HOXA 5A8OA 3T09A 1PX3A 3BAKA 3SCPA 4D6IA 1J10A 1FP9A 4Z2KA 4CD5A 1EDTA 5I6SA 7TAAA 4CCEA 2GK1B 4JKMA 1JDAA 1XCXA 5C71A 3RJXA 1FH7A 3MV11 1OT1A 1TVNA 3O2LA 4XUYA 2F7OA 4FLRA 5IHRA 1NOUA 5GNYA 3EDDA 4PEEA 3WH6A 4UR9A 3WF4A 4FNSA 3VIFA 3OLGA 3HZ3A 4P7NA 3AMKA 3CIVA 1EDGA 3VSVA 2WM0A 1FFQA 4Q22A 2DGAA 1VB9A 5AC4A 4KGJA 4MB5A 1TQWA 3OG2A 1CGYA 1I1WA 3DYPA 2XIIA 3QHOA 4H2CA 3AYRA 4P7LA 3PZVA 2JIWA 1JZ5A 2VZOA 1X1NA 3GBDA 1CLVA 3IJ7A 4HPGA 3LRKA 3MMDA 4UQCA 1GUVA 4GKLA 3IK2A 2YA0A 1KCLA 3L4YA 5HBFA 2VL4A 3LPPA 2EAEA 2VVNA 2WKGA 2ZX7A 1TG7A 2F61A 3O6AA 2VQTA 4MJ4A
chains in the Genus database with same CATH superfamily
4YGAB 2F8XC 1T66D 3FFQA 2I7GA 5D2XA 1QRNE 3LXCA 2QAFA 1TWDA 4LHUA 2BIMA 4J3UA 1Z7S3 3SYAA 4YGCA 3S35H 4P7OA 3O0FA 5G5IA 1G0XA 2GTZB 5FYKE 5GRXG 2NZ1A 2GZWA 1GZPB 4PSRA 1ASJ1 5F2IA 1MFMA 2DH2A 3THML 3BOFA 2AK4B 1A5AA 1U8OB 5DQJA 5D7LB 2W27A 2PS2A 1ZDQA 2YMXL 3BO8A 2IPUG 4G6CA 3B9KB 1BFVH 4KJWD 2OYPA 5JO5A 2HKAA 4DXXA 5CSZA 2LLNA 1E71M 1Y07A 3LQGA 3IFLL 1DWIM 5EIIA 2NXGA 2B5HA 4IPNB 3ZLQC 4FKEA 4WK9A 1MF2L 2WDBA 4E41D 4IV1C 3I3BA 4AIZA 4W68A 4NJGA 5H2BB 3I75A 1TJ2A 4QRTB 1HE7A 2EAKA 2BZ7A 4X99B 2Q5TA 1TSIA 4Q0XL 3W5NA 1ZMYA 4POZC 4U0RC 3KBFA 1OKOA 4CD6A 3F4WA 1UM5H 4RFNB 4S3BA 3NV4A 1NOVA 3PGCB 2GDFA 2PCYA 2ROXA 2DD8H 1ZM1A 1EZWA 3HC2A 2GP3A 5A6ZA 2I9TA 2QKDA 5I75C 1TDQA 3N40P 3ZN6B 2VDGA 1I9RL 2Z8RA 4NX0A 3CL6A 3GXPA 1HL2A 1W04A 3A64A 3KPPB 8FABB 3SKJL 3OXSB 4YQXH 3FYOA 2FEDC 3OBEA 4G8IA 4RR3A 1MJ8H 4AT6A 4PU2A 5E95B 2X87A 4FB7A 4Y20A 2A9ML 1ZHLA 4F7MB 3JWOL 3LXUX 4DPPA 4G1EB 2OMBA 3H9AA 3UAEA 2MANA 3NPUA 5FWQA 3BZDA 3AQZA 5A2LH 4F5CE 3NAAL 3STPA 2D3VA 1Q2RA 1YN6A 1W0NA 3RU6A 3T81A 1W8HA 1FCGA 2Q7AA 1QEXA 4E41B 2GAZA 3SD5A 3I6TA 5DMNA 2WQVA 1OD3A 3BPSA 4ZUVB 4QHKJ 1E9ZB 2JB8A 1AANA 1LOBA 3KPOA 5I66B 4F33A 3RR4A 4DEUA 3V5FA 1UROA 3JZVA 4JFXB 1Z9OA 2Y2YA 5GHWL 1R3IH 1OFDA 4Y9GA 2PXJA 5C5YA 3BPOC 3TQPA 3BAIA 4G72B 1TTBA 1KRCC 5D7LD 3EDFA 1W6PA 3BU7A 4TNFA 4A05A 2QXWA 1GKPA 3O0WA 1A3HA 5IMKB 4MJJA 3HU7A 2Q3ZA 1FNFA 1UH2A 5HWJA 2ZKHH 5GVJA 2FGLA 3SN4A 4Q4OA 1N1VA 3PDDA 3JT2A 3LK6A 4MNJA 4NUGH 2P6HA 2DZAA 3TEZA 4O1FA 4ORGB 4R5TA 2J8GA 2IDFA 3FSZA 5C8BB 3TW9A 5ECUA 5T1DH 4AEEA 3P8JA 2HJKA 2B16A 1Z78A 2ZP9A 4V2XA 2ZKXA 3KGTA 5F37A 5C8CC 4GW5B 5J04A 1MCSA 3FNKA 2OXHB 5KSAA 3TH6A 1QUNB 3N06B 4QYOA 4JNMA 1QAWA 2MHFA 2V5BA 3SO5A 2PDXA 5JDJA 1JHTA 1A3WA 2R0WH 1DQMH 3LRGA 3BKJL 2OXGB 3G8EA 3QWQB 1GGIL 4XJ9A 3IN2A 4L7ZA 4N9IA 3SGEI 1SGJA 2VI0A 3DG3A 5HYSB 3W87A 3MPBA 2CD0A 4HJFA 3TC6A 1D7PM 5I1EH 1DQXA 3ZO0B 4XBKA 1CR9L 2YPLB 2F5BL 1HI6B 2FSEB 3OTFA 3USSA 4D9LL 3BQUA 2F8IA 5AAWA 1LGVA 1SU5A 1RJQA 1ZBA2 3M2MA 1NFDE 4ZO8A 1LQSR 2R0LL 3MA8A 2NUXA 1GYUA 4Z3TA 3RG6A 4M5YH 2L7QA 5ABJA 2WSQA 1BFNA 3QC5X 1SW7A 5HV0A 2BFUL 4RMSA 2GCYB 3E5XA 1J93A 2CU0A 2Z34A 2P53A 3T8LA 3KRBA 2WD0A 2JF7A 3W21A 5DJDA 3CEPA 4DPQA 3QTPA 4RGGA 4ABUA 1L6YA 2B7DT 4BKSC 3LPWA 3VD4A 3M70A 4F7MA 4F27A 2P8PA 3U4XA 3WSOA 3NO8A 2MQCA 2F1EA 4RISL 1KBWA 1LLWA 5C8JA 1G87A 4DZ8B 3ZN6A 1LHWA 3P9LA 2RBLA 2FEDD 4J1XA 3D3VE 3DO7A 3MP4A 2A9BA 1AW1A 5ICXA 5LBCA 2HPTA 1WDDA 3FUOA 3VM5A 1EXGA 2Z64C 4X4ME 3CCHB 4CD7A 3OJGA 3W7NA 3APMA 3U7YL 1YQ5A 2XXCB 2CBOA 5E2WH 1XRSA 5ACMA 3NQBA 1IL1A 1O91A 3WDVA 3NJHA 5IVYA 4PD4J 1X8FA 1UJPA 2BSSA 5FREA 1UIKA 3USUB 2X89A 3BJ91 4X7SL 1XDJA 4KXCA 1IGFH 1E9PA 5EEVA 4DNMA 1L9MA 1OC1A 1RZFH 2FATL 4ODBD 1A5CA 4ZD3H 1AGDB 3MUZ1 5K1JA 3HPXA 4MF4A 2E76C 5B4MC 4WY0A 3L3OC 5I74B 1ERNA 1GGCL 2XBDA 3MMTA 5FCSH 1FO0L 1RSYA 3RRDA 1T6MA 1O75A 3UKTA 3TZFA 4P61A 2MNRA 2PDIA 4NUMA 5GGTH 2J1XA 2PR4L 4ZMGA 3O6KH 3CHXA 3AU1B 4ZSTA 1EB3A 3BVVA 3EYOA 3RX3A 4KOCA 4PGZA 3P82A 5FZAA 1OKEA 1S9VB 4B4QA 1K4HA 4WQOA 2PBGA 3U1SL 5A3NA 3VA2C 3W59A 1SW3A 5F7LB 1A4CA 3WUWB 3F4VA 3ETTA 1FHDA 4DWSD 5HHMB 2F1AA 3AXIA 3WIAA 3ULSA 1XLGA 4N9GB 4LL1A 4GI6A 1GTFA 3OGCA 1QNYA 4GMP1 1WX0A 4XKYA 2L04A 3GG1A 1FORH 3QKZA 4EIGB 1NUNB 4XD6A 5E03A 2FTWA 1KSRA 3TZVA 5F7YC 3AMCA 5T1LA 2GUUA 2B1OA 4YE4H 4FOVA 4NP9A 4COVA 3TJXA 1E5YA 2HMID 1SBSH 1HXJA 4CPBA 2NX5A 5AHFA 4MNQB 3C2UA 3WY4A 4AJWA 1Q6RA 5CU9A 1PPIA 1E50A 5IGXL 4GC3A 5CC7A 4RZ4A 2DEPA 2JNZA 5AAWC 1ZV5A 5BV7L 4R9DA 1UR1A 3PBWA 2QCCA 3AP7A 3MV7A 5LNUA 2PFWA 5C3IA 1P4IL 3D0VB 5DAQA 2NXYC 4QQLA 2DM7A 3RDTB 3LB6C 3URAA 4CEWC 3BYTA 3H1ZA 5T5FA 1HEJC 1DBMH 4LT7A 4FO4A 4IIDA 1WFTA 3BP5B 2CK0L 5AUMA 1KZYA 3TO4C 1S2KA 3NSMA 3PM6A 4AUBA 3B43A 2DWYA 4O2EB 5FZMA 3NQ8A 5CGMA 3FJ4A 3MQIA 1PVC2 3L2MA 1V3KA 3HBGA 3V6ZA 3OKEB 5FA3A 1BXVA 1TVHB 2PD9A 3SKNA 1UUNA 4KFNA 3ITVA 4TN9A 4D7SA 3NCBB 3PIQB 4XUGA 1DVYA 1B3ZA 1WMFA 5J1SC 4H55A 2EE2A 3Q0HA 4X6CE 2BDRA 3S34H 5JTWA 3C9NA 1DL7L 4JKKA 4TSBL 3CVIH 1M05A 4FFTA 3CUZA 2KZWA 4ONHA 3UWVA 3COOA 2PU1A 2MQ3A 2AJUL 4YM0A 1PNGA 3FU5A 4HPYL 3B8VA 2CLEA 5GQBA 2Q71A 1KS5A 1OX5A 2AVFA 1UC5A 5HHOE 4ORZC 2XYCA 5L6YL 4H1LH 4XP4L 3G1SA 2CM6A 1JODA 4PWIA 5JOFB 4AVTA 1UZ4A 3QYMA 3UR2A 4KX9A 3FZUC 5GNXA 4XIMA 5DUPL 1JRBA 2BIPA 3DV8A 4JFSA 3PQYA 5LNGA 1KN2H 3KPSB 4C59B 4ES8A 1XC4A 5AZ2H 5JXJA 4GG6A 2Q76A 5JHDB 4GAFB 5LAXA 5EF3A 3EYVA 2P3IA 3BVJA 1LEDA 1IEWA 4PJFF 4Q6KA 3CFJA 3LCGA 1BK0A 4DRSA 4OT7A 3GMRB 4MYWB 5AVXB 3B7YA 1E0VA 1C29A 2QPUA 1BXUA 1MAJA 1RU9L 4A35A 1J0KA 2RM21 5HVWA 2QGYA 3WFZA 4O5LH 3VL9A 3A0OA 2YBTA 2YAHA 1LT8A 2AJ3B 3MRQB 1MVYA 2HN7B 1P4IH 2BHUA 1EDHA 1DYZA 1Z5YD 2CFFA 1TJPA 4CQDA 3QUYC 4DYEA 1TJ0A 3QPZA 4LANA 4AW4A 3NGBB 4N9OB 5I1GH 4UW6A 2IALA 2R1LA 5CBJA 2NY7L 3F12B 4A68A 1EP3A 1TIWA 1PZ7A 1M9SA 4J3OF 1AQ0A 2K46A 3DN5A 1DBJH 2IGLA 3IANA 5FV1L 5MEND 3V35A 2PDPA 2YIHA 1BWVA 1K9TA 1B30A 5GALA 1SLBA 3USUA 3MRBB 4K3GA 2TMDA 3QMRA 5EC1B 1LHNA 3WLHA 1LBLA 3UH8A 2NY3D 3FGCB 1DIKA 4Y8DC 2ZOUA 4X5PA 4QQUA 3JXAA 1XV8A 3X3FH 2YJQA 3ARGC 2E75C 3WDRA 3CUPA 1XIGA 1N10A 1ZQ5A 2APWA 5I3DA 4NO4A 4MOAA 1UPPA 1H3TA 4FPSA 1CTNA 2RS32 1QT1A 4Y9NA 2KA3A 4JO5A 4ANXA 3PPGA 3PTKA 4Z7VF 1EAH1 5BNOA 4EVNB 4DPBX 1THAA 3S5QA 3GHPA 1A3RL 3T8MA 3N4FA 3OG3A 5I26A 1F8IA 2WNWA 5AC7A 4BGDA 1LXMA 3TN0B 2CSGA 3N0AA 4EIBA 5ITBH 3K6NA 3QY8A 2OJEB 4RVBA 1UIOA 4O28A 2X29A 2OX4A 3RZCA 2YAOA 5EBGA 1W31A 2CHDA 1T5XB 3LS5H 1QHOA 2F53A 1NMCB 1UUOA 1IZJA 1J9SA 4BUGA 2VD7A 2LHAA 3JR2A 1GQPA 4XP5L 4LBQA 4ZFGL 2HXTA 1NSNL 1QP1A 3BCWA 3GIVA 3U1XA 2XG5A 3MICA 1G01A 3V4PA 1AJ7L 4LIUA 2X10A 2CLRB 1J7VR 1S7TA 2FDMA 4CJ1A 2PU0A 1YEHL 4AXWB 1BREA 1E4WH 4UDTA 5CG0A 5DFTA 4A66A 2DZTA 3QW4B 1KWKA 4LVHC 3RU8X 5B4MD 3GTTA 5C0CE 1UZ0A 2YL9A 5I1KH 1BZ9A 1IIHA 1YCSA 1EERB 5LNDA 2AK1H 5IKCB 4QB2A 3CFEA 3T8QA 1U1HA 2A3CA 1VBHA 1J86A 4ZMZA 5ALBH 1V7ML 1KENH 1OFBA 1NDTA 4O9EA 5I6XC 4PCYA 3HUJB 1S7RB 1YECH 2WTPA 1ZA6B 3C09B 3FN0L 2XNAA 4I48B 4IUGA 4XP6H 2NY3B 3D48R 1QXJA 4PLJD 2GJ6E 2GNTA 4F57L 4LLDA 2XN0A 3CJIB 2AEQH 1D4M2 1SO6A 5D2YA 1H8SA 4GW5A 4AHWA 5FO7B 5C6TL 1GU3A 1ZLVK 5KYWB 4Q4QA 2CR3A 1GGTA 1LHUA 1FAIL 1YTKA 2CWXA 4NAEA 4OHVA 1AXTL 4NAQA 4XZ9A 4S2GA 1FFNA 4KJWC 2ZXQA 1G7PB 5JXAH 2Z7WA 3TQKA 2VMFA 3BUQA 4KFZC 2L7UA 5J12C 4Y4FB 4Z7QE 3H8AA 4UQIM 3QVQA 4XDPA 1G7QB 3ESUF 1SYSA 4CQ8A 4DLMA 4Z7NE 4W6XA 4YVSC 4NHCH 4G9FD 5AALA 2VR8A 4RMRA 4YE0A 3I6KA 2GOKA 1DVZA 3V10A 2JJWA 3MI2A 2X9YA 2DI8A 4GW4B 2A70A 1F1DA 4R0LB 4JCWA 4HYTB 2D6NA 4Y24A 3QJOA 1KOAA 5L9BA 2WWKT 3WS3B 3KDMA 3L1OH 1QRNA 1G1YA 2OOGA 3TXAA 1AVBA 3CYVA 1M1XA 1NH6A 4H4NA 3ZDVA 2VDRB 3MOBH 5E0CA 2OMWB 4KBXA 1R0AL 3ALWA 5JDSA 3MO4A 3MJ8A 3ZVXA 5FO2A 2F6BA 3ABLB 4RSVA 2D7QA 3TVMD 4HBNA 5GS0H 3U8GA 1INEH 5AB2A 3QRGH 3AW5A 4I87A 2Y7SA 4F83A 2J78A 1ZBA1 4WIQA 5H9QA 2CK2A 4DO4A 3GM0A 2CC0A 2GBAA 1F2XK 1VBA1 4GRMB 1SFJA 1GVSA 3GALA 4Y2OB 3M64A 4XMVA 4UBGA 5ICXB 2Q86B 4DPNA 4XH2B 3IRDA 4W8BA 1XE0A 4X99A 3V4PH 4G5ZL 2CIKB 5I1LB 1XNTA 3M0ZA 3M1ZA 4U0RB 3BFQG 5DDHB 1L6XA 1UWXK 43C9A 4JMNA 3CBRA 1MOEA 1RZJH 4HGWA 5DRWA 3TA3B 1R1A3 3HC3L 3FU6A 3ZYGA 3VXOB 4QTGA 2JGYA 4XP5H 3WV6A 2G3JA 4K8HA 3RMYA 4PBOA 3ZLHA 2DWSA 3HOJA 1Q6OA 4Z3GA 2CUHA 1STMA 3N9OA 5KVGH 1HOEA 5I23A 3TWCH 2Q6WA 2ITEA 4R85A 1CENA 3VFSB 3WH5A 1CL7I 2WPGA 3CT7A 3Q45A 4GS7C 3VG9B 2D6PA 4NKDB 3VNIA 3ULUF 3ZVIA 4NHKA 5GRWA 2Q8BL 1X8MA 4POYA 3F85A 5HXMA 1CJYA 6XIAA 5CN3A 3DXIA 4JFWA 1B54A 1F4YH 1WWYA 1U8HA 2WN3A 2YV8A 4PRBB 2QTEA 4K9JA 1B3XA 4XQDA 1AR1D 2V5LA 3MZHA 2OX1A 2GC7C 3VJ6A 3BCDA 3P80A 3PZMA 3GRBA 1QKQA 1HB1A 5CSYA 1TTFA 2J1AA 4ZXLA 4R52A 3LSCA 3HG4A 5BU9A 1M05B 1CD8A 3VBFB 1B0GB 3HZMA 4M7JL 3K1KC 1Y43B 1EJ8A 1WIPA 5LA2A 2AMGA 1TMQA 1BIIB 2HTKC 3WP3A 4HJ0D 1WXZA 4P02B 3FQUB 1WYJA 3M1CA 1T0NA 3W70A 3MHUA 3I65A 1N4XH 1P48A 2X4UA 3EBHA 3TBVB 2VWSA 5F0MB 3E8UL 1O68A 2YFZA 1OF3A 2PF6A 2OL3L 3WD5A 2Q8EA 4NKOA 3LHTA 1PBGA 3WD1A 5D70L 2EDMA 3WEMA 2DYCA 2J7MA 4GBXB 3NRPA 3BEWA 1R30A 1ODMA 1YZZA 4J4PC 4EDXA 3L3KB 5IHSA 2WC7A 3WKPA 3FS9A 5LDSA 2X2JA 3GDCA 3BJTA 4EAYA 2IMRA 4LUMA 1KGXA 1KJ2H 3HCVA 1N6UA 1A7QH 1FVPA 4GUQA 1J4EA 2CUIA 2MEJB 4JIHA 1JUBA 1Z5HA 1L9PA 4DKAA 1Z9SB 1XU1A 5L88H 3G1HA 3DPDA 1JGVL 5CLZA 3OLEA 4NQCE 2E7LA 4U28A 5G4MA 3BAEH 2NVDA 2Y6FA 5FZDA 3JWOC 3NAPC 1IEBA 5E94B 5JQ6H 2YEZA 5SV3A 4PR4A 1LNUA 3A4EA 4XMKH 1QATA 1RZPA 5J1TC 1WOAA 2FMNA 2OJZH 2A6VA 4NQTA 4PP1D 3THMH 1CBVH 1JCJA 2VUYA 3H2CA 3N2XA 3AUVA 4LEOA 5JWPA 1R5WA 4EZJA 4Z1PA 4GXMA 3M8OL 2P52A 3EXJA 4XZBA 2X4SB 1UF2C 1VPHA 4D6JA 5LXGL 4HS6B 2OKTA 5F9AC 4WLCA 4G1EA 2I9LA 1VBA3 5K9DA 1NDWA 2AW2A 3NZ8A 4CCKA 5T3XD 1V0AA 4FP8H 5TSWA 4DS0A 2J4WH 4P9HL 1NJJA 5JDBA 5MEQA 1S7XA 2WO5A 3BV7A 3MYXA 1V0NA 1FJ1B 4Z1DA 5FK9A 5HQEA 4K3DH 5EO9B 5FCUL 1WCUA 4CAGA 1BQ5A 3V4PL 4LXLA 2NLIA 4CGUB 5SV5A 1TA3B 4LSBA 2HJFA 5B80A 4X0KB 1RCYA 5FZ4A 1C1EH 3VGBA 4AXKA 1FVDA 3FXGA 4BE3A 2JB6A 3FO9A 5HYJB 1H5YA 1A3QA 3IIXA 4LK7A 5AVVB 1D4M3 1KGCD 4S2SB 4JPVL 2V69A 1ZK9A 2H7WA 1PO22 1FH7A 5BV7H 4FLRA 3BESR 1UB3A 1QLRB 2NY5H 3KTCA 2BTMA 3KPRA 1GVEA 4AVNA 1F4XL 1FZJA 3M88A 3VQ1C 3V18A 3VIFA 4O1BA 3OHMB 4LRNH 4GWEA 3AMKA 3QH7A 4P7NA 5AG9A 2YPLD 2WM0A 4QTIH 3LTPA 1WKDA 3QC0A 2WXLA 2GFBA 4P7LA 3JZYA 2VZOA 4L05A 2AQOA 2FK9A 4OD1L 4DBWA 5I5JA 2UZYA 5EBLA 1I9IL 3GIPA 3IK2A 1GW9A 2B7YA 1YRZA 2O5XL 1L9TA 4Z0BL 2GMMA 1TSRA 4XZUA 5F5AA 2L3BA 3X13B 1U9KA 1EV13 1CLZH 1LJYA 1GVYA 5AB1A 3GHBH 1GNYA 4MAVA 4PG9B 3MWAA 4BF7A 2EDYA 1UU6A 1JCYA 3U4FA 2A1YA 4MYEA 4Z7IA 4NRMA 3KXFD 1CE1L 1H2JA 4IJRA 5D8JL 4LCWA 3RKDD 5FAAA 3WDIA 2ADIB 1LG2A 2P5EE 4Q7NA 3MSPA 2VDQH 3MTWA 3RTLA 3QNZB 4XO3A 5D6DC 3SXWA 1MXGA 1Z7S1 1J0YA 3QPYA 1B0RA 4FTBA 2XGIA 1BZDA 4MLIA 1DE4A 1I82A 4H3WA 1WB0A 4U1SB 4AUYA 1M4WA 4N22A 1SJHA 4P5TB 2A9DA 1FDJA 5C2CA 4X4YA 1KELL 3POFA 5FA4A 1IGMH 1CDUA 4GW1B 2EPNA 4YZWA 4LSQL 4MDRA 3VH8G 4NI3A 2YYUA 1MRCL 4FA6A 1A4AA 4ZQPA 4TSCL 4XFBA 4I88A 1ZCOA 1BYNA 4LASH 4Y5SA 2Y7FA 4M93B 2GTWA 3DURB 3HS0B 2J27A 1AMKA 3H50A 5D9MA 1PDKA 2OELA 1HSBB 4FFVC 3ZYOA 4S1FA 4C56B 1MQTC 1V5JA 3WNLA 5F3GA 1ZRIA 3APCA 3N2JA 1KFLA 2DQHL 3CNYA 3KH3A 1MCOL 4TVDA 1UZVA 2GYIA 1OD5A 1FWHC 4OFYA 4Z82A 4E3TA 5FKPA 3MJ7A 2J3SA 4HIEB 1C92A 1VBE3 1WLHA 2Y1ZA 4LLWB 4DVBB 3OAYK 3D9AH 5HYJA 2K8QA 3ML9A 4JIQA 4P2YA 3DC8A 4AR2A 5IB4B 1MRCH 3LCHA 3PAVA 4JO1H 2GJ6D 1IXPA 4TIMA 5I73C 3D85B 2X4QA 2V5YA 3T3YA 2YPVA 4U6VL 1SZFA 3GUTB 5IMLB 4YBLC 5BOZG 4RDZA 1WCDJ 4I0BA 4GRWB 3CFNA 2XWJA 4E42A 1BV8A 4OV9A 4MVBD 2R1MA 2MSPA 2ZOKA 4Y4KD 3VXPA 3X3FL 3WKMH 4F3JA 4EP8C 3A7QA 1OOPB 1NWSA 2I9LB 3WQ6A 4XMLL 3AG4B 4D6CA 1WAWA 5M94B 1TPVA 3T0AA 4CVXB 3LDVA 1G6VK 1TPH1 3B0PA 1JULA 5C7HA 1Q6FA 5CEYB 4OI7A 4L0YA 2AK4E 2QGEA 4DPRA 2BP5M 4ASMB 1OA2A 4UV7L 1O7DE 1GJUA 3KBSA 3VH8A 4WEEA 3TMQA 5T5JA 3SZ6A 3SE4A 2C8NA 3BTYA 5D1QE 1K03A 4U7MA 4D6GA 5A7NA 4F7TA 5G1YA 1NCUA 2ZXEB 3I3QA 5D2VA 2E68A 4PJ8A 3CEWA 2R1XA 2GQ3A 1Q5MA 3VI4B 4F80A 3ES8A 1D2SA 4L9DA 4JZNA 3NWRA 1U8CA 2OJ1A 3IDUA 3GU2A 4IRJD 3U14A 3HC3H 1IR2A 5EPAA 4CQAA 4UFIA 1E4LA 2YO3A 3MYZA 5A6XA 3LKQA 3QCTH 1W9TA 3GSUA 1KBIA 1DYKA 1S3HA 4QHPA 5BNXD 5KBLA 2N7AA 2DQTL 2YARA 4NRYB 2KQNA 4N1CA 1A5OC 2XFFA 3OZ9L 3QIUC 2OMTA 3IDJA 1ND2B 3B9AA 4DXRA 1G7PA 4L29B 4X50A 5JI9A 3A9BA 2PW1A 1V9U3 5D1XD 3ESVF 1OLZA 3V6FA 2NXZB 4YMZA 2VURA 1HS6A 1HRI3 4A6YB 4UTBL 2VVEA 3AP6A 3FUDA 5E93A 5J48A 3O9WD 3AYAA 2XVLA 5LGJB 4J6IA 3S4SA 4DBUA 4K1WA 4EAEA 3PWGA 4F0LA 5LA1A 2BFVL 5LBGA 2X4TB 5B2GB 1UQZA 1EZLA 4P23A 3IRSA 4L3CB 4MA7H 5CC3A 2DLIA 5GSRA 1E4XI 3QS2A 3Q6GL 5KYUB 3K2UH 3ZFEA 2YFOA 3TYBA 3W1NA 1NM9A 4YIQB 1B9KA 3ZMNA 2ZCKL 2QL1A 4A45A 4XGZA 2DT2A 1WA3A 4XVHA 4AMXA 2P8CA 2J79A 1FG2B 4LRSA 3W7RA 2IFGA 1EUUA 5IUSA 1E0UA 1M1SA 3IACA 2HA1A 3PNZA 4L4TE 2A6IB 2FZ3A 2W9LA 1NFPA 2V2TA 4RR3C 5IMOA 4Q9QH 4MVAA 1C5DB 2PHRA 5J7MA 1TTGA 3SRDA 2DW6A 3CZFA 5KHIA 2R6OA 4F2BA 3QDAA 3UJTL 1LCLA 4CN4A 4XMIA 5K7PA 2TRYA 1SACA 3UTSE 3N9KA 5C2XA 1LAJA 3D3VD 4GSXA 1KXVC 4XP1H 4X22A 5DHYB 3FB7B 3NPVA 1IGFL 1S5IH 3RFRA 1ITUA 4YGBA 4I2OA 4B9ZA 4QP0A 4QM1A 5D5MF 4H7CA 1OLRA 4YWGH 4AWEA 2QCMA 1LDCA 4Q7DA 3BW4A 1E30A 5A6JA 1KC5L 4PS4H 1X5YA 4BHUI 1DJZA 2ZZ1A 1N6QL 4RWYL 3TNPB 4TUKH 4AX7A 3WQVA 1FWDC 1DR9A 2VR3A 4BZ1L 1SHSA 1UMIA 1EPZA 2AKZA 4UMCA 2YOCA 2NV1A 2BERA 3MCLH 5CJXA 2JKLA 2ERFA 4KT2A 3U1PA 3P0YL 2UY4A 3UYRH 2Q86A 3MROB 2Y85A 3GMLB 2P3ZA 3MCKA 4W4OA 4LNRB 3J8F2 2XZAH 2VZVA 3VPLA 4Z7VB 2CA3A 3VKKA 1NAMH 2QVMA 2R94A 2V6HA 3GJFB 3FZ3A 2Z0IA 5PCYA 5M3WA 4DJEC 1MJ7H 1IM9B 1UD5A 1LP6A 4KITB 4GB33 3ARVA 1XLDA 1MN4A 1EYEA 5A2AA 4K3DL 2IGFL 4JNYA 4IHCA 5HHOA 5GZEA 1M53A 4O16A 2HVKA 1MCJA 3M7OA 2G9FA 4IBUA 3VVWA 4I9TA 2XQ0A 5EEUA 3QIBA 3VIIA 1H3WM 1QOXA 5ABTA 3QQWA 3CH9A 3GWJA 1KEXA 4FYQA 3DOHA 4S2FA 4F8AA 1OCWH 4AZGA 4ALAC 2MEV1 2ZYHA 1XR8B 4WNQB 2IXHA 5FLVA 4FTSA 2QUNA 2OKXA 3WJJC 3O0RL 1MAMH 3P74A 1S2UA 4G8GB 4P8XA 1RA5A 3PDOB 2PZ0A 3KGRA 4GQ9L 1QW8A 3N3MA 3FQTA 3HMXH 3PL6B 3S5YA 2GC3A 4PVLA 5IMOB 4NAEB 1J5IA 3ZZLA 3KPSA 2X41A 3DUUA 4FSAA 4O54A 4BEIA 3AVSA 3K5SA 5DRZA 2VWEE 4WM8B 4EYUA 3NNJA 5FYUA 5F2FA 4NT0A 3LRLA 2F38A 3BP7B 4OZHA 1H1AA 1GGIH 3WQOA 4P2RB 5CJ8A 1BVWA 3WW1A 2KAUC 2JIXA 5IVCA 4NM8L 4PG2A 3VXSA 1MR5A 1ZLDA 1JGDA 2X5PA 3L7EA 4TQPA 3CFBA 1O5KA 2WBJD 1RJ8A 3LA7A 3VX0A 1W37A 4NZTH 3NMBA 2PAEA 2F18A 5JYLA 1YHFA 3WNKA 1EO8H 3Q9PA 1YCIA 4CEYC 5DEJA 1KLUA 3OOXA 1F3DH 3NK3A 2I5YH 3ASOB 4MJ6B 1OY0A 4KVCL 3ARXA 3UJOA 4LPTA 4ENED 1TSHA 1JNNL 4QDGA 3FCSB 4M1GL 1XGEA 1MEC1 2J8OA 2GSHA 1OCNA 2NP0A 5AD0B 2X05A 3TIMA 5EBAA 4A55A 1IM3B 4G1KA 5JHLH 1AYN3 2IPUK 2TBVA 3LEYL 2ETEA 2WXJA 3LOTA 4CUBA 2LS6A 3GSQB 4N9BA 2NX1A 3VFNA 1IS5A 1QOSA 5HHQA 1B35B 1DJQA 1ME8A 3AG3B 3FQWA 4ATEA 1U5ZA 1UWRA 4GAZA 2A2QT 3ET9F 5FO9B 3R2GA 4JRXB 2E63A 1IBFA 4JY9A 3BIKB 3BSZA 2A4AA 1MNUH 3WP5A 4LAMA 4HKBB 4DGYH 3IWPA 3ARDD 4CMMA 4F7CB 3GNDA 1DVXA 5J0BA 1W6WA 3ZYIB 3HHRB 2ACQA 3PHSA 3TCXA 2XVNA 3LHUA 3KOXA 3N25A 4B9YA 3L17A 5BMXA 1IPJA 4M8UA 1M6JA 3KHQA 3FFOA 1U6AL 4UTAH 2IV8A 5DBTA 1V6OA 3W0WD 5KC5A 1EYBA 2PCXA 3X12A 1XGRA 2IAND 2NZ9A 3C5ZC 1W3XA 5K59E 4J1UA 1YQ6A 1T1XB 2UUDK 1L6FA 1WUVA 3VNLA 3BLPX 3EO9L 4JFQB 1I1AB 3QYNA 2V9RA 4REQB 1ZSXA 1BZQK 5IQMA 1E15A 2UWAA 2VFIA 1WFNA 2HJLA 4IM4A 1FWSA 3BOVA 1AJ0A 3MC0A 4OCRH 3S5SA 2DWTA 1BG9A 1HQ4A 3PN8A 5M17A 4J8RB 2ARXA 1INQA 1UYPA 4G80A 1O1ZA 3HE6B 2I17A 5C08B 3CWHA 4PUKA 3NCWA 4E9TA 2YZ5A 3GUTA 5CBLA 3GIZL 3SBWC 4C6EA 4IEOA 3FQXB 2XJLA 2FLMA 3VXQA 3LD8C 2F74B 4PB4A 4LB4A 4FFVD 4OSUL 3M0IA 2DMGA 4NZJA 1A5UA 2HWD3 2CEQA 4L3EB 4COZA 1PY0A 3G6JE 4YLZA 3C08L 5T5LA 4XAGA 1RP9A 4R97C 4A8RA 3S1WA 3QJHB 1BRLA 5F3HA 1A1NA 1PCWA 4AK3A 4GYBA 1V8HA 3R4SA 2YD2A 3L7RA 3FRUB 1VIWB 2CLZA 3PWIA 1HP5A 3HZVB 5CZXC 3SCGA 2EZ0D 3ZIWA 3TR2A 3N2CA 1P1MA 2ZDRA 1NY1A 4AZZA 2WSRA 1YEKH 3WE6B 2OBGA 3FUHA 5A6BA 4I77L 2NY4C 4JRXE 1BVOA 3E8UH 1R3YA 3GLZA 4HMCA 2REQB 4YZFF 2OP4L 4NZ3A 3N85H 2XXFA 5LCVL 3PAOA 4A7YA 5FUOL 2I26N 1V6JA 5EZJB 4K3EL 3WJSA 1XLHA 3MLYL 3BAXA 2ZUNA 1AR2A 4LE4A 1ZJBA 5IG7B 3SB3A 1MFDH 4B53A 1HXS1 4JEQA 2IQTA 2Y25A 3K6SB 1J79A 1TJGH 1GYNA 2YL8A 3VNYA 3L0KA 1SR9A 1BM7A 3RYMA 1EXHA 5E1QA 3ZGIA 4I9XA 3GDRA 2QCGA 2Z4FA 5F72S 3ZKUA 1DIEA 1HHJB 5FAGA 3KL3A 4XE0A 1QRKA 1RQHA 4N28A 3IPVA 5ACA3 4QX4A 4QDSA 4K23L 6PCYA 1GVFA 4HPHA 4J2PA 1E6PA 4GQGA 1PIIA 3TN5A 2EIJB 1P7QD 4JTQA 2QJNA 5HVGB 2FCUA 4ZQRA 3GG7A 4UNVA 3JQXA 4PQXA 4BJLA 3D05A 3OKNA 2QMJA 3G77A 4AHYA 1NTHA 5RUBA 3FWEA 4YHPB 1XGQA 1BWWA 2NV9A 2KKQA 1QJEA 4P23D 4HQVA 4ZVJA 4IIQC 4CXYA 2YMTA 1W6QB 2XKPA 1KCXA 3T3ME 3MJGX 4J5VA 2WYSA 5D1QB 2Z6JA 1FVCA 1V6YA 3NVDA 3C08H 5C97A 3EO1B 4XMWA 4OI1A 3OJBA 2XN9A 3GPEA 1U8JB 2NX9A 2W39A 1D7KA 1UWWA 2V7HA 3V1PA 2BNUB 1EJRC 3VFPA 1LEIA 5K0UB 4IE4A 2E56A 4G6FB 2AXFB 4MGGA 4Z95H 5TH2B 4QCFA 2FR4B 3UACA 3HFMH 4PRAA 5AZ2L 3QM3A 2A9NL 4KH2A 3TN0C 1YDPB 3R1GL 4XMUA 4WVZA 3ZHKA 1N5YH 3VDDC 2D93A 3QHTC 1OCRB 1WD3A 4N26A 4UFKA 1GGBH 3NZRA 4GRLC 4LLVA 4KROC 4U1LB 2ZGQA 4O2FB 5JMCA 2WIIB 3OKDA 3UP6A 3QORC 2OZ8A 4W1TA 4TV6A 1JN6A 2R14A 4RGNC 5BV7B 1QDSA 3QR3A 2JQMA 5FUZL 1D5BA 3OM3B 3OZLA 4TX6A 1MWAL 5CJOL 1JGEB 2JJTA 2R042 3O1UA 2J25A 1MSPA 2R1WA 2B46X 4TQTA 3I7SA 1GIGH 4GQZA 4GIEA 1FJ1A 2OMUA 3EO9H 3VXSB 5EUOE 5MEQB 2NDFA 3JWNH 4OFPA 4V15A 2W1SA 4OVUA 4XN2A 1NEYA 3UZZA 5C4WA 3NYZA 5JW3H 4L8DA 2DLFH 5IJVA 1MRQA 3THCA 3QWOA 3NBNA 1AR92 1XYOA 2LTNA 4XPAH 4IX0A 2JIEA 4HJEA 3PL6A 3EFFA 4O4YH 1C8VA 5BUGA 3K0WA 1FH5H 3F00A 2AQWA 4HWBH 4FG0A 3SNMA 4R7LA 1KBPA 5KN5A 5D2NC 3N2MA 1Z8AA 2MNWA 1ZZBA 3WGVB 3FUIA 1JAEA 1TR1A 1AYN2 1PY9A 1FG9C 4U1HB 1MWOA 3WUWG 3I59B 2Q6ZA 4MZ8A 1GMEA 1WDAA 4J12A 3VWKC 3L5XL 1VFBB 3NP3A 2XDVA 4Z3JA 1P0BA 4ANUA 1R9XA 1AD9B 4QHKI 4P2RD 4GSQA 1ND3C 2QNKA 4HJGB 2VXTH 3GDBA 3SJ3A 4LB3A 5JU6A 2CSPA 3AZTA 5INDB 4KXAA 1MACA 3AREB 5ACZB 4U7SA 5A3OA 2B9AA 3N34A 2WQRA 3D2UA 4JN7A 1SFSA 1PMHX 1P4BL 2WUBH 1WXJA 3MACH 4W7VA 3P3NA 1R1A2 1MO0A 1OGAD 3IV8A 2PUQT 3MI8A 3P77B 1E1EA 1LUCB 1INDL 3ZTCC 2NW2A 3CSGA 1JUHA 4NJJA 1ULVA 3NSYA 4YBQD 4LLMB 4Z0XA 4ZTPH 1SVCP 3GBMH 3TO2B 1N1TA 1XB8A 1NGZA 5A16B 3FNDA 2RH0A 2K3TA 3PNWB 3T65B 3H4WA 3KCPB 2RDRA 4PN6A 4LORA 5F7MC 1TLMA 4H8PA 3E2RA 3KCWA 1EP0A 3OWEA 2J1WA 4WO0A 4WM7B 1PIV3 1QR4A 2QQLH 1DQDL 4HLEA 1BQHA 2WNOA 4EI5D 4Y2NA 4XRCA 4FSJA 3CQKA 3LN4B 1OW0C 2IDTA 1L0YA 5D96B 3H6OA 3T8VA 4FNRA 5ADPH 1W0PA 4YS4A 1FP5A 4FABH 1EH9A 2WBJA 3LPGA 5FY7A 4CDQC 2GHZA 1E5ZA 1UP2A 4PTDA 4PL2A 4F8PA 2PAMA 2QQWA 1KYFA 5ERWB 4BWLC 3KTSA 1RUNA 2FB4L 4OF5A 4ZO9A 3B7TA 2BY0A 4O4YL 5FY8A 3LS5L 3C4UA 3EYQC 2BO0A 3WTTA 4YSRA 3OC8A 5E9DE 1JPTL 3LNGA 1V6IA 3RWJB 2X1TA 4KNSA 1SYTA 2VWTA 1XCWA 5L88L 2Q6WB 3GEWB 4ML4A 1OVPA 1QTWA 1ZFJA 4JQIA 3NYKA 5C3OA 4AYFA 4Q4EA 2XGZA 3LD8B 4LO5B 4AZUA 3WTSA 2P47B 2HWB1 1XB6A 1CX9A 1NJ9B 2ISVA 4QTHA 4FOKA 4D6DA 2ATSA 4FZ8L 2A6KB 3ROLA 1UJQA 4ELKB 5LG1A 4NZRL 4NIAA 1R083 5LQBL 1N55A 4X63A 3RZKA 4POCA 1UPMB 3KPQB 2KZBA 4GRWH 2GSJA 4HTBA 5JBFA 1C93A 2HFGH 4XXDB 4P46D 2AC0A 2W38A 1HJQA 1APNA 2J75A 3T4CA 4Y5TA 1Z5LA 3TN4A 1QUMA 3OQ8A 4K8RB 3BIBX 1CWYA 3ITQA 4IG2A 4F9LC 2EYSB 3GXIA 1KIUA 1KGIA 1UW8A 1W8GA 2XSBA 2R16A 4B9IA 3NQFA 1T20A 4YVWC 5E9NA 5ID1A 5CAZA 1NFKA 1N9PA 2MPVA 4A29A 2WKLA 4OMDA 5HDWA 4AKPA 2HPOA 4JDMA 3EOBA 5CU1A 2HPIA 4GJJA 2OWCA 5D7KE 3RQ0A 3FF7A 4GVFA 1HJSA 1P7KA 4NWTL 1XI3A 2X3AA 15C8L 2WWCA 1YBQA 3HMYA 1ZHKA 5DD5L 1EPFA 4G7EB 5C0DB 3KE0A 4B95C 2XV3A 1IQDB 4G1NA 2BOLA 3T08A 4WDIB 1FH5L 1XKJA 1NGXB 1PO9A 4MQ7A 3SDAB 4NJ4A 4UB0L 3QUZA 1C1FA 3T9PA 2BVOA 1EJUC 5DRCA 3WFDH 2YZ4A 5I2IA 4D9LH 3QI9B 5IK5A 3W6LA 4G3YC 3ZR4A 2PTYA 4Q4PA 1P1XA 4KWKA 5EOTB 4HPKA 4BZ1A 3BAKA 3SCPA 2VLME 7TAAA 3Q7JA 5DJYA 3MRDB 1TVNA 5D1XC 3N43B 2GUOA 1MUJB 3MDUA 3R0DA 4RQPA 5IAVA 5FZIA 1FCQA 1PLAA 5FZBA 4YWSA 4JUTA 4NNYB 3PNWA 2ZNWA 1OZUA 3QQ3A 3HZ3A 4K4KA 1QBLL 4HZLA 4DO0A 3CIVA 4HUMB 1S7UA 4QU1A 2GIXA 3Q6GH 5E6RB 5AC4A 2E46A 1YHPA 3PZVA 5GRUL 1CLVA 2K45A 2MH4A 4GKLA 5CCKL 3NFSH 4OCTA 3L4YA 4H7ZA 4XBGB 1ZA6A 4ZMLA 7REQB 2N59A 3VRIB 3QUMA 4U1JB 1GMMA 3C3VA 1OYCA 3BE1L 2NNXA 5TK4A 3ZKNC 1DBKH 2EEAA 3GSRB 3ACHA 5JNYA 5HHXL 3H3LA 2DVGA 1JVNA 3N44F 3L9CA 4YDLB 3BISA 1MPAL 3SDAC 4O8RA 2E5DA 1W15A 3MLUH 4KXDA 3NIDB 4HALA 4KVPA 3C0SA 1N8IA 5D8ZA 4C6CA 5ABFB 4JQ1A 9XIAA 3KXQA 5I1AB 3QLLA 2MMXA 3DXUA 4W9ZA 1SJCA 1FBIL 1XBRA 2E6FA 2FGBA 1NGWB 1R3TA 3MRIB 2DFAA 1F4AA 3NSJA 3S3GA 4UQEA 3PC0A 3PJUA 1VH7A 4I9MA 5A2IH 3GD1C 3LNEA 4YEEA 3L95A 4Q2ZB 2UWFA 1H63A 1HZKA 3I02B 4EOUA 2PMWB 1S2WA 3I6GA 1Q3NA 3RWDA 1QJY1 4J40A 1YYMH 5L9DH 4QSFA 3ZE0F 1ZPUA 2PWEA 2YPVL 1QSED 3SY8A 2BIHA 2LU3A 1RUPH 1AXSB 1RA0A 4ODHL 4XNAA 4W70A 3AKQA 1NQBA 3IXAB 2FYMA 4K3JH 4AL8C 3AT9A 3HBZA 3F8UB 1RVF1 4BFGA 3POHA 4Z0JA 1TJIL 3CX2A 1T0OA 1E65A 3IDNA 2VRQA 4PW9A 1A3RH 1PU0A 3B3IA 4XTRD 4TUJA 3EGSB 3OP2A 3KNBB 4QY8A 2GTQA 3OBRA 1ML0A 2YKLL 3GTNA 5C0IA 4LUKA 3RYSA 5E0KA 1LEGA 1JN6B 5EDSA 2O6CA 5ICUA 3PDQA 3JB8A 2OGJA 4HKXA 4AG0A 4KUCD 2YS4A 4FG6C 1EY2A 4X6QB 3ZRSA 4OF6A 3PVOA 1XQNA 2PP3A 3NJFA 5F9WC 3UPBA 1OX4A 3ICJA 5IAXA 1BHGA 1NC4B 4AL8H 2YPVH 2ZOTA 4MMXB 3SQOH 2Z31B 1UIPA 4D69A 5DO8A 2AV7A 1PYFA 2XQXA 4JFYA 1MCWW 4XZUB 5E2UL 4HD5A 1EWHA 2DTYA 5DO2C 5E8PB 4NPYB 4WENB 1MPAH 1NDMA 4CEWB 4N9DA 5BUAA 4G70B 4I2XA 3EJYC 2FDGA 5TAOA 2SBAA 1KFBA 1U93B 3TSMA 3CX5K 9PCYA 2F2KA 3V0BA 5K93A 4M6AA 2CLIA 3W9DA 4OLUH 5K9QG 4I3SH 2ORBL 4GP5B 3HN3A 2ARJQ 1ODZA 1W6OA 1SOSA 1J6PA 1YC8A 3N9MA 4AL8L 3W1ZA 3KLLA 3RILA 5ANME 3E49A 1X5XA 4QYAA 5CXPA 5CSGA 2GVEA 2D7PA 1DTUA 4LEXH 4QPIA 1VAKA 2PCPA 4J6RL 2WOQA 4KU1A 4A7ZA 2D69A 3L7FA 3EJCA 5DHVB 2V0TA 1F0LA 2DZPA 2OLHA 3F4DA 4SBVA 2SEBA 4L9LC 1CU4L 2YR1A 2ZDSA 3VZNA 5KSBF 1Y6KR 4BKNA 2GIYA 3GG8A 4C6FA 4P2RA 3KBVA 4HWEH 3LM7A 3LVEA 4HJ0C 2PCQA 4F7EA 5DRZB 2G9HA 3I2CH 1E5NA 3WLKX 4F58H 2W67A 5CBEB 3MWCA 1POQA 2X1RA 1CDIA 1SPDA 2WJ5A 3AO0A 3H55A 4PJBB 4A2FA 1UOZA 2DVFA 5C3PA 1OLQA 4HCHA 4PRIA 1KITA 3CVHB 1ID5I 4Z7VE 3NJYA 2GGIA 2B9VA 5CPQA 3HB3B 3L3IA 4CLMA 4JCMA 1SMOA 2V8ZA 5E09A 1QFOA 4QNPF 2G3ZA 1H5BC 1AI1L 2QHRL 3D09A 3IXTB 4LO8A 4WFHD 2VMDA 5HYJD 2AZ5A 4AFAA 1FOD1 1OK6A 5DTFA 3VX1A 5ABFA 1A2YB 1K9EA 5TQ2H 6TAAA 4FS0A 2QSCH 1CECA 3B5LB 5JNYB 3KDPB 3TA6A 3GO1H 4BFRA 4CSZA 5E1HB 5H9RA 4NRZA 5FXCH 2HEVF 4EI5A 4AW7A 4YDLC 3QUMB 4NAFA 3ZYFA 4GI8A 4N2LA 4BDVB 5IVNA 3HF3A 1Z9SA 3BH9A 4O5LL 1WJ3A 1A5FL 4OD2B 1ZVHA 1WCGA 3CVHH 5B21A 3VXUB 3FQXA 5KS9A 4ODUA 4HIPA 4ASTA 3QQ9C 2WJSA 2C4FU 4LCVA 3KYKH 1Q6QA 5TQLA 4KNCA 4DP1X 1WDWA 5D38A 2CLPA 3NQKA 5EWIL 3BTAA 2PABA 5HMFA 1NFGA 3PG2A 4K5MA 1AG6A 1PKOA 2B0SH 4LKXB 3KV9A 2VH9A 1E3FA 3PNRB 2AQRA 1T22B 4QLLA 2DLGA 5IB3A 2G60H 3D30A 3NJ3A 4A2SA 5LNSA 2YR3A 3GH7A 2GUOB 1R7AA 3DVNA 3TZVD 3MRMB 2E27H 2H3NB 1HOCB 2KPWA 4LFHD 4KI5F 2NX5D 5CD5C 4QRSA 3S1GA 2LR4A 4MMZB 5L6UA 2Y5SA 5C6CA 3AUJA 1F3TA 4CA4A 3AU2A 4FKKA 2WQZC 1TWIA 3A5FA 4NNCA 5DJ0A 1NIFA 3FTUA 2NWRA 4V1DD 1W2NA 1NIDA 3GSVB 2YGPA 3VKCA 4GAYA 2VDKH 5FMOS 2QKIB 1PSKH 4KQ4L 5CCGE 1QDCA 1RMU2 4AZHA 5E00A 4HISA 1M2VB 4Z1BA 5E9DD 4KWVA 1I8KB 3CXHK 5DK3A 4NIIA 4ZMAT 1UC6A 1UACH 3HA0A 2PXYD 1JI2A 1PZDA 3QIUA 1VD6A 5DUJA 2C0HA 3BEVB 3M43A 3FXIC 5HCBA 2XYLA 3N9SA 2AUYA 1SQ2N 1UXZA 3ZJKA 4X6RB 4LBAA 1TRDA 2W6RA 1UD8A 4AI8A 1BQLH 2MCAA 4FI8A 2E6JA 3I2JA 1J5TA 2XT1B 3OA5A 2F7PA 5JMUA 1T20B 3V56A 2A2IA 4IOTA 3G1DA 3VKAA 4DBDA 3FYIB 2B77A 3MRLB 4ZAKA 1D4VB 1GC1H 3SQRA 1R3QA 1Z9NA 4PJFA 1XB3A 4LPWA 2C3VB 2HFFA 3GH5A 1V79A 2HROA 3V7AG 1S9YA 5A7WB 1OHLA 4QJ4B 4NJHA 1PZ3A 1RIHL 3DENA 1PYWB 4G9SB 1PZCA 4WX2A 4XN7A 4DP0X 4GKNA 2NUTA 4HF5L 2ZOWA 4M01A 4URKA 3N29A 4XVOA 3EFOB 4RNIA 3ZJ6A 2YHJA 5EL1A 4A6YL 2TUNA 4K7PL 1TFVA 3H24A 5IEKA 4N2NA 5LATA 1RBAA 2H0JA 2AXWA 2VOVA 3ZYZA 4ZE4A 3N0PB 2WJDA 3OPUA 3J7NA 3WQ5A 3ZMRA 3KPMA 3FMGH 3II3A 1RIHH 4YHNB 3GXFA 3IDGA 3OY8A 1QMJA 4CVZB 2NNAB 3PJSB 1AQMA 1Y9MA 3WQPA 5BZXA 5IROC 4AEDC 3KYNB 1SBEA 3DTXA 1NL0L 1XUUA 4YAQB 3RTQA 3RZWA 3R0UA 2ID5A 5BRQA 1JCTA 2X1WL 2BVVA 3H2PA 3BVTA 4LP8A 2JXMB 5HGDB 1A65A 4Q7BA 4MAUL 5EU4B 3ZPDA 3WS3A 2AEPH 3RDTC 3S3SA 2NY0B 3QIBB 3RHGA 4Q9BA 1DDHA 1I9RA 1Z89A 4FOWA 5LBSA 3U25A 2YC4A 2X2HA 2NUPB 25C8L 4LVAA 2HH0L 2CGRH 5CZJA 1ID2A 4IEZA 5CA6A 5K9OA 1DLLA 4ELME 1E2VA 5KBFA 1UU5A 1GVQA 3SCFA 4KHXL 3W2DH 3MF6A 1Z1WA 1IS4A 3PWLB 5IK7A 1IOAA 3K8KA 4U3XA 4AGOA 4E4SA 32C2A 2AEOA 5HI5C 5HHOD 3RIAF 4LCIL 4HJIA 2ZACA 5I75B 5FYVA 2GOUA 2QR0B 4XVUC 3CSYA 3D0SA 1WPCA 3M0YA 3GUFA 1ZT4A 1EBGA 3S2NA 1O8SA 4TULL 2ZZ3A 3UTSB 1CICA 3W38A 8RUCA 4DUWA 5HYIA 5I79A 2GSIB 4UBDC 1WBZB 3CC5B 2WQXA 1RXLA 5I0ZA 4JS7A 2DWEB 1E4KC 5E1GA 4IBSA 4OAWB 4P2OC 5C86A 3EEZA 2ISSA 5GGSA 5HNUA 5FL0A 1WCBA 4QTIL 1BEUA 3CFTA 3CH1A 2ZHMA 1ZALA 2EC9U 4Y4FD 2BS8A 4UF7C 1MJJB 4NXSA 3W9EB 1A2YA 2EHHA 2JI2A 3KLSA 1CFMA 4BR1A 4D1JA 5B1BB 1DG6A 4OQTA 1CFTB 4F48A 5IW1B 1AGFB 1QCWA 3IKWA 4W9JC 3ECBA 1ACZA 3IE9A 4GO6B 3HGJA 2BZDA 4ZSOB 1KF9B 2W07A 4UR8A 1XNAA 4NQXA 2FGZA 1LP9B 3FLRA 4JGNA 4PRHA 4RAUA 1I8MA 3W75A 1YWKA 3V36A 2GPZA 2ACUA 5C7VA 2H3KA 5CB7A 3UGFA 1YIPA 4P9XA 5AHIA 2HT4C 1U1JA 5DFVC 2QFRA 4E0RB 2WTRA 4WO4A 1FFPB 3CB3A 3GI9H 5D1QD 2P48B 1DSFH 5JZ7D 3ZL2A 5IQLA 3MTRA 4KL1A 2V72A 5I6NA 1UENA 3MBXH 5C54A 1FNGB 4NUPA 3M8LA 1HHKA 4Y16C 1M71B 1ZXKA 1QI3A 4HN4A 3NACL 4R27A 4QT6A 3QJQB 3T07A 3N85L 5LCVH 4Z7UE 2OP4H 4WRHA 1AC6A 4JZJB 3G3MA 3RI5K 4X6DE 4LEXL 2NYYA 3IRPX 1EZSA 4TPRH 4JDEB 2FDKA 3MV8E 3AJYA 4XWOD 1AVAA 5LJYH 1GZTA 1K8CA 1C3HA 4FA8A 1IWPA 3LYRA 3FB6B 1Q1PA 1UM5L 3FN9A 3UTPE 4IIFA 3ULUE 3I4KA 3WOGA 4G9FA 3ARDA 1ULDA 3R06A 5GS1A 1W1TA 3M5VA 3QXWA 3NABL 3DBPA 1VZGA 3PJLA 4KDTA 1QJX1 2YPLE 4AY1A 1YFWA 1X9UA 2CQVA 3B5GA 3TN0D 4PTXA 4N0UB 4ZO6A 1BXAA 3MDJA 4DKEH 3CFKA 4DAGL 2QQKL 1FA2A 1AMYA 2X38A 3H4FA 1JS4A 6XIMA 4FNUA 3P4MB 1YA5A 2AR6A 3KOYA 4Z7WA 2FHCA 3O3AB 4F7PB 5EA9A 1L7LA 1OXCA 5T26A 4KXZI 4U1MB 5C0ND 4LQ1A 4QXTA 4JN1H 3IS4A 5CO1A 2IAAC 3S5LG 4JDNA 3E2VA 2VC7A 3WD5H 5FXXA 3W1TA 2ID4A 3G6MA 5JHBA 4K5LA 1XLKA 3CLEL 3ORWA 5CLYA 1KBVA 4GRWF 1V9U1 2B7QA 5MENB 5LLIC 4HSLA 5F96H 2ZXBA 4K94H 3FCBA 3SBQA 3NV1A 5CKNA 5JR1H 1JXGA 3U75A 4ZENA 3B2MA 1KLGA 2NCEA 5G5DA 3MBEC 1OQEA 2YPKB 2BSTB 3QZPA 5J1XA 5FMDA 2D6MA 1PAZA 1RJLB 4PY8J 3IIOA 4L3EE 5ENWB 4A22A 1R092 2ZKMX 3P0VH 3QE5A 4KPLA 4NJ9H 4QRFA 4NQEB 3OEBA 3KW3A 1QVBA 3PZOA 5IJCC 4BCUA 4EBQL 5DMMA 4H8VA 1MMFA 3CUFA 4X2UA 5IVXE 1CNVA 2HNHA 2ABAA 2A9CA 2HEYF 3RIFK 3BH8B 1MNUL 4N02A 4IBTA 5CR1A 5HR6A 4IP5A 2WWUA 1BFVL 2DZXA 2P8LA 5DHVH 1ADQL 4AFBA 3HPJA 4PBXA 2HWC2 4H9TA 2QPEB 2B9BA 4JGZB 4UU9A 1NAKH 2P46B 2FWUA 1ZE3C 2D43A 3JQOB 2VHLA 3N5AA 5FUNA 4NQ1A 3ERPA 3UWQA 1NYWA 3GJEA 4C57C 2IANB 4MRCA 4O14A 2OUJA 4PJ5E 3D4ZA 3HHSB 4ODVL 4Z7QF 4C1XA 4Y1UA 4RGOH 2FH6A 3V6ZB 3ARRA 1W0MA 2C1HA 3QISA 1OA4A 1MFUA 3K71A 3PTQA 4MXWA 2A0LD 1GYMA 2YROA 2LFGA 1L2QA 1OVSA 4AH2A 3MO7A 1GJWA 5D9SB 4OCWH 2ZBJA 1IT9H 1G7VA 4UTJA 1RMFL 2AL1A 1VAMA 1R9YA 4AQ1B 3B1UA 5L2KD 4KO9A 5C0EB 4GXUN 3NTCH 5FKAB 1EJOL 1ZGLP 4RE0A 3Q2WA 5FJIA 1E9OA 1XGZA 3QQ3B 5AKVA 3KW7A 5ITFB 3B04A 5FQ0A 5CG7A 3QNZA 5C3TA 1GR3A 3R4IA 5I03A 3LMJL 1YADA 5AHEA 4ODXB 4LCWB 4C7GA 5AVWB 5E70A 5CN1A 1NF7A 3AMQA 1FUNA 1WAAE 3MDWA 1OF2B 3P0WA 4JHUA 2CGRL 1JGLH 4K07A 3VWJC 1VPXA 5MI0B 3CWGA 4ZXBD 2J1UA 2OKOA 4Q58C 1QEWA 3PWUB 2DJLA 5FB8A 3RUBL 2EPHA 2PE4A 3I97A 1CJPA 4RSUA 1HL4A 5E6IC 5CYYA 3DUGA 3BAEL 5I28A 2YC1A 4XMPL 1QSZA 1G7IA 2YAFA 3R4DA 2QJJA 1M04A 3ES6B 3VWJD 4M1DL 1YBQB 1CIUA 3OVUB 3ZSSA 3EYUH 4EUPB 3BYWA 3IETB