3ZR5A

Structure of galactocerebrosidase from mouse
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
641
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Insights Into Krabbe Disease from Structures of Galactocerebrosidase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 218
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zr5A01
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3zr5A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zr5A02
3BH4A 3VD3A 2QF8A 2D22A 1XSIA 4PMQA 1BHGA 1CENA 3CZJA 1UR4A 1OINA 3AIUA 2V3EA 3WMBA 3ZT7A 1B30A 2DT2A 2XSAA 3T09A 2JIEA 3APGA 5CPTA 3OGSA 3WH7A 2IXVA 2JFEX 4C7FA 3VKKA 2WZEA 3HJEA 1MXGA 3ZJ8A 1UD5A 1J10A 4AZCB 1H3GA 3A4AA 1A47A 4JFUA 4QCFA 4GINA 1ITCA 2QQWA 5FKYA 3VD4A 4JAWA 4ZENA 3WDQA 1HKMA 2DDXA 2JE8A 4NZJA 1QW8A 4M29A 3LXCA 4W7VA 2BY1A 1G5AA 2XWDA 2E3ZA 3PZGA 4D6JA 4UCFA 3WUFA 3W37A 3BMWA 1C8XA 3ARSA 2ZUVA 1UR8A 4CCEA 2VRQA 1ZL1A 4LX4A 4MNKA 3L4TA 1VENA 4D6IA 1X6LA 1RH9A 2J8FA 1JYXA 3CZSA 4F79A 5DO8A 1QWNA 3H3LA 3CZKA 4HPGA 4ML4A 4CN4A 1CXEA 2WMKA 1B3WA 2ZUUA 2CYGA 1M01A 1HKJA 3B9AA 3OGVA 2GVYA 3RO8A 4B1LA 5FL0A 4AIEA 2WBKA 3W24A 1DP0A 2E4TA 3SCWA 5BYWA 1V6XA 3LXBA 3QHNA 5D8ZA 3ZT5A 4GO9A 3U5YA 4CCCA 5LA2A 3EDFA 1MFVA 5E0FA 2J7EA 3BAIA 3S5QA 2QLYA 5ECUA 1JZ8A 3L4XA 1E6PA 2G3JA 3PBGA 1KTBA 3GM8A 1OT2A 3SC7X 1Q6DA 5A8OA 1FOBA 3M6DA 1ISYA 1V0MA 3WF4A 1TVNA 2EEXA 3RM4A 3F5LA 4H8HA 5E70A 1ZJBA 2WXDM 2E8YA 3NJ3A 2BY0A 3BVWA 3ARWA 4FFHA 1Q6GA 4H04A 1Y7VA 2GK1A 3IJ8A 1GOIA 3MI6A 3L4WA 2A3AA 4PMUA 2VT0A 3VIJA 5A8NA 1BG9A 4TX8A 4MAVA 3RPMA 1EO5A 2F1AA 2IGTA 3ZR6A 3SCRA 4TTUA 1LG1A 4PSRA 1EIBA 1JD7A 1KGUA 1NARA 2MANA 4ATWA 3AROA 1GJUA 4HMCA 3W82A 1B3YA 1MW0A 1VB9A 1CXHA 4DO5A 2PWDA 3A4WA 3AXHA 5I5RA 3HZ3A 4AIUA 1AMYA 3PHAA 1BVNP 2WHMA 1J0YA 1UWSA 4CD6A 4F9DA 3IJ9A 3SUSA 2XHYA 3ECQA 1UWUA 1PBGA 1E56A 3ZJ6A 2G41A 1EDQA 2AMGA 1NQ6A 4W84A 3LEMA 2ZUTA 1HF6A 3OLEA 3EJUA 2XSBA 1G0CA 3IMMA 4D1JA 1KR1A 4PN2A 2CIPA 2V5DA 4PTVA 1CGXA 4JFSA 2J7CA 2EADA 4FLOA 3DECA 4W86A 1H0IA 2QQVA 5JBFA 4ACZB 4OZOA 2VX7A 2WHLA 2E9LA 1UD4A 4D1IA 2CBVA 3FHAA 5A6JA 5FL1A 4YHEA 1UR1A 3UG5A 1GQKA 5IFPA 4JHOA 1NP0A 1WZKA 1R86A 4EAMA 1W1YA 3WNOA 1VBUA 2CNCA 4X0VA 3BAXA 5A8QA 2OYLA 4NF7A 1FP9A 4XX6A 2D0FA 4DO6A 1OGSA 3QGVA 3II1A 3RWKX 4LXFA 4HOZA 3MV11 1V6YA 1RP8A 3WY3A 2CITA 4PTXA 3VIIA 3WF2A 1ESWA 3OB8A 4KMQA 3WUBA 3UR7A 5I78A 1V3JA 4OBRA 2VCBA 4AYSA 2PI6A 3QOMA 3T2OA 2J77A 5M03A 3PZ9A 3CZGA 1V3LA 2CKSA 3ZT6A 4MB1A 3NYDA 4WSJA 1NH6A 3BVXA 4OKDA 3TP4A 2J7BA 2FHBA 1JGIA 4ATDA 2QMKA 1BPLB 1E70M 1FA2A 1CGVA 5ABFA 5HPCA 3SUVA 2XJ7A 1E6QM 2XIIA 3IAQA 3AZRA 1EOMA 3WY4A 5I3DA 4PMDA 4S3JA 1W2VA 1NWRA 3AIWA 5CGTA 2OYKA 2RGLA 3WH9A 4AZHA 5A95A 4UQAA 4S3KA 3BSHA 1TA3B 1E6NA 4CN1A 3OG2A 4BZYA 5A6BA 2VRJA 3BUBA 2BNJA 2FGLA 3GXTA 2AEYA 4QAWA 2J7DA 3NDYA 1KXTA 3UETA 4MNLA 4Y7EA 4UQBA 3BSGA 1G01A 1HJQA 1TCMA 3D52A 1R47A 3HMCA 3VDCA 1EDTA 3PTMA 4YN5A 2W4XA 3ZMRA 4AEEA 1HVXA 2F1BA 2QPSA 1BYCA 2WBGA 2WMGA 3HBKA 1QI3A 1V02A 4AZ5A 1E43A 4QLLA 2YOCA 4DWSD 3N12A 5A3HA 1XD1A 2ALWA 1ZBCA 3AYSA 2W91A 1WE5A 2WZHA 1QI0A 1EA9C 2X1IA 2VCCA 5FK7A 3AHZA 4PMZA 5TD4A 4PCSA 4KRTA 1VFOA 3SEPA 4JL2A 1J18A 2F7OA 3GXMA 3TA9A 1ZS2A 4P8WA 3WDIA 3SCVA 5A2CA 1J11A 1UKSA 2G3IA 4LYQA 4PTWA 1H09A 1US3A 4UFLA 1GUVA 5JBEA 4H8VA 3U75A 3SIMA 2PWHA 1NOUA 2DQXA 3IAPA 3VD9A 4JHZA 1WNOA 4GO8A 1UUQA 3CHEA 1OIFA 2XYLA 4AD4A 1BAGA 2PC8A 3AHXA 4UNIA 2CERA 3GNPA 2C8NA 4HZ7A 1NP2A 3M07A 1B90A 4WKHA 4AZ6A 4HZ6A 3OZOA 1S46A 3CO4A 9CGTA 1JDCA 3AMLA 3CHDA 2NT0A 4TOQA 1QX1A 2WCGA 4PBGA 4IPNB 4DWSB 3DX3A 3H54A 1TR1A 5E6ZA 4AZZA 3BC9A 4AMWA 1PIGA 4HMEA 1EO7A 2OW7A 4QP0A 3UESA 5AYBA 2Z1SA 3SCUA 4JL1A 5I0DA 1CBGA 3W0KA 1EQCA 5JUVA 2VX4A 3SCNA 8A3HA 1FHDA 4FF5A 3HG5A 2ZWYA 2VR5A 5CG0A 4JKKA 1C93A 3LIHA 2PWFA 1HJVA 1B31A 4Z2KA 2GJXB 2WSKA 3GBEA 4UFIA 3T2PA 3BLKA 4JIEA 4TTGA 3JUGA 3MUIA 2E0PA 4AD2A 1JL8A 4PYSA 3ZM8A 4U31A 1SMDA 1TUXA 2DH2A 2GUYA 3BCFA 3WNMA 1A3HA 3PZTA 3MV01 5ABEA 2VMFA 3FAWA 1UD3A 4URIA 3MO4A 2GFTA 4CVUA 2D1ZA 2DSVA 3VIMA 1C92A 2XN1A 2WB5A 2HISA 2ZUWA 3TTYA 2VQTA 1GCYA 3GH5A 2YLLA 2VX5A 1HX0A 3N04A 4UQEA 1WCGA 3N11A 2A3CA 3UCQA 5IHRA 4EKJA 1B1YA 1VAHA 3VIFA 1WZMA 2VCAA 2UY2A 2UY5A 4AXNA 1BQCA 3B8SA 5AC4A 4ACYA 2VZSA 2YFOA 2E9MA 3I3DA 2QPUA 3ZOAA 2EACA 3UG3A 5JBDA 2WMIA 5A6KA 4J3UA 2JIWA 2BVYA 1C8YA 2FYVA 1V3IA 3K8MA 1AVAA 1VFUA 2WNWA 2V3FA 4FLRA 3WN6A 1J0JA 4BQ2A 5I79A 4U2YA 3VNYA 1E1FA 1AQMA 2Y2WA 4TVDA 1QBBA 3N17A 2EPNA 3EJRA 1CYGA 1HXKA 5KEZA 5D9MA 3ZJKA 5D8WA 4PMOA 2W63A 3SCQA 3NMBA 3MMWA 2AEZA 4PTMA 1KBBA 1J0HA 1MQPA 4UQDA 3GXPA 1WZAA 1ISWA 4MAZA 4U5IA 1MWOA 3MU7A 4U2ZA 1GOOA 3LFIA 2CBIA 1V0NA 4W8AA 1GVIA 1Q4NX 4BQ4A 2WMFA 3WF3A 3ARTA 3POCA 6CGTA 1O7DC 4M8UA 1WB0A 3SCTA 2D23A 4WJXA 3VDAA 1JAKA 4HOXA 3AJ7A 1GHRA 4MB4A 3GDBA 4TUFA 2WVUA 2IXUA 3EMCA 2EXOA 3WBEA 1K9TA 5BROA 1HKKA 2DT3A 1VEOA 2J7GA 3WBAA 3WDPP 3AOFA 3ARYA 3T0AA 3VGGA 3U7VA 2OSWA 3UERA 4UFHA 2VVSA 3W29A 1CGWA 2JEPA 1UKTA 2AOSA 4U33A 1GQIA 2XWEA 5E0CA 3VIOA 1VJSA 1JDDA 2BHUA 1F4HA 1QOXA 1ST8A 3A6OA 3FNDA 3RDKA 4IM4A 1HL9A 4YPJA 1NOFA 4AYGA 3CUGA 3NSNA 2D0GA 3BAYA 1UQYA 3SUWA 1CXKA 3FY1A 3VGBA 3W27A 1FH8A 3WFLA 3K4AA 3CC1A 2EBNA 1UWIA 3PZUA 4MB5A 7A3HA 2DIJA 1UASA 1DWHM 4LGXA 1HNYA 2XVLA 1V02E 4AD0A 1Q6EA 3AIRA 4NXKA 1KB3A 5BXTA 3WH8A 5ABHA 3MMDA 2XFRA 4LYRA 1UA3A 5CQ1A 4UFKA 2NW0A 1MW2A 4PMVA 4NZFA 4P7QA 1GNXA 3OA5A 2DT0A 1NWUA 2FE0A 1HVQA 3OLDA 3VIGA 5A2AA 3D5HA 5CPQA 4J27A 4E2OA 2NT1A 5FK8A 3IGUA 3QHOA 3FXYA 2ZE0A 1BGAA 3AMCA 2X0HA 2WW5A 2WC4A 3AICA 4GZJA 1KQYA 4AEFA 3W6LA 2WZIA 3CUFA 5HXMA 1E0VA 3AZTA 3MSGA 3ALGA 2YIHA 3O2LA 3WNLA 4XB3A 1UWQA 4JKLA 4B1MA 4RE2A 3U1XA 3PZVA 2WWDA 3L2LA 1BG4A 1CZ1A 3WQ4A 1E1EA 3VGHA 1U33A 3PIJA 5A8MA 2OSXA 1GOWA 1G94A 1D7FA 4DO4A 3PZOA 4FFFA 4OIFA 1ODZA 1JYVA 4PEEA 3DDGA 1Q6FA 3A22A 4MNMA 2VJXA 4TVUA 4AMCA 1TQVA 1M04A 2JALA 4HP5A 4A3HA 1E0XA 4GPNA 1OBAA 4E8CA 1ZU8A 1ZBKA 3GYCA 1QNOA 1CXLA 1QNSA 4Q22A 5ABFB 1KXVA 1C3FA 3D51A 5CLWA 3W81A 1SFSA 1UR0A 4QLKA 2JF6A 3D4YA 4UOQA 1E55A 4TX6A 3ARVA 2QV4A 1L8NA 3VU2A 1JD9A 4PSPA 3WY2A 3LXAA 2J79A 3HG4A 3WELA 4WIWA 4D6HA 5EMYA 3VD7A 2WCSA 1W2TA 3AIEA 3WDRA 1TMQA 3AZSA 1DWGM 2Z1KA 2ZX5A 1JZ6A 4J3XA 2X8RA 1XCXA 1H11A 2WMJA 3RILA 3SCOA 3A4XA 2D20A 4JZ5A 4QHZA 1TZ7A 4P7LA 3ZSSA 1W1TA 5I2UA 1UKQA 1DWJM 1QHZA 4CD8A 2OLHA 1QNRA 2DIEA 2F7RA 3GXIA 4B3LA 5BCAA 4TXEA 1H0GA 1JZ5A 5CSYA 1MQQA 3DHUA 3RM9A 3WQ5A 2ZXBA 3VUPA 2ZUNA 1W1VA 5BXRA 1EHAA 1QHPA 4V2XA 1PJ9A 4UOJA 2CPUA 2VZTA 4W85A 4P7NA 5A6SA 1U30A 5BWFA 3VNZA 1UYPA 3F5KA 3SCPA 2VUYA 2VZUA 4JFWA 3WL0A 4H41A 3PTQA 3KL0A 1XYFA 5DEZA 4AZGA 4HOWA 1X6NA 5A1AA 1V0LA 1NOWA 5E9AA 3A3HA 2FHFA 2BHYA 2CXGA 1OIMA 2A3EA 1MXDA 2F61A 3EDJA 1I75A 3WDHA 2XIBA 3EMQA 4J7RA 4KGLA 1H2JA 3ARXA 3W25A 4GI6A 3K4DA 2BHZA 4PMRA 1UH3A 1NWSA 3LPFA 2PB1A 4QCEA 3LDRA 2EPMX 3CBWA 3PIGA 3POHA 4NXSA 1TFVA 3FHQA 3NSMA 3BUIA 3RIKA 1V3MA 4BF7A 3F4VA 1BYDA 4D6EA 3T0BA 1JZ2A 3H55A 1F4AA 1M53A 3CMGA 1FH9A 5D4YA 3ARZA 3D50A 3VMNA 1WDQA 2J8GA 3L4ZA 4NI3A 1MW3A 1HN1A 2CBUA 1VFFA 2J25A 3WUGA 2BXYA 4W5ZA 4IISA 1JNDA 3RM8A 5CXPA 1JI1A 3WNNA 2EPOA 6TAAA 3CMJA 1CECA 4KH2A 2Y8VA 4V27A 1XCWA 3S5YA 1HJWA 5I23A 5FMCA 3LRMA 2VX6A 4ATLA 4MTVA 1QNQA 3ZR5A 1E40A 2EAEA 3EJSA 2OW6A 2DPEA 2UY3A 2X2HA 1E5NA 1KCLA 4PMNA 3D4ZA 3GXFA 3MUAA 4HTYA 4FNRA 3RMEA 1ITXA 2GDUA 2OWXA 2PF0A 1JZ3A 3UG4A 3ZQ9A 3L4VA 1J9YA 4RE4A 1H1NA 1OT1A 3M7SA 3N18A 2YDRA 2YFNA 4LPCA 4AW7A 2WVSA 3T2QA 2VO5A 3HG2A 2BY2A 1KGWA 2X09A 2WANA 4HPHA 4EK7A 1QI5A 2FHCA 5GNZA 3UGFA 3N15A 1EDGA 2YDQA 3AIQA 4ACZA 1LL6A 1V08A 5FIPA 1JFXA 3K8LA 3DX0A 2WCAA 3TTSA 3AIVA 4EANA 1BVZA 4UFJA 1D3CA 4FFGA 2OWCA 3I3BA 4GXPA 3WFZA 5JIPA 2WVVA 4BA0A 1KXHA 3BVUA 4GIAA 1E72M 5D9PA 3A24A 4XV0A 1WDSA 3WMCA 2X2JA 4CUCA 4N42A 1T0OA 1BYAA 4UFMA 5M17A 2GSJA 4UR9A 2FDMA 3J7HA 4P7RA 4CGTA 5IDIA 4WF7A 1E3XA 3QOKA 1J0IA 4RL3A 1W9DM 2WYSA 1XC6A 4CU6A 2EPKX 3DDFA 2WC7A 3DX2A 3KZSA 3KL5A 2O9OA 2O9TA 3W53A 2XG9A 3EJQA 1CLXA 4Q7NA 1RPKA 3LX9A 3DX4A 4JCMA 1Q6CA 2G4FA 3PN8A 2CHNA 3WF1A 4DM2A 1EXPA 5FMBA 1GOKA 4JFVA 5I6SA 2AAAA 2DSKA 4MJ2A 4F8XA 5HDRA 3DC0A 3WDJA 3VINA 2ESCA 1XH1A 1G1YA 1XGZA 2V3GA 2BVDA 1QWUA 1MQRA 1CPUA 4WKAA 3HG3A 1K6AA 1ISXA 1W9XA 1W3LA 3GNOA 4FNTA 1HJUA 4M56A 5M3WA 5CSUA 1GOMA 1SZNA 3GH7A 2XVGA 3WH6A 4BQ3A 5D9OA 1E6RA 1OB0A 3T08A 1BF2A 3O9NA 2WPGA 1LJYA 5I77A 3BLBA 3BUPA 1HWWA 2IUZA 4NRRA 3E1F1 3W4RA 5GNYA 4Z2IA 1VFMA 3LMYA 2VC9A 1B3VA 1UD8A 1C91A 2YL8A 1GQJA 2ADEA 3EDDA 3ARQA 1BGGA 3KLKA 5IHSA 2YJQA 2D73A 1BTCA 1SMAA 1CGYA 5CPSA 4HA1A 4OGZA 1JG9A 1VEPA 2PWEA 2Q8XA 1HP4A 2YA1A 3BVTA 2GJPA 1US2A 4BCEA 1JXJA 3AHVA 3OGRA 3WD1A 3LDKA 3DHPA 2XTKA 3GTNA 1GW1A 1UQZA 2WSPA 4AD3A 4ZE5A 1W32A 3MUY1 3EJPA 1CLVA 3S2CA 3EJTA 1GZJA 4P8VA 4DWSC 1EHNA 2VTFA 2PWGA 3VMOA 3PTKA 3LPOA 1IZKA 1KGXA 1ZJAA 3BXWA 3A23A 4RE3A 5IFTA 3FN9A 1FFRA 5C70A 2G8ZA 1XD0A 3TONA 1K9EA 2VZVA 1MW1A 2J7HA 4HU8A 2FGZA 1EOKA 1AQ0A 1OSEA 1UWRA 2VVNA 3NCOA 4FLSA 1ZBVA 1JF5A 3ZIZA 1DHKA 2VZOA 4CVWA 1AQHA 5FD0A 2DSWA 3UGHA 1U2YA 3OSDA 5FKBA 2XVPA 4QLJA 2EABA 3AMDA 3AIBA 2WHJA 1R33A 4JCLA 4WLCA 1TVPA 2YA2A 4LQ1A 1PAMA 3CZNA 3UR8A 3BMVA 1PPIA 1V6WA 1W9BM 1GORA 4Z2LA 2XUCA 1J0ZA 4ZXOA 2J75A 1R87A 5C71A 4AISA 1GPFA 3AI0A 3TTOA 4E8DA 2XM2A 5DT5A 1E6XM 1O7AA 2VR4A 1PZ2A 3WENA 3VSUA 4K68A 2RGMA 3SCSA 1UKPA 1KFWA 1LG2A 4C7DA 3VOCA 1R75A 4DWSA 2ZICA 5AY7A 3N9KA 4D72A 2CBJA 2WC3A 2X05A 2ZIDA 4AZIA 4OOUA 1BLIA 1CIUA 4AIOA 2DH3A 4FNPA 1FHLA 1UR2A 3EDKA 4BS0A 1HJSA 4PMXA 1OCQA 1P6WA 1SR0A 3GH4A 3G6LA 2BV9A 2GK1B 2J47A 4JQTA 1HKIA 3O6AA 4BQ5A 4XZBA 1KTCA 4GQQA 3WEMA 3BUDA 3WEOA 2OXBA 1VIWA 3PZNA 4GZEA 5FMDA 3KE0A 5HPOA 2PBOA 1JIBA 1TQSA 2JEQA 4L4OA 2J78A 1E4IA 1CTNA 3CGTA 3K1DA 1QI4A 1Y9GA 1E6SM 1BYBA 1V3HA 4HA3A 4JKMA 4PRWA 1PEZA 2ZX7A 3LF7A 4FMVA 2VI0A 2QHAA 2WLZA 4UZSA 1V6VA 1KR0A 1W9VA 3DYPA 3VGEA 2QMJA 3WF0A 4J3VA 4X0NA 2E9BA 5A6AA 3W28A 3L2MA 3N1AA 1C7SA 3VILA 4JFTA 1H4PA 4TVCA 3A47A 1YHTA 3VIKA 3U57A 4KRUA 4CD7A 3WNKA 1WP6A 4FLQA 5F7UA 4D71A 2F8QA 4E4PA 1CGUA 1QW9A 5C8BB 1XV8A 1Z32X 1PX4A 3I3EA 4B15A 3LRLA 1UD2A 3WEZA 1WZLA 3WD4A 1JNEA 1R7AA 3CH9A 3KLLA 1W9PA 1UR9A 2CKRA 5BRQA 2J4GA 1OWQA 2EPLX 3THDA 2YL5A 1KWKA 2J62A 2AC1A 1B0IA 1FH7A 7CGTA 5D9NA 3U14A 4J3SA 3DYOA 1UYQA 2WAGA 1PX8A 3SURA 2ZUMA 1B9ZA 2EJ1A 5EBAA 1BFNA 1CGTA 1OD8A 3EMZA 2A3HA 1VJZA 1PS3A 2O9PA 1E4LA 5A6BD 1UG6A 4PUEA 4WK9A 2XVKA 3AFBA 5A2BA 2WK2A 1UD6A 3WQ8A 2J74A 4ZXLA 2W66A 1HIZA 2OYMA 1X1NA 3MSDA 4P7OA 3TV8A 1JZ7A 2F7QA 2E8ZA 2ADDA 2GJRA 3BGAA 3RJYA 4QFUA 1VRXA 1W9UA 2XPKA 5A6LA 4R5EA 1UZ4A 2W61A 1GQLA 2F7PA 2B31A 1R7OA 3AMKA 1E4NA 4NX0A 3ARRA 2YBUA 4UOZA 1MYRA 1C90A 4QDMA 1V3KA 2XQRA 2VL4A 5CZKA 3LRKA 5A8PA 4DUWA 3AMGA 1Y9MA 1OD0A 3EYPA 1C7TA 2FH6A 4P8XA 2DT1A 1UKOA 4WSKA 3CUIA 1XRVA 4B3KA 4Z2HA 3KEHA 3D3AA 3NDZA 3UEQA 1IV8A 1PIFA 3ALFA 1E5JA 4AD1A 4CU8A 5JIWA 2C0HA 1UZ1A 3B9EA 1XH0A 1XSJA 1WAWA 2G3NA 1HT6A 1GONA 3AS0A 2O9RA 3WMSA 3U7BA 1KBKA 4PUDA 1JXKA 2PBGA 4KWUA 1I1XA 2Y5EA 1O6IA 1CXFA 1E73M 2CEQA 2DSZA 4AZCA 1UH4A 4J28A 2E40A 4DUVA 5LA1A 3B9DA 1B3XA 2XN0A 1KXQA 3W26A 4PMYA 1JYWA 4ZFMA 3AISA 3ARUA 2ZXQA 3WL1A 2VQUA 1EGZA 5EFFA 4W88A 2ZUSA 3UGGA 3OLIA 1ISVA 1E3ZA 3TTQA 3VTRA 2BFGA 4CCDA 2W92A 4NSBA 1TQUA 3VDHA 1DEDA 3LIGA 1R46A 1QVBA 4CN6A 4DM1A 1DWAM 3RJXA 3AXIA 2YKKA 5GNXA 1L0PA 3BCDA 4CU7A 1QPKA 3ZJ7A 4NRSA 2WM0A 2Y8KA 3BAJA 3NIYA 3CPUA 3IJ7A 2UY4A 1LL4A 4F9JA 2VNCA 2WVVB 1UWTA 1K9FA 3MS8A 4M81A 2W67A 4OOZA 1ZB5A 1EH9A 2NSXA 4W8BA 2YBTA 3OIHA 4PCTA 4W8LA 1ZBWA 4MDOA 1ISZA 5EFDA 4ZEPA 3BAKA 4GKLA 2CCRA 1LWJA 3CUJA 1JZ4A 3MKKA 4D6DA 4AC1X 4B16A 1LF1A 4FNUA 2YL9A 3WQWA 4AWEA 2WLYA 1CNVA 3NUKA 3WY1A 3CZ8A 1HTYA 1J01A 3SUUA 5IXEA 4AD5A 5LA0A 2Y24A 1R85A 1V03A 1TQTA 1UHVA 4D6GA 1YQ2A 1J12A 4AZ7A 2V38A 2CETA 2BXZA 1TG7A 2VURA 1KWGA 5BXSA 5CLTA 5GPRA 3OBAA 3WNPA 4M82A 1W3KA 1K9DA 4W93A 5DFAA 2D3NA 5A6MA 2X0YA 7TAAA 5HNNA 2DGAA 1W91A 1QHOA 1I1WA 4FNQA 3QR3A 3VX0A 3DYMA 4YHGA 1CEOA 2XM1A 1WDPA 2WWCA 1MFUA 4MNJA 4C7GA 3CZLA 1XYZA 2D0HA 2O92A 4MJ4A 3WD3A 3AS3A 3BUQA 1DWIM 2X2YA 2XVNA 2YLAA 1H5VA 1G9HA 3CZEA 2YDSA 6A3HA 2UWFA 4W5UA 4H2CA 3K46A 1JDAA 5CJ5A 1BSIA 4OBSA 2V5CA 3F5JA 3WD2A 4M80A 5KZ6A 3OZPA 3VMPA 3FAXA 1JYNA 3N13A 1JFHA 2EQDA 2OSYA 2JF7A 3EBVA 3G6MA 2WHKA 3SUTA 3DX1A 4A4AA 3L4YA 4CD5A 5I24A 4MDPA 1R34A 3HN3A 1QI2A 4FK9A 1H49A 2V3DA 1GOQA 5A94A 4H8UA 1TE1A 3CHCA 1E6ZA 3VIPA 1CWYA 2WMIB 3VM5A 4MPKA 1V0KA 1JAEA 3CLWA 3T0DA 1M7XA 3WSUA 1EQPA 4L4PA 2G3MA 4FNSA 1W3JA 1XHGA 3U5UA 4GI8A 4NZCA 1W2PA 4HXCA 1XSKA 2HVMA 2X2IA 2WMHA 3VDBA 1WPCA 4WKFA 1WO2A 4J3TA 4R27A 4CKQA 1RD6A 4OUEA 1KQZA 2VOTA 4HA4A 3GXNA 3VSVA 4B9ZA 4CD4A 1NM9A 1KCKA 1MVYA 1GVYA 3LPGA 3NSXA 2BVTA 2OWWA 1UH2A 3A21A 1IZJA 3ZO9A 2QQUA 2ZX9A 5ABGA 1TQWA 3GZAA 1PX3A 5DT7A 3KF5A 4UTFA 3IK2A 3RCNA 2WVTA 2ZOXA 4KGJA 2ZXDA 4P8UA 1QBAA 1UOKA 1M03A 5HOSA 2BS9A 1SYTA 3WQ6A 1JI2A 1Y4WA 1FFQA 1TA3A 3BVVA 3GBDA 4AMXA 3AXXA 2ZWZA 2XGIA 4J3WA 1E4MM 3WD0A 3GXDA 1HXJA 3MUZ1 5CGMA 3LPPA 2XFYA 3IANA 3THCA 4N0RA 3WKZA 1B2YA 1LLOA 2XN2A 4A3YA 3CHFA 4Z2GA 2D3LA 1OM0A 2F2HA 3MMUA 2XFFA 1NWTA 1VEMA 4U3AA 4MB3A 1IT0A 2W62A 4GZIA 1CDGA 3W38A 5DF0A 2DEPA 5HBFA 3AS2A 2D2OA 4IPLA 1H41A 3BAWA 3KWXA 3CUHA 3AS1A 2A3BA 2ZXAA 3KF3A 5BXPA 8CGTA 3HU7A 3VO0A 3S6TA 1E0WA 4GI9A 5A69A 5FIXA 3CTTA 1W3HA 3VIHA 4GQRA 1VBRA 1WDRA 4OJYA 4W7WA 1GHSA 1HP5A 3WIJA 1R8LA 4HU0A 3L4UA 3OLGA 4DUXA 5LYRA 1LWHA 4XZWA 1ECEA 3EDEA 4H7VA 3AHYA 4U5KA 2YA0A 1E9LA 1C8QA 5GQBA 2BY3A 4F66A 2FH8A 4EE9A 4XUYA 2C7FA 2CESA 4D6FA 4UQCA 5EB8A 4IUGA 1LL7A 3PZMA 1HJXA 3VD5A 4EQVA 3S5ZA 3QHMA 1OGGA 2GDVA 3VM7A 3CIVA 5AYIA 2W5FA 4M24A 1V6UA 5FCZA 3ARPA 1LQ0A 4Z2JA 3AHTA 2D24A 4MADA 4UZUA 4M1RA 1JF6A 3VSTA 3W6MA 2ZX8A 4V28A 3VGDA 2WKLA 4X9YA 4HZ8A 2VRKA 4AY1A 3GNRA 4ZE4A 3H53A 1GJWA 4W7UA 3AQUA 3VVGA 1B3ZA 2XGBA 4LYPA 3VPLA 3BLPX 4AZBA 2J7FA 5M5DA 3ZSTA 3WUEA 1UA7A 1FP8A 1WKYA 1ODUA 4W89A 1VF8A 5BRPA 1HL8A 2DSUA 1DTUA 2YL6A 1QNPA 3A5VA 2EO7A 5AC5A 1CXIA 4D6CA 3MANA 1D2KA 1OGBA 1W1PA 5E6YA 2Y4SA 4B9YA 5FKCA 3WQVA 4UQ9A 3PZIA 3VGFA 1DWFM 1N82A 1E15A 3M46A 3PZQA 3CV5A 3KL3A 2CHOA 2F18A 1J0KA 1RP9A 5ANNA 2GJXA 3AYRA 4HMDA 5DMYA 3WH5A 3K8KA 1PZ3A 3TOPA 4FFIA 4W87A 2TAAA 5FOOA 3FW6A 5E09A 5E1QA 4U3CA 1E71M 3VX1A 1XH2A 2ZX6A 2WKGA
chains in the Genus database with same CATH superfamily
2R0KH 1MCIA 3DGDA 4F7CA 1MCSA 1K5MC 2ADYA 1J1TA 3FQNB 2PRMA 1AG6A 4W6WA 2HT3C 4X6CF 4KQ4L 3ORWA 1R30A 1ZJHA 2JKBA 2Y36H 4ZB2A 2VRAA 3FIGA 2PUZA 4MZ8A 2YXGA 3MHFA 4IV3A 1JCJA 4ABUA 3HE7C 3QMRA 3QQ9C 1BA9A 3WUFA 2R073 2QZQA 1XIGA 4ANKA 1AL22 4FOMA 5FPZA 4MWAE 3CZSA 5I74C 5C5TA 2YAFA 5T1MB 5HHPA 3CZKA 3D3VA 1FZOA 4G8GB 1A9VA 3BALA 4GJZA 5F71A 2I27N 2YD7A 5EBWB 4HQQL 2YCLA 4URKA 3J9SA 4WCYL 5GGVY 1L7TL 3R5EA 5TFSL 4K1ZA 1O5DT 3EWXA 3IACA 4P2RD 3MXVL 4DYKA 7REQA 2J8UA 2Q71A 4ZJ9A 3OJGA 5F39A 1WYJA 2CBPA 3N6YA 3CS2A 4H1LB 3WIHH 1R3VA 4H04A 4PGJA 4GH7B 4XHJC 3BP7B 4JHMA 4XJ9A 3GIPA 4ZX5A 5B39G 5BNOC 4LVAA 3HG1D 4TTUA 2MPAH 1LG1A 4AIBA 2BX5A 4WUKL 1EIBA 3B37A 3I7RA 2MANA 4EI6B 3DUSB 4B8EA 4PY7A 3SQOL 2I69A 3ALQA 4MGKE 1BVNP 4Q6XA 2GITA 4AQ6A 3KEDA 2XHYA 3LN5A 4BWUA 3S5LB 4OMCA 4HEPG 5HI3C 1F11B 3ABOA 2HWD2 5EMJA 4Y1TA 3TWAA 3VFOB 2FAUA 1S2CA 1Z44A 1AGCA 2J43A 3BK0A 4KQ3H 1O94A 4DN4H 2QQVA 3NQ2A 3BB6A 1CVNA 4WNQA 5DHVB 2AQSA 1QDOA 5FA3B 2VVEA 1BXVA 3V79C 4FP3A 4RNRB 3PVFA 1B9KA 3HZVA 1X33A 4X0VA 1AAJA 1VD6A 3PY9A 4LXFA 3W0WE 4ETQA 2AAMA 3ETTA 3WQ0A 1UWGH 4RGGA 5IM51 3MJ7B 2XFXB 2AC0A 5HBBA 2IMMA 2ITDA 1ZHNA 4L3ED 3NURA 3NYDA 4WSJA 4RQPA 4MFEA 3QUKA 5JXQA 4ONFL 2D3RA 4Q0VA 5E24E 2ZOKA 5IB5A 3MACH 2H32B 3MN8A 4MFDA 1EHLL 5JIKA 1OXYA 1VRBA 4PMDA 1LHVA 5JOEA 5IESH 5F2IA 1HJGA 3W7LA 4S3FA 4PHZA 5FDBA 1VQTA 1FWXA 3OXSA 4A2UA 4S3DA 3QZWG 2P24A 4XABA 1S7WA 3P11L 4QAWA 4I3RH 4NVPA 1UTDA 5DRWB 3ZFEA 3VFUA 3CEPA 4I7VA 5FX3A 4E9SA 2CK0H 1HQRA 2A9NH 4MSSA 5KXDA 4G6CA 3N4EA 1USZA 2CW6A 4U1HA 3FXGA 3TZVC 4OU1A 3SCMA 4GRLB 4OUOA 3PPCA 2VQ0A 1UJQA 1SDDA 4AKPA 3BFQG 3F95A 3P4OA 4H9ZA 3FCUB 3TJ4A 3VOFA 3GINA 3JBG3 1JPKA 5F7EL 4C54A 2BSRB 2WZHA 1OKQA 1TV3A 2FT7A 4GB32 2C1OA 3SEPA 4JL2A 1IC7H 2FZ3B 3WL9A 3TZNA 4Y5VC 4NAFB 1X7IA 3W75A 4QX3A 3HW7A 4XX5A 2DQJL 4NPMA 2C3VB 1IBDA 2WGXA 4ACPA 3MLWH 2XYLA 3NOIA 5AG9A 4ZT1A 4H20H 3AY4A 3WTUA 4Y4HA 1W3TA 1A5BA 1XLMA 5JZ7C 3VXSA 1P1MA 4XQDA 3U7WH 2W1WA 4QXIA 2VITA 4KVCL 1DORA 1XLHA 1THCA 4V2WA 5LNRA 1W9SA 3X1FA 2W52A 4NHUA 5I82A 3ABRA 3C2AH 1IM3A 1SYVA 3T6ZA 2CKNA 1PY4A 1NUKA 3R8RA 1RITA 3NJGA 2F1EA 5FIEA 2W46A 5A43C 1ED3B 5LY1A 4LOEA 4JQIA 3N55A 4D3WA 5FWEA 4R90L 1DANU 1MS5A 5BOFA 5FA5A 3ZM8A 4WU7B 2FMYA 4B9PA 1BOGA 1LNUB 1UD3A 3LKOA 4UMAA 2BLEA 1KJ3L 4CCJA 3UKVA 3KS7A 1XXXA 3PHOB 3N04A 2HPTA 3CVHH 4L9LB 4WI0A 4CVZB 3UCQA 5AHEA 4PRNA 2NZ9C 2R69L 1VAHA 4HCRH 4K5PA 4Z2AA 4ANUA 2PSNA 4AGQA 2EIBA 2RACA 4LOVA 5CGBA 2XONA 5IHBA 1XIEA 3IF1B 3NRFA 1E6OH 3VFCA 3AQZA 4XQWA 1UAIA 4EVZA 1PHMA 4IDJH 3BYYA 4I3PA 3DUUB 1Y07A 4CDWB 2Y0SA 4FFVC 1DSYA 2R15A 4IJCA 4ZOEA 2R0ZH 4JRYD 1B0RB 3SDXE 4TVDA 4N26A 3CN1A 5I3JA 3UGEA 4L61A 2FB2A 1JVKA 1HC1A 1F8TL 4L3CA 1KXGA 4QU1A 4AM0B 1GKEA 1SFJA 2Y6FA 3ITTA 3Q7JA 4MUPA 3DVGA 1V0NA 4PJBE 4AZ8B 3LCYA 3GZEA 4HNVA 3X17A 4YSTA 4L8CB 1S5NA 4L05A 5DDJ3 2IPTH 5HA7A 4PW3A 4E42B 4GW5A 1K9TA 3S36H 2C9VA 1PYMA 4XWOC 3QG7H 4Z7UA 3AOFA 3DRQB 4AEIL 4QKNA 3X14A 5C0CB 3I2IA 3JV6B 4A6OA 1XR9B 4JTIA 4N3TA 3VIOA 2VDPB 4WW1A 2PHUA 2GSHA 4YM2A 1AJ2A 2V4AA 2WQXA 5JW3H 1A3LL 4NHCL 4YM0A 5EBMA 1HL9A 4A7YA 4MKVA 1UQYA 4E9WA 2E47A 1C5CH 2IDUA 2M8XA 3S3JA 4XPHH 2MRYA 3TKFA 3J07A 5JPMC 4R96A 1L7QA 1FDLH 4PJCB 1YDYA 4HMNA 2SEBA 4LGXA 3ILDA 4O54A 3K74B 4U36A 5DZJA 1FKWA 2HG0A 3STLB 2VO8A 4LYRA 5AZEH 4UV7L 1UA3A 2MPVA 1JMUB 4PMVA 3PVNA 1OOPA 3MZGB 3VUSA 1KBGL 3DTDA 3OLDA 4RS5B 2DJLA 3BPCA 4YAQA 1CE6A 3ME3A 2WUCL 2XKNA 1G4TA 1BGAA 1J05B 2YPDA 1POQA 4YXKL 2AJYL 2WZIA 1YQCA 2YIHA 3CAWA 3MNDA 5AAMC 4JKLA 1BEYH 4O58H 4UT6H 1XB3A 5HHQB 3DWTA 1E1EA 4CAGA 2OSXA 4F93B 4ZGYA 4WI2A 5D2WA 1D7FA 5J37A 1Q9OA 4XJAA 3BTNA 2MCG1 1I7RB 2AABH 4AVJA 3ZFFA 2MTPA 1F8IA 2BRRL 3HBZA 1QMJA 3PNUA 5I8EA 5C9AB 4MWAD 1KLZA 2MQGA 4PSPA 3LRSB 3LTYA 1HV1A 1ZLPA 1K02A 3WW3A 1Y1UA 2Q8EA 3QKEA 4HIPA 1S7UB 2Z1KA 3QDME 3OL2A 1L3NA 3VXMB 3O3UN 3ZYPA 2OLHA 4P8QA 4B3LA 4UOW1 1WW7A 4NC1C 2BSSA 2HRLA 5FHAL 2VUJA 5IREA 3S6CA 1YNKH 3QFDB 3EO1A 2EIKB 3WY6A 4AG4A 2HK1A 3NCWA 3HNVL 4ATFA 5LGKA 4Z07A 1RIUL 3KL0A 3OGCA 5I75B 4MMWA 1XYFA 5C0RH 1BJMA 5DRXB 2WTRA 3CZFA 3QDGE 2QTEA 2CXGA 4L4MA 2F61A 5KITA 1QJWA 4Z1CA 2E28A 3ZWSA 1XBVA 2CC0A 4J7RA 2POZA 1NCDL 1SLUA 4JPVL 4XO7A 2FJSA 3MJ9H 4JFFE 3RGVB 1BQLL 2NUTA 3C7OA 3H2OA 2XQXA 1TFVA 4G80A 2OX0A 3RIKA 2N7AA 5DJCA 1SBBA 1IO4C 1JZ2A 5GSRA 32C2B 1M05A 2DUXA 4L5ZA 2AKZA 1K12A 4FTBA 1JW6A 5AVVB 5FYHA 2B59A 2A83B 2BCMA 5E9XA 2CDEA 3W2DH 3WUGA 5GGQH 4RRPG 2YD2A 3PP3H 5IQMA 4H9UA 1FBIL 4NWUH 1CECA 3S5YA 4L4VB 4PJGE 4XEZA 4R7WA 2UY3A 3TV3H 1E6JH 4RMVA 3TW9A 3GS7A 3G1VA 1PD1A 1A9BB 3W1MA 1DLHA 5J6HA 4E8GA 2J20A 2Y5TA 4OLUL 1MEHA 4EQ3A 1A7BA 1NC2A 2X09A 3LK6A 1QI5A 2OXHB 3UBHA 3AIQA 1ZA6B 4FT8A 5BNNB 3SOBH 4AYUA 1Q85A 4W9ZA 5E8PB 3WD5H 3APCA 3ESUF 2SFPA 5DD5H 2VGFA 4P9MH 4XV0A 2K1MA 2JWPA 3LHWA 1NT0A 2HWE3 3NJFA 1ZVYA 4UFMA 5CKMA 1AKJA 3SGEH 2VW6A 2IXJA 2ZX0A 2WQVA 2OQLA 2EDYA 2CK2A 4PR5B 3L67A 3VQMA 4U0RC 2NNFA 1AL0G 2WYSA 2HX7A 3FH5A 1WG3A 4KGQA 4NUBA 1WIUA 3KZSA 3QUMA 3US9A 4AL9A 4XP1H 2ZMLA 4RL7A 1GIGH 2CHNA 4DXVA 1XKYA 1B4KA 4KNTA 3GBNL 4ZZ9A 1KCUL 5AUMB 5DZPA 5DLLA 1K6AA 2I5GA 1D8WA 4ICMA 5JIQA 3AQYA 3GHNA 1MIEH 5AB3A 3EH5B 1N7ML 2QJVA 3FO2B 3RIAK 1C5IA 2JG9B 1AUYA 3IDIB 1G69A 1N0XL 4NRRA 5E88A 1F90L 4G1NA 3RITA 3G04A 3BO8A 5IQ7L 4OI7A 1ETJA 2UVEA 4WDTA 3U4XA 5IUQA 4HVOA 4CC1A 5HINA 3NV3A 2YPLE 2ICCA 3RWGB 3IMBA 1MDLA 12E8H 3ABZA 4HWZA 1AR82 3VFSB 4NWWA 1B4RA 1XGRA 2CHXA 2OMWA 4LP4A 2WSPA 2VW4A 4JFXB 3EYVA 4U1LA 5DMGD 3D0SA 3GS4A 3QDJE 5LQBH 3FMGA 5FUOH 1S78D 4F2EA 2YC1A 4HWEL 2V5YA 4A2MA 4LEXH 2Y7NA 3MP4A 5L2KD 4FKKA 3SDAD 5B1JA 2JIXA 5IAVA 2VL5A 2JDNA 2JK5A 1JI6A 5FDYA 1TUFA 1KFBA 1TVPA 4PJCF 3HHMA 4Y2DD 2KZ1B 2X53S 3ERXA 4FYRA 4RAHA 2X4SA 1O7AA 4XCEB 4P07A 1BYNA 1S8DB 2HEWF 3J8F3 1UKPA 4IW4C 2WLLB 2D5HA 3L3DB 5EO9B 4X7SH 2QR0A 3O7UA 4XMKL 1P6WA 3SY6A 3GH4A 2QUMA 1HKIA 3O3DB 4PM1A 3WEMA 3VOHA 3MHGA 3CXFA 2EEBA 2YRZA 2N7GA 2DM3A 5BPXA 3S97C 3ABLB 1Z6KA 4PTUB 1H0BA 4GXLA 5IW3A 1E4IA 3K1DA 4QX2A 2CE6A 4D6QA 3H8UA 2H26B 5KYXB 2R29L 4JKMA 2D31A 3PP4H 2XBO2 5F4SA 1IKFH 1A0QL 4JCKA 2CBQA 2NXIA 2ON3A 4RR3B 1KN4L 3I6TA 1ZHAA 3VBRA 2JB8A 2YZ1A 3NA9L 4JQXA 3BPSA 2I9LA 4UUIA 3CN4A 3F2LA 1JNHB 5D5MB 3GMPA 1CQKA 3RU8H 5LZ6A 5EU6A 5ADOH 3FFCE 2F38A 3PU3A 2Y7MA 3DX5A 1NIBA 4YZWA 2Q02A 5HPMB 3RDIA 1UC4A 4YLBA 4AQAA 4AV5A 2J4GA 4YDJB 2EPLX 3N4FA 1B0IA 4N28A 1S2TA 4XVEA 4K71B 1YYNA 1BGXL 5GJTH 3ZYJA 3OVQA 1NMAL 1Z0NA 3LKQA 3EXTA 4M1BA 1U4EA 3SD2A 3W84A 3VWKA 1A6WH 5C9KA 1RUE3 1DQIA 4YDNA 5MP6L 3C56A 4WI4A 2C24A 3I2CH 3IARA 1XTMA 4JGYA 6PTDA 1QFPA 3W73A 3OTTA 4F2MA 3CC5B 4KZDL 4Q4OA 3ZSKA 4LAMA 3H9YA 4QRPE 4GVIA 2XQRA 4P23D 3E6EA 1OD9A 2NX5A 4JHAL 2HWC2 3MBWA 4AQOA 4FXGA 2K8MA 3BZDA 1S1AA 1UOFA 1WTGT 2ZAAA 4AD1A 4Q4RA 2YMXL 1ORQB 1W2AX 1S7QA 2F8VA 3R2GA 3B0YA 4XZLX 1YE6A 3DI2B 4XC1L 3LA7A 2CYFA 3AS0A 4LEEA 1I1XA 2PYFA 4HHHA 2WHVA 1D6VL 1E73M 2LABA 4YE4H 4RQQA 4AHWA 2PDKA 4J28A 3JWNH 2ZUQB 5F96H 2K0RA 5T3NA 2X40A 2WJSA 3FTVA 4E4HA 3P9MB 4H1LH 1UACH 1S3KH 1U8KB 4J2QA 1IEBA 4XNQA 3SLIA 4NQCA 3MCNA 5JYMA 4ELKB 4W88A 4F0KA 1KTRL 9XIAA 3I6SA 2EG7A 1DEDA 5C97A 3NQ8A 4UTTC 5I0ZA 1TV4A 5D1IA 4U1SA 1LP9A 3GI9H 1R1A1 1TPUA 2UY6B 5J3UA 3W57A 1E9PA 4B91A 2P46B 2WVVB 4JPKH 2VEPA 2NMOA 1TVDA 5JW5A 4QQHA 3O11A 3RE0A 2R1DA 4RZCB 3N29A 3MKKA 4AC1X 4KTEL 3LKRB 3QDMD 3T3ME 4YTTA 3MJYA 1OSPH 4AWEA 1HNFA 4Y2WA 1SSGA 2TSAA 2QCEA 3NIFB 1KACB 5A7BA 1EAOA 2KDYA 1J12A 5IK5A 4AZ7A 4C83A 5DHVH 4WHTA 3NFPA 3QJXA 3P0YH 5FKAA 1G9MH 3KOZA 5I06A 1HOCB 2ZYIA 1I1WA 4GA9A 4MWAC 4UUJB 3RFAA 1OV8A 4PREB 4ZYKA 4JQAA 1ONXA 2WWCA 5DQJA 3QDGD 2RDUA 4MJ4A 3QFJE 2DI7A 4QQPA 4XFBA 3HIZA 2ZZ3A 2R061 2YUXA 3B43A 1W0YT 3TN0A 4N9EA 1QEWB 2R2CA 1WUVA 4EP8C 4AFAA 5MHSD 3WN5C 4LBRA 3ATGA 5D8JL 1SM3H 3UBXG 5KHKA 2H32H 4N2CA 2PA6A 1YBQA 4S1QH 2W0LA 3HJ0A 1H30A 1WTLA 4FPHA 1HW5A 3T3PB 1MFEH 3GVVA 4RZ6A 3IV3A 2QFEA 3N36A 5LBSA 5CR8A 4K2UH 5BRZE 3T0DA 4B9GA 3LB9A 1QPOA 4RFEB 4WCJA 4OU3A 3HOBA 4XUTA 1W2PA 3CX2A 1XSKA 2EIJB 2F53A 4FQZA 1OX4A 3FQWB 4PC8A 1L9MA 3DO7A 3WQOA 3LZLA 4R27A 4UDTB 1KQZA 2VOTA 3B0UX 1ZGLB 3GDMA 3RO6A 1Q0EA 4JK0D 5I02A 4M03A 3VXOA 5C08E 2XYCA 1MCDA 4GSXA 3CM4A 4AYDC 1D5ZB 4IL2A 4DT2A 3GSUB 1K77A 1RZGA 4PG2A 4H25B 3T1MA 1FH2A 3HQNA 4SBVA 2IGFH 4A39A 3WQ6A 3NGBC 4HFUH 4EWJA 3V4PB 5F7YC 3MUZ1 3LPPA 1B2YA 4KNUA 3CHFA 3LHPL 2VDGA 5CIPH 4DGYL 4QOKD 4PRPB 3PL6B 1AIFB 1V79A 1T7ZA 1DLFH 1S7XA 3T6CA 5DMMA 3IJYB 1N3OA 4PRIE 2XJPA 4YYCA 4GFTB 8CGTA 1UZ6E 2XG5B 1A7NL 4GXVH 5BQDA 1WDAA 3VWJD 2QAFA 1PYWB 4EN0A 3WIJA 2F5BH 2UWAA 4YVWB 3OLGA 4HSNA 4Q6IB 1ECEA 1XCQA 3IXTA 1XFPA 4QM1A 1UCBH 5I6MA 1JZIA 4U5KA 1VFBA 4IMLA 5GQBA 4F66A 5CN2A 4O17A 2C7FA 1YPZE 3ZYFA 4I0PD 3ROLB 3G1YA 1Z8AA 1YFWA 1W99A 1XVSA 4OD1L 5AOUA 1RUAH 3RRDA 4UMCA 4NG3A 4O0KA 4ZU5A 2D24A 2IQ9H 3VABA 1A64A 1U8QA 5D5MF 1JPTH 3MY9A 2XACC 4NJ9H 1RLCL 3H53A 2OTPA 1EXBA 3EYFB 4W7UA 2IWFA 1UA7A 1W9YA 5B8CC 4LCWE 4I87A 3EB3A 5D93B 4DZGA 2BNQD 2ADFL 2FB4L 4DP5X 4Y3OA 1PEWA 2J8OA 5AZ2H 4M6NH 5BVJA 5IMLA 1IM9B 3BH9A 1JPGB 2PD5A 3ZDZE 3N2MA 1AZUA 4HUCA 2RUSA 4NHYA 3VQ2C 1KCBA 3OW1A 3IRSA 5GRJL 1LEIA 2WKGA 3PAJA 2KKQA 1UROA 4KROB 2I5YL 4J8RA 2EKSA 3ISRA 5GSVB 4NVTA 3LEKA 1XF1A 5CPOA 4D94A 2RIKA 5KG9B 3ZYIB 2QGYA 3MRGB 1S0IA 2YD9A 1M41A 4HG4J 1Y9QA 3A4AA 3B7MA 2YMZA 4TSCH 3P0VH 4LLUB 2OQJB 4NRXA 5DMGC 1FVDA 3LCPA 3B5LB 2HZGA 1L2QA 4UT9H 1S78C 3BMWA 4OB5L 3B9VA 2BG5A 1UR8A 3L4TA 3BD5A 4PRDA 2VH5L 5I1IH 3BZ5A 4F3JA 5LNDA 3IDXH 2QDWA 1QJEA 4DWDA 3NK4A 4EXBA 3RO8A 3SDAC 2Y3AA 4B2DA 1KG0A 5LEJA 4DZBB 4PN6A 1WWAX 4R2GC 2VDOB 3LXBA 1XH3B 1PL3A 1K3IA 2C9KA 2H0PA 2A6JA 2QBXA 4DBEA 1W0VB 4H8PA 3OTRA 1ZLDA 4Y2DC 4R3SB 2ISVA 2A6VA 5JOYA 3EPNA 1RH8A 1FQ0A 2V5MA 3M6DA 1ZJBA 4WWID 1NDGB 2FIQA 1VBB2 3PQYE 4DY1A 2BWDA 1SW7A 5SWZB 1Q6GA 1XL4A 4M3KB 3FFCD 1XCTB 1JGVL 3VIJA 1R2SA 5HGHA 3L9JT 1RR2A 1F1AA 1KD0A 3UAFA 5I76B 1JD7A 1KGUA 1NARA 4X61A 4EI5A 2VSMB 5EZOH 4NN5B 5E6ID 1TOXA 4YWGL 3FH8A 5K1JA 3NIFF 2WWNA 3C7HA 5CR1A 1RCXB 1N59A 4ZFOB 4BKSC 3N4MA 4QYOB 2D03H 2P5WB 4F9PA 1MEC3 1HRI1 1Z0HA 4Y19E 4FULA 5LIUX 5F70A 1YHFA 5G4MA 2VR8A 5E8AA 5I3IA 2F17A 2WN2A 1OPGH 5A6JA 3BEVA 1U8NA 1LCLA 4IH3A 4ZQKA 5IFPA 1DBBH 1AD9A 2Z8VC 2VKZG 5D05A 2I32A 1RUNA 1VYSX 3EOTH 3S1UA 3IK4A 3BVNB 1KTLB 3T2OA 4NPRA 4JS7A 4Z3EA 1FI2A 3ZT6A 4MB1A 3T3PF 4YVXA 1ASJ1 5EV7A 3RJQB 2ZGLA 4P23C 4A7GA 1UM5L 2RS33 2D43A 1U58B 2YZ5A 3FCTA 2WO1A 5I3DA 5AW8B 2LTQC 4L5FL 4YWAA 4OLZL 1REFA 1QQDB 4HHGA 4GW1B 4PTTA 5FYKD 4GG8A 4WEBL 4AQ1A 1RVF1 3UIYA 4GKNB 4NKMB 1S0DA 3DAQA 5E2VH 2IGLA 3USSA 2NSQA 1HRV3 3BPOB 3MROB 5ICXB 4CDGC 4E41D 4CCNA 4DPBX 2NXHA 2W4XA 3NIDB 5DT1H 3TJEH 4WM7A 3SD5A 2X9WA 4DJED 4N6RA 4X42A 4QGTA 5LBBA 3M44A 5A3HA 5I07A 3UO8B 4JDZA 2W91A 5ENWB 3LH2L 3HNBM 1EA9C 4KRTA 3TJXA 3HRZA 5EUOA 3NJNA 4KFMA 3BZFB 1KJMB 3WMLA 3WDIA 1AQKH 1H1AA 3PWJA 2RD0A 4OFPA 1R9XA 4UFLA 4YK4C 3VD9A 5LHFA 1UUQA 4I9JA 4P3CH 1BAGA 2P5EE 4K8RB 3VFRB 4DJFD 4QB2A 4AHZA 4JFED 1UYWH 3W72A 1JVOA 3W74A 1T3FB 5IIEB 5I0SA 4FPLA 1OAKH 2JXAA 2JDYA 4TQTA 1CLOL 4NPLA 2G5WA 3N9NA 4WWKB 2MHAA 5F7BA 4CP9B 2Y85A 4G7VH 1X4ZA 3W58A 1UC5A 3OAWA 2TNFA 3GEWB 3FU7B 3T65B 2X5IB 1I7ZA 3GSMA 4EE2A 1W8TA 3PYCA 1ZZBA 4K8EA 3HG5A 4FTSA 3RPBA 3NJXA 2JKNA 2NRDA 1BVVA 2NUXA 1H2LA 3R94A 1NFAA 4WI9A 4LSRH 2XPZA 2VCOA 3WNMA 4ZQCA 2X10A 5HWMA 3MV01 2AUYA 4XRCB 2J2ZA 4XILA 1IBGH 2R27A 4BXFA 1UUNA 4ZX6A 1GZTA 1FIEA 1DE5A 4LRNH 1IB5A 5HYQA 1LCOA 3IIVA 4Q4PA 2X6MA 2MNUA 3VYLA 1E8WA 3VIFA 3QULA 5C08D 5EOCJ 1X7TA 3WJLC 1HZHL 2GPZA 3J7NA 3QIUB 2YFOA 3ZW3A 3I3DA 3B4NA 5DQ0A 4M7LL 2Z7GA 3UNTA 3FB8A 3GMQA 3MXWH 4Q8UA 2H3DA 4MSWB 1W3NA 3CT2A 4W8JA 1IC5L 1QBBA 3U6XA 3R05A 2YWYA 1T6GC 2AV1B 4GSDL 1PD0A 3L1EA 5F3FA 3JV4B 2RS11 4PJXE 3MJGX 3GW3A 1KBBA 3FU0A 1MQPA 3GXPA 3KPSA 4I4WB 3KH4A 4N3UA 4IESA 4XTPA 3INOA 4GHRA 3BQUD 4A66A 5C6TH 4FFYH 5IF0A 4K3HA 4NC1E 1CIYA 1ZCOA 5REQB 4CNIB 2VDNL 3MCKB 2R16A 4YS4A 4AX7A 4YLWA 1U8CA 2OL3L 2CHWA 1PZ9A 3FE5A 2XTJD 1PLCA 4X5WA 4UQ3A 1DQDH 5JNYA 2YLKA 4MGTA 5CBAB 1DHPA 2R39A 3MPGA 2WO5A 5FGSA 3TYJA 4WDIB 3S96A 1N6UA 2HLAB 1CGWA 4AGOA 4PB3A 1N10A 2WC2A 5GJMA 1XT5A 4XF0A 3ZTJH 4UMBA 3DVFA 2VFDA 4AXKA 4ZMGA 2V9RA 4LB8A 3GYRA 2WZPD 3SDOA 4TOYH 2RKXA 1CZTA 1NOFA 4MYPA 4LOCA 1JXNA 3QE5A 4YEFA 1W54A 5CN3A 1A4KA 2WR9A 1REDA 4TYSA 4E2DA 5CP7A 4YMPA 3PDQA 3UPMA 1DWHM 5HYJB 4DKDC 4FR1A 5E2UL 4FQLH 3VWJC 2H0JA 4CDXB 3MMDA 4LCWD 3GRGA 5KVFH 1IG0A 1NWUA 1MQTA 4YH6A 3HG1E 1FGNH 4I0PC 2ZKHH 4NNXB 4XR8C 3O2WH 2EDLA 2NLYA 3D0JA 4W9DC 3W6LA 1NOAA 2J4WL 3MSGA 1X36A 2IAND 3UPBA 3TNMB 1S0GA 4ZZ8A 1N8OE 3PZVA 1RUJ2 4R4FL 1FAKT 3MRLB 3FT3A 4WEMB 1Q8JA 3BG9A 4HW6A 1RV6X 1ODZA 4OIFA 2X38A 3VNLA 1ZOXA 1SM9A 1S0JA 2EF6A 1M4WA 5A3LA 3UPRB 2X8KA 1KPRA 4ZS6D 2VXSL 1RV8A 1H7NA 2QV5A 3MODH 4C5ZA 3FEQA 3D0LB 3CVIH 2BUKA 3SRDA 3ARVA 4AHPA 2CCLA 2QV4A 2ZF8A 4H0GA 3MGUA 3VU2A 1SXCA 1Z7AA 2J79A 4GVGA 4ES9A 3MVTA 5AFDA 3DFYA 3GHUA 2NQHA 3WHXB 3D33A 1JZ6A 4HN0A 5IBXA 3BP4A 3FNKA 3RILA 1NIAA 2Y26A 4CEXC 1TZ7A 1NC4A 5FXZA 4AVBA 3GJEB 4CNSA 4L3EE 1JF1A 5JPNC 2PPDA 3GXIA 5KVDH 4OYUA 1JFQH 2Z92A 5D1QB 2NV2A 4QHUB 3L5XH 5FZGA 3PQYD 1YNTB 2FDIA 3TWBA 1W1VA 1QHPA 3PNWB 3EOLA 2CPUA 4J4KA 1EUUA 3WIIH 3T55A 2PGRA 2V7NA 1SF5A 1WBYB 1Z3GL 3OZLA 3VNZA 5F7MC 4H9VA 1TZIA 5JMCA 1NKRA 1KF9B 3G5YA 4S0HA 4QDRA 3NIDF 1MJJA 1UXSB 1M2OA 2DWEB 5ISZA 4IFKA 4NYUA 2MOVA 3WFCL 2Y06L 1J5CA 3W1UA 3HFTA 4GI6A 1AHWB 4N9GA 1FYTB 1OK0A 3EX6A 2J42A 1UH3A 2H6CA 4ZUSA 1KEXA 4XT1C 4YTRA 1A6PA 1TJ2A 1OY0A 3PDOA 4AIZA 1MFBH 1XBZA 2OOGA 1OZQA 1OSYA 1U3HA 2YY1A 3FHQA 5DHDA 2O8OA 3NSMA 2RS52 1BYDA 4KWWA 2ZXCA 5DVPA 1YY9D 4QM9A 1OWWA 5T52A 4P59L 3CMGA 4ODHL 4KCTA 2Q1FA 1EZSA 5HVWA 4JFYB 3WTWA 2XXGA 4WSHA 4MX7B 3X12B 3W7OA 4RDQF 4FTDA 5BZWA 4PLOB 5C09A 5E6IC 3UD6A 3K5XA 3LZNA 4ZO7A 5T1LB 5CXPA 1ODNA 1XPWA 2EPOA 3S4TA 3RWHA 5BPPA 4ASKA 1NSNH 1HJWA 3LRMA 2PYEA 3C2FA 4RNJA 1E40A 2EAEA 4LLMB 3BDBA 2A6XA 3D4ZA 3FTZA 1NICA 3WO4B 1ITXA 2GDUA 1R1A2 1RUG3 4MUVA 1A3RL 4PODA 2CDFA 1IIGA 4E9RA 2EAWA 3T2QA 1IBFA 4HPHA 2FHCA 1AG0A 2AAVA 3EYSL 2VXVL 4MSVA 4POZD 5AW3B 5HATA 4BR1A 2ED6A 3SKOB 1DVUA 1BK1A 3I3BA 4BA0A 1JPSL 1AR81 4JLRB 2WBJD 2DQMA 4F7MB 1QSZA 4Q7DA 4CGTA 4XXPA 5IDIA 4R85A 4NWTH 5D7IE 2NX1A 1XC6A 3FT4B 1QHDA 5CZRA 2F0CA 3KL5A 4K7FA 4AC4A 1IC4L 2IDCA 4DO0A 1XRSA 3DX4A 2P80D 2XIOA 3PJYA 3WF1A 3NPUA 4JFVA 1F8VA 4CW1B 4JTHA 2AAAA 3DC0A 3VINA 2V3GA 5T5LA 3SGEI 1UD1A 1ZSHA 3B5GA 5CSUA 4BSWA 4KZ0A 1TQ5A 2XVGA 3ZZLA 1NFDA 3FYPA 3RL1A 1FNGA 3FC0A 1OBNA 2R062 4GRMA 1Q6RA 4HYTB 5ICYA 1JZHA 1S9XB 3LIUA 3LZRA 3HNTL 4WV8A 2BOBB 1TZHB 1VRSA 4CILA 3O16A 4JRYE 2Q0AA 3NDZE 3TO4A 5H8UA 1YKWA 2PGEA 3EDDA 3N3HA 3QOPA 1Q8VA 1ID5I 5CLYA 1TFHA 3M17A 2HWZH 2YJQA 5IHSA 1PK6A 4MDJA 2VISA 3APMA 3IMVA 2JELL 2FBJH 3G6JE 2P5ED 4A2LA 1I2RA 3BMXA 4D8ZA 2Z25A 4BCXA 4JDEB 4NUQA 3PUIA 2YXVA 1CPNA 4DY5A 4R7OA 2A74B 4UAHA 4DJEC 1E27A 2ARJA 4AKOA 4XXDB 2B8MA 4QJ4B 4CCLA 3VMOA 3D0CA 3AKTA 4MCMA 5F37A 3A23A 5IFTA 1YYMH 3TN91 1YUKB 1CL7L 2J7HA 5E89A 3K6IA 5LDSA 4KI5F 3HMXH 2Z00A 3IVSA 1SU5A 2BMBA 3LFMA 2JQMA 5IWFA 2JCCA 4HPJA 4WLCA 3SKNA 4HWBA 1XIWC 1MCHA 3BMVA 4Q4QA 3UAAA 1GORA 1SSDA 4KKXA 4DJFC 5JSPA 1F6FB 3CLPA 1K2DA 4IGPA 2IWKA 2WLKA 3Q8CA 4HSQA 5DEJA 5DEGA 1ALYA 2X4NB 1WBFA 1KFWA 3NO3A 3KPRD 4FQ2H 5CFDB 2I60L 3DUIA 3SIKA 1ZAIA 4AIOA 3ULUL 4OMDA 4M6PA 3OG3A 2PTDA 3S8FB 1NE6A 3N9SA 4YIWA 1RUF3 1UB6A 3RU6A 2HVJB 1MZ5A 2ZKYA 1OB1B 1E9QA 4LE3A 3JTTB 2AMXA 4QX7A 2CRMA 2VDIA 2ZX7A 3KS6A 4ZPTB 3UXDA 3CN0A 4NP7A 1XLKA 1SJHA 3JB4C 3O8XB 4X8PA 2HWC1 1E4HA 3RG0A 1FOD2 1LHWA 2DVBA 2SODB 4YLQT 3TBVB 4C8XA 4IFOA 5CBIA 1SEQL 5EP9A 5BJTB 2JG8A 5KN5B 4WGHA 3LRLA 1NPUA 1QSEB 3R8BB 1W9PA 5FJUA 5J36A 1UR9A 2YGQA 3LS5L 1WAUA 4JTLA 1F56A 3PGDA 5LNGA 5AWNL 4PMFA 3V7AG 4FX7A 5DUXA 2EO1A 1LU1A 1B3IA 2WAGA 1KBPA 2Y23A 1CGPA 4L0ZA 8PAZA 3NAPC 4PCNA 3LQAC 3ML9A 4PG9B 2YU1A 2A3HA 2G19A 3GHRA 2JKEA 5E5CA 1ZZ6A 4D7TA 1GZ1A 1JGMA 5D1ZI 1YNTF 1NF7A 2RQEA 2OMUA 6PCYA 3BQUC 1JU4A 5JVVA 4C59B 1O12A 1IQDB 1LO2L 5IUCA 4KXBA 5FBJA 4APQD 4N2LA 3GZUC 4UOZA 4O9EA 2HFTA 4GBXA 2A6YA 3OF6D 4YVSC 3MFFB 3HR5A 2XTJC 3G5EA 3KBNA 4MA7L 4WSKA 5H37H 3N7LA 3L45A 4KNSA 3CQQA 4HBCL 3O0XA 3GTVA 4WM8B 4AU0A 5K39A 3PJXA 4LAUA 5KSBA 5HYIA 4NGHL 3ZTNH 4HK3J 4CU8A 2VDOH 3FUMA 4M3HA 3SO7A 4KS0A 4UR8A 5CAHA 4I6VA 2P1YA 4IGHA 1X98A 2XMLA 4I5XA 1F4XH 1KULA 5D7JC 5BNQA 4XWGL 1E5ZA 3T3YA 1B3XA 4WO4D 4PY8I 3QW9A 1CR9L 2BBAA 3WUWB 4MYXA 2P52A 2XZAH 3BAEL 1QOSA 1UOVA 1CICB 1QUPA 3SN1A 4ZQTA 5MENA 5FYJD 5ID0A 2LALA 4MA8L 5GNXA 4Y9FA 4ZTXA 2NMNA 2WAHA 3QDHA 2DQEL 4YDIH 3G5VA 3L4CA 1Z7JA 1B54A 4NM8H 2UY4A 5ILTL 3UO1L 4PGBB 1E28B 4TUOA 2QQLA 1JYIA 1F6AB 4Y16A 1ONEA 1W2KT 1Z9LA 4FNUA 4JZJB 3K2GA 3U07A 3JVGA 4KX9A 4MQ7B 4AH2A 1LO4L 1NUDA 2JQXA 4M3CB 3I9GH 1NEZA 3F04A 2CETA 2NR6D 5H2BA 4ZS6C 2YW3A 1GQPA 1W3KA 3QUGA 4UTWA 2J88H 3RUGA 3QR3A 1J1PH 1TLKA 4UILL 5T26A 1HRI2 2DQIL 5JW4R 2DZSA 4K73A 3CO2A 3PMSA 4XP9H 1XYZA 4BQCA 5LXGH 2YPKA 3LA3A 2B1HH 2C1PB 1CAXB 3O2DL 3KR3L 3HGJA 4FI7A 1AK5A 5E9DA 4LA2A 4GIOA 2AEPH 3PUQA 1U1HA 4G8EB 2A0LD 1SLCA 2B0SH 5E00B 3RX8A 1YUHA 4IGBA 2V2TB 4R97B 1D2SA 1TE1A 1BBDL 5E4OA 4GG6E 1H5YA 3FT0A 4HKBA 2DMBA 3E0WA 1HOEA 4Q4EA 4MA3B 3QWOA 5K9JL 5EOCL 3NNGA 4L9YA 4QWNA 3MLVL 1ASJ2 2EXTA 4DI9A 3W9ZA 3MYJA 3K77A 4PUBH 2Z91B 4I85A 3VDDB 3LKSB 2ZEYA 2ADJA 5EA0H 1YNLH 4D3CL 1RD6A 1TX0A 1POKA 1EV2E 1NM9A 2CAVA 1H5BA 1A9EB 2VZRA 5EPMB 1AGFA 3LIZA 3ME0A 3WO3B 1J5OL 1UH2A 1QJY1 3ZO9A 1RVF2 4OGQC 3I9IA 4TNWK 5JLVA 3I2KA 2HJKB 2BC4B 2UBPC 4FHBD 4KGJA 2NV9A 1YY9C 3IDJA 1J6OA 1OVZA 1Z41A 5EDSA 1Y4WA 3Q8EA 3FQ4A 5L2KE 2REQA 3GX9A 4DCQA 2ADAA 4PEKA 2BCKA 1F4YH 2CIKA 2X87A 5KC6A 2DJMA 2HPIA 2D3LA 4K8RH 3MP3A 1GNYA 3ZIYA 3C6LB 2DD8H 4TVPD 1AW2A 3MZHA 1VEMA 1DYOA 1D2PA 1CDGA 3BVJA 4PH8A 4H9YA 4DWHA 3KV9A 4HJTA 5JA9A 3AS2A 2Y7DA 4R7JA 4B5TA 5IM7A 4P5SA 1LTEA 1NDVA 1UEYA 1E0WA 4GQRA 4GYFA 4OD3L 4OJYA 2BVEA 3KHJA 4LTSA 1MMFA 5DURB 3LI0A 4POZC 4J3BA 3N5AA 3QIWB 4HGMA 3C2RA 3QXVA 4JB9H 2JCWA 3JTSA 2OODA 2BY3A 1M6OB 4XPFL 4R6UA 2QV2A 4D6FA 3T1GA 3MRBA 1PVNA 4ECNA 4M7KL 3U25A 1GWMA 3QHMA 1IGTA 2WBJC 3ESOA 2X70A 3AHTA 5DS8A 2GFBB 3M1BA 3FX3A 2P3ZA 4ONHA 1WMDA 1WW4A 4DX3A 4WTZG 4X9GA 1AOZA 4AVNA 2WKLA 4X9YA 4N1HB 4DOUA 4NHMA 3THUA 5B39B 3VVGA 1FN4B 3BIAX 4G42A 3ZSTA 4OFKA 1DCSA 2ZKMX 1ETZB 4HDIB 4JN7A 3HURA 1SFYA 2OR7A 4UC5A 2NNAA 1R3HA 2AK1H 4G5ZH 4A2GA 1ZHLB 2R1WA 1OCOB 5G4NA 2ZG1A 3O2VL 2QJDA 1DPMA 5D2NA 5C9WA 5DYFA 3T6WA 3IM0A 1IUZA 1S7TB 3H4GA 4ADTA 4K15A 1VBB1 1LILA 2VDKL 3S8GB 4GMP3 2Z7KA 2PXYD 3P2DA 4DFHA 2Q1EA 1XBDA 1E3FA 1OCZB 3VCLB 5C3IA 1CD3G 1Y0LA 4GSQA 3TAKA 3WLRA 4ZD3L 4UB9A 3U9UB 4NUJA 3V9EA 1H3GA 3CVDA 2NYYA 2QQWA 1K8CA 2FLBT 3NJZA 3GVRA 1VYPX 1UX6A 4PJAE 3S5OA 3IZOA 1AD1A 4BFFA 5DK3A 3PZGA 4D6JA 2WXKA 4K7VA 3W37A 2FCVA 3F7YB 2RS12 5GGSB 3RRQA 1PGL1 2XJSA 1JYXA 4LVFA 2P3IA 3BQVA 1ME8A 5DJYA 4LVEA 5C2BL 5DUUA 3U1QA 2FECL 4OTXH 4PBWD 1WC7B 3U5YA 4YGAB 1L7IH 1PKQB 1A4JA 4Z76A 1ZWIB 3FZUD 1MDTA 4AX6A 2UY8A 5TBOA 3PBGA 5U7SA 4ZXBB 1EXUB 3IMTA 2ACQA 3SDCB 4RGAA 4JEJA 1IVLA 2VLRA 4BH7B 1TVNA 4XMLH 1J5DA 4QD2E 4KKPA 5DJ8B 3NJ3A 4JJOA 3QUYB 4DTGL 2J55A 4OVXA 5CD5D 4L29B 3GO1H 5C07E 5IB4A 4LNRA 4NZ4A 4GB9A 3QZWB 4FFZH 4YHPA 1LEGA 3DIFA 4TPRH 1AACA 3RPMA 1TYRA 1O3TA 3EYUH 2F1AA 2GK0A 3CSYB 1YQVL 4IU2B 3DG6A 4XPBH 3MCLL 2R0WL 4S0TD 4ONGL 3T0EA 5ANMA 3DHJA 2DBNA 3DXAD 2O5XL 3VBOB 4M3CF 2Z1WA 5CLZA 4C1WA 5K59E 5B4XA 1YMMA 3EYOA 3KCPA 5AD0B 4J6GA 1F5ZA 3GIQA 4ICNA 2P0OA 4F8LA 5KHHA 4FPEA 4JG0L 2QKIB 3GMRA 1RFDL 2YKLH 4WXYA 3CMOH 1V05A 1KV8A 4W86A 2ATSA 3WLKX 1P5UA 2OIIA 3SJVA 4AQEA 2A5ZA 4LGPB 4LHUD 4G8FB 5BQ7B 4AHQA 1LKNA 2NY5C 4JHOA 1N68A 3IMRA 1CLZH 5J12B 2IH1B 4HT1H 2ZGTA 3IGHX 4FQXD 3VFMB 5LY2A 2I9EA 1EJXC 2WJ5A 5FYBA 1I1AD 4XBJA 1AI1L 4KJWD 3FH7A 1GZHC 3RF9A 3O06A 4XP5L 1OGAD 2VCBA 2F74A 4O1EA 3NTCH 3OKDB 1GGBH 4PLKD 5M03A 2R49A 2CKSA 1N1TA 4GKXA 3BEWA 1HJBC 1EGMA 4OIBA 5MHSE 3TCLA 2FHBA 4B50A 4APQC 3A12A 3RDTD 3QEUA 3B9IA 4DGWC 4ZS7H 1ONWA 5HI0A 4LKSA 2R51A 3SPHA 1HLCA 2WRAA 4UT5A 4TR9A 2W9EH 5DANA 1KM4A 3S9YA 3JU2A 3F7PC 3ZKYA 1E6NA 3GFYA 3UJJL 3QY8A 3GXTA 2OXGB 3NDYA 3W5NA 1HQWA 4NQSA 2DWDA 5MEQA 1GVSA 3D52A 5J8LA 1NAKH 1R47A 1C12A 1EDTA 1CT8A 1Z42A 2H8PA 1A49A 3ZDYB 1A7RH 5FZ6A 3KSCA 4NEHB 4WO4C 4Y22B 3HOJA 1OAYL 4PIYA 3L9YA 1FFOB 5BVPH 4H8WH 5EZLA 3H7BB 1YEHH 3PWPD 3K71A 5F1NB 4MKSA 5DWUL 2DMKA 4XETA 2ZGOA 4AW4A 4IRJD 1PAZA 4LHJB 1FL5B 5TD4A 2IPUG 3TSMA 2Y5JA 3GXMA 3D3VE 3G18A 3ZUCA 2HH0L 3LZOA 4E2QA 5LVEA 2CO7B 1ADQA 3QEGH 4QOKE 5E08H 2CERA 3SY8A 4OCSL 3JXAA 4WKHA 1K4DA 1M7IB 3OZOA 2CAUA 4TOQA 2J8UE 5G05L 2FYYB 2CO6B 3AXMA 4Y96A 4YNYB 3BN6A 1OCNA 3C8KB 3QQ3B 2NR6C 5K9DA 2RR3A 2FT6A 4CXWA 4ISVA 1DCLA 1XF5A 1EJUC 1T99A 3SCNA 3GCWA 4RKAA 2X9YA 3WDWA 3QQNA 3N7JA 1RJ8A 3RLGA 4M1GL 1JL8A 2F8IA 1RU9L 1TUXA 4YO0A 4JPSA 3ZFGA 1PY9A 3SSZA 2NXZB 4R8WL 5EUKB 4KESA 4LS1A 4FQIH 3ABKB 1NGQL 1MZRA 1T1WA 1EGVA 3D25B 4QRBA 5DQ9B 3VKMA 2DSVA 1RVKA 4BZ4A 5T33H 1HSBA 3LZQA 5A1LA 4WHYG 2VW2A 1W9WA 1YXCA 2DORA 2DQGH 4XXCA 4EF3A 3B83A 4K7PY 4ODWA 2OS7A 5H8MA 3TA3B 4QKFA 5FY7A 2BNQE 1UA6H 4QXUH 1OC1A 5E03A 4P9HH 4F58L 3RLVA 3MRIB 5KSAB 1LTXA 5I5MA 1MHEB 2Z6JA 5JHBA 1L6GA 1UXZA 2ADGB 1HI6A 3BWUC 1E1FA 1AW1A 3A6CL 4Z1VA 3ZKQD 1HXKA 2FUQA 4XN7A 1H7RA 4U3HA 3ZL4H 2XFGB 2ZGSA 3PVEA 2AEZA 1OF8A 3POWA 1NGXA 1DQ0A 1W8HA 1NIEA 4XISA 4REQB 1NCBL 2DZUA 2WOQA 1XEUA 3OQ3B 4W8AA 3E9UA 4O02L 3GMNA 1Q4NX 2VLLA 4BQ4A 1U8JA 1YJDL 3AU1A 4OFDA 3RGTA 2FWSA 3B02A 1QO3B 4XUGA 3WQCA 4D0BB 3FU5A 1P0SE 4U6HA 2A3YA 1RK0B 1E8ZA 4PWJA 2EH8H 3APFA 4BZ2L 1AODA 1BZ9B 4Q0SA 1RUJ1 5T50A 2OSWA 3W85A 3UERA 3WMQA 4OI0A 2ENYA 4K38A 3V5DA 1MRCH 1ZHKA 1NIDA 1VJSA 1C8PA 3UVAA 1F4HA 2NXYD 3KXFA 2C3GA 4JQ2A 4NQVB 3T1LA 3MZNA 4DH2A 3QCVH 3TN92 2K7PA 3FY1A 3N9PA 1PZ5B 5DUPH 2EBNA 4UV4L 3QIBA 2YGLA 3SQOA 5BRBA 3KW8A 4OW6A 3VFVA 4IRZL 1ZLWH 2CAKA 3ZDXB 5CQ1A 4HVBA 3FU6A 5L9DH 2WLIA 4GJYA 1BD2A 1ZK5A 2BASA 1S5MA 3KS0J 4G1MB 1BD0A 1TG8A 1ZENA 4ZB0A 2NQLA 2VNRA 2X89D 2VLKA 3C6CA 4LLAA 1IIKA 3KJ4C 3MRCB 4FXKB 4M7ZC 1EFXB 3A67L 3NH7H 5T3ZL 4P5TA 3ZBMA 3GVQA 4EYUA 2JKXA 4X6BB 1AH1A 2OCJA 4FPSA 4P5KB 1PM7A 3H42L 3LAFA 4YG3A 3STFA 2XIMA 1TMF2 4PJ7E 4XZ4A 4P99A 1H0DB 1POV1 3CFNA 4P5HA 3GYCA 4PCFA 3LNHA 4M5ZL 3FQRB 1FWAC 1KKRA 1I9RL 2FJGA 5FXXA 3VHPA 1WJ3A 1UR0A 4QLKA 4UOQA 3H4WA 2AQQA 2ISSA 4J3ZA 5IJKA 3ZN6B 3LBCA 4Q52A 1I9IH 1ZANL 2ZA9A 2VJ0A 1UJ3C 3A6BL 4WIWA 5FYVA 3LTSA 2PXYC 3WR0A 2RS51 4ODTL 2HG5B 3ULVF 2I5IA 3RFZC 2IPKA 2DQHL 1IF2A 4HUVB 2HX9A 4YGEA 4LSBA 2F19L 4FL4B 3IJEB 3VFPA 4HIEB 2QULA 2X7VA 3T77B 3BI3A 3EOOA 3S37L 3DFQA 2WXRA 1F8MA 4FKEA 2ZUNA 5BXRA 3AREA 5C07D 3EB4A 1R3SA 2GN3A 4YHZL 3OSVA 1KBWA 4RW5A 3R7QA 1L6ZA 3WEXB 2HLFD 4H41A 2O6DA 5FYKE 4PQ9A 4PJ8D 2FX9H 1NBQA 5E9AA 2HYMA 3PABA 3ZDYF 3MLYL 1I75A 4GIRA 4MLJA 1I8KA 3O12A 1OGPA 2WZ0A 4XD3A 3EMQA 2OMBA 2FEEI 3FZUC 5J7MA 2V5SA 3IWPA 4ACTA 1S7VB 4E41E 3LQMA 3F7KA 2XXMB 4RSUA 1F3DH 2V6HA 5CD5C 3RR1A 1G7QA 5L19A 5DUJA 4OLWH 2VWEC 3ATEA 3QUZB 1ZE3C 4UYPA 3QORB 2ARJQ 3ARZA 3US0A 4ZX4A 3RVVD 4K1YA 2BWCA 2Q87A 4QKDA 1S38A 1VFFA 4W6YB 2DY3A 3KCOA 4A7SA 3KRSA 3ZZ1A 4NO0D 3RM8A 4PVLA 2Y7QB 3W39A 1NTHA 5DVMA 2DAVA 1E5BA 3W7EA 3HS0A 5I23A 2VX6A 1WW5A 1SN0A 3BE1L 3K75B 2H3XC 4JFEE 2Q86A 2JXMB 3EKGA 5KZMA 3C5ZB 2WNUA 2YRPA 3BWAB 2PF0A 3QTGA 4FZEL 2YDRA 1XPYA 3P30L 1CLCA 2XZCL 1PZDA 2ZZJA 5H6HA 4AAJA 4KK9D 3QQ0A 1EUNA 4F7EB 1XIJA 3LGDA 3CX5K 2OKXA 2Q3ZA 4NO2A 3TVMB 1W15A 4XXWA 1KCWA 3X1BA 1QOPA 2F08A 3SJ3A 1ZX5A 2IC1A 2BP8A 3GAKA 2YK1H 1D3CA 4FFGA 4W68A 2ZP9A 4ZAKA 4MDIA 3ZYRA 1KXHA 4GIAA 3LEIA 3RXZA 1YMHB 3OHXC 2R69A 1XNAA 1JK9B 4CUCA 5KTEH 1T0OA 1FWIC 5JIIA 4FQXC 3GLEA 4GY7A 1I1AC 4FS0A 2N0KA 4CJ0A 2A3WA 4IP4A 4UYQA 2R23A 4KJWC 1M56B 3C3NA 4OECA 1AZ2A 2XG9A 3NG3A 4PLKC 2IV8A 4INDA 1UZDA 4RMQA 4HUMB 2A4ZA 3PFQA 1KSRA 3D2TA 5XINA 3VFTB 1J6PA 1G1YA 4ZMNA 1ISXA 3ZTCC 3SISA 3BESR 4NQUA 2X6VA 1P7TB 4ZKTB 3V0BA 4RISH 2R1NA 4U1IA 4IK7A 1GOHA 5I18H 1JEZA 5I77A 2NTSP 3BUPA 5FS5A 2FR4B 2ADIB 5FA4A 3D3VD 3G6DL 3NFSL 1XLEA 2E1DA 4P00B 3K6FA 3S47A 1BTCA 5EO1A 1ONAA 2VLJB 4EI0A 1JCXA 4Q8QA 2BVOB 4KEUA 3URNA 4OIIL 3V0AB 4JY4A 3WLLA 3BRGC 4BCEA 1TWSA 1F4WL 2DWRA 1MUWA 2WIIB 3QI9B 2V09A 1CK0H 3NABH 1RZJL 3T42A 1U8IA 4R0LC 4JGZA 1H6TA 3I7SA 3I4IA 1KCZA 2J57A 3T71A 2Y0IA 4YBQD 1T83C 1JZEA 2XTJE 1NCNA 4TS6A 5DJAA 4IRJC 4YSPA 2KD7A 5EYYA 1G9EA 3TONA 4OQ1A 3FWEA 3OD0A 3TPUA 4CCMA 1ZBVA 4PTNA 1FOD1 1QJY2 1ZPUA 3DGBA 1NA1B 1PY0A 2OX5B 3AIBA 4KOCA 2VECA 2ENPA 4B4PA 2Y1YA 3KHQA 5IVZB 3C5QA 3HCVB 2DCJA 5K3VA 1R64A 1PSKH 4C6NA 3AI0A 1FUYA 2KAUC 3ZDXF 4ORGB 1AL23 3L9RA 5KS9A 1CZSA 4FSAA 4ZBCA 4DWSA 4AEDC 1YLBB 4ANVA 2GJ6A 4CDUC 3KOFA 1VACB 3LZFH 4ZFZA 2P34A 2JJWA 2NW2B 3FUJA 5J9PB 1O60A 4JQTA 4L3FA 2HTLD 4XZBA 1CC3A 4M1DL 4QGYA 3M0KA 3BUDA 4IYKA 1P7KB 3MC5A 2ZEXA 5L4JA 5JVLA 1XO8A 4S23A 3DG7A 3FX4A 1FIGL 3V10A 1MCPH 5IRPA 1P53A 3M1ZA 3DKWA 3X3GH 1YPIA 3MA9L 2IANE 3DYPA 4BU2A 2BOLA 3NAAH 1LLZA 1RB8G 4ICXA 3GMOB 4MWFB 2E9BA 2CGRH 3OXRA 3HPJA 4Z95H 4TVCA 1U8MA 3UFYA 4HS3A 4LBSA 3HF3A 3SSJA 3TS8A 3CFJA 4DGVL 1KCVL 2PP7A 5E4AA 2YBPA 3DG3A 4LMQI 3C12A 4GKZB 2Z28A 4I7WA 5EHFA 4I18A 4ZUVA 1JNEA 3MC0A 1DGRN 2XRAH 1CFSA 4FZ8H 4JN8A 1WICA 2VXTH 2VZ1A 1I53A 3P54A 5JR1H 4LB4A 4N7QA 1IEHA 3D18B 2HWD3 2MCAA 1W5PA 3FO9B 2VDPH 2I7OA 2PR4H 3ITXA 4OGYH 1GP6A 4DPCX 1G1KA 4YXLL 2W66A 2OYMA 4P7OA 2YJLA 2E8ZA 1NINA 3PGCB 3HHSA 3K72A 4R5EA 1HL4A 1BKZA 4F7KA 1URXA 2W61A 5C7HA 1FNAA 3SCMD 5GGTH 4I9AA 3DV6B 4QDMA 2EVGA 5ITFB 1X8MA 3WS3B 5LASA 4QHLB 5D2LA 5A2IH 1KDKA 3FUFA 3APBA 4M0NA 3WP6A 4G3YC 2E9WA 5FGBA 3MW4A 3RX2A 4Z7VB 5F4XA 4UB0H 3ALFA 4TSAH 2AJSH 1WUZA 2X4PA 3IPWA 2NXYC 6FABH 4AMKH 2FIKA 3ZMEA 1EJSC 2EDXA 3PTRB 3KPNB 1GYLA 3IIIA 1XYLA 3KS5A 1H3PH 3UBXB 1KBKA 3EGSA 4GUHA 1HYRC 4QIUA 1PGL2 2IAMA 2VAJA 3HPLB 4GAYB 3MLRL 5J56B 2QGHA 1EJVC 3R25A 4Y4HD 3VXSD 1LT8A 3ZXKA 2PCEA 3MV8A 4UIKL 5IUSA 1SJAA 4M93C 3CFBA 3MLPA 3HBPA 1CO1A 3DPRB 1C1LA 5AVYB 4LUJA 3VTRA 3NSJA 2W92A 5I19H 1K4GA 3P9LB 1IM3D 3BCDA 4K94C 4L0YA 2CFFA 4JFOB 4KBBA 1AXSB 4KKQA 4UW5A 1NGYB 1T2JA 4P48A 1UPSA 3OYWA 3CLMA 1A8ZA 3PAVA 4ZTEA 4CMHC 1UMZA 4UIMA 4O61A 1JU3A 1HHIB 4BFKA 2RH0A 2DQCH 1DQ5A 2Q2LA 4DRVA 2WM1A 3QA3B 2D40A 3A3XA 2B9AA 3FBKA 4GB33 2WNVA 5LA0A 2VENA 1YEFH 2Z2UA 1JK8B 1NDZA 3ASIA 2NMSA 4NBZB 2VURA 1YN6A 1U95A 1DBKL 3OAUL 4HUWA