3ZR5A

Structure of galactocerebrosidase from mouse
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into Krabbe Disease from Structures of Galactocerebrosidase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 218
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zr5A01
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3zr5A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zr5A02
1OT1A 3OGRA 4H8VA 1JZ5A 1J12A 2YLAA 4B9YA 2ZIDA 3H53A 3TTYA 4UFKA 2TAAA 3HU7A 3WL0A 5M5DA 2Y24A 2JIEA 1EA9C 2HISA 1UWTA 3VSTA 3II1A 2ZWZA 2YKKA 2G3MA 3DDFA 1NOUA 3LDRA 4PMVA 5DT7A 4IM4A 3HZ3A 4EAMA 5HOSA 1BYBA 4Y7EA 3CIVA 5ECUA 5AY7A 1BYAA 4F66A 3GXDA 1ODZA 3WNLA 1VB9A 1ISZA 5KEZA 1R85A 5GNXA 4PMXA 3WQ6A 5IFPA 1UWUA 1W91A 4HPHA 1ZJAA 3WELA 2IGTA 3K8MA 3WMSA 4ACYA 1FH8A 3UESA 2AOSA 1Q6GA 5CJ5A 1JNDA 2W4XA 3WQ8A 1LWHA 3NDZA 3I3DA 4JCMA 4KRTA 1BG9A 1VFFA 5DO8A 7CGTA 2CYGA 2DSZA 4F9DA 1HL9A 4UZSA 1J01A 1UKSA 2O9RA 1UR0A 2W91A 3GXIA 1R34A 1G5AA 3WNNA 1E6XM 3VSUA 3WEOA 2YFOA 3MMWA 3RM8A 1H0GA 1UYQA 4J27A 1US2A 2XG9A 2WBGA 2G3NA 3OLDA 3UG5A 1IZKA 3MKKA 4OJYA 1FH7A 1B90A 4PMDA 7A3HA 2Q8XA 3WDQA 5D8WA 4OOUA 1JYVA 2XQRA 4P8XA 4HA1A 1J0HA 3RIKA 5AC5A 1E55A 1VRXA 3MU7A 3WD2A 1W1PA 4UFHA 2BXZA 3ZR6A 1QI5A 1B9ZA 2WC4A 1UOKA 3DECA 3GM8A 3UERA 1EHNA 4DWSA 4CU7A 3WQ5A 1UD5A 3PBGA 1EGZA 4W8LA 1U30A 3GYCA 4BF7A 3DHPA 1UYPA 3GDBA 5BXPA 1DWAM 1JGIA 1QI4A 2GVYA 1BFNA 5C71A 4HXCA 1R46A 2X8RA 3NMBA 2XUCA 2GUYA 4WKHA 2RGMA 2O9TA 2VRQA 1DEDA 4P8WA 3W28A 3VGFA 4HMDA 2XN1A 5FK7A 1TA3B 3L4UA 1KCLA 5BXSA 1GCYA 2J7FA 3BGAA 1B3ZA 1PX4A 3BMWA 3ARQA 3VOCA 1OD8A 1R33A 2XGIA 3VGEA 2F61A 2WZHA 4CCEA 2VT0A 4MJ2A 1A47A 3UR7A 3AXIA 1JI1A 1CYGA 1C93A 2DEPA 5E70A 5FL1A 3ZR5A 1EDGA 3ALGA 5I79A 3BMVA 3CC1A 2ZX8A 4AEEA 3KL3A 3A47A 2BNJA 4TXEA 3AZRA 1PEZA 3EJQA 1NH6A 1JIBA 2GJXA 3AYSA 2E8YA 5IDIA 4EE9A 1H1NA 1LWJA 1W1TA 2Y4SA 3M6DA 4Z2LA 3AZTA 5E6YA 5CXPA 1OWQA 2Y5EA 1V3MA 1BSIA 2F1AA 3TOPA 1LG2A 4D1IA 2W61A 1UWRA 3RPMA 3U57A 4P7QA 3H55A 5HDRA 4NZCA 3WF2A 2V5DA 2WMHA 3FY1A 4QCFA 2JF6A 5ABEA 1C8XA 5ABFA 3BUQA 1CECA 1TQWA 3SUTA 3ZOAA 3VDAA 3K8KA 3EJTA 1PBGA 5AC4A 3QOMA 3AI0A 1BVZA 5A95A 5I78A 3DYMA 4PCSA 1DWHM 2E0PA 1PJ9A 4BQ2A 3VO0A 3HG3A 1VEPA 4PCTA 1ZU8A 3M46A 2ESCA 1UG6A 2AEYA 2WVVB 3WUGA 1RP9A 3J7HA 1WPCA 4J3UA 3TP4A 1MQPA 2Y8VA 2F7PA 4UOQA 1KTCA 9CGTA 6CGTA 3WUEA 3WY3A 5A6JA 4JL1A 4OOZA 4F9JA 3OG2A 3B9DA 1XC6A 3F5LA 5EFDA 3T08A 1B3WA 1HXJA 2X09A 3AIVA 5FMDA 2YL5A 4CD6A 4ATWA 3RILA 2E4TA 4RE4A 2PBGA 2YBUA 2ZOXA 4GQRA 2VZOA 3U5YA 3WF0A 2VO5A 2GFTA 3CMGA 4W7VA 4MJ4A 1MQRA 1V3IA 1BGGA 1N82A 1CZ1A 2WVVA 4V2XA 4H2CA 1UZ1A 4TX6A 4AMWA 3ARUA 3MS8A 4Q22A 1KXTA 1WE5A 1D2KA 2XM2A 4QFUA 2E40A 1HVXA 1QHOA 1ITCA 2EBNA 1C3FA 1VEMA 3QHNA 3D52A 3NCOA 2WMKA 2A3HA 2YDSA 3AHXA 4PN2A 3THDA 2XVLA 2XN2A 3VGDA 3T2OA 1VFOA 3IMMA 4GI8A 5D9MA 2A3BA 2YA1A 3TTQA 1K9EA 4AZBA 2Z1SA 1E73M 4HOZA 5I23A 1OBAA 1GOWA 4TOQA 3TA9A 2OYKA 4OBSA 1V02A 2EPOA 4OBRA 5A6BA 4JZ5A 1HJSA 4FNQA 1J0JA 3PTKA 3WH7A 1XYFA 2GJRA 5BWFA 1HVQA 3CZSA 3EMQA 3MUY1 3PZGA 1JXKA 1EH9A 3ARXA 2VQUA 3VIJA 1WB0A 2X2HA 3PZNA 4C7GA 5LA1A 3WH8A 5I3DA 5CSUA 5C70A 4E8CA 2YJQA 4TTUA 1GUVA 1AQMA 3SCVA 3MMDA 5IHRA 1OT2A 3A22A 3NSMA 4Z2GA 4X9YA 3KWXA 1Y4WA 1V6YA 1JNEA 4MB1A 4RL3A 3AS3A 1AVAA 3MV01 5A8QA 2CKRA 3D5HA 5CPTA 2FGLA 5FCZA 3AJ7A 4IUGA 4CU6A 1CDGA 4W5UA 3L2LA 2J25A 3CHEA 1OGGA 3MUZ1 1JAEA 4UFJA 2W63A 3NUKA 1TQTA 1JDAA 3BAXA 2G3JA 4TUFA 1EHAA 1B1YA 4U33A 1NP2A 1AQ0A 3AMKA 2F8QA 2WB5A 3BUIA 1PPIA 1D3CA 1HJXA 4GO8A 2IXVA 1GPFA 2E8ZA 3SCTA 1E72M 4EQVA 3M07A 2CNCA 4PMUA 3S2CA 1VAHA 1KXVA 3SCOA 5CPQA 1WDSA 2ZXDA 1W9DM 3DX4A 1GHSA 4A4AA 1CXFA 2CETA 1NP0A 3L4TA 4AYGA 1UZ4A 3CZNA 2GJXB 3NJ3A 3MMUA 2AAAA 1JZ3A 4AEFA 1I1XA 3N11A 3GBEA 5CLWA 2WKGA 3HN3A 4GO9A 3VSVA 4FFGA 1TE1A 3VINA 1CEOA 4M29A 2CHOA 1GOOA 1VBUA 3CHDA 2CITA 3VMPA 2EEXA 3B9AA 3O2LA 4D6GA 3AHZA 4HMCA 3MSDA 4Z2IA 4CGTA 1H09A 4F8XA 3LPGA 4UCFA 1ZBWA 1E6PA 1F4HA 2PBOA 5A2CA 5EB8A 2WLZA 1VFUA 2DSWA 1Y9MA 2WANA 3SUWA 4W87A 3ZO9A 4C7DA 2PWGA 1S46A 4FNTA 4NRRA 1XCXA 4OZOA 1HF6A 3RCNA 4DWSD 1G0CA 3MUAA 8CGTA 1M7XA 4FNRA 4HU0A 4KH2A 1W32A 3ZMRA 1QWNA 4P8UA 2J8GA 4LQ1A 3BCDA 1V3LA 1NWSA 2VX4A 4D6EA 3F5KA 1VIWA 2CIPA 1NWRA 4OUEA 1H3GA 2DGAA 3HJEA 1E6RA 1B31A 4CD8A 3CUFA 3BLKA 4R5EA 2YA0A 3QR3A 4UOJA 2YA2A 4B15A 2WXDM 2OWWA 1UD8A 4WK9A 1JDDA 1CGUA 4JAWA 3WD0A 2WNWA 5GPRA 3OZOA 3WNPA 1UH4A 2OSXA 1CGYA 1UD4A 4XV0A 4ZEPA 4AD1A 4UQ9A 4XUYA 5BRQA 3HBKA 2A3AA 4WJXA 3L4XA 1SZNA 4CD5A 3D51A 4FF5A 4JFSA 2VCAA 2E9MA 3A23A 1J9YA 4UQBA 2JF7A 3RMEA 5IXEA 4DUXA 3BCFA 3KF3A 4U2ZA 3LXCA 1EXPA 1ZJBA 3N15A 5FK8A 2WWDA 2WVSA 4YN5A 2J7GA 4KRUA 2ZUTA 1UWQA 2F7QA 2WHKA 1BG4A 1ISYA 2Y2WA 2JFEX 1H5VA 1HL8A 3POCA 3AS1A 1E43A 3N04A 4UFLA 4NI3A 3ARRA 4NF7A 5BCAA 1I75A 1SMAA 2NSXA 3S6TA 1OM0A 2CPUA 4GPNA 2VX7A 2QPUA 2E9BA 2QV4A 3RO8A 2PWEA 5HBFA 1O7AA 3BUPA 2B31A 1IZJA 3BSHA 3LRMA 1ZBCA 3PIGA 1GJUA 1ODUA 1FA2A 2XSAA 3I3EA 1UD6A 4ML4A 5ABGA 1WP6A 4PEEA 3VIIA 1WDPA 3FAWA 5CPSA 5JIWA 3ZSTA 4H8HA 1BQCA 3EMZA 3LF7A 4UR9A 1TG7A 1V3HA 1XSJA 1W9XA 5C8BB 4MB3A 1VF8A 4FMVA 5E09A 5CGTA 2VQTA 1IV8A 1ESWA 4CN4A 5A94A 1GONA 2DT3A 3SC7X 2XJ7A 3CUHA 2D2OA 3IANA 3VMOA 2V3EA 1QNPA 3CBWA 1KR0A 1GOQA 1BVNP 3PZOA 2DH2A 2VL4A 1MW0A 1VFMA 4FFIA 4GIAA 3VGHA 1FH9A 2ZICA 2WSPA 1CTNA 1WZLA 4QCEA 4QP0A 4UFIA 2VCBA 2QF8A 3CZEA 2WMIB 1BAGA 3BSGA 1TQVA 2BY0A 1E6SM 1WNOA 2F18A 2F7OA 5A2AA 2BS9A 1LJYA 4QLKA 4S3KA 3W25A 5LYRA 1OCQA 4B3KA 2JIWA 4CKQA 4P7LA 1JD9A 1CBGA 3VD9A 5A8NA 3B9EA 5CZKA 2QPSA 3IJ9A 4JFUA 2OW7A 3GH5A 4UQEA 2BY3A 2WYSA 3VIGA 4CUCA 5A8OA 1WZKA 1VENA 3ZJ6A 1FOBA 1UKQA 2VCCA 4CVWA 3PZMA 5AYBA 4BA0A 4F79A 1QI3A 1NWTA 1UUQA 1R47A 3THCA 3PZVA 2XYLA 4AMCA 1QI2A 1PX3A 2E9LA 1E0XA 4AZ5A 3CZJA 2X2JA 4MNKA 4L4OA 5I6SA 4PTVA 4PUEA 1Q6CA 3BVXA 1HTYA 3N13A 1W9PA 3RJYA 3VIMA 3DC0A 1LQ0A 1TVPA 1V6XA 3GH7A 3FN9A 3WDRA 3AFBA 1HJQA 4NX0A 4RE2A 4AZCA 2VZSA 2EQDA 3ARPA 3CMJA 3WBAA 1CGXA 1UD2A 1RP8A 3W0KA 2VMFA 1M53A 1Q6EA 4QLJA 2CKSA 4PMRA 2X1IA 1WDQA 4AD4A 3WY2A 1J0IA 4PMZA 3SUSA 2DSVA 4N0RA 1W2PA 3AIUA 3VTRA 1HX0A 4GQQA 5I0DA 3KE0A 4OGZA 3RJXA 2D73A 4DUWA 4PMYA 1E4LA 2G3IA 3WD3A 3U75A 3VIKA 4D6HA 4CN1A 3WENA 2GSJA 2YL8A 4X0NA 2EPMX 2OXBA 3IJ8A 1DWFM 4ATLA 2CBIA 3W38A 3AXHA 3AISA 3W4RA 1JZ4A 4CU8A 4M1RA 3WUBA 3K8LA 3EDKA 4N42A 3WQ4A 4QAWA 4JKMA 1O7DC 1EOMA 3BAJA 3UCQA 4YPJA 3AQUA 4BZYA 1CXIA 4KWUA 3SIMA 2FH6A 1B3XA 1HXKA 5ABHA 7TAAA 4HP5A 3ZT6A 5EFFA 2CBUA 1KBBA 4ZE5A 3SUVA 3BC9A 1W1VA 4FFFA 3EJPA 4MDPA 1RH9A 4A3YA 2VI0A 3W29A 3GXTA 2YL9A 2DIJA 4AIUA 2BVYA 4MNMA 4H7VA 1MFUA 3DX2A 2EAEA 3OBAA 3WMBA 1MYRA 4U2YA 3FHAA 3AIBA 5CGMA 5E6ZA 3ZQ9A 2WC7A 1HIZA 1FHLA 3I3BA 5E9AA 1JDCA 1J0KA 5BRPA 4M8UA 1C91A 4GINA 1CWYA 1GQIA 3WF4A 1UR8A 3RM4A 4DM2A 1KXQA 4X0VA 1GHRA 1ISXA 3HMCA 1C92A 4D6IA 2D22A 2V3FA 3WFLA 4PMQA 3NIYA 3F4VA 3A5VA 2ZXQA 1ISVA 5I2UA 5JIPA 5JBDA 3CZ8A 1E0VA 5I5RA 4MADA 4PTXA 2VR5A 3ZJKA 4M24A 2QQUA 4U3AA 1L0PA 1UWIA 2ZWYA 4AC1X 1XSKA 2BHZA 1O6IA 2DSKA 3T0BA 4W88A 3CH9A 3NSNA 3U1XA 3TONA 1M04A 2YDRA 2RGLA 4UOZA 3VGGA 1KGXA 1W3KA 1SFSA 1CXKA 1ECEA 4IPLA 2PWFA 4U3CA 4XB3A 4GKLA 5JUVA 1H4PA 2QHAA 2A3CA 2J47A 4FLSA 1XHGA 4LYRA 1UQYA 4MAZA 1H2JA 1RPKA 4J3TA 4HU8A 3GXNA 2DDXA 1U33A 3ZT7A 2W67A 3DYOA 1E6ZA 1Y7VA 3FAXA 1GQKA 2J7HA 3BAKA 5LA0A 3EJUA 1OIFA 1W3LA 2EPLX 4ZXOA 2YOCA 1A3HA 4GI9A 5E0FA 1UHVA 2IUZA 4U5IA 3APGA 1BYDA 4K68A 2DIEA 2XSBA 1LF1A 3AMLA 1CPUA 3ZM8A 4D6DA 1HJUA 3EDFA 2NT1A 2VC9A 1V3JA 4NSBA 3K4DA 1J18A 1V02E 1X6NA 1EQPA 3AIQA 4IPNB 1VEOA 4PMOA 1EDQA 4AZCB 5FMBA 1FHDA 3SEPA 2NW0A 2MANA 3GNOA 1KWKA 4LYQA 4WSKA 4Z2KA 1NWUA 3WBEA 2F2HA 1V0LA 1DWIM 5CQ1A 4NZJA 3LFIA 4TVCA 5FL0A 3VGBA 1JZ7A 2V3DA 1HN1A 3PZUA 1HKKA 3W53A 4LXFA 1XD1A 4CD4A 3GNPA 4CCDA 2GDVA 1KFWA 1MWOA 2J7DA 2EPNA 4GXPA 4R27A 4D71A 1BHGA 1EQCA 2J79A 4YHEA 3BUBA 3IAPA 3RWKX 4LPCA 3AHVA 3PZQA 5HPOA 1BGAA 1YQ2A 1MW2A 2WK2A 1CNVA 3HG4A 5A6AA 4JFTA 4AISA 5A6MA 1Q6DA 1KBKA 5JBEA 3GXFA 2XWEA 4B3LA 5F7UA 2CBVA 5BYWA 4PSPA 2J7EA 4EANA 3VPLA 4P8VA 3LPPA 4MTVA 4JL2A 1R7AA 4JFVA 1TFVA 2D3NA 1WAWA 4AW7A 2D23A 3VIHA 4UTFA 2OSYA 1UQZA 5ABFB 3SCUA 2WCGA 5A1AA 2X0YA 3ALFA 1V03A 3ZIZA 3VMNA 2WKLA 3FNDA 3S5QA 4MB4A 3KF5A 1B3YA 5EBAA 2EO7A 4HZ8A 2G41A 5M3WA 4ACZB 4ZFMA 2O92A 3KZSA 1XH1A 2VR4A 3EJSA 3WNMA 4WIWA 2OSWA 1V6UA 5LA2A 3GXPA 2WMFA 1UKTA 4AYSA 3VD5A 1BTCA 2WBKA 4BS0A 2ZXBA 4W89A 4OKDA 2EADA 3AIRA 3A4WA 3CTTA 2PF0A 2FHBA 4J7RA 3AZSA 3CHFA 2WM0A 3GBDA 3VDHA 3OIHA 4AXNA 1VBRA 2VTFA 3WD1A 3WF1A 2XFYA 1F4AA 3VD7A 3ARZA 4W85A 4Z2JA 4E8DA 4GZIA 4WF7A 3AMGA 1QNRA 2QLYA 4KGJA 4GZJA 3U7BA 2OYLA 3E1F1 5HNNA 2JEQA 3NSXA 2X2YA 3UG3A 1KWGA 4JFWA 2PC8A 1KQYA 4DO4A 1E15A 1JZ8A 1ISWA 3K4AA 3AIWA 3DDGA 1C8QA 3TV8A 3ZT5A 3N1AA 2DSUA 2AMGA 2VNCA 2XHYA 1LL6A 2J78A 1JL8A 3W24A 3N17A 1K9DA 4HMEA 5A6SA 4DO5A 2E3ZA 3A6OA 3B8SA 2ZUNA 5BROA 4Z2HA 4HZ6A 4AWEA 5HXMA 4E4PA 4DWSB 3CPUA 2FDMA 3VX1A 3LX9A 1DTUA 2WVUA 4UNIA 4E2OA 1UKPA 4JIEA 1W9BM 4JHOA 1G9HA 1B3VA 5FIXA 4FLRA 2C0HA 2DQXA 3SURA 3AHTA 2VZVA 2UY4A 4NXSA 3WH5A 5M03A 3A21A 3LRKA 4GZEA 1GORA 5DEZA 1V08A 5DFAA 2YIHA 3BVTA 1HKJA 3VIOA 2XVGA 2FH8A 3SCSA 2WMGA 3VKKA 1CIUA 1C7SA 2CXGA 2VUYA 4XZBA 2YBTA 4UQCA 2W66A 1UA3A 3LPOA 3VM5A 3MI6A 2VZUA 1TA3A 1I1WA 3ECQA 5D9PA 2UY2A 1JFXA 3N9KA 5JBFA 1LLOA 1G94A 3WIJA 3KEHA 4B9ZA 4UFMA 3KL0A 1TQUA 2EXOA 1DHKA 1WKYA 4ATDA 3AS0A 3DX1A 5A6KA 1US3A 1NOFA 4MAVA 2XVKA 1G1YA 4AZ6A 2Z1KA 3WEMA 4CVUA 2ZUWA 1E0WA 4WSJA 1QVBA 4PTWA 2VVNA 3AHYA 1CXLA 3BAYA 1KR1A 2JALA 3AS2A 5CSYA 1X1NA 1X6LA 2ZUMA 2XWDA 5GNYA 2FYVA 3VUPA 4BQ3A 3W6MA 4GI6A 3DX0A 1ZBVA 3CZKA 4J3SA 3WDHA 4DO6A 3AICA 2XVPA 1U2YA 2UY5A 4WKFA 4AZ7A 4J3VA 4CD7A 2FGZA 1QX1A 4LYPA 2WHMA 4FNUA 1L8NA 3OA5A 4W93A 1MFVA 4XZWA 1AMYA 3LIHA 4PTMA 4XX6A 3T2PA 1B2YA 3UGFA 2QQVA 1PAMA 3D4ZA 3WF3A 1UH2A 1J0ZA 1KCKA 2D20A 1E40A 3OLIA 2DT1A 4HOWA 1H0IA 5A2BA 3L4VA 4ACZA 4M81A 1JZ2A 1SMDA 2GDUA 2ALWA 1ITXA 5DF0A 3O9NA 1BYCA 2OLHA 1TVNA 3BH4A 4RE3A 1E6QM 2BVDA 1WO2A 2D0FA 2WWCA 4PRWA 1HKMA 1LG1A 3H54A 1FP9A 2BHUA 1K9TA 1SYTA 1OSEA 1GW1A 5FKYA 4QDMA 1BF2A 1FFQA 2YLLA 3BLBA 2V38A 1XD0A 1D7FA 4L4PA 1UWSA 1E3ZA 2ZUSA 3W26A 1NQ6A 3D4YA 3CUGA 3W82A 5ANNA 5D9NA 1Q4NX 1H49A 3W37A 2D0GA 4MB5A 2ZX9A 4D6CA 2ZE0A 2VOTA 2J7CA 3EDDA 1PZ3A 1GQJA 1E5NA 4FFHA 1JI2A 2EABA 2QQWA 4PUDA 2V3GA 5AYIA 2Y8KA 3CLWA 1W2VA 5A3HA 5E1QA 3QOKA 2GK1B 2DH3A 1VJSA 5GQBA 1QBAA 1WZAA 1ST8A 3CO4A 1M01A 2EJ1A 1XSIA 5I24A 2OWCA 2NT0A 1E4MM 3WY4A 4MDOA 4D1JA 4M56A 4CN6A 3POHA 3BVUA 2AC1A 4W8AA 3SCWA 3L4YA 3WH9A 2VRJA 1NM9A 4EKJA 4FLOA 3AMCA 1ZBKA 4H41A 3FXYA 2WVTA 1CXEA 2X0HA 4FLQA 1WZMA 2XN0A 1R7OA 3BAIA 1PZ2A 4B16A 3MO4A 1EO5A 3EDEA 1J11A 2ADDA 2FE0A 2UY3A 3PHAA 4FNPA 1HKIA 1E3XA 4HA3A 1DP0A 4C7FA 1QNSA 3U5UA 1QOXA 3BLPX 2O9PA 4IISA 3HG2A 1Q6FA 3SCRA 4BCEA 3GXMA 4M82A 4B1LA 4AMXA 3T09A 2OYMA 2WZIA 1NARA 2A3EA 1QWUA 3VD4A 3QGVA 3A4XA 2BHYA 4OIFA 5BXRA 2D3LA 4P7OA 1XH2A 1TR1A 1QHPA 5BXTA 2BVTA 3H3LA 1JD7A 2YL6A 4ZENA 3LXBA 3OGVA 4TX8A 5KZ6A 3A4AA 2WHJA 1HP4A 3PZ9A 1KQZA 5DMYA 3LXAA 1CXHA 5IHSA 1V6WA 3PZIA 5E0CA 4FK9A 1WCGA 1MVYA 3CZLA 1LL7A 3ARWA 2YDQA 6A3HA 2AEZA 4HTYA 4D72A 2X2IA 4W5ZA 1UR1A 1DWJM 2C8NA 1K9FA 1UA7A 1HWWA 1AQHA 1W9UA 2W92A 1E6NA 1TMQA 1OD0A 4MNJA 3WD4A 3N12A 1OGSA 4JCLA 3LEMA 3OLGA 3MSGA 4M80A 5TD4A 1IT0A 3DYPA 1V6VA 4V28A 3D3AA 2CHNA 5FKBA 3AIEA 3F5JA 4ZE4A 1GVIA 4AIEA 4Q7NA 1KGWA 3PIJA 1ZS2A 2WMIA 2VRKA 1R8LA 4JKLA 4D6JA 1XCWA 4YHGA 5DT5A 1PIFA 2XTKA 3DHUA 3BVWA 1C7TA 4AD0A 2ZUVA 4HOXA 3O6AA 1WDRA 1YHTA 3PTMA 2J74A 3A3HA 3T2QA 1PX8A 4JKKA 4UZUA 3IAQA 3ARYA 2DT2A 3T0DA 1JF6A 3SCPA 3OZPA 4H04A 2BY1A 3WUFA 4PSRA 1UH3A 2WC3A 5FKCA 2XIBA 2ADEA 2V5CA 4J3WA 3CUIA 3EDJA 3CV5A 2XFRA 3OGSA 3TTOA 3VNZA 1J0YA 4MNLA 1QW9A 4TTGA 1OIMA 4AIOA 2BFGA 1XV8A 3PTQA 3EYPA 4AZHA 2PI6A 4URIA 6TAAA 1CGWA 3QHMA 4AD3A 4HZ7A 2BY2A 3S5YA 1GOIA 2J8FA 2JE8A 4CCCA 3TTSA 1JZ6A 2UWFA 2J75A 5FIPA 1HJWA 3VX0A 3A24A 3U14A 4PBGA 2ZUUA 4KMQA 3AXXA 4W84A 3WL1A 2ZX6A 4D6FA 4A3HA 2D24A 2EPKX 4DUVA 1UR2A 4AZZA 1EO7A 2G4FA 2XM1A 4W7WA 3VDCA 2VVSA 3BXWA 3WFZA 3K46A 1MW3A 2CCRA 5I77A 1GOMA 3VU2A 1W3HA 3WN6A 2WHLA 3LDKA 1KGUA 3IK2A 1TZ7A 3WY1A 1E5JA 3VD3A 1JYWA 1TUXA 5HPCA 3VDBA 1W1YA 1GZJA 4J28A 2VZTA 3AROA 4WKAA 1R87A 3WQVA 3NYDA 2BV9A 2WPGA 1OINA 1MW1A 2PB1A 4W86A 4V27A 1UR9A 2D0HA 2CERA 1QW8A 3VNYA 5IFTA 3JUGA 1V0NA 3SCQA 2IXUA 3WDPP 1MQQA 3WMCA 1E70M 4JQTA 2O9OA 1FFRA 1EDTA 3N18A 3ZJ7A 2WCSA 3G6LA 3M7SA 3L4WA 1V0KA 5D8ZA 3KLLA 3UG4A 3IGUA 1JFHA 3S5ZA 3CGTA 2WLYA 5FD0A 1V0MA 5A69A 3LMYA 3OB8A 3GZAA 3VIFA 5EMYA 4QLLA 5A8PA 1M03A 2W5FA 1UKOA 3T0AA 3CZGA 2DT0A 3BVVA 1GVYA 3W81A 2JEPA 2OW6A 1GQLA 3UGHA 1VJZA 4WLCA 3W27A 1JG9A 1OB0A 1C90A 3EBVA 1XRVA 3RM9A 8A3HA 1HJVA 2C7FA 3MV11 2W62A 1E1EA 4AZIA 4JHZA 4TVUA 3LIGA 1CLVA 1E4NA 3CHCA 3QHOA 3K1DA 4BQ4A 3OLEA 3LRLA 5D9OA 4BQ5A 5CG0A 1EIBA 3KL5A 2CESA 3SUUA 5A6BD 2VURA 1JAKA 1GJWA 1QNQA 3BUDA 3LPFA 1JYXA 3L4ZA 3WNKA 4QHZA 3PZTA 2GK1A 1E9LA 4UQAA 2WMJA 3WQWA 1V3KA 1E56A 1R75A 3HG5A 1ZL1A 1MXDA 1LL4A 2PWHA 1JYNA 2ZX7A 3VM7A 3UETA 1KB3A 2J62A 4B1MA 1QNOA 1G01A 2EACA 1QHZA 2ZXAA 1NOWA 3ARVA 3EJRA 2XFFA 4NXKA 5A8MA 1JXJA 3FW6A 3KLKA 1KTBA 4HPGA 1CENA 2J77A 3ARSA 1RD6A 2X05A 4AD5A 4W7UA 1H41A 4AD2A 3CUJA 1K6AA 4TVDA 4AZGA 1JF5A 4NZFA 2G8ZA 1XH0A 3AMDA 2DPEA 3UR8A 4PYSA 1J10A 1HT6A 5M17A 2J4GA 3FHQA 2VX5A 3WDIA 3AYRA 2ZX5A 1BLIA 1UD3A 3G6MA 4U5KA 5D4YA 3VILA 4AY1A 5GNZA 1KXHA 4EK7A 2QMJA 3W6LA 3UGGA 1HNYA 4DWSC 5FMCA 1MXGA 3OSDA 1CLXA 1GOKA 3GTNA 2WCAA 4ZXLA 1QI0A 1W9VA 4J3XA 4FNSA 4MPKA 2F1BA 1B30A 3VVGA 2F7RA 2WW5A 3NDYA 2YFNA 1ZB5A 5CLTA 2XIIA 2CEQA 1Y9GA 3VIPA 2WSKA 4NRSA 3MANA 4P7RA 1TQSA 2D1ZA 4PMNA 2VJXA 2XPKA 4LGXA 3RDKA 1BPLB 3ZSSA 1EOKA 4KGLA 1XYZA 2WZEA 4S3JA 1GNXA 1HP5A 1B0IA 1T0OA 4UQDA 1QPKA 1UR4A 3ZJ8A 5FOOA 1E1FA 3ARTA 4P7NA 4W8BA 2HVMA 2FHFA 1E71M 4LX4A 3GNRA 3WDJA 3WNOA 3AOFA 2CBJA 2J7BA 3D50A 2XVNA 1PIGA 1XGZA 2XGBA 3WEZA 1W2TA 3WKZA 4DM1A 1H11A 1Z32X 3GH4A 1UASA 4H8UA 1DWGM 2WAGA 1W3JA 3U7VA 1CGVA 3PN8A 1SR0A 3IJ7A 3DX3A 1E4IA 2GJPA 1QBBA 2PWDA 3BAWA 1PS3A 5A6LA 1TCMA 3MUIA 1R86A 1P6WA 4U31A 3UEQA 1C8YA 1OGBA 3EMCA 1CGTA 3WSUA 3L2MA 2FHCA 2VX6A 2BXYA 2QMKA 4HA4A 3WH6A 2OWXA 3SCNA 1FP8A
chains in the Genus database with same CATH superfamily
2TMDA 3WFCL 1JZ5A 1WIPA 4E8GA 1FI2A 1UFGA 4UT6A 4ZD3L 1DZ0A 4PJ7B 2GABA 3VSTA 3WN5A 3UZZA 3W1AA 1VMHA 3G1DA 1OTUD 3F95A 1QQDA 4OB5L 4QYOA 2KDYA 4HIXL 4PGZA 4JRFA 3S1VA 1W8HA 3WTVA 3QSTA 4WM8C 1A65A 4C1XA 3GEFA 4ZO9A 5IFPA 2JK5B 4HPHA 5CD3B 1E4JA 3SO3B 3VTAA 6REQA 2VMDA 2ZYSA 4NZRH 4BEQA 3TBYA 3SH4A 2CHZA 2XL9A 4CUBA 1EEZB 2EINB 5KSVA 1OXCA 2HTKC 5DO8A 2CYGA 1RU9L 2DZWA 5H8UA 4RFEA 5I19H 1G5AA 4OQ1A 1MWAA 2WS93 2CH8A 2GCYA 5L88L 2P7TA 3WFCH 3OR7A 5EB9A 4LPTA 4S3BA 2YPVA 3O6KL 1RZ8A 1H8NA 1JCMP 3UGEA 4MKTA 4XN8A 1OLMA 4K5MA 3KJ6H 1EZSA 4R5TA 1A14H 1B4TA 2P48B 4LLQA 3U4BL 2B14A 2GJJA 3W70A 1MDLA 3BW9A 2JMRA 3K3QA 4PGLA 3FH8A 3MLRH 3V6OC 2MQGA 5C71A 3K13A 1MS3A 2D4DA 2GOUA 2P7TB 1MCNA 4NAJA 4XSLA 3HN1A 1IGJB 3UXFA 1OD8A 1KFLA 3ZX1A 4X9HA 4ZUUB 1S0BA 1SVZA 3SH3A 4FOWA 3LGRA 5FPVA 5CHNA 2GLKA 4XD3A 1WCQA 2E7HA 3L5HA 1FWNA 3RU8X 1QRKA 4AQLA 3IWPA 2C9RA 1JPTL 1FH5L 4MWAA 4A3QA 5T91A 2Q76A 4ZD3H 2RJGA 1AL7A 2F74B 4D1IA 5IBUB 3BJSA 2QFPA 4OLXL 3U57A 1KCZA 5DT1H 4KI5C 1G1CA 3SDCC 2V5DA 5L36A 4NRXA 5E00B 5A7WA 2GSYA 1TQWA 1Y0LA 4DNMA 3GFZA 5FB8A 4HBKA 4TLGA 1PJ9A 7REQA 3VO0A 5HHMD 4FSAA 2J9YA 5CP3H 2UV8G 5CNHA 1Z9OA 2Z4QB 3U7WH 1I0BA 5C0GA 5K5YA 5CZXC 3GRIA 4ODWA 4QG8A 1RP9A 3UGRA 2XX1A 4UT7L 4GRWH 4L4VD 4P05A 4UOQA 1XCQB 2WOYA 1HZKA 4ZW6A 2QT6A 4JL1A 4OZFA 5BOOA 3VD1A 3G08A 3LZZA 2TNFA 4PJXE 1FGVL 2YMOA 3VUSA 3QYCA 2FT8A 2X09A 1UW8A 1XF3A 2J21A 5L6YH 5CINL 4JFDB 2PBGA 2VZOA 4HUUA 4AFMA 3NQMA 3IARA 3MLTA 1PG7X 2GFTA 4APQD 1AR61 5DJCB 5H2ZA 5LIWX 2EDFA 1QAPA 5FA5A 2ZYIA 4XAWL 4HK6A 5CSZB 3T4CA 5T1LB 4WKZB 1WE5A 2YUXA 4QFUA 3L67A 1AX0A 1VFAA 3NJMA 3H8OA 2DY3A 5DG2A 5FYYA 5A2KH 1KJ2L 3TW6A 2XVLA 1MCOL 3ME3A 1K5MC 4OLVH 2NZ1A 4U1NB 5ETUB 3I8TA 3X13A 1DJHA 3HFFA 4AI8A 4IMLA 2X4UA 5BWFA 5LO7A 4L4LA 4N8UA 3ARXA 4XILA 1KUMA 3QKEA 2BWCA 1DUYB 3T8VA 2KZHA 1RZJC 5DMKB 1EV2E 1KFAH 3N1PC 4X9YA 1WA0X 2LLEA 5CJOL 1ZBA3 5A8QA 5EWSA 3ERXA 2YG0A 4GKYA 4W5UA 4F57L 5G05L 3WFHB 5G1TA 3AL5A 3B7RL 2NCEA 3WMLA 5C0BA 4G8AC 2GQ9A 5KTLA 2RTTA 2WWKO 4Z7NF 4RS5B 4F7EB 2IAND 3UZYA 1E72M 1Q0YH 1V9U2 2Z3FA 1BGXH 2GHZA 4R5XA 3BW9B 1FSKB 1X5XA 4QX2A 1CXFA 4XWGH 3NJVA 2R69H 1K6WA 3M0VA 2DMCA 3N11A 3FB8B 5BVPL 3NEVA 1FWIC 1T6WA 3HVNA 1GPOH 5DZ9A 2JCWA 3M7OA 1VBUA 3V4VH 5E99L 4JQXA 5JXED 2IPUG 4TUJB 3QVAA 1UY3A 4CGTA 1VPQA 4HZLA 4UQ3B 3QEZA 4TUKH 3SUWA 3VVWA 1XCFA 4X6QB 4PIXA 4FNTA 3CZUA 3C6LA 3RZCB 3SECA 4YZ3A 3MUAA 5H6HA 3R1ZA 1HZYA 4XO9A 4XJWA 4XT1C 1D8WA 1W2OA 2FZDA 5IVFA 3QZLA 4PJ6A 1QQP3 2WLIB 2PYED 3WKPA 3ES7A 2YA0A 4Z7WE 1BZEA 3RDTB 2G60L 2PA7A 4XZPA 3BLIA 4JAWA 5AAPA 2OMTA 4IBTA 1MR5A 1GEHA 4IEXA 3NOEA 7FABH 2YK1H 1LQSR 1LP9F 1OB1B 3OZLA 4OVVA 2BLFA 4PW4A 1EPZA 2TRYA 4WJXA 3SQBB 3L4XA 3A23A 3ZXFA 4DBSA 1Q2SA 4ZNEA 3BDXA 2LTQB 3W3BA 3LXCA 1SOXA 1VBE3 1OKOA 3SY0A 1R3KA 2WVSA 5E8EB 4GH4A 3GALA 4J2MA 4YUEL 5G1MA 3JTTA 3TYCA 1MZFA 4ZA0A 5KHHA 3TN0C 5DRWA 2NMSA 1E43A 4MXQD 3NK4A 4IRZA 2QBXA 3S6TA 3O6CA 3LS9A 2FX8L 3G04B 4XD4A 3LRMA 1SXAA 3BGMB 4URTB 1CDIA 4ML4A 1AZVA 2B5IC 3TEYA 3MV9A 3TYJA 3VZOA 4U1SB 4YG6A 4KKBC 3D3VA 4R9DA 1SJHA 3TYGL 1HHGB 3JT2A 1ESWA 3Q3GB 5FF2A 1UCWA 1TSHA 4KU1A 3K2OA 4MNQE 3PFMA 4NWUL 2DZBA 4AXWA 3D9AH 1CWVA 4Z3FA 3EOYG 3FT2B 3DI0A 1P5UA 1OTSC 1HEJC 4BFBD 5CBJA 3BFQG 3MOAL 3H2MA 5FZ3A 2YAHA 3S6OA 3KWVA 1TVBA 1AFSA 4JY8A 4OLXH 2Y1HA 2ZG2A 3MBEA 3W25A 4YGEA 3IFOB 4NUPA 3HW7A 4M4RA 4JDZA 4OCXL 4JFUA 1MUWA 3GH5A 2WYSA 3IETA 3S9YA 3GHMA 1H19A 4JN8A 4ZZ9A 4YHZH 4PJIF 3SIZA 4JJ5B 4XN2A 4HK3J 1UUQA 2Q5BA 4L11A 1B9BA 3O41A 4ISQA 5GGVY 1S5IH 1PX3A 4QXGL 1YLVA 4MLIA 3RO6A 3BPZA 8RUCA 4KNQA 4BZ4A 4L4TA 5CADA 4N22A 1NPJA 4AQ8C 4C6CA 3VZXA 3K80A 1LQ0A 4HIHB 1OCNA 1F6AA 1HJQA 2D03H 1XJBA 3WBAA 1XHHA 2XONA 3ABXA 3ATGA 4PAZA 2YUVA 1FFOB 3CEPA 4O50A 5J89A 5JQ9A 4LB8A 2VUOA 1M2VB 4I77H 1ZLVH 1JYCA 2PE4A 3EZ4A 3H9HB 1W2PA 4X0KB 3AIUA 4X5WA 4B2DA 43C9A 5D2NA 4X6FA 2GSJA 2ANUA 4MNQD 2D7QA 2Y22A 3VXMB 1QNZL 1A7OH 5DAVA 4FTVB 2Y5JA 1FWFC 3W1ZA 1QSZA 3EDKA 2OZNA 3S48A 4N42A 4JKMA 4H83A 4X4ZA 4JTJA 5HHPA 2ESVB 4AYDC 1JHJA 2HT4C 3S2AA 1INEL 3L95A 3TPUA 3AG2B 4DEQA 1MJJB 1EZWA 1AD4A 1F4XH 5FUCE 3DETC 3JXSA 4G7VH 3DO3A 2YL9A 5JR1L 4E9SA 1CAWB 5BV7H 2BVYA 3HE6C 1MFUA 4PRPB 4A66A 3H7VA 5SWSD 3VB9A 2FPYA 3KJ6L 3QUZC 4KERA 5E16A 1JDCA 3OQ3B 1C91A 5G4OA 4NHVA 4IQEA 5F3BA 4HV8B 4DBWA 3AP5A 2D22A 3I9AA 1O60A 4L8DA 3MFFB 4R6UA 3HS0C 2P3IA 4F7KA 3F4VA 2DUPA 2DLHA 3CFDA 3D87B 1IF2A 4QE4A 1A5BA 4NQUA 1JPFA 4MADA 1I0DA 4XN5A 1CPNA 2W2IA 5B38G 1S5IL 1EFXB 5DCCA 4NO4A 3MACH 43CAB 4Y9PA 4P5MA 3PUGA 1DIOA 4KMLB 4GRMA 5HCHA 3R6IA 3QFEA 4KRPD 1SACA 4UNUA 5DMGD 4ZZ8A 5K59E 5CSZA 3OHIA 3W1LA 1OX6A 4QNWA 3MGTA 1CF1A 4MA1C 2CIKB 4JTTA 1D3GA 2AJVL 4KKLD 4NCDA 5EEZA 2J47A 3G8RA 4P2QD 1CT5A 4J3TA 4UV7L 4IXLA 3J8F2 3FQTB 1EJXC 3LPWA 4J4KA 5FA4A 4K7VA 4RPQA 5C0JA 4MCYB 2QXWA 3DV4A 1FKXA 3KBMA 4MAYD 3YPIA 5DHVB 1T7XA 2AI0L 1PZCA 2CDOA 1O94A 2WQRA 1JZEA 3MPCA 1BM7A 1A7QL 1I53A 4NWTL 1DQJA 4AJ0A 1N26A 4IP5A 1RHI3 5BW7A 2QJNA 5J9PA 3QG6B 3MRCA 1KT2A 2BNUB 2MANA 2NY2D 1UZ8A 5M1TA 2QADB 3G7DA 3F65A 3LFIA 5FWQA 3FQWA 4H0HB 3W53A 4LXFA 2HWF3 2ITDA 4X2RA 1YX1A 4HMZA 4EP8C 4MXVE 4CCDA 5SWSB 3D0CA 2NY3C 4XN9A 5FLIA 2CD0A 3DX6B 3HI6L 4NUBA 2AAVA 1GIGH 1F11A 3PZQA 3LD8B 3BVNB 4KK5C 3ZDZF 3SODB 1O5UA 4FJZA 1Q6DA 1X8MA 1MQTC 5TFSL 5ADPL 1TME1 4KWSA 2C1PA 3GG8A 4NFDA 4NNCA 5F7YC 2D3NA 3AZWA 4DP6X 5CBLA 2K9UA 5I76A 1K1DA 2ENYA 4FQCH 4GVHA 4QBXA 3S4TA 2R1KA 3O6FD 1W90A 4RWYL 3LSDA 4DF9A 3ROLB 4W4OC 3RFZC 2PZNA 5IEKB 5BNNA 3DK2A 2HRGA 4X6DF 4UTWC 3VOIA 2H9GB 4MKNA 4BFNA 4XP6H 1SHXA 4N85A 4OKDA 4XBNA 2VDRL 2PF0A 2FDBP 4M9PA 2AREA 4CP1A 1AE6L 3KPRA 1REDA 3IWVA 2QLYA 4AYID 2DJSA 1CDHA 1A14L 4LALA 1R3LA 1CWPA 3M1ZA 3HUJA 4UILH 1VBB2 2QEJA 4DO4A 4LO9A 3D4GA 2Z91A 3FVMA 1IQAA 1MRQA 4LK4A 1IS6A 3T6CA 1K4DB 2Z35A 3RPKA 1A5FL 4H01A 4X5PA 3SDDC 4YBLB 1AI1L 1FWHC 2EEBA 3CU7A 2R69L 3EFOB 4YK4C 2GQ8A 4PLJC 2DVGA 1OC6A 5CWSA 2C4FU 1QJY3 3M16A 2H6PA 1E9QB 2A85A 1LLWA 3AU1A 5F7DA 3Q2DA 4JBRA 3ARBC 3P0VL 4NHKA 4LBNA 1ZWIB 1RZKL 1CDCA 1ZT7A 5A2FA 1DQ1A 4YXLH 4P2OB 3KR3H 4Y19A 2PLKA 1O7SA 1N7MH 2BVWA 4AVOA 5A3WA 5J1TC 5DJ6B 2QIWA 3HGSA 2CAUA 1S7TB 1I8LC 1UA3A 4YSQA 3VM5A 3K71B 3MI6A 5E8NB 3WEXA 5F7HA 1JFXA 2QULA 3JT0A 2A9BA 3NQFA 1W5NA 3ABKB 3E5UA 4B9ZA 3E8UH 5T5FA 4S1RL 4S1SH 1ZP3A 4QPGA 1MZEA 3MRFB 4K8HA 1NFDE 2GIXA 2PU0A 4PB3A 2JALA 3AS2A 1DJYA 1VBE1 3GSWB 1PCKA 3W6MA 1TZIA 5LVEA 5EOTB 3AICA 4Z1AA 4HIIB 4AVHA 4EN3D 1Z7S2 5D8JH 3UWWA 4WKFA 5CBIA 2WOBA 4LYPA 2EDRA 5AW0B 1S7QA 4PN6A 4DKDC 1DSFH 1U8NA 1VLWA 1MFVA 2H6UA 1AMYA 4LGRB 3RR4A 2VDML 4EYUA 3EOTH 1O6UA 2KZWA 2Z1VA 5M0TA 1FL5B 3UADA 5BMFL 4N1HB 4YPGB 1IU1A 4BE5A 3BSMA 2ALWA 1W1IE 1AR72 2PQSA 1TVNA 3S42A 1J1OH 5HDOA 2QBWA 1R3RA 3ILDA 5DDJ2 3LS4H 5A6QA 3WVJA 4MNGB 2V37A 3QG6A 4IIQA 2E74C 2ADAA 4NPMA 2W1SA 5CAHA 3L9BA 4XO4A 4OGAC 2YV8A 4NHCL 4BCUA 4PJ7F 4GB9A 1HINH 3R1GL 5F7LB 2G9ZA 2VY0A 4UTJA 4WHDA 5A3TA 4M4PA 3F7QA 4JFFB 5T9CE 3QOKA 4LQFL 4RFT0 3SBRA 1AZ1A 1X5ZA 4E38A 4ZFZA 5HYQA 4JM2D 3HNVL 1HNGA 1YY8A 2YPJA 1XQLA 1RCOB 2PF6A 5BNOB 4IIFA 4PJFA 3TVMA 5T5OA 4RNHA 4YWSA 3FBKA 4J9JA 1EHKB 4UTWA 4HG4J 4B16A 1CICD 4NPKA 3VB8A 1KKRA 3QIUA 2UY3A 43CAA 1ZYBA 2QUTA 1T1XB 3BLPX 3GR4A 1Q6FA 3SCRA 4Z3JA 3AREB 3ESPA 1LEKA 4GB33 2BP6A 3N7LA 5FYJH 3UP8A 3MJ8B 3QIUC 3NIDF 1BBT3 5EZLA 3RNQA 4EVZA 2PHUA 4JIPA 1EPVA 2YGPA 3SPHA 3ZFFC 1XBDA 1O6TA 1O5DT 1JUBA 1HP4A 5DMYA 1CXHA 5C0CE 4AAPA 4XW3A 4QI3A 4XIAA 3V5DB 3ARWA 2D3JA 4J35A 5TE7L 4XO8A 5DFWH 1LK3L 1JN6B 2PW2A 2CDEB 3MHFA 5IQ9A 3UC0L 4OCMC 2WZMA 1W9UA 3N7KA 1E6NA 5I5JA 4WY0F 1PG7L 4WQ6A 3FFSA 1AA1B 2FBRA 1EV13 3QZNA 5C6WH 2WLIA 4X7SL 2D9CA 4I3RL 2GN3A 1AQDB 4UIMA 2VRKA 3NSDA 2NZIA 4O4YH 5DT5A 3BVWA 1R3JB 3SRKA 2ZGMA 4XFAA 3I65A 3IWZA 4NSKA 1NJ9B 2IDTA 4DTGL 3A3HA 1RUI2 1OZMA 3SCPA 3FZUD 1LLAA 4XTMA 4HGWA 5J6HB 1L4IA 3ILFA 2Z7GA 2ZXCA 4ZMYA 4MXVF 5GGTH 5D03A 1RKRA 3DGGA 3EBAA 3HN5A 2BDNL 1VACB 4U6XA 1DQ4A 3TTSA 4NRXB 4LRIA 2WAAA 2L7UA 4PW9A 4YX2H 4WJEA 3NQ8A 1AHWA 3LAFA 4TUOB 1XGQB 4AYBA 5GGVL 4WD0A 4YLQT 4Z76A 5I0WA 3EYSL 4M5PA 5FA3B 3TDFA 2VXNA 1TUXA 3MGAA 5FY8A 2N1TE 3V5CA 4X8CA 1BLNA 5BNPB 1OINA 3O41B 4DETA 1Q8VA 3NFNB 1QW8A 4JRXD 3O0LA 3V4VB 2LW8A 1MQQA 1JN6A 2CGZA 1G5GA 1VPOH 3PMEA 4U0QB 2WCSA 1JFQH 1WBLA 4NNBA 2ENRA 4XMVA 4EN6B 3N1GC 5C0EB 3AVRA 1V0KA 4GABA 4CDGC 2D98A 1KBGL 3ME0A 4IMLB 3S5ZA 3CGTA 1SSGA 4NRZB 4ORIA 2MQ0A 3KR3L 3TCTA 3TQVA 3LB9A 1Q66A 4Y5YB 1RUH3 2IW0A 2AGTA 2FB2A 4HSOA 2HLEB 3OUHA 4ELMB 4PV9A 4KFZC 4TKWA 4WAFA 4XBJA 5DJDB 3ARBA 1EFXD 1THFD 1MQKL 4HXBL 1C90A 3IN0A 1JK8B 5CSGA 1HJVA 2WZ0A 4W4QA 1RZ8B 3TNQA 3W1NA 1M2VA 1A4JA 1D4M1 1G69A 3M0JA 3AWOA 3FE5A 4HIHA 1XIFA 4MMXC 2HPIA 3WIFA 1XDTT 2BNOA 1KTRL 3GIVA 1SFDA 1AG1O 2W1WA 1G7MA 4UQAA 2BU9A 4Q9QL 3KEDA 3GPEA 2KM2A 1UXWA 3CHPA 3EFFA 4RGOH 1JYNA 4YWIA 1ASJ1 4Q33A 1XT5A 3RKDD 2ZHNA 1OSYA 1PVC3 4B1MA 1PW3A 4E4SA 4N6QA 3LDVA 1SCRA 3SKNB 3EJRA 2ZOKA 4NUJB 4HHHA 4BQBA 2YRZA 3ARSA 3RAJL 1BXHA 3OJDB 4UXAA 4P9HL 2HVJB 3MV8A 2WLPA 4XMIA 3K6IA 4AVKA 2C79A 5AVQB 3OX8A 1FUNA 3IFLH 5GLWA 1SPPA 3T1MA 1PMJX 4LAUA 2AUYA 3WDIA 3KVDD 3DHFA 2N4IA 2MQCA 3G1YA 4JTDA 2R83A 4DWSC 2PURA 1YWKA 3RTQB 1H3UA 3N41F 2ET1A 4JRXB 1CE6A 1Z6JT 2PODA 1OEZW 3WSOA 4N7IA 4AX3A 3APYA 1EERB 1UEMA 1YRZA 3U4KA 1Y9GA 2M2DA 1JPSL 1GJPA 2P28B 1F8MA 3VXGA 1MIMH 4DGUA 5FYLL 2GC3A 4PMNA 2VJXA 4QX0A 3RDKA 4G9FA 1NGXB 4Q14A 1BQ5A 1KULA 1A5MC 1MFAH 3W00A 1BOYA 1GZWB 1UR4A 3QC6X 5D6CA 5EBLB 2E7QA 3N35A 4FDWA 1BSLA 3IFLL 4TUJA 4C65A 3WKZA 2KKQA 1Z32X 3GH4A 2ZKHH 4H8UA 3MJWA 3X1GA 4MQXD 2IH1B 4K94L 4BFOA 3LHVA 2GJPA 4Z7OE 5J11B 3MV8D 1J1TA 1SEQH 1K03A 2Y0FA 5AVNA 1RULH 3CL6A 3GAYA 4XIOA 1FDLH 1O5KA 3VFNB 1TWIA 4WTWA 4ADTA 1SHWB 4U2AA 3WSUA 3GD1C 1N8ZB 2A6IB 1WGOA 2YGQA 2AI0H 4AENA 4O65A 5E89A 3NRFA 2PZ0A 1ONQA 2XQYA 5D96C 5DMIL 3DJ9A 1O5LA 3OGRA 4OMDA 4V1YA 1JU4A 5LXXA 4ODVL 4GNKB 3H1YA 1B6DA 4XP1L 3HU7A 3QUKB 4DVBA 4XKYB 3LTPA 4P2QA 1E9PA 1LOFC 4UU9A 5LDSA 4Y7EA 3BO8B 3RWJB 4FNLH 4H6KA 2WBJC 2VDQB 2XG3A 1F6PA 4WZHA 1RIUH 3O6LH 4ANVA 6ENLA 4KWKA 1Q7QA 1KKOA 3WO4B 2RFXA 2ZPKL 1CB2A 5TDNB 1W8NA 4BFEA 1D5XB 1HGWA 3TJEH 4P5MB 1U12A 3IVUA 5JPNC 2WLJA 3WEOA 5DWPA 3MN8A 3MMWA 3ACGA 4Z7QE 2WRAA 3TBDA 3PM6A 1ZENA 2XLAA 4HUKB 2JE9A 3RX5A 4ZMAT 3S5OA 3W76A 2BVEA 2ZC8A 5HYQB 3G1FA 4GVGA 1XF0A 1MFNA 1U30A 1G9ML 1WT5A 5L9VA 4BCYA 3BTAA 1EMTL 4Q7IA 2OS2A 1ZZ9A 1JGIA 1SXCA 1GGIL 1TMHA 3P4NB 2VR8A 1EC8A 2QELA 3IGKA 3MW4A 1V6OA 5DVNA 5I0ZA 3W7QA 5DFTA 1OABA 3VLBB 4KZDH 3WDXA 3RA7L 2Z4QA 3OC8A 3UR7A 2UZXA 3CBNA 1C93A 5ICZB 3CK0H 5AKRA 3EHBD 5C0NC 2WSUA 1I1CA 1OIOA 3BEVB 1L7IH 3PP7A 4QIUA 2GJXA 3AAMA 2DWEA 4EE9A 3AZTA 4LAZA 4UTAH 5D1ZB 4LC6A 2NXYB 4A8LA 3FH7A 4GJTB 4F58H 1DOSA 2VZ3A 4PD4J 3GZKA 4H6EA 2E7DA 4NCC2 4GY7A 3MXVH 4E5TA 1Z5HA 1JRHH 1MRCL 1KCRH 3KBEA 3QJFA 4MJ6A 5KYXB 1S9KC 5D1XB 2Y0IA 4Y2LA 5C33A 1QJZA 4YFLF 5IB3A 3CO2A 5HJXA 4ERSH 4XO6A 4JBSA 1V8HA 4Y5TA 2I74A 2FEJA 1DE4A 2CO7A 4NHLA 1RZFL 4BEIA 2E1DA 4L8CB 3D0VB 3WUEA 3OBKA 3EGXB 1F6LL 3GF6A 4GRLA 4S3DA 4NKOA 3QIWD 1HXJA 1C12A 2FQFA 1Z3NA 2R0LH 2OW4A 5B4XA 3H4HA 5JNYB 2G5RA 5FXZA 1JHTB 5CEYA 3UC0H 3ORWA 4L4VE 2VOKA 2NUXA 4MWAE 4GG6E 4NOTA 12E8L 3K6OA 4YZFF 1VEMA 1H6XA 1AR82 3CXDL 1J8HB 3GMMB 3S1WA 1FC2D 1VFOA 4BWUA 3GDLA 4P48A 2IPTL 4HOZA 4LBRA 2ARCA 5I93A 1DDLA 1Q6QA 2PDHA 3V9EA 1MZ6A 1N6VA 3GRWL 2VYOA 1MZRA 2C13A 4AEDB 4HD9A 1BTMA 4KKQA 4U3HA 4G5ZH 3PTKA 2AGJL 1XYFA 4KCVA 4MDIB 2R23A 3WQDA 2XVBA 1XGTB 2IV9A 5BO1L 2F7FA 3H6AA 3TEVA 1WB0A 4ZU7A 1SEFA 1W6LA 1YQVH 1ZZCA 2E59A 1WTLA 1P0SE 1AJ0A 1NFDA 3SKMB 3C8NA 3V18A 4RL3A 4QYOB 2AQNA 1A4AA 4CNNA 3PSVA 2HVNA 2QV5A 3D69B 2Y64A 3H9SB 4JTHA 2CG9X 3NUKA 4ZXKA 4B9FA 4KX7A 4NO0B 5T5FL 4MWAC 1P6FA 1D3CA 3QFJE 3QE5A 1U5YA 1QGLA 2UZIH 4P3DB 2R2HB 3B8DA 4FQLH 5C7VA 4QPYA 3RI9A 3SCOA 3EXLA 2NTFA 3NW4A 4G7VL 1D9KA 1LTDA 4XMXA 3EWZA 3FTWA 4I09A 5FZAA 3L5XH 2HTLC 3IMUA 3KW8A 4C4BA 2R16A 2GCYB 3GBEA 1QOQA 1MNSA 4DHGA 1GOOA 3HS9A 4LSTH 4ODTH 5I3HA 1SW3A 2ZKXA 3V4VA 3O2LA 3RNDA 1R6VA 4MDJA 1KJ3L 1LENA 1CU4H 3ZO9A 2ADGA 3ABLB 6REQB 1QYGH 3EW3B 4FERA 2P80D 2OEMA 5JHLA 2ZTNA 4I3GA 3PL0A 1SBDA 3CLEH 4OZIF 1BX2B 5JZ7D 1D3HA 3C8DA 3CUZA 3HT1A 4MHBA 1SDAB 5ES4B 1ZV5A 1OYBA 3HJEA 1PLCA 5BY5A 4MGSA 4N8VA 4JFYB 1UM4L 1U8CA 4UOJA 3N42F 1ZEAL 3VXMD 4YZWA 1S0EA 1IRAY 2X1TA 1CE1L 3HGJA 4PFEA 5DAQA 4NAQA 4ZEPA 3NACH 5BRQA 5F7EH 4DQOH 3HBKA 1JBCA 3JU9A 4NNPL 1X50A 1PXGA 2XYBA 1QXPA 4LPWA 1AZZC 3TV3H 1W31A 4GNJA 4EI5B 3QCUH 2FR4A 2XTJB 1ZD6A 3ZGIA 4KGQA 1POJA 1PD0A 2F54E 3UZEA 4FX7A 5BO0D 1AQDA 3J4UH 3MY9A 1N7ML 1UB3A 1GW0A 3O2WH 2X16A 1ETB1 2GC4C 4OLWL 4NHXA 3ARRA 3MEPA 5FUOH 1YDOA 4PJ5D 4TNFA 1PLAA 4ONFL 3QR1A 5T3XH 1G0XA 4NAEB 5EBGA 3UJFA 3HMXH 5HBFA 4TNVF 3QJFB 4MJ6B 3P3UA 3NKTA 2XZAH 3LRSB 5ABGA 1RBAA 4R97C 3BLFA 4XVTH 2BVQB 3CXHK 4TSAL 3ULUC 3FTZA 1K5MA 3GMOA 2IXQA 5LK5A 4IQJA 1NCOA 5KSAA 5HGDA 4GH4B 1XZ0B 3LD8C 3WZ0E 2Z4GA 1RJYB 4MAYC 1S2AA 3RSJA 2DH2A 2AH2A 3VGHA 1FH9A 2ZICA 3Q67A 3AYAA 2W08A 3PPGA 4HKPA 5CUSH 2QQJA 2HPOA 1TQVA 2ODOA 1R64A 4FR6A 1ONWA 4QLKA 4PU2A 5LYRA 3CN0A 4RV3A 2JIWA 5DJCA 5C9ZA 4P7LA 1BLNB 3OGJA 3H2QA 4UQEA 3VBFB 3N6HA 4G1EA 1Z7S3 2VCCA 1N1VA 2R0KL 5EPMA 3E2SA 3BMXA 3V52L 4PJAE 4LVAA 4P5KA 3SZ6A 2B8MA 3MRQA 4A55A 3FX4A 3CZJA 4YWGL 1BQHG 2RMNA 4HKXB 2NDFA 4JPSA 3BZFA 3E5XA 4D2JA 1Q9KB 4MHHI 3HGOA 5GALA 3R05A 1NA8A 3O6DA 3W7GA 4C4KO 2ZKWA 1P7TB 2DJUA 4N8CL 4C83B 5AD0A 1V7YA 2OXHB 1CGXA 1UD2A 4UI2A 3MGUA 2NNAB 2BBFA 2AZ5A 1AI1H 2CHHA 3POIA 4PL2A 1J0IA 2Q7YA 3PU8A 1HX0A 1OI6A 4F7PA 3FQUB 2IADB 3SDDB 3RVTD 4TQIA 3U75A 4PJ9A 2YL8A 4X0NA 1NUDA 4CRQA 3LKSB 4EROA 1OK6A 2CSGA 5FZDA 5B7ZA 4V1DD 3FFDB 3RJOA 2Q76B 2VDPB 4DINB 3K3OA 3V4LA 3C87A 4N8MA 4MZYA 3MODH 3FT4B 3TO4A 2ZPKH 5JPNB 2JXMB 4JRAA 4KWUA 2FH6A 4FG0A 1H3VA 1L7LA 3JYCA 4C1NA 5AC91 2C6SA 3BC9A 1GWMA 4MHHG 2PRLA 1AAJA 3W1MA 2A9AA 5IJVA 4A6GA 2WZ6A 1YECL 4TNGA 2BWDA 5F3CA 3L45A 3QRGH 3TJHC 2VDIA 3FULA 1HQRB 3W2MA 1XIWD 5HHQB 1JRHI 1VFBA 2X9XA 4MA3B 2GIMA 4WNJA 3TAOA 4L1SA 4GW1A 5CU9A 4WWKB 3HQXA 1Y07A 3CLEL 1ISXA 3M3OA 4FFVD 2OQHA 4H44C 5J6SA 2E6JA 4BXFA 1QRNA 4LKSA 4FQIL 5JIPA 2HG5A 3MV7D 2VDMH 4AXKA 1MUMA 5FF4A 1LL1A 1RL3A 5ALBH 2FHRA 1O6IA 4P9HC 1AL21 2P44B 5E2VH 2VD7A 4WK4B 4BWOA 4KRPC 4DI8A 2YDRA 3LHTA 1H9WA 1HB1A 3WLHA 2XWBA 1UL9A 1H15A 1AHMA 4PJXF 1LUCB 2HE5A 2P3EA 1MDRA 2ZAAA 1ZTMA 3UTTD 3N3TA 4M48L 4EI5A 3GXNA 5AZUA 5I1KL 3DERA 3KXQA 1WDAA 1YEDA 3RY6A 2BCKA 5C7HA 2VDOB 3N9MA 4AITA 1FMD2 4GJIA 2V72A 5DMIH 4ZXOA 3RWGA 4RQPC 4O0KA 1ADDA 1RLCL 3UTPE 4ZK8A 1BYDA 4K68A 1Y0LB 1EPFA 5DELA 1HJUA 3STLA 2VC9A 3MIEA 3LS5L 5ABAA 3K4DA 5JMUA 4FPKA 1P1VA 4BQ8A 5JOZA 3H42B 4LUIA 4AZCB 3QORD 4L6OA 2PDCA 3MCKB 3OY8A 2RS13 1ODNA 1W8UA 1NWUA 5F7EL 4DQOL 3T8QA 1FFNB 3L0KA 3M0KA 1JPHA 3U48A 5FDWA 1FDJA 2EDLA 1FGNH 3QRLA 4YVWA 3MLYL 4RR3B 3JYBA 4O58L 1YY9C 3DSNA 3BZJA 3GIVB 1KTKE 4ASLA 4AQEB 3NCCB 3EWBX 1MCOH 1IHMA 4WWKD 1QQP2 3HG4A 3NCWA 4JFTA 2J8UF 4NNXA 4HQQL 1JPKA 1GRWA 1VAKA 3NGBC 4GP4B 3I02B 4HN1A 1S2VA 1QD0A 3SITA 1RAMA 4LAQL 3I2CH 3RI8A 1SLWA 1FNZA 3UBGA 2K0GA 5E9XA 2OSYA 3LS5H 5FHBL 5CU5A 3PPHA 2I17A 4PV9B 2OI9B 4LBEB 4UF0B 5HHXH 1C5CL 5M3WA 3UTQB 4JO1H 5HHOD 4DSYA 5JUEL 4YLZA 1WFOA 2YQGA 2HT2C 1XJAA 2PUQT 5LA2A 4GXVL 1RUH2 2ACUA 2WMFA 1KJ2B 4LSUL 2C3HA 2CWMA 3UTTB 4XISA 2EADA 3UDWA 5J9PB 2QUNA 4JN6A 3AZSA 3TYAA 5I8SA 3S57A 4Y4FD 3VDHA 2H32H 3IDJB 1ECZA 3P8IA 4NWTH 1CD1A 2K9FB 4XFGA 4JGYB 2HT4D 4BOWA 2FBOJ 4E8DA 3LN9A 1X6UA 1K5NB 4KGJA 4L8SA 4X5QA 4LOFA 2AQ2A 3HE7C 1FYHB 1XR9B 2WKOF 5CS7A 2JEQA 2P43B 3NRQA 3QMTA 3UG3A 5I3GA 5AW3B 1AYM2 1ITUA 3B3IB 5I8CA 1A8MA 1E15A 5D21A 1GA2A 2XGXA 4NN5B 3Q6GH 2VXUL 2YD5A 1RUC2 4UMBA 5ACA1 2YD2A 4QS6A 3W24A 3GPSA 3QORB 3B8SA 4JG1H 3QC3A 4UF0A 3TH6A 4OULA 4FT8A 3MLJA 5HDWA 3W7RA 1OX4B 1ZAJA 4Y4KC 1UKPA 5JIMA 1ACXA 1MJ7H 1XNAA 3BVDB 1U5JA 3ZFEC 2OQ7A 2B1AL 3ZQWA 2IXIA 5KVGL 1KCWA 3KGZA 3MRKB 4X42A 3USBA 2YIHA 4GUIA 4ETYA 4FXRA 3KZ8A 4FQXB 3MFCA 3SCSA 2YROA 2PD9A 1CIUA 2BOIA 5DFVC 2VUYA 3WBWA 5C9JA 5SWQA 2XZ9A 4L37B 4F37K 5B3NA 1RXGA 1YEYA 3RXZA 2PP3A 3B0YA 1ET8A 3VKMA 4Y2DC 5F2MA 5LNRA 2XY1A 2E5EA 2WUBL 1BDYA 2BFUL 4J12A 4A2LA 1RVKA 3UZQB 1ACYL 5KWRA 1VE0A 3F7RA 3O0WA 4N9DA 2NQZA 5DZFA 3F58L 5C2BH 3TN6A 1TXKA 5FHAH 4GMTL 3C5ZA 3QPQD 3AM8A 3D85A 3IGAA 3PIQB 1U2YA 5FW7A 4KO7A 5FAGA 4AZ7A 4Q27A 3PVFA 2Q3OA 1LOEA 1XYOA 3Q06A 4PTMA 3SBQA 4XX6A 4WEMB 4UILL 5F7BA 5KN5A 3TESA 1ONRA 4J1OA 5JXEA 2A6ZA 3LZ3A 4N0UA 1QACA 3PL6D 1U8JA 2WZR2 2BSTB 3CLMA 4CUGA 2UV3A 1NTDA 5DJ8B 1K2DA 1Q2RA 3EWXA 1H0IA 2CKNA 4UCGA 5DF0A 1LE5A 1FVCA 4CADA 2XXFA 1MRFL 2XWRA 4PRBB 4QXBA 1T20A 1PHQA 2YXWA 5AYUL 3SDOA 4DP2X 3GY1A 4HISA 5DQ9B 2QVIA 3R6SA 4LUSB 5T5NG 2H8XA 3CMOH 2IG2L 3CFTA 5IBXA 1FFQA 2V8LA 2KLRA 1BVWA 2JG8A 2WYIA 5ANNA 4IBLT 2F19H 2G75A 2EDNA 2VOTA 5FDYA 5HHMB 1PY9A 5KVGH 3I9PA 3DEMA 1OW0A 1Q56A 3ZHKA 1UPPA 4PUDA 2FGWL 1I4FA 3F6IA 1QH6A 4KGGA 2GK1B 4AE0A 4JJ5A 4EDXB 4A3RA 4TN9A 3RIAK 2JG9C 1OF2A 1QK2A 4MMZB 4QHNB 3WY4A 3VBOC 3OP2A 2YMXL 3RY4A 3QACA 4XNXH 3OX8B 1TR9A 5DZVA 5I1LB 4PEKA 3NTYA 5FYJU 3VI3E 1KCUH 4LBJA 1DJQA 1U8CB 5DD3L 1QYGL 3V0GA 4XPBH 3ZYRA 2IPKA 4BIKA 4XZLX 4PMEA 2G0WA 3C6CA 3JB8A 1BFTA 5IJBC 1UKGA 3O45B 4OLUH 3RGVC 1YEHH 5C6TL 4JGZB 1H7OA 4KG0A 2ZEXA 1MFCH 3HZMB 5AC8A 4TX8A 4FPLA 2Z0UA 3GQFA 5DHMC 4JGMA 4UTKA 5K9JL 3N9OA 1FN4A 3J8F3 3M47A 2E9WA 1GZ1A 2ZWKA 3PL6B 4KDWA 4UT7H 4LARH 2XXCB 4D72A 5FZ1A 4RV8A 3TPUB 3S6CA 5AVTB 3KBJA 2WR9A 4PLOB 4HIEA 4H1ZA 4XUGA 1HQTA 1PDZA 1W0VB 3AIEA 5HATA 4AIEA 2GGJA 3SHRA 3GMLB 4F93B 1SLIA 1VZHA 2W0FA 3FOMA 2NY0C 3I6LE 4WDWA 2R56L 2NSQA 3VXMA 5EMUA 4XZ4A 3IXTB 2IGLA 1DSWA 2X7LA 5DRZA 1T0MB 3USSA 2F6AA 4OWGA 5I66A 4H04A 4L8BB 4NUGH 2FWUA 5FKCA 3CCHA 3VL9A 2XC8A 3BWUF 3QISA 4TOYH 5FJKA 4P2OA 5F5CA 2YCLB 3BW4A 4QWWD 4OGYL 2O5YH 1F1AA 4XN7A 1W6PB 3VBFA 2G97A 4GXVH 3O2DL 1XV8A 2ARJA 3PTQA 1CICC 1CGWA 2WBJB 1TYEB 2QCDB 3S5YA 4HFSA 2QNKA 1UMYA 2DWDA 2O14A 4WDIB 4Y96A 4EN3A 1G7HA 2O5ZL 1W9SA 1CIWA 3WLBB 3OKMB 4JUTA 3IWUA 4PJ5A 4C54A 3AY2A 2VVSA 5PAZA 3WFZA 4K3GA 2Z91B 4NRYB 1A1OB 2HFGL 1VMFA 5DYOA 4UBPC 4EKXA 4JYDA 3BUTA 3S97C 5IROD 2WNXA 3AMNA 1Q8JA 2G2RB 3LXUX 4Q4IA 3JUGA 3SCQA 2C4FT 1RXLA 3LEVL 3CN2A 4ZTOL 2PMQA 4GXUN 2O9OA 2J9ZA 4TMPA 1NLRA 2A4AA 1NF0A 1Q6RA 3QXDB 4YDJB 4JQ4A 3KLLA 1CIYA 1ZOXA 1IGCH 2Q6WA 1T03H 1OKQA 3DF0A 4WGWB 3T2NH 1KLYA 5KVEE 3EF7A 2BNQB 4YWGH 1UKOA 4ASMB 4JFHD 3QC0A 5C0BB 2BSRB 1FLRH 1HJGA 4WLCA 4OHXA 3AZVA 3ARGD 4FI8A 3P2TA 3MV9B 3FNKA 4X4XB 5I1GL 3H22A 4FIQA 4DZBB 1E6JL 5AOMA 3QHOA 4GBXB 4M1GH 4RS5C 4PV1C 2ZMNA 2RDWA 3K48A 2Q3XA 3QTPA 2KAUC 1T1ZB 1B3IA 2BJSA 4BQ5A 4CVZA 5J1XA 4QR6A 3NA9H 4WM7A 1GJWA 4I2XB 1FSKC 3MLVH 1NOVA 4FOQA 3OL2A 5C9WA 3WQWA 2MRYA 3CL1A 4CSZA 1INDL 1OGTB 2VXVL 5ILTL 1XSOA 2YC0A 2RJ2A 2ZX7A 1YMYA 1EA0A 3PG8A 5KANG 5IHWA 2HV5A 4NYLB 2VL5B 2HZGA 5A8MA 3Q65A 3GSXA 1G7VA 1JN2P 2JKPA 3HR5A 4GRLD 4H00A 3ZZQA 1S5MA 1LO5B 4H40A 5TDOB 5B1JC 4KPHH 3HS8A 4OFKA 4LR4A 4PS3A 2WNQA 4LVEA 4UM9B 2CWXA 1JDEA 2C3VA 3T40A 4QTIH 4FX5A 1MHPH 2VR2A 2PTWA 3Q94A 3T55A 1QR4A 4PRIE 4JHWH 4XP6L 4ZXLA 1AMXA 3BISA 2LALA 4OZGB 3UKTA 3FU0A 3IVTA 2F7RA 4NPYA 3ES4A 4ZQCA 3KPSE 3HF3A 5HV4A 4TV3A 2VJ8A 1OAZH 3Q2VA 1LCLA 4ODWB 2ZWSA 4AHWA 4Y5VA 1IKPA 5JQIB 4PI0A 3TV3L 2R1BA 1GNXA 1DN0A 3M1BB 1PL3A 4IU2A 4G43A 3KZ4C 4HIEB 3V8OA 5E6UB 4Q7DA 3EWCA 5H37A 1T6MA 4GKZB 3HIJA 1ODAA 1PQZA 1DWGM 3D85D 4G6JL 4UT9A 3W7LA 5IFJA 2XIMA 1LOFA 1NQJA 3OCPA 3BAWA 4Z3GA 2BIPA 3CN3A 4RRPA 2HWD1 2X30A 4Y4FB 2CLZB 2Y07H 3K5XA 3EMCA 4EZJA 2BOEX 2FHCA 5HQLA 1MQ8A 1W3NA 1CL7I 3E49A 4ZY9A 2K6WA 2VGDA 4IE7A 2JB5H 2XLGA 1J12A 3TEZA 2WQXA 5CLZA 2EKJA 1OZQA 4LTSA 3IIZA 4CL7A 5EUOF 4IHOB 3P62A 5M5DA 1EA9C 5I1LA 2ODHA 2ZWZA 4JG5A 2VUJA 4Y89A 3QD6A 1DVFD 3FXIC 1NOUA 1PDKA 1ERNA 2D43A 5KG9A 3MMTA 1WYIA 3VZJA 3S5LA 1SBBA 1RJZA 1XR2A 4XNUH 4IOSA 4PBXA 4XCNB 1Z1WA 5I91A 3TJIA 1WUNT 2ZNWA 5EO9B 4JFXB 2EKSB 3SJVA 2OEKA 1JK9B 5D2NB 5I0TA 4D94A 1F8TL 2AOSA 5FFOC 1CU4L 5FF3A 2RB8A 1NGYA 3FO2A 2XPJA 2V7HB 2ADIA 1VFFA 2F38A 4ZNEE 5JMOC 3N19B 1FPTH 4QB6A 3WLMA 1OOPB 3FIGA 5KC6A 5IB3B 3QRFM 1L0QA 1BIHA 1FH7A 5MENA 4Z6AT 4ZFZB 5JXAL 1NA1B 5T8IA 4ZPTB 3ID7A 1TJHL 5C2XA 3K6NA 3ZR6A 3VFWA 1OAUL 4K9JA 2CLEA 3DFSA 1NMBH 1KN2H 2EDEA 1AG0A 3RGHA 1AS6A 3W57A 1F58H 2BC4A 1UYPA 3H6OA 2HVKA 1QI4A 1DHKB 4CQDA 1CE6B 2X8RA 1H7WA 2PPAA 4XCBA 2INEA 3WHTA 2VDMB 3BMWA 2BS71 3ARQA 3FUNA 4LLUB 4NQED 3SDAA 2UXVA 1EC9A 2NRDA 3GUFA 2ADYA 5L7XL 3QSKB 2O4QA 3AAZB 3AXIA 5JXEC 3G5XA 1AYRA 2J2ZA 1EGJA 4OQ9A 1BIIB 3D3FA 2BNJA 5ADOH 4JPVH 4WSGA 4HF5H 2QJGA 1IOAA 2D6OX 5F9JA 2MKLC 5FJTA 1NZIA 4AC4A 3HC4L 3LV3B 4P2RA 1WDWA 1UOWA 4AUUA 5B4NA 1KO0A 4YTSA 2OSLB 2AF2A 4QCFA 1MY5A 1FUYA 4KRNA 1V77A 2WFPA 5FJHA 3SUTA 1G9NL 2ZCKH 4IJ3B 3DPBB 4AFCA 3IMVA 2AMUA 3HAEA 4DELA 2ZKLA 5TAOA 5E5LA 4TX9A 1YYCA 4PCSA 4MX3A 3WLNA 1YLLA 1QFUH 4MA7H 2EEAA 3W9DA 2XJPA 4A2UA 3UCCA 3DX6A 2ESCA 3J8F1 1D7CA 1SOKA 5TPWL 3J7HA 2Q01A 1WPCA 4J3UA 3LCFA 3FQWB 5A6JA 3U83A 3WEXB 2AL2A 1I85A 3NZ8A 3WSQH 4ATWA 3CQIA 5EFIA 3U0PA 1VRBA 2B1AH 4H3DA 3VFGL 4ERAA 2YQ3A 1WLTA 1NC4D 5H4ZA 4NO2B 2R9HD 2ZSVB 2DKUA 2HQAA 1AGEA 3NAPA 4W70A 4V2XA 4OHYA 2FDJA 1EGJH 3D7PA 4K8FA 2O1QA 3F4CA 5DDHB 5E6SB 3MNDA 1O1ZA 4A7GF 2XKNB 2GMPA 3D18A 4GI8A 2A3BA 5E7BA 3VI4F 2WWUA 3W7PA 4NU7A 2BIHA 4ISVA 4OV5B 1L6ZA 1YJLA 4LITA 4OBSA 3U6XA 5K9QI 3O1VA 5I1HL 4F2FA 4F7TB 2J6XA 3Q48A 4FTBA 1TQBC 1HVQA 5G4NA 2XWJA 3PZGA 5CKGA 1JGLH 3RU6A 2YD8A 4Z78A 4ZG1A 4M0XA 3NWKA 3T0EA 4ZSOA 4ZO7A 5T3NA 1KB5B 4EN0A 3EOEA 5JHDA 5LBEA 4LOTA 3ZXAC 1PV8A 3IBEA 4J8RA 2Y3AA 4BH8B 1TMLA 3DGGB 4LPXA 5FPUA 1E7UA 2ZCLL 1DN0B 1SJMA 3FSUA 3PBMA 2B59A 4G1NA 4JY4B 4RK8A 5EBLA 2Y6ZA 4ERSL 3BAXA 3PWLA 2G3JA 1ZXQA 2DKSA 1JZHA 1Q9KA 2RHPA 4F0RA 4PFMA 1DYOA 1ZAHA 5AAMA 2EXTA 1NJ9A 1UM6H 1OTSD 1SUXA 5CJBA 2CNCA 4PY7B 1H3WM 2FZ3A 2VGLM 2X4PA 4P9IA 3VA2C 1W9DM 3NQKA 2AJZA 2OPCA 5GRWA 4A4AA 2AAAA 4AEFA 2C71A 4A6SA 1NBZA 5DWUL 4X98A 4QDSA 3VMPA 3UPBA 4JTKA 5IQ9B 4W6XB 4JLRA 4F83A 3H12A 3HS0B 3NA4A 2DSWA 4QNPF 4XNBA 2EXYD 2ESVA 2ZJCA 3B8IA 2PWGA 4EUPB 3MRIB 4ZTPH 1OK8A 4OZXA 4HOMA 4IOFC 2HMID 1QWNA 2CRYA 4OM0H 4JZNA 1OGTA 1F41A 4U1NA 3T3PF 5A2LH 2R7EA 1MCIA 1QNWA 4CP2A 4UOW0 3AMPA 1JDDA 1TTBA 3W7CA 4GD4A 3L6FA 4XURA 5GPRA 3OZOA 1SLXA 3VQ2C 3ISRA 3ABOA 1QEXA 4DGVH 4XV0A 5FM5O 1D5IL 5ERWA 1LODA 4CCOA 2B5HA 2VN4A 2KS0A 2E9MA 3ALWA 4XXDA 1DDHA 3QGAC 1ZT1A 4OQTL 4OT7A 4KIEA 2DQDH 1HESA 5JIKA 1CLZL 3QWNA 3ZDXF 1BG4A 3T0EE 3MGOB 1P1XA 3EUDA 1JMXA 4J1WA 3FTYA 5AEAA 5XIAA 3Q9PA 4L29B 3SY1A 3C7EA 2VX7A 2E9BA 4M6OL 2IH3A 2OKMA 3WCZA 4TVSa 1HILA 4M6NH 3EB4A 1XB6A 5LGHH 1AXZA 3FAWA 4IS6B 2PYFA 4PIYA 4LCCB 2ZA3A 4L61A 5C8BB 3N9QA 2YEZA 4FFWD 1HG3A 4XBEH 2ESVD 3VXTA 4PR4A 4U1LB 3ES6A 1FCGA 4ODXA 2EZ0C 2E3VA 4QJ4B 3Q45A 1F3JB 2CYFA 4BA6A 1SDDB 1SOSA 3WQ7A 1EUUA 2VCBA 1W16A 4MDJB 2WMIB 3FF8A 4RMTA 3ACHA 5A1LA 2QGBA 1S6NA 4F7PB 3BGMA 1ZRIA 2VR9A 3GNDA 2Z7YA 3GSVA 4DWHA 4HS8L 2QPEB 1FRBA 3VBRB 2QPSA 2BY3A 4HCLA 2BCMA 5CJOH 3LZOA 5FOBA 1I60A 5SWZE 4JGYC 3MRFA 4G6JH 4F79A 2DEWX 2AQ3A 2IXLA 3KP1A 2XYLA 2ITCB 4O4VA 4AMCA 4H1LB 4BD4A 4YYOA 1KV7A 3BDBA 4DGVL 3T7VA 4YTTA 3VXSB 3MLKA 4O2EA 1Q6CA 4L1TA 4UTTC 1HTYA 1HCZA 3N13A 1W9PA 2BW5A 2FJHA 3LLXA 1X3DA 1U42A 4OLVL 6PAZA 4XD6A 1UWXH 5AFEA 4DVRH 4UB9A 4HBCH 4YSRA 1RJRA 3IVKB 2CALA 3AABA 1SN5A 5J6GA 3VTRA 1OTUC 1GZGA 3N73A 2WLMA 4GXUM 2EPMX 1NLBL 1ZSXA 1H3PH 4W6YB 1EYWA 4BZ2L 3U46B 3W38A 4FA7B 2FQPA 2P80A 1I9RH 1G7QA 4KEVA 3WUBA 4H19A 1QSEA 5T5LA 4HT3A 3W6YA 5EJ1B 1JCJA 1UUOA 2GGEA 3DKHA 2CR0A 1DFBH 1HXKA 3BVJA 1EHLL 5G4WA 4IGHA 1DIKA 1RSFA 5D32A 5LGKA 3IJ6A 1RHHB 1OFDA 2BDRA 4FADA 3NJYA 2DQUL 5DZAA 1TTFA 3Q4DA 4F27A 3TE9A 1IKOP 4QHNA 3ZFFB 3N2OA 5IQNA 3NPSB 3DGDA 3I10A 4PBVC 2R4RL 2WINA 1R0MA 1HIZA 1FHLA 4UV4L 3JQOB 4KROC 3RM4A 3GB7A 3URFA 4E36A 4NC1E 1AOZA 2PELA 1PKQA 1UKRA 3H3PL 3ILRA 5DQPA 4QHUB 2OJEA 3BQUC 3FKUS 3GGLA 1ZZ6A 1JNLH 4GWIA 4P9ML 1JZIA 4FFYA 3ZE0E 4B4HA 4EN8B 4GG6A 4N02A 5FF6A 1PG7W 1Z6KA 4NJAL 1HHKB 4GMSH 1HRI2 4DMIA 3WO8A 5EO0B 4W88A 3HQRA 1OCZB 1C16B 3CM4A 2EDQA 2ZT9C 1M42A 1AL0G 3AXEA 5HHNB 4DRSA 2QDNA 3N0AA 3FT3B 3GKWH 2PW1B 5FYMA 4GKLA 1QMLA 3H7JA 2QHAA 2R27A 2YX0A 4MAZA 1UQYA 1P6BA 4XP4L 3ZN6B 4E2BA 4O2CA 4GG9A 3R5EA 2QQMA 1QWRA 5EOCL 1VIZA 2W3ZA 1OP5H 2DTWA 2ATMA 5E8PA 4ZFCA 2ET7A 4CP0A 4Z0XB 2DVXA 4MMZC 1UY4A 3WK0A 2EVIA 3NSYA 2NY7L 3AMLA 2XNAA 4FC3E 2NT1A 3PTRB 1KRIA 5DGQA 3O15A 2AABH 3W9AA 4F9LA 3RNKB 2DAVA 4Q8WA 4RZCB 4PQXA 1OD5A 3OAUL 1BA9A 4JFOA 1CICA 5CQ1A 1ZBE2 2D97A 3WUWG 2CO2A 3PJXA 1TME3 2NY0D 4C6PA 4CD4A 5SWQB 1FWSA 3F2CA 4OQTH 3LB6D 2V5BA 4R27A 2BP0A 3TO4C 1Y8BA 3GDRA 5DZEA 5EDSA 4PB5A 4FYRA 1EX5A 1CAUB 4PY8J 4LZKA 4JHUA 3IIAA 1RUG1 4FXFA 3WJYA 2XB6C 2YCEA 1D7PM 1KBKA 5JBEA 1OWWA 2QR6A 3MP5A 1YBQB 4YDLC 1TQCC 3D69A 5K39A 3TWIA 3LPPA 4JFVA 4ZS6C 3DLQR 2VMEA 2OOFA 5FZGA 1B3YA 3VG9B 3R58A 3C6LC 3TJLA 5LJYH 1MJ8L 1W6QB 5F0MB 2RMU3 3IDMA 1NGQH 5A3MA 5HMFA 3B2UD 4J7RA 4KWWA 4EWAA 3GBDA 4BA8A 1KNOA 4ELME 3OPZA 1Z9SB 2VTFA 5DK0A 3PUQA 2VD9A 4GZIA 1YC7A 4MKVA 3US0A 3VXNB 4GYKA 3IU3B 4UIKL 3U7BA 4KKXA 1TQXA 4LLUA 1N8ZA 2A6IA 2G2NA 2X2YA 3A4UA 4BGDA 4L9BA 4P04A 1QJY1 1A6PA 2EDKA 2H47C 2A6DB 1G9FA 5JHLH 3GG0A 3TV8A 5BMFH 4N9GA 4DNHA 3P3TA 4X63A 1KGCD 1BFOB 4Z95L 5IEKA 4HMEA 4L0ZA 1RCQA 4KY1L 2W9MA 2Z00A 3AW5A 4DWSB 1I8UA 4UNIA 1BQLL 1MFDH 2WO5A 3VCRA 1L7TL 3U2OA 1AO7A 3W7OA 4PJ7E 3A4EA 4H9UA 3TX4A 3FYPA 5KSBA 4PJDE 2DRUA 4TTDD 3I3MA 4LT9A 4RR3A 2VLJA 4MAUH 1JV2A 4FQHA 2ITEA 1I2PA 1LLOA 4HCRH 4F2MB 1C1EL 3LKRA 1F7BA 2W94A 2F4PA 1SY6L 5HD8D 1B0RA 4Y2DD 1TRIA 3DX1A 4L9ZA 4OF3A 1H8TC 1E0WA 2I14A 1CXLA 4P9MH 2XA8H 3D07A 2AEPH 4EN2A 1EUAA 4BE3A 3ALXA 3QPQC 1RUF2 5FUIA 3N50A 4GMSL 4ANKA 3CC5B 1NL0L 2WWMC 3RE0A 3L5WB 4A8IA 1OVPA 3F01A 3ILEA 3M5ZA 4XZWA 1PKLA 1M6JA 3PNWB 1KTDB 3VG0H 2Y0SA 1HDKA 2WS91 1A6ZA 2LU5A 1MF2H 5IP4A 4WVMA 4Q8UA 1EJ8A 2G5UA 3HBGA 4Q8BA 4Q4SA 3ZN4A 4RMSA 1T1YB 5DC2A 5ICYA 5IFJB 2HVOA 4ZMOA 3V4PL 5IVZA 4YRDA 2GVJA 1EEYB 5DUPL 2WT0A 3DARA 1UROA 2FL5A 4B4RA 2PDQA 4EUPG 5A1FA 5D93B 3GO1H 4R4FL 4MUZA 4TM9A 1UWSA 1E3ZA 1QFPA 4KITB 3VVVA 3NAAH 2CXKA 1Q4NX 5CZSA 4D6CA 1UATA 1OVZA 4ZFFB 2R14A 1UACH 1GQJA 4WWKA 1GW9A 2QJHA 1W2VA 3HA1A 3WBYA 1UOFA 4JDMA 3QHFH 4FQCL 3D12B 1H4GA 2P5ED 1XPGA 4JYEA 3N34A 1LHWA 3T4HB 3POHA 4KOBA 3BO8A 2Z8WC 3DX9B 1BJ8A 4HN4A 2WVTA 2ZEYA 1EAOA 1A5UA 2XN0A