3ZR5A

Structure of galactocerebrosidase from mouse
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
644
structure length
641
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Insights Into Krabbe Disease from Structures of Galactocerebrosidase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 218
structure length 641
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zr5A01
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3zr5A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zr5A02
3WEOA 3GXNA 1UKOA 1TQUA 1HP4A 5IFPA 3WNOA 1OT1A 1UASA 5FK7A 4GKLA 2V3EA 3CZJA 1FHDA 1Q4NX 2YBUA 3IMMA 3WEMA 1WO2A 1H3GA 3L4TA 4MNLA 4H8UA 4TX8A 1OB0A 3BLKA 2OXBA 2ZXBA 4X0VA 2OSWA 4PMXA 3APGA 5D9PA 3AS1A 4P8WA 3WNKA 3AIVA 1AVAA 3LRKA 2FGLA 2XN0A 4MB1A 3O6AA 1QHPA 4U31A 2J62A 3HJEA 3M7SA 4AD3A 3RJXA 1GHRA 3O2LA 5BXPA 4RE3A 1Q6DA 2ZUNA 3VPLA 3MMWA 3BVVA 1UH3A 2VRKA 1M7XA 4PTMA 3CZGA 4N0RA 3WN6A 1JG9A 4AZ7A 1UA3A 1OGGA 4PSPA 3MMDA 1UWUA 3QOMA 2YFNA 1BAGA 1XGZA 1U2YA 4AIOA 4PEEA 1BYAA 3BAJA 4AMWA 2C8NA 3CMJA 2BY1A 4J3SA 3KWXA 4AYGA 4UFHA 5AY7A 4F8XA 1D3CA 1V0NA 2EABA 1UQYA 2OYMA 4MDOA 1CXIA 4W5UA 3N15A 5DT5A 2D73A 1WZAA 1TCMA 2ZX9A 5LA1A 1CGYA 2UY4A 2E9MA 3KEHA 1EIBA 1BLIA 1JF6A 3D52A 3GBDA 3PIGA 4DWSB 1JI2A 3GH5A 4QHZA 5BXSA 1JXKA 3AS3A 2WC3A 5A8PA 3VMPA 4D1IA 4PMOA 2E0PA 3LX9A 4M56A 3KF5A 5CLWA 1H5VA 4MNJA 2XVLA 1QW8A 4CGTA 4GO9A 4XX6A 3W0KA 1ISWA 3OBAA 2FHCA 4BZYA 3TP4A 4MJ2A 3WNLA 3WNMA 3MO4A 1W3JA 4EANA 4B15A 2J25A 2QHAA 3PTKA 4PCTA 3WBEA 4H7VA 5A6BA 1E5JA 3UG4A 1B3XA 3AHYA 4OGZA 3GTNA 4JIEA 1UHVA 4BA0A 5HNNA 1E0XA 2V3DA 2W61A 1E9LA 4ATLA 1KR0A 3K8KA 1B3VA 5C8BB 4Z2GA 3CIVA 3PZVA 5M3WA 1PAMA 3VSUA 1KFWA 3ZIZA 4ZENA 3VIKA 3L4ZA 1CIUA 1H0GA 4FLSA 1O6IA 4LX4A 8CGTA 1OGBA 4X9YA 1PPIA 5HPCA 2VX5A 4AXNA 1DTUA 5I77A 1XYZA 4U3AA 2PF0A 3MUY1 4UQBA 3WSUA 2DT2A 5DFAA 2WMJA 1US2A 4M24A 2JALA 3WFZA 2QV4A 1XH1A 4CN4A 1ST8A 2J4GA 4NX0A 3AMGA 1J0HA 2X1IA 2A3CA 4OKDA 3DX2A 3QHOA 3VX0A 4LYPA 2QPSA 3WQWA 3CGTA 4P7RA 1LJYA 1WB0A 2D0FA 1JZ6A 2J74A 1PJ9A 3F5KA 3NCOA 3VGGA 3ZQ9A 1NH6A 5A2AA 2XTKA 1OT2A 3MKKA 4AD2A 1LL4A 3U14A 1CYGA 5IFTA 4E8DA 1HNYA 4D1JA 2ADEA 4ML4A 2D24A 2OWCA 4AD4A 4W87A 1TA3A 1V6YA 1R34A 5CGMA 2DSUA 1JXJA 2E8ZA 2J8FA 3KLKA 4PTXA 1OBAA 4TVCA 3ZJKA 2VR5A 3U1XA 4Z2LA 2UY2A 4W5ZA 1HXJA 4RL3A 3WH5A 2EXOA 4PCSA 5FK8A 5CSUA 4ZXLA 1JL8A 1TQTA 2CKRA 1UKTA 8A3HA 3AXXA 2J7BA 5FD0A 1GQKA 2WVTA 4FNTA 1ISVA 1WZMA 4XZBA 3H54A 2CBUA 4W89A 3IANA 3NIYA 5E6YA 5E9AA 3KL3A 1E6SM 2XVKA 1JD9A 3AS2A 4E8CA 1OCQA 2YL8A 1VJZA 3LPGA 1UH4A 1XC6A 2W67A 1QI2A 4DO6A 2VQUA 1HF6A 1EDQA 3ARVA 2VCAA 1CTNA 1PS3A 1NQ6A 2X09A 1CXLA 3VNYA 1BG4A 3DDFA 3DDGA 2MANA 4IUGA 1JZ2A 1JAEA 3AHZA 4ATDA 1J0ZA 2VNCA 1DEDA 3TTSA 2GDVA 4GINA 2VI0A 4MB4A 1L0PA 4U2YA 1TQSA 2JEPA 1F4AA 1B3WA 1FHLA 4DO5A 2VO5A 2O9TA 3LMYA 1BSIA 2BXZA 3HZ3A 1HXKA 3SC7X 3AIBA 3N13A 5BRPA 1E4NA 4J3WA 1JZ4A 3IAPA 3ZT5A 1QVBA 1HWWA 3MSDA 1R85A 3LDRA 3VILA 1CXFA 2XVGA 3AIWA 4HXCA 4WF7A 4W85A 1U33A 4HA4A 4Z2HA 3BAYA 1H09A 2J47A 3VUPA 5I5RA 3W26A 2NT0A 3T08A 3ZMRA 4GZEA 3VU2A 1QBBA 3GH4A 3ZT6A 3GNOA 2FDMA 2HVMA 1CWYA 1EDGA 5TD4A 7CGTA 1FH9A 1HJVA 5DT7A 2DT1A 3CHEA 1ITXA 1RD6A 2XIBA 3WFLA 3NYDA 3LXCA 5A2CA 1KBKA 4N42A 3PZQA 1NP0A 4Y7EA 2WZIA 2OYKA 4WSKA 3WY4A 3F5JA 5I24A 2BVTA 4W93A 3ZO9A 1H49A 3FAWA 3AROA 4OBRA 1ECEA 2E9LA 1CGXA 4PSRA 1HKKA 1IZKA 2JF6A 4H8VA 3GXTA 5AYBA 2YL9A 1E55A 2V5CA 5A94A 1W3LA 3MANA 3DYMA 4GIAA 1HIZA 2VZUA 3BXWA 1MQRA 2YL6A 2ZUVA 2XFRA 3UETA 3RCNA 5IDIA 1Q6FA 4LYRA 1N82A 2OWWA 1BFNA 2WKGA 2D0HA 1UZ4A 2OSXA 4TVDA 1V3KA 2FHFA 1CGVA 1FFRA 3RM4A 4TX6A 2CHOA 4GO8A 4WIWA 3DX4A 3BMWA 3OA5A 1EH9A 3WDRA 4R5EA 1QWUA 1XSIA 4PMDA 1VBUA 4WKHA 4M82A 4D6EA 2J8GA 1KXTA 1WDPA 1JDAA 4PBGA 4C7GA 5I6SA 1E6XM 1KWGA 3RM8A 4PMRA 1MQQA 5CZKA 5FMCA 2XWEA 4TUFA 1QPKA 4J3VA 1W9UA 1X6NA 3UGFA 3I3DA 1HN1A 1QHOA 1GOWA 1OINA 1R46A 1J12A 4QFUA 4P8XA 4Z2JA 3EDDA 4ZE4A 4DM1A 1HTYA 1KXQA 4J3TA 3U5YA 4NRRA 4UCFA 2VZTA 4PRWA 3VM5A 5E1QA 3AMKA 2WSPA 4PUDA 1BYDA 5FCZA 5FIXA 3BH4A 2WHLA 1EHNA 6TAAA 4J3XA 1GONA 1KXVA 5EMYA 1BPLB 4PUEA 1OD8A 2DIEA 4W7VA 1M01A 3WD3A 3A5VA 4ATWA 3PZMA 3VO0A 4HOZA 4CU7A 5BXRA 4FK9A 1BYCA 1CNVA 1KGWA 3AISA 3O9NA 3K46A 1M03A 2V3GA 3H55A 5DF0A 3WELA 3MS8A 2E3ZA 1VB9A 2WHKA 2XWDA 1HP5A 1WDRA 3GYCA 3WD1A 1GOQA 2VL4A 1GPFA 3DYOA 1JGIA 3HN3A 1ZL1A 1CZ1A 3H3LA 3OLEA 1ZB5A 3PZ9A 1QW9A 1DHKA 3B8SA 2ESCA 4HU8A 4FFFA 4WKFA 3EBVA 1UA7A 1G5AA 3RM9A 4JAWA 2V3FA 1NP2A 3BUQA 1C93A 3AXHA 1QNPA 3ZR6A 2DQXA 3AJ7A 1M04A 1TZ7A 2GK1B 4TTGA 4V28A 2VR4A 3GXIA 2ZXAA 3SUWA 4AISA 2C7FA 3OLDA 1GJWA 1E4MM 1V0MA 2F7PA 3SIMA 5BXTA 2G41A 4FMVA 1VEPA 3VDCA 4TOQA 4Z2IA 2W66A 3WH7A 1NWRA 4ACZA 3S5YA 5HDRA 5JIWA 3L4UA 2OW7A 3GNRA 1K9DA 3VIHA 3A21A 3AYSA 3K8MA 3TOPA 2DT0A 1GNXA 1E6NA 2TAAA 3WDIA 2ZOXA 4A3HA 3FN9A 3N17A 4ZFMA 1ZJBA 3A22A 4HMEA 2EPNA 5I79A 3ZJ8A 1E6PA 3OSDA 2F7QA 4CD7A 5IXEA 5ECUA 1W9BM 2CHNA 1C8XA 1BGAA 4JFWA 1G94A 4YHGA 1JFXA 2DIJA 2WCSA 3BMVA 1Y9GA 1SZNA 2PBOA 3FHAA 1WDSA 4GI9A 1DWGM 4AD1A 3D5HA 5LYRA 2D2OA 1MYRA 2BHYA 3AMCA 3IAQA 5CSYA 1HJWA 1B90A 1CENA 1KTCA 1KQYA 2V38A 4DWSA 5I78A 3GXPA 2XFFA 4HPHA 3SURA 1HT6A 3NUKA 4DM2A 2WLYA 1JYXA 1QBAA 3BLBA 3AHVA 5I0DA 2XPKA 1AQHA 4FNPA 1E43A 1CGUA 5EFFA 2WHMA 4KRUA 3BCFA 2D22A 4NXKA 4U5KA 4PMZA 1O7DC 1C8QA 2AAAA 2WSKA 2VJXA 2WBGA 3BUIA 3WEZA 4AC1X 3OGRA 5D9MA 2J7DA 2XUCA 3WUEA 1W2TA 4NRSA 3M6DA 1WZLA 3LPFA 2E40A 3CH9A 2YA2A 5CPQA 3U5UA 5I2UA 2VRJA 4C7FA 1V08A 1VEMA 4S3JA 4LPCA 1SFSA 4JHZA 3AQUA 4MB3A 4DUWA 4UFJA 1C7TA 1VENA 3MUIA 2GFTA 3B9AA 3TV8A 3K4AA 1CXEA 1CXHA 5ABEA 1V3MA 2A3AA 2J77A 3B9EA 1OSEA 4M1RA 3VIGA 3CBWA 3POCA 2CPUA 2QQVA 4HA3A 2CEQA 1JYVA 3N18A 3WD4A 1E72M 1UD8A 2VZOA 3VD9A 5A3HA 1V6XA 1ZS2A 3LIHA 3AMLA 2O92A 4ACZB 1U30A 2VZSA 1V3JA 3POHA 4KGJA 5CJ5A 3ARPA 4GZJA 1CGTA 3KE0A 1WPCA 4AZ5A 4BQ4A 1JDDA 1UWRA 1V03A 1EA9C 3AZSA 3LIGA 3FXYA 4CN1A 1NOWA 3EMQA 3ECQA 2CBJA 2QMKA 2XN2A 5FKCA 2CBVA 2ZWYA 2ZX7A 2AEZA 3VIFA 3UG5A 1PX8A 1V6VA 3JUGA 3WQ4A 1M53A 2OYLA 1TG7A 3WDPP 3VD5A 1H1NA 2OW6A 5I3DA 3SUSA 3L4YA 4CD5A 3WUFA 1IV8A 1XCXA 4NZCA 1UOKA 2YLLA 3CHFA 1GUVA 1LQ0A 4CD8A 3BLPX 4FNQA 1C90A 4CUCA 3THCA 1H11A 3OZOA 5BWFA 3ZSTA 1R87A 5F7UA 3CZNA 3TA9A 1W9VA 5M5DA 1MW2A 1AQ0A 2D0GA 1SR0A 2EBNA 2WC4A 4URIA 4CVWA 3A24A 2UY5A 5DO8A 3ARWA 4V27A 2BXYA 2ZX6A 1UD2A 2WXDM 3U57A 2VRQA 4FNRA 3WF3A 1UR8A 2WMFA 1KQZA 3RPMA 2XM2A 5ABFA 1UKQA 4XB3A 2W63A 3CHDA 2YA1A 4KH2A 1WE5A 4UFKA 3BUBA 1JD7A 3LDKA 2F2HA 3AMDA 2WPGA 4AMXA 4HZ7A 2VC9A 4AY1A 2DSWA 4PTVA 1ODZA 5KEZA 2VMFA 4AW7A 2WMIA 4UFLA 3SCWA 2CESA 1E70M 4CVUA 2YBTA 1CXKA 1LG2A 3F5LA 2D1ZA 5D8ZA 5BYWA 3ZSSA 4KWUA 4TTUA 4JL2A 3A23A 2VUYA 1V3IA 4QLJA 5C71A 4JFVA 1BG9A 1KB3A 3SEPA 1TQWA 4HZ8A 2BV9A 3L4XA 1E15A 1OM0A 4KRTA 5E70A 4B3KA 3N1AA 4PMVA 3SUUA 4AZHA 2PWGA 5LA2A 1SYTA 4ZXOA 1DWIM 2FYVA 1R47A 1XD0A 4NF7A 4P7QA 3TTQA 4UR9A 1VFMA 1XSJA 1EQPA 1VFFA 2DT3A 4JQTA 2ZXDA 4R27A 1E40A 5HPOA 4JKMA 4CN6A 4H8HA 4OZOA 1E3XA 5CPSA 3NDZA 4JCLA 3G6LA 5FKYA 3T0DA 3AZTA 2Y5EA 3A4XA 1LG1A 1TUXA 1PZ2A 1I1WA 3BAWA 3WMSA 4UFMA 1H2JA 3VGEA 1H0IA 3AHXA 4FFGA 2ZUTA 3T09A 3A4WA 1OGSA 1J0JA 1OD0A 1CLXA 2VCCA 4EK7A 1CBGA 5D4YA 5ABGA 3QGVA 3FW6A 4AIEA 3LPPA 2D3NA 1ITCA 4IISA 2RGLA 1AQMA 1B30A 2F18A 4QCFA 5EB8A 5ABFB 3FNDA 4Z2KA 3W27A 1UD5A 3N12A 3BUPA 1C92A 2AOSA 2F8QA 2WYSA 1E1EA 3DX0A 4H04A 4B1LA 3NSNA 2Y24A 4IPNB 3VIPA 2WMIB 3EMCA 3EDFA 3I3BA 1O7AA 3SUTA 4D6CA 1W91A 4UQAA 1UWIA 4FNSA 4GI8A 3UERA 4MB5A 3SCNA 2J7HA 4W8BA 3UESA 1HL8A 1KGUA 2F7RA 1EHAA 1QNSA 4MJ4A 2EPKX 3WH6A 6A3HA 4PN2A 4S3KA 3NSXA 3VGDA 3W25A 3W6LA 3ZJ7A 1W9PA 3UR8A 2WMGA 3BAXA 1GJUA 1LF1A 1VEOA 3AICA 3GNPA 2WCGA 3WQ6A 3I3EA 4PMNA 3BVUA 4NSBA 2E8YA 5EBAA 3WKZA 4JFTA 2WAGA 5CQ1A 1MWOA 2EAEA 2W5FA 2WCAA 1TVNA 2VVNA 3DYPA 2DSZA 3QR3A 3VGFA 3PBGA 3W53A 1FH8A 2FH8A 2XFYA 3W24A 3MSGA 4J27A 1JF5A 2ALWA 2BNJA 3MV11 1KGXA 4A4AA 2VTFA 3N04A 1W3HA 5GNYA 3W38A 3G6MA 2AC1A 1HJSA 1UQZA 4YN5A 3SCOA 4AD5A 2Q8XA 4IPLA 3TTYA 1UWSA 4MNKA 5IHSA 1EO5A 3VM7A 1B1YA 3WD0A 4PTWA 1T0OA 3MMUA 3IJ9A 4OJYA 2GK1A 2ZUMA 2ZUSA 2Z1SA 1XV8A 3WL1A 2G8ZA 3OGSA 2J78A 4CCEA 1W1TA 5HBFA 1HX0A 3VNZA 4FFIA 1PBGA 2D20A 5DEZA 3CUFA 1E6QM 4MAVA 1J9YA 2JIEA 3UGHA 1E1FA 4XUYA 3WD2A 4M80A 1MXGA 3VDHA 3MI6A 2WW5A 1V3HA 1H4PA 4AZ6A 3SCQA 3VD4A 3WDHA 2XGBA 4Q22A 2YLAA 1MW1A 2ZICA 4HTYA 4DO4A 3LEMA 1D7FA 3S5ZA 2A3BA 2CYGA 1MW0A 3ARSA 3PZGA 3VDAA 4B9ZA 1K9TA 5IHRA 2W4XA 3T2QA 3HU7A 2PB1A 2FH6A 2BVYA 2JE8A 4C7DA 4MDPA 2F1AA 3RO8A 1ISYA 4PMQA 3BC9A 4P7NA 4XV0A 3HG3A 3K8LA 2D3LA 1B31A 1W1YA 2XGIA 5BRQA 3GXMA 1QI3A 3PZNA 1C3FA 2IXUA 3OB8A 5BCAA 2O9RA 1PX4A 1K9FA 1XH2A 4QAWA 5FKBA 3DC0A 3S5QA 1QNOA 4J28A 4CU6A 1JIBA 4FF5A 3RIKA 4EAMA 1JDCA 3EJUA 3W4RA 3BVTA 1MQPA 2WVSA 3KZSA 4J3UA 4EKJA 3A6OA 4GI6A 4CCCA 1QNQA 4ACYA 3CZKA 4GZIA 1UD4A 3UR7A 1JI1A 3WY1A 4AYSA 4YPJA 3WUGA 4F66A 5KZ6A 3PHAA 2EPMX 1Z32X 2BY2A 2J75A 1UKPA 2WC7A 2EQDA 5I23A 1UYPA 3FHQA 1GZJA 3WF2A 2Y8KA 3WY2A 1UR2A 3L2LA 2XM1A 3WH8A 4M8UA 1V0LA 5FMBA 1UH2A 2G3MA 3D4ZA 1E0VA 2X05A 3AOFA 4CU8A 1QWNA 3EJSA 1VF8A 3CTTA 1Q6GA 3PTMA 2QMJA 1HVXA 2PWEA 4KMQA 1SMDA 3NSMA 3BVWA 3WDQA 4UFIA 4PYSA 2VX7A 4YHEA 4UQ9A 2E9BA 2IXVA 2Y8VA 4B9YA 4MNMA 1AMYA 2ZUWA 3THDA 5A6JA 4MAZA 3CZSA 1HKIA 3AHTA 5JIPA 4U33A 5HOSA 1LL7A 3ZR5A 1IT0A 1UD3A 1R86A 2WWDA 4BF7A 2JIWA 4W84A 3VMOA 3FAXA 2DH3A 5GQBA 3A3HA 2WKLA 1FFQA 3CMGA 2GJXB 5E6ZA 3WMBA 5A8MA 1DWHM 1HKMA 5FL1A 3QOKA 3S2CA 2J7CA 2VURA 2WK2A 3SCVA 2CXGA 1E56A 4UQCA 1HKJA 1OIFA 2ZX8A 1B0IA 4UQEA 4OOZA 3EMZA 4HMDA 3VGBA 3WH9A 3EJRA 1QNRA 2WLZA 3MUAA 1BQCA 3PN8A 4AZCB 1QI5A 3EYPA 4HOWA 1B3YA 1DWFM 2G3JA 3AIEA 2QQUA 1CPUA 4UZUA 3GXFA 5DMYA 3VGHA 3VDBA 4GQQA 1GOMA 1NWTA 1ZBKA 4HZ6A 4JCMA 1TVPA 3K4DA 3DECA 1BF2A 2O9OA 1UD6A 1R7AA 2PWFA 1HJUA 1VFUA 1OIMA 3MUZ1 4JKKA 3BSGA 3PZTA 1KBBA 5ANNA 1JNDA 1EXPA 2YJQA 3LF7A 1YHTA 2XHYA 4EE9A 4UOJA 3RDKA 4B3LA 1V02E 4JFSA 4AZBA 1WNOA 4D6FA 3EJTA 1V0KA 5A8OA 4F9JA 1S46A 1X6LA 3ZM8A 1VJSA 3M07A 6CGTA 3GXDA 2WMHA 1BGGA 2WWCA 1E4LA 4BQ2A 4FLOA 1E6RA 1VRXA 2PC8A 3DX1A 2WANA 4H2CA 1E3ZA 2J7FA 2VVSA 3EDJA 1JZ5A 1EQCA 1W9DM 4UQDA 1J0YA 5CGTA 3WF1A 3QHMA 2Y2WA 1MW3A 3CZEA 1HVQA 3ZJ6A 5A95A 5JBFA 4D6GA 4F9DA 2BVDA 2ZX5A 1JZ3A 3UCQA 2CCRA 4U3CA 3OG2A 2XJ7A 1GQJA 3SCSA 2FE0A 2CIPA 4FLQA 4RE2A 3WIJA 3VSTA 2WVVA 1R33A 3BUDA 1GVYA 2WB5A 3VMNA 1IZJA 4AZZA 3CUGA 2YDSA 2YIHA 2DH2A 5A6BD 2XVPA 1LLOA 1UUQA 1R7OA 3T0AA 4CKQA 1UYQA 2CKSA 4JKLA 2WZHA 4P8UA 2ZIDA 1Y9MA 4ZE5A 4DUXA 4W86A 1E0WA 1W9XA 1HJXA 3WF0A 1WKYA 3DX3A 2ZUUA 3RWKX 1ZJAA 2BFGA 3WUBA 2FGZA 4K68A 3KL5A 1XD1A 3ALFA 3E1F1 2XG9A 1XCWA 4DWSC 1ZU8A 5A6SA 1NWSA 2WMKA 2J7GA 1VAHA 3W82A 1CEOA 3VVGA 1BVZA 1ISXA 2OWXA 3F4VA 3ARRA 3W81A 1BTCA 1R75A 3LXBA 3LFIA 4TVUA 4BS0A 2BY0A 2WZEA 2VOTA 4WJXA 3TTOA 1Q6EA 2UWFA 1V6WA 1V3LA 4L4OA 2JFEX 3VTRA 4Q7NA 3D51A 2UY3A 4OBSA 1KR1A 5D9NA 1LL6A 2AMGA 4MPKA 1E5NA 1XYFA 3ZOAA 1Q6CA 2XVNA 2EJ1A 2HISA 4AD0A 2G3NA 2BS9A 1JZ7A 2WM0A 1GOKA 2DGAA 2VQTA 2C0HA 3PIJA 1UWQA 2JEQA 1FH7A 4LXFA 3H53A 2DPEA 3MU7A 1Y4WA 1PZ3A 3LRMA 1XRVA 3VKKA 1GORA 1DWJM 5JBDA 2WVVB 3IJ7A 2O9PA 3EJPA 5FOOA 5FL0A 5HXMA 1NWUA 4D71A 5AC4A 1PIFA 4UZSA 2EACA 1ZBWA 1GQLA 2PI6A 1J01A 4P7LA 2QQWA 3CHCA 2NSXA 4MTVA 3U75A 3OLIA 4B16A 1I75A 1TE1A 3VIIA 3T0BA 4JFUA 3LXAA 4OUEA 1ESWA 4UOQA 3D50A 3N11A 2G4FA 4AMCA 2ZXQA 3GZAA 3UEQA 4W8AA 1UR0A 2YKKA 2OLHA 2EPOA 4EQVA 3HMCA 7TAAA 2GVYA 1BHGA 1G1YA 3ARZA 3VOCA 4D6DA 2QPUA 1E71M 3PZIA 2B31A 2XIIA 4JL1A 1TMQA 4GPNA 2F7OA 3A4AA 3IJ8A 1ZBCA 1DP0A 1QI0A 4GQRA 1W2VA 3EJQA 5A6LA 1A47A 2FHBA 1RPKA 1RP9A 3SCPA 3W28A 3NMBA 3CUJA 3BSHA 5D8WA 3ARXA 5GNXA 3WMCA 2A3EA 3CO4A 2AEYA 4J7RA 4P7OA 1ZBVA 4LGXA 1SMAA 4NXSA 3L4VA 1JFHA 4QLKA 3ARTA 2Y4SA 1MVYA 4WLCA 4E4PA 1D2KA 5A69A 5FIPA 3WENA 3T2PA 1UKSA 2CERA 2VX6A 4NI3A 3CUHA 2EEXA 2PWHA 1GOOA 4X0NA 3ARQA 3SCUA 4P8VA 2PBGA 3CC1A 4D6HA 2CITA 3VIMA 1RP8A 3U7BA 4QDMA 5A8QA 3S6TA 2EPLX 4V2XA 4W7WA 1A3HA 3DHUA 2J79A 1NM9A 5CPTA 4QCEA 1LWJA 3KL0A 2QF8A 4GXPA 2EO7A 1GW1A 1E4IA 1ISZA 3VD7A 3IGUA 4UNIA 3RJYA 5M03A 3MV01 2ZE0A 1GHSA 2ZWZA 2A3HA 3GDBA 1GOIA 1GQIA 4BCEA 2CNCA 1CLVA 1W2PA 3AI0A 2WHJA 2DSKA 1E6ZA 4PMYA 1JNEA 4PMUA 4U5IA 3FY1A 3D4YA 4D72A 2XYLA 1US3A 2D23A 1VBRA 3ZT7A 3WF4A 3LRLA 3PZOA 1PIGA 4AZGA 5A8NA 1JYWA 1E73M 3HBKA 3DHPA 2DSVA 5E09A 3WBAA 2X0YA 1JYNA 3VIJA 3AIUA 2GJPA 4WKAA 4U2ZA 2YOCA 1W3KA 3GM8A 1TA3B 1UWTA 3U7VA 1W1VA 1BYBA 2VCBA 4AEFA 2YFOA 4QP0A 1NARA 2NT1A 3SUVA 4FNUA 3AIQA 2GJRA 1R8LA 1JZ8A 1VIWA 3WQVA 5A6MA 7A3HA 2ADDA 1B9ZA 1KXHA 2OSYA 1KTBA 3BAKA 1G01A 4KGLA 3LPOA 3W37A 2X2YA 3EDEA 5AC5A 1YQ2A 2YDQA 1FP8A 4OOUA 1WZKA 3WY3A 1F4HA 1WDQA 4NZJA 3WNPA 3N9KA 2X0HA 4UTFA 1J11A 2RGMA 3WQ8A 4AEEA 1FOBA 1UR9A 1QI4A 3VX1A 3VIOA 5A6AA 4M81A 2GUYA 2F1BA 1ODUA 1J0IA 1Y7VA 4OIFA 2GJXA 4LYQA 2F61A 5BROA 1MFVA 4E2OA 3AYRA 1EDTA 3ARUA 1FA2A 4H41A 3SCTA 5JBEA 2X8RA 1B2YA 3UG3A 5D9OA 2YDRA 1WAWA 5E0CA 1G0CA 1H41A 4CD6A 4XZWA 3SCRA 3OIHA 2V5DA 2EADA 3AXIA 1UG6A 1TQVA 3WDJA 5A1AA 3VSVA 4FLRA 4B1MA 4NZFA 3OLGA 2G3IA 3UGGA 2DEPA 4LQ1A 3ALGA 1K9EA 2BHZA 4AZCA 1QOXA 1W32A 4HPGA 2JF7A 2W91A 2XSAA 5JUVA 2PWDA 3BGAA 1J18A 3GBEA 1X1NA 3OGVA 1J10A 4HOXA 1VFOA 1GCYA 1B3ZA 3WL0A 3CZLA 3WQ5A 4WK9A 3KF3A 4HA1A 3AZRA 1P6WA 1C8YA 3VD3A 5LA0A 4JHOA 3GH7A 1QHZA 2X2HA 3RILA 2CETA 3L2MA 5GNZA 5A2BA 2VT0A 1CECA 2XQRA 1XHGA 5CXPA 1EGZA 5ABHA 1TR1A 1RH9A 1UR1A 4IM4A 4M29A 1LWHA 5FMDA 5GPRA 4BQ3A 1NOFA 3AIRA 2WBKA 1NOUA 3WNNA 3NDYA 4AZIA 1KWKA 1UR4A 4HMCA 4DWSD 3PTQA 1BVNP 1TFVA 3K1DA 2YL5A 4L4PA 2NW0A 2GSJA 4ZEPA 5C70A 2CBIA 1L8NA 1J0KA 1QX1A 4W88A 3AS0A 1V6UA 2IUZA 4TXEA 3CV5A 1DWAM 4CCDA 5E0FA 2WVUA 5EFDA 2E4TA 3BVXA 1I1XA 1G9HA 3CZ8A 3CPUA 4W7UA 2VZVA 1CDGA 1XH0A 3OZPA 5A6KA 2Z1KA 1JAKA 1PX3A 2GDUA 4RE4A 1HJQA 4A3YA 1K6AA 2IGTA 3W29A 4UOZA 4AIUA 2X2JA 4JZ5A 3RMEA 3D3AA 4CD4A 4QLLA 1WCGA 1C7SA 9CGTA 4W8LA 2YA0A 1MXDA 3J7HA 1UZ1A 3II1A 3EDKA 1FP9A 2X2IA 3ARYA 3QHNA 1CGWA 4WSJA 2BHUA 4D6JA 1WP6A 3BCDA 1MFUA 3IK2A 4D6IA 4BQ5A 3NJ3A 3HG5A 4FFHA 1V02A 2QLYA 1GVIA 3CLWA 3T2OA 3HG2A 4F79A 3CUIA 3PZUA 3AFBA 1EO7A 3TONA 3VINA 3HG4A 3M46A 2J7EA 1OWQA 1XSKA 1HL9A 2XN1A 5CLTA 1PEZA 4AWEA 2WNWA 2DDXA 2W62A 4DUVA 3A47A 5M17A 5CG0A 1EOKA 5AYIA 1C91A 2BY3A 3KLLA 1KCKA 1KCLA 4MADA 3L4WA 3BAIA 2XSBA 4HP5A 2W92A 3B9DA 4HU0A 1EOMA 2VX4A 3W6MA 1W1PA
chains in the Genus database with same CATH superfamily
5IHZB 4QQPA 1QLFA 1ZVSA 4K2UH 1H15B 3N9LA 4UT7H 1OYBA 2TBVA 2NLIA 4J3OF 1AANA 4PJCF 2QCGA 2AXFA 3RWEA 4AGOA 3S47A 1W72H 2HFTA 2ZOTA 4X0VA 5F9TA 1IMHC 5DHDA 3O12A 1SXNA 3OJDA 4GVHA 2FJUB 4AQZA 1I1AA 3S8FB 3KPRB 1IGWA 2VN6A 5C9JB 1FWEC 2VE6B 3EHBC 1WBYA 4LA3A 4B95C 1XGRB 2DMBA 4PL2A 1MG3C 1TCDA 4NS0A 2PFHA 3LJ3A 3K91A 3AALA 2OMNA 4BE5A 2BOCB 3KWXA 4JO5A 4I1NB 4LQRA 1SF3A 1IX2A 1NCDL 5J1AA 1ZBE2 4W5UA 3OPZA 2D73A 1BWLA 1WZAA 3P3TA 2E9MA 3FUOA 3KEHA 4TNEA 3WIHH 5HI3C 3MRLA 1OFPA 5FYKD 3M3EA 4XAKD 3EWZA 1TDQA 1AG0A 3LIZH 3F4NA 4DW2L 4EV0A 2VLJB 4Y1VA 3KCCA 5E4OA 5MEQA 1NCRA 4XX6A 3EEZA 5DEFB 5EMKA 4ZPVB 1F8TL 3RPIA 1JUFA 2CRMA 3G22A 2ZHKA 2BW8A 4AVVA 2X3AA 4EANA 2JICA 2HA1A 4JIEA 2PCPA 1DV7A 5BNKA 1A6TB 3NK4A 3RX9A 4ATLA 4WHDA 3FT4A 5DYFA 4I3PA 5JHDA 4UV7H 3O2VL 3ZYGA 4WFGE 1CIUA 4KMLB 1JW6A 4DYKA 3JCIA 1ETB1 2IOIA 1MCLA 2B3RA 3L5XL 2DT2A 3DG3A 2W65B 4YL4A 4MJ6B 4TKWA 3ZZLA 3UF9A 3KV9A 1HC1A 3FFOA 1L6GA 4LSSL 3VX0A 2WUCL 3BODA 2VUAA 3SRFA 1BIHA 5CN3A 3Q65A 4OSUL 2QZ3A 2VDKL 4U1JA 3JVGA 4Y6GA 4NJ9L 2FMYA 1XPWA 4Y22A 1I1EA 4TLUA 4L80A 5I66A 4WWOA 4AR2A 2UY2A 5DS2A 4Y8EA 1DIOA 1RVKA 2EXOA 3T6ZA 3BV4A 4PJAE 3MGAA 1NGPL 2WVTA 3HG1A 1ISVA 4XN1A 4UTHA 3P60A 1UZGA 3DIVA 1I2RA 3WXVL 2QCDA 4GEIA 1BM7A 2CGRL 3D07A 5AC93 2P24A 5LNGA 1PDZA 1PS3A 3X11B 1RLCL 3FFCE 3DDGA 1AUYA 1KTLB 1UB5B 2DAVA 4TRPL 5MENE 4JFQA 5FLJA 5TF1L 1T20A 1KPUA 4HJWA 1SEQL 2IH1B 1LEGA 1JZ4A 3MBXL 1JGDB 3HNVL 3MV7A 4WI6A 1CXFA 2Y2YA 4XNAA 3AP6A 3AIWA 4JTIA 2XLAA 3VUPA 4LSVL 3ETBF 4DY3A 3TCXA 3GH4A 3DU0A 3B8YA 2VMEA 2HVMA 1KT2A 3AYCA 1CK0H 3QDMD 2Y22A 1NEZG 1FH9A 1HJVA 3S7GA 4R8HA 4JOMA 3WFLA 5HWNA 3BG3A 5GALA 4XIKA 4AQ8A 4AVAA 3OCPA 3L3GA 1GYMA 2E9LA 5EV7A 2OZ8A 3GU9A 4ZUSA 4UOW1 4QDGA 1P6CA 2B42B 3MV9B 3HLAB 1KBWA 5AYUL 1BYOA 4HSAC 5CAZA 3H9YA 4ARYA 4LY8A 4FXLA 4X7TA 4MAUL 1G7PA 2XKNA 1RH8A 1V3KA 1YA5A 3ILPB 5FEBA 1RZJL 4WIWA 3ES4A 3NA4A 5DDJ2 4X83A 1XSIA 1VBUA 1HEZA 4CDXC 4WXZA 5GSRB 2F8VA 3GNXA 2F4LA 3QHZL 4PD4K 3CFCH 2NYYA 2EXJA 4I0WB 4LIQL 4OD2B 3UIYA 1KEGH 4P8XA 1IAOA 1QNIA 3XINA 4ZYKA 1CI5A 4HWUA 4LUMA 2J1YA 1PO23 1J5OL 2AK1L 1IM9A 4LKFA 1IG3A 1UADC 2RDNA 3GUWA 1AC6A 2WHLA 4EKXA 1AO7B 5CCZA 2VOXA 3OB0H 4QXBA 2DQTH 2C1GA 3KPLA 5FTTC 3JZYA 1HXS2 3TLLA 3ACLA 1RUAL 4ANKA 3PUQA 3UYRL 4ZUWA 2XBO1 1MEXH 5GGTL 4AVTA 4QEEA 1CMOA 1IKQA 1MNSA 2NR6A 3ZDZE 3SGUA 3BZDA 5CMAA 2WHKA 4L3FA 1R24A 3DYOA 4JFOB 2WLQA 2DKSA 3QJTB 4IDJL 1HZHL 1ZKAA 3OV6A 4YDNA 3IDGA 2KX9A 3ZTJH 1B54A 2PDUA 3APTA 4JAWA 1BVLB 2V3FA 1NP2A 3BUQA 4JUTA 3MRGA 1QHDA 3GC3A 1VKFA 3FSWA 1M04A 4V28A 5FY7A 1JPFA 1RJZB 4XETA 1XHHA 3WHXA 5EYWA 4XMAA 1GT8A 2ITDB 3DBPA 4BE6A 5DHVA 2FCTA 2PLV2 4ZA0A 3VFVB 4Z18A 1I31A 1P4UA 4LMQE 3MZ2A 4LCCB 1XX9C 4X5PA 3TOPA 2IOMA 4YWGH 4MZUA 4B4FA 5KYYB 4NROA 1BG1A 3PPEA 5C92A 4AI0A 1PLCA 1JF1B 3MZNA 2J4WL 4BOWA 3QPXH 2HFFA 5I78A 5GM0A 3VKCA 2KZ1B 2O14A 1E5RA 2J13A 4R96B 4KVCH 1YVLA 1N6UA 2G9ZA 4Z7UB 1CI3M 3PU8A 1S2VA 1CGUA 1XVSA 1XSOA 1S9XA 2HRPH 5TE7L 2RR12 3R43A 3UWUA 2FZ8A 5GSVB 4X8XA 4O54A 4YHNA 5SWZB 3ZDXB 2WLPA 1OVDA 2QCMA 3LEVH 2EYSB 4LPCA 1QDOA 2P42B 1LUCA 1AOZA 2DB8A 4XAYA 4QXGH 5E08H 1PLAA 1YDPB 2GAUA 2G37A 2CGNA 4IU3A 3ARDD 2PXYA 2YMXL 2OMYA 3QXDB 3KXFE 2V5KA 4AVCA 4QSHA 4HC1L 1AL0G 1FZJA 4M0XA 3T78A 1DBML 5T3XL 3PHSA 4MZ2A 1XF4B 1TETL 1LDPH 2ADGB 4C1NB 3W59A 3FQ2A 2GN3A 4ZFFA 4MQ7B 5DWPA 4AHZA 3KE0A 2AQOA 2UXVA 1E5ZA 3WS6C 3QXWA 3DX8B 1TWIA 2A75A 4HJJH 4H1LA 2WNOA 2GUOA 1FO0A 4UTAA 4GB32 2D3PA 1KCSH 1TTCA 3QJHB 2Z93B 2RS12 3L3OB 2F6XA 1X5FA 3O11A 2R4RH 4KL1A 5BWFA 4ZXKA 3E5BA 1DL7L 4FX6M 4DXVA 4A6YB 1ZA6A 2W3ZA 3AVRA 1T7VA 2C1FA 4URIA 4NDMB 5CEZH 2HTKC 3HIFA 5FJTA 2A6WA 1CFMA 2B4CC 2RJ2A 4WX2A 5C2BL 3ZXWA 5C9ZA 2PYTA 1XLBA 5IMKA 3IDUA 3EWCA 1QOQA 3DXIA 5GJMA 5LXGH 3RX5A 1D0GA 1TMLA 2F2HA 3QQXA 3BQUD 3IKCB 1OZQA 1PVC1 2VC9A 3TNBA 4JGNA 2Z2AA 4NQVA 3ULUE 3AVEA 3PUSA 2FDHA 3H0TB 1D4M1 2CESA 2CRYA 1EERB 4KWUA 4D6QA 4FPLA 2Y88A 2OMUB 4LBAA 3KHJA 3A23A 1NE4A 4JRXD 1QPNA 2VC7A 1Y18A 3TBCA 5SX4I 5DHEA 4ENED 4YHIB 3MV8E 1WK0A 2R0LH 3MR9B 4AIZB 5FV2A 3OWRA 3GMQB 1LESA 4AIBA 3IDIA 4V1YA 4NQCB 2WBJD 3IRCA 1J88A 1R47A 3DK0A 4JFFD 2HT4D 4IERA 3CIXA 1E6JL 2BFVH 2NY1C 3WJMA 2Q8AL 4WO4D 1KMGA 4UWQB 4YGDA 1FI2A 2FIKB 4MMZB 4C4KT 1E40A 4H9VA 2QVHA 5JPNA 4OZGE 1A22B 3SN4A 4XPBH 2JQAA 2Y5EA 3CX2A 2AW2A 2WYZA 2C0ZA 4BD4A 1X9RA 2X4NA 2IWKA 1U8OB 4FQXC 1RTVA 4X22A 4AQAA 3FTXA 3SKOA 3TNMB 1OD0A 1AZZC 3HMXH 2J73A 5H37H 3OG6B 3UBPC 4NEHB 4DZHA 3FSUA 1EZWA 4Y4HC 4OD3H 5F9WB 3VXNB 4J2MA 1X5YA 3SZKC 4UTCA 1PDYA 3DZ1A 1E1EA 1B35B 1AR2A 2AHIA 4OZXA 7PTDA 2V7HA 1AQDA 4BZ1H 3HQNA 4GKYA 5T3ZH 5JMOC 4JIHA 5EA9A 3R25A 4MJ4A 4QNEA 2NLJB 4C6CA 1UYXA 1XRFA 4LZKA 3O05A 5CAHA 4PRNA 1PXGA 4M0HA 3I3EA 4P3CL 2ZEZA 2E8YA 1FRGH 1I8JA 5CZJA 5EO9A 4FQZA 5FYLE 5AVAA 2GYIA 1HDMB 5DGQA 4ZQMA 1VADB 4R33A 3TX4A 5IHWA 1RSFA 3BG9A 4UTBL 3LCYA 3MV11 2VJ8A 2WWKO 1OOPB 5FYYA 4DGUA 1Q6OA 3N04A 2NXIA 3I68A 4PDWC 1N18A 2ORXA 1I2QA 4YW7A 1UY1A 4U3HA 3W38A 3VZLA 5TK2A 1UN1A 2R0FA 2UZXA 4XXDA 1BRLB 2ICWA 3KCYA 3CSPA 2ADAA 3VDDB 2ATMA 3GB7A 2FCUA 3TC9A 1K02A 3Q67A 1RGSA 3FK4A 4EDXB 1WW5A 1D6VL 2R062 2Z1SA 1YTKA 3VYNA 5I1DB 2MNRA 1RI8A 2KPWA 2JCCF 4FFIA 3IM1A 4YMPA 4NOBA 1LBFA 4LP5A 3SRDA 1QFWH 2D7MA 3QZ6A 1E1FA 4NOFA 2C15A 2X5IA 4RBPH 4BZ2A 4TN9A 2DQWA 3L68A 4Q22A 2ROYA 4KRMB 2NNXA 4Q4V1 3AU1B 4NO0A 5IJRA 3U7AA 5C9WA 5ISZD 4HEPA 4G1NA 1W15A 3Q6GL 5BZWA 2ED8A 3FQRB 3K8LA 3ERPA 4LAQH 4MA3A 5HGDB 3TN6A 4H9MA 4QWWD 3RNQB 1SZBA 4A42A 3RIKA 3VFRA 1NY72 1GGTA 3FFSA 2JIXD 3PJSA 4ZQNA 1IU1A 4IKLA 4XWOC 1VFSA 1GGIL 5L36A 4HUUA 1EC8A 1KB9K 1GGYA 2CJUH 3NQKA 4YLCA 3CASA 2VSKB 4GBXD 2AAMA 5E6ID 3U0WH 5AVXB 1XRUA 4G8GA 2Z8RA 4HUXB 2GDQA 4NR1A 4GT0A 4ZAKD 3AJXA 4XB7A 3BARA 4GVIA 4UILL 4Q9BA 1HKVA 3IRDA 4GG6E 2A5UA 2I45A 1XISA 1A4JB 2HS6A 2GCYB 1TB3A 5B39A 1XR8B 4LIUA 5BMFL 6TIMA 2JB5H 4U6XB 4RGNE 3FAXA 4I3SL 5F7EL 4D3WA 5IVOA 1PNCA 5HDOA 1CICA 3EOAA 5IEKB 5TFSL 1HB4A 3B9NA 4PRRA 4WHTB 4YDIL 1W6NA 3ZDWA 1P0EA 2NXGA 2Y1VA 1NC2D 3VWKC 4CDGC 4NYYA 4ZXEA 1IIHA 2QQUA 3VDBA 3SYQA 3MYJB 1FYTE 2KYIA 4G5AA 4AX6A 1SACA 3ZRFC 3BISA 1MY5A 2OQ7A 5DCBA 4HWZA 1IC4H 3MUHL 4P05A 1QUMA 3LQAH 5DQJA 4BB3A 3TIEA 4WVMB 5J0BA 1TQXA 1EJOH 2AK4A 4XYXA 1V0KA 2HP4A 1UWWA 3OJMB 4G9DB 1V7ML 4XAGA 1GYAA 1SBEA 1S7SA 4ZFOL 4U6VL 4P3DB 1IEIA 3BJLA 1SMOA 4ZU5A 2Y2WA 4ASTA 3L3IB 3BK0A 5EWIH 4UTJA 5A3NA 1F00I 5BNOA 2O5YH 2CCRA 4RFOL 5CGQA 2O61A 3QV7A 1L5GA 4G2AA 5D1ZA 2V2CA 4PGDB 3O7UA 4YYOA 2OZ0A 2OTWB 3QDGE 3MLJA 4K3UA 3GX9A 1F3RB 3HZVA 4O50A 1WLDA 3OXRA 3MLSH 3QORC 4P8UA 5I1HL 4ZE5A 3VRIA 1NCWL 2DW6A 4J1XA 4REQB 3DXAB 3HAEA 1FATA 3O4OB 5FK9B 2ZGTA 4AHPA 4TLSA 1XCWA 2R16A 5CG7A 4DKFH 5F6HJ 1LOFC 1BVZA 5KYXB 2ZX2A 2EP6A 4PLMA 5D37A 4TVUA 2NX1A 3NQFA 4K8RB 5JW4M 4BS0A 4WJXA 3JWNH 5BOOA 1MHEA 3T04D 2E27H 4AITA 1X5GA 2YDAA 3CJIA 1EBHA 1DQ1A 5HD8C 4DBUA 4MAYA 5CBEA 3QNZA 5FW7A 4GVGA 1RUF3 2R0KH 3RZCC 4PB4A 3JTSA 1NBYA 1CBVL 2BS9A 1HTIA 4HN4A 1JN6B 3SCFA 3ATAA 3SKMA 2AXFB 4V2WA 3NESA 5C9UA 4KJQC 3W5MA 1QWRA 3ZVIA 1YIFA 3FRPA 3LMJL 2XJVA 3WFEH 1E4WH 3GALA 1BEV3 4JEGB 2JKNA 2YPJA 3OJDB 2B1AH 2WVVB 5I19H 1I1AB 1A5KC 5LBSH 5FOOA 2RIKA 3MYPA 3BVDB 2Y6SD 4NO2B 4D71A 4NYUA 4UZSA 5J6HB 1J01A 3OMZA 4LAZA 3D69A 3EGJA 5FUZL 3SDAD 3S34L 4XFIA 2NW3B 4WJ8A 1U3HC 2D98A 1M57B 4ZOCA 3V95A 3QFDA 1E9ZB 1LEKA 2HVNA 1NAL1 3GZAA 4L8DA 5J1AB 4OI9A 3WD5H 4COYA 1BHGA 2NUWA 2DIKA 2NY0B 3I3QA 2QPUA 3ATZA 1V6OA 1ERNA 2NY5H 2DQHL 2BP3A 3LKSB 2C26A 2R30A 3MLRL 1G5GA 3DN5A 5C2GA 4ELDA 1UMZA 1JUFB 1DLFL 2IADA 1J86A 4IPIA 5B80A 2AXWA 2I9EA 4R4ND 4HFUH 1FL5A 1X7FA 1CT8A 3B9KD 2Y26A 3UZWA 4AFBA 1FH5H 3H8XA 3G18A 3U6WA 5JHDB 1VYSX 3ZRCC 5I1LB 4OF5A 1WWBX 1ZVYA 4FQ2H 4P2AA 3RLUA 4HGMA 3PL6C 1A3HA 1TWZA 1NM9A 4HXAH 3Q2CA 5GZNC 2EDMA 2XKOA 1GJIA 1SZEA 1AJ7L 1QOSA 3GDBA 3JVFC 4BCEA 3V56A 2CNCA 1W2PA 2WHJA 3ZKUA 3GSRB 2Y70A 5DZOA 1JPEA 1E73M 3VKFC 4DVOA 1K6QL 2DSVA 1IXQA 3BW9A 5DD5H 1BD0A 1FYUA 1B4JH 2NY3C 3AQDA 3E3QE 1FQ0A 2BGCA 2ZGPA 5J96B 1F6YA 5I66B 1VPXA 1VIWA 4N0YH 4C6BA 5DY2A 2BIPA 5D72L 5A6MA 1B9ZA 4QGMA 1AJOA 1RHI2 1KD0A 4FMKA 2IWFA 3KHOA 4RMTA 4W6YB 3KH4A 5DQ0A 5KWYC 4EI6A 1ICTA 3HG1B 4OZIF 3N9KA 2RGMA 1OCWL 4O9HL 2EH8L 4LBJA 4J4KA 4FOWA 4JRYA 1SW3A 4JGZA 3IN0A 1P0NA 3K2GA 3VIOA 5I09A 4IRJB 4MQTB 2DQGH 3ZDSA 4X6BA 2P24B 5BROA 1TPXC 5EL1A 1FHVA 1HHIA 4UTWA 1B2YA 4M3JA 3M0YA 3AYTA 5D9OA 1BMV1 3U2CA 2EADA 2DZWA 4TNVF 3VSVA 4WDWA 4M02A 1A53A 4JFQB 5DA0B 3OLGA 3UBXA 4QOKE 1J4EA 1K9EA 1KPUB 2OZ4A 2D97A 1ZAIA 3U7YH 2PLCA 2BK8A 3LI0A 1LEGB 3U8GA 3BN9D 2W9MA 1RVGA 3MV7B 3H2OA 5HSFA 4GXMA 5F4SA 2Q3ZA 4L7ZA 2OXGA 3SE3C 1NLDH 4XX5A 1KT2B 4Z3EA 3TWCH 4FPYA 1MQ8A 3JU2A 1CECA 2VDNB 1TR1A 5IHZA 1RZIB 4INDA 2OULB 3AIRA 5HVHC 1L9RA 3L3GB 1NLSA 1QBML 4HMCA 1GP4A 3OHIA 2NX5E 2HPOA 3EXLA 1HLCA 2GGGA 3HBLA 2WWMD 1YYLL 4W88A 5CA6A 4K07A 1DWAM 2PGFA 2W0KA 2DKUA 3QCWA 3CQHA 1E7VA 4X7TB 5CU1A 1G9HA 1UZDA 3P93A 1G7PB 1AZCA 3LRHA 2IUWA 1CDGA 1NDTA 2A3TA 3LAFA 5D70H 3BJFA 4I3RL 5C9JA 2AQVA 1FNLA 4M4RB 1HEZB 3FUDA 3OAUH 2G5RA 2W3JA 4HN8A 3ULVC 3QM3A 1OT4A 3RMEA 3FDGA 2R9HD 4NJAL 2DZPA 3FJ4A 1DSYA 5IVNA 3L0GA 3E0IA 1UZ1A 2APBA 1CGWA 3ZXGA 2BOCA 4WSJA 1HB3A 3QQ9D 3GSXA 3FQXA 2G96A 1IM9B 3EO9H 2EDTA 4NE9A 3W9DB 4JO8A 1J8SA 4AK2A 3NNTA 1T5AA 1L0XA 3NJMA 4AWEA 2CD0A 4ZXBA 4WZFA 3HUJA 4ZMGA 2VLJA 5TK4A 5K1JA 3WKQA 2G9KA 4ZOBA 3S1WA 1W1PA 1YEEH 1MCCA 1S7QA 1O7FA 1HP4A 3B8WA 5CMAB 4IQEA 4XN5A 1VRH3 4NU7A 2ZC1A 1JGVL 3LZLA 3O6MH 3BIKB 5J13B 4PC8A 1Q4NX 4TX8A 4YZFF 1A6TA 1KCXA 2R1YA 1X7IA 5D7KE 1IGSA 1EJRC 3MRGB 2I9TB 43C9A 3N44F 2FO4B 1V10A 3WHXB 3I7DA 1J2WA 3M7SA 3EH2A 2J1KA 5DHVB 1Q0EA 2W65A 2ZUNA 2QSQA 3M0MA 1M7XA 4GRWF 2EVXA 5F7NC 2EE6A 2XG5B 1JG9A 1WUZA 3VGIA 3KRUA 5ESVA 5AHLA 2B7NA 2AJYH 2BIMA 2JDYA 5EF3A 4MLJA 3KD4A 3S8HA 1P0KA 4ASKA 3STFA 4HHHA 1T1YB 2ZX9A 1XS2A 1RURL 4QCIA 2HFFB 2WMPA 5I74B 4WK2B 2VGGA 3MXVL 4JJHA 3F7PC 1LKNA 1TJ2A 1OF6A 1ZBE1 3QUYD 2VD9A 2QGYA 4AV4A 4ODTL 3D0SA 4ONVA 3PPGA 2A4ZA 3WG3A 3LOWA 4AC2A 2ATPA 5B3JF 4YHNB 3QIUC 3P0GB 3ASNB 2P5WD 3WBEA 5C3RA 3FN0L 1E5JA 3DVIA 3LE0A 2YW3A 4DCQA 5C4WA 3TFKD 1YNKH 3RR4A 1Q9WA 2DJXA 4IU3B 1M4WA 3X11A 5K59E 1XYAA 3ITQA 1KFWA 4P2VA 4PJHA 3V0JA 4Q9QL 3NYZA 3NJLA 1FZJB 3KDMB 1KQRA 3OODA 5A7OA 3WSUA 3S3GA 5DFAA 3N35A 1NFPA 2IH1A 1OOWA 3RN6A 1JGDA 2FTWA 1SFHA 3W70A 2XWTA 2C14A 5EDXA 3W0WA 3LN3A 1ZFJA 2W6RA 5C09E 4KHTL 2E75C 4AC4A 4H1LB 1NH6A 2YAQA 4AD2A 2V9UA 4OJFL 3PG8A 1XPYA 5BPXA 3NOIA 4WQ6A 4FD0A 3E0GA 3KBFA 1MCPH 3HN8A 1G9FA 1LILA 1OBAA 4NC2B 4GYFA 2HUEA 1MVQA 1G6RH 4AFMA 3E38A 4NBZB 1JL8A 3D0JA 1DQDH 3KOYA 3BSMA 2J7BA 3IDNA 4R5XA 4QRRA 4NZ5A 5IV2A 5E9AA 2VITA 1E6SM 2DF7A 4J3OG 3AS2A 1HQLA 2HKHH 3LLDA 3LPGA 2W67A 4MGYE 1EDQA 3ILPA 4P5UA 1H2MA 3WOVA 2E7HA 2Z92A 3W74A 4H0IA 2MANA 5DXDA 4NUPA 5GS0L 5GSRA 4A37A 4ALDA 3KGLA 4NQVB 3R4DB 4AFAA 2FWOB 2OZNA 1BSIA 4H8WH 1KTJA 3IBMA 1UJQA 4G11A 4N87A 1E4NA 3GBNH 1DVFC 1M3IA 3AY4C 3C52A 1OURA 4DTGL 1QFHA 4PJEE 2ZTNA 1AO7A 1YXYA 1YMMD 4A2HA 4D3CL 4PBPA 1MDRA 2YXGA 4RR3C 1RZGB 4GZEA 2XTJD 2Y7GA 3WJMB 2YD9A 2X1UA 1CWYA 4KKBD 3A67H 4HT1T 2QCEA 1S0BA 1T03H 4OLVL 5JPNB 3PBUA 3G24A 1ET8A 2QDWA 1NP0A 3LVTA 2P1YA 4X4XB 2Y07L 2X89D 1HXYA 1HKKA 2X4NB 3MDUA 3GXTA 4JFOA 4HPKA 4RAUA 1WFTA 4AQAB 3NJJA 3V18A 4NJJA 3TA4D 3SKOB 1BVLA 4NWUH 4J2QA 1UW9A 1KTDB 2EE3A 1JUEA 2OWWA 5SWSA 1S2CA 2ZZ1A 5LIXX 1PYWA 3VOJA 4RGOL 2AFNA 1TVDA 2CW6A 2TSAA 4JDNA 5J3HC 1UNBA 1WDPA 1JDAA 2CLZB 3QIBA 3UMTA 1E6XM 2Z24A 1AQDB 3WN5B 5DDJ1 2OMZA 3Q5TA 2A6XA 2HWZH 4GB9A 2HJIA 2PR4L 4QKDA 2HWC2 3N42B 3CSBA 2IXKA 5E1QA 4XSLA 3HMWL 4PRNB 4QXKA 4JMXA 4S1RH 3PJQA 4K4KA 3WFDL 4JGYB 2DIEA 5EO9B 3VXRA 4W7VA 1XB6A 2VLKA 1QSED 2JQMA 1KGCD 1Z6KA 2ORBL 4WJKB 4UW5A 3C5ZC 2AH2A 3A6BH 4BI7A 3KBMA 2ZKWA 1JCLA 1P5UA 4G6FD 1KGWA 2NXZC 1HXS1 5KHJA 2I24N 4XO7A 4HK8A 2R0WL 3ARED 1MCOH 5SWZA 1PMJX 5AFEA 3K6OA 1GPFA 3O4LE 2EYSA 3HN3A 3SIZA 3BL3A 3GSVA 1X8EA 1SW0A 1IOAA 2ICWB 4X9SA 1YDPA 3NRFA 1RZ7H 2K6YA 4HSNA 4WKFA 4LT7A 3M41A 3IVKB 4UM9D 5T5FH 1LO4L 2CLOA 3K6IA 4GGBA 4Q74A 1AAJA 3H8NA 4AISA 3OLDA 1W5PA 4YHYB 2IG2H 2JK5B 5IB4B 1XF4A 1PL9A 5E1GA 3SE4C 1DQ0A 1RKRA 3V7AG 4F9LC 4FADA 3E97A 4I0AA 3FB6A 1QSFE 2PLV1 5F5QA 1D7PM 5AOIA 4UNUA 3RY5A 5GLTA 4GH4C 2J6EL 1PMIA 1QR4A 5HDBF 5F96H 5B1CA 1N4XL 3FHAA 2DQJH 2XHKA 3K2OA 3AMCA 1HJWA 5FEXA 3QJHA 1ACYL 1B4TA 2Z93A 3WXPA 3GDTA 3D39D 4L4VE 3VXUE 3HA1A 4MA3B 3EOTH 4BCXA 5AVZB 3L3OA 1R2RA 2CYFA 1VD6A 1AD1A 3O1PA 2CHWA 2YAHA 4GY1A 3KOFA 1E43A 3VFRB 3MWAA 5DMGC 4I5BB 4NXKA 1I5PA 2VABA 1SR9A 5FM5O 2OGJA 1GR3A 1IC5H 4B0MM 3WV0A 4LTAA 4RPPA 3EYUL 4HUUB 4NDMA 4OFKA 5B7FA 4PTDA 1RULL 2A71A 2AR6A 4Q6IC 1XWVA 1UUNA 2RR11 3ZSJA 3XISA 4G8GB 1VENA 5G05L 2N3JA 3LEIA 3WS3A 1X44A 3QQ1A 5KSAC 2MCPH 2J77A 3IN9A 4Z7VE 2BVQA 4HJTA 3BICA 3H0TA 4RA0A 4F8AA 5B39B 4F2BA 4ELMA 1H7WA 2OMUA 3W9EA 3HPAA 3QHFH 3UP8A 3MR9A 4AIZA 2PO6B 3OZYA 4HUWA 3GMQA 1JDDA 2BNQE 2P34A 3CQPA 1UWRA 4NQCA 4Y4YA 3EOAB 4QKBA 5T5NF 3FXYA 4M3KB 1DLHA 4WCYL 5ACLA 2VECA 4GG8A 3DUSA 2Z7UA 4DF9A 2FIKA 1YEIL 4L6OA 2OYLA 1PZBA 1F3EA 4Q4X2 5IWLA 1U58A 3UNTA 3MKVA 4MYPA 4HYRA 4L3EA 2C9UA 5DAWA 3RIFF 2RS11 1R87A 2P3EA 4ZW8A 5M5DA 2V68A 1Q63A 4YSFA 5BV7C 5DQJB 3TIEB 2BXYA 2AK4B 3CAKA 2A0LD 3SH3A 4KDTC 2QCNA 4MCYA 2XDHA 2UXGA 1KQZA 1ZNNA 3H42L 1UKQA 2UZPA 1WE5A 2LTNA 1ZZMA 1BEYL 3WLBB 2C1OA 3BPNB 4UT6L 4DGYH 1VLNA 1CC3A 3TW7A 5BNOB 2IPKB 3Q05A 3P0YL 1M56B 3MRJA 3RFZA 1UXXX 4AI7A 2O61B 1X8FA 5DR5H 1GC1C 5D1ZB 4GEJA 2BV9A 1GC1L 1E15A 2HEJA 3HB3D 3N4FA 2BNOA 4WDTA 3S2LA 1XGQA 4Q6JA 3F65A 3HZVB 4NJIA 1JHTA 4RQPB 1YC7A 1KFLA 2QGHA 4NN6C 1IARB 3HAEB 3LZFH 5DD0H 1LJMA 1VADA 2DQUH 5ESQB 3E7JA 4RMVA 4UNLA 3ZKMD 3O3AB 4QTGA 1DQTA 3U1PA 2QQNL 2VAJA 4IHCA 4MLRA 1J59A 2HYXA 3K6NA 6PAZA 2AAVA 4YHZL 3HRZA 3ULUH 1H0IA 1J0JA 1MHEB 3BALA 3CJIB 1C8M3 3MACH 4EDXA 3K5RA 4MAYB 2Z6JA 4IMAA 1VMFA 3GBFA 1KC5H 2YUVA 1WSST 3C09B 3SH5A 4ECNA 3C2YA 1DZRA 3JTSB 1NBYB 3B4YA 2WYSA 4XHJC 4P59L 3GU2A 5K4ZA 2ZSWB 3CK5A 3FRPB 1TWSA 1FH2A 4XP6L 2CSPA 4GQPH 2VR3A 3AU1A 1VE0A 3FN3A 3NCJH 3J8F3 4BFKA 3VACA 3NPZB 4AL9A 1XQLA 1IM3D 5G4HC 4PMNA 3QUGA 3FQRA 5C08D 3A7QA 3WKZA 2D7NA 3UW6A 3W53A 2XFYA 2P88A 1Y6MR 1WXJA 3ZXAC 1ZLWH 4WEMB 2YBPA 3FTUA 4HKBB 5IBLD 2ET1A 1NJ9B 1RFDL 4YTTA 4MXVF 4NT6B 2F68X 4A35A 3EB7A 3BZ5A 2HTLD 2VZQA 4DXRA 2WWOA 3TTYA 1S4CA 4YFZA 2HVJA 1K5JA 3NSCA 3KWTA 4R9DA 1VGEH 4MLIA 3S36H 3VQLA 5EDSA 4N25A 1CCZA 2G8ZA 2CWNA 2INZA 3NFPB 1A4JA 1BVNT 3VNZA 5DEZA 4IRZL 2D20A 3S2NA 5JXQA 1OH3A 3Q2VA 3WD2A 2R061 1QF3A 1FL5B 1P4IL 3GIPA 2X0SA 2E86A 4B2DA 2ZPKL 2UV3A 3ULSB 1X5XA 2WYHA 1HL4A 3DTUB 2CYGA 1EFXD 4KQ4L 2OP4L 4FQJH 3HU7A 1ZQ5A 1AE6L 1O5PA 3GHMA 2F1AA 4NJGA 1JFQL 3LGGA 1ZJHA 4BPZA 4UUIA 4KKLD 4W65A 3UA4A 4HNTA 1JBCA 4N9BA 3F58H 1NOLA 5FEZA 3WHE0 1O59A 3GW0A 3L95A 3MYJA 4FT8A 2BMBA 4CCNA 1NTDA 4PH6A 4GI6A 1MHHA 4KHXH 5L19A 4QX1A 1YJLA 4RK8A 1DANT 5A2JH 3W00A 3HBPA 5ALBL 1NY71 1XF2A 4MH0E 4UNVA 1UOGA 3D8MA 4AE0A 2YPVH 3KNBA 2J88A 4PRAB 1Q6GA 2WNVC 2R29A 2IWEA 4WJ5A 1PSKL 1YQ6A 3TJEH 1CB4A 1W03A 5I8TA 2HMCA 3T40A 2CLKA 4Q4PA 1C8PA 4ZTEA 3T1LA 4EI6B 4XX1G 1E42A 1W8SA 1R86A 2EG8A 1M1SA 2FBRA 4JC1A 1QRKA 4G1EA 2PURA 2ATFA 4JGZB 3OKDA 4IH3A 1G4EA 3TUUA 3J7LA 1I1FA 5A8MA 1DWHM 4FX5A 2OTWA 1HHIB 2PPFA 3TEUA 4CNPA 4BYYA 2QADD 1Z66A 3EMZA 3VXOA 2DVTA 3ABQA 4LOSA 3UBXB 2WLZA 3CU7A 2OL3A 1AX2A 1EYBA 4A04A 2TSBA 5FK9A 3IV8A 1YFYA 4YXLL 4ZJ9A 4TXVB 2WLKA 4F33B 4IOTA 2XCMC 4GQQA 4OZ4A 3D18A 1L6SA 4JCMA 5FKPA 1OSZA 3RYSA 1Z1WA 2R24A 2OXGB 4EE9A 3RGVC 2D2GA 3EJTA 1YO4A 4XP1H 3W7IA 4F9JA 3CWGA 4ZTOH 2WMHA 2Q0ZX 2OKTA 3CD4A 2ILMA 1E4LA 3B2MA 2PC8A 3MCNA 5L7XH 4KEMA 3TF7C 5I1AA 5DJ0A 3MB9A 1JN6A 1JTTA 1P7BA 5CGTA 4PJXE 3X2QB 4KRPD 3R4SA 3QJSB 4NCDA 1DJIA 2BC4B 4JTFA 5B4NA 4D6GA 3H2NA 3UJTH 2J8UF 3NIGB 2JD9A 3VA2C 2FE0A 3DETD 3NJFA 4PJDF 1FY6A 3HGOA 2WVVA 3BYTA 2UY8A 4F0LA 3F3HA 4P2QA 2BOGX 5CBIA 2EG6A 3PIQA 4NO2A 4FQ4A 4GIOA 5J6HA 5JYLA 4ZMVA 3WJJC 1CE1H 1WEJL 2NW3A 3GWQA 2R7EA 5IQLA 2DFBA 2V73A 4OCYL 2MPFA 1FWNA 3LLFA 3GSXB 3PNWB 3WFHA 4BIOA 3FQXB 2QQJA 1RU9H 2QF7A 4NHVA 3JXSA 4KKCD 1W8OA 1AD9A 2XU2A 2BP5M 1BX2A 5FRAA 3QGAC 3W81A 2BTVC 1YRZA 4KO5A 4ZXBB 2E7FA 1MR5A 4HZAA 2DIBA 1Q6EA 4H4IA 3KPNA 2YBKA 3LKSA 3HUJB 4CCOA 2YYOA 4KI5D 1OALA 4MWAC 1BXUA 3P11L 5AZ2L 1S7QB 3TNNA 1O9WA 3NJGA 3M7WA 1CU4H 1H9PA 2FVKA 2BZDA 3R19A 2R1YB 3IWVA 1BQHG 2F5AH 5FJHA 5D1QA 3TEXA 5BVPH 43C9B 5I1LA 3EX3A 4QRPD 3PTYA 1M7PA 3N9GL 3ZPYA 1H1YA 5HXMA 5FIEA 4GYKA 4M7KH 2VWEC 4X6CF 4AW4A 1QPRA 1ZBWA 1A3RH 1W2AX 1IS5A 4Y89A 2ZBJA 1RXFA 5EIYB 1XR9A 5ESVB 5JMCA 5IJCC 1T96A 3GTFA 1CT5A 2W1UA 3ITYA 3U9PH 3GSRA 3MJ7B 3RUBL 1J1XL 2G9HB 2FD6L 3UEQA 4EQVA 1ONRA 2X5PA 1Z0NA 4QCIB 3QUXC 2WMPB 3GMNA 5EF1A 4ZQTA 4GPNA 3A4AA 2W0XA 4BHUA 4F80A 2GC1A 3SGEH 4Z8FL 4YDLB 2OPKA 4TSAH 2YGLA 3FLRA 1PKQE 4NUBA 2PAKA 1BLNA 1F11A 3M8OH 2EXHA 3AJZA 2FK9A 4W6YA 3RSJA 1P2CB 1OFQA 2ATPB 4QLKA 4YDZA 1YY9D 2ZTJA 5A3IC 1O5RA 4DCQB 2K45A 5C4WB 3EX2A 4IRJA 4HF5L 1LOEA 1Q9WB 2EZ0C 2YQ3A 5F3EA 2I9UA 4PRID 5DJ2A 3N6YA 4H9XA 1PZDA 1NZRA 4PJHB 3BW4A 3W11D 2DWXA 1S9YA 4P5KA 2GPTA 3KYMA 4L8QA 5F89A 2XZCH 3RO6A 2NWSA 3IGUA 1R3IH 4C90A 2XWTB 3W0WB 4KX7A 1W1IE 4U5IA 3FY1A 2VQAA 5TE4L 2XH7A 2IXQA 4QMEA 1W8TA 1XL4A 1GJPA 1JRHI 3FC8A 3O0XA 4LVAA 1ET7A 5FZOA 1H8TC 3AT0A 1GEHA 3VD2A 2ZUQC 1RZIA 3UJSA 5LCVA 1URZA 2VUDA 4PJBF 3PAJA 4XQWA 3IU4L 5AFDA 1JZ8A 1Q0YH 2CBQA 5A5WA 1DXEA 5EORH 4KY1L 3BAKA 4F8PA 2PLJA 3SJVA 2Q4SA 2XZAH 1LLAA 1EWDA 4OOUA 5I3KA 1WZKA 4PTUA 4WUUE 3IDNB 5A43C 1ME7A 1ZP3A 4QRRB 4JQIA 5IV2B 1ZZ7A 2VITB 1RHI1 1EO8L 2EDFA 4Y5SA 4KOCA 2QJGA 1AR1D 3PQYD 1EDTA 1FA2A 3MJWA 4KO7A 4H7MA 4H41A 5HGBA 5I9QB 2Z92B 1Z3NA 3CTLA 5LGXA 3C5JA 1J83A 4M4RA 5LIWX 2ABAA 1TELA 1B2WH 2FO1A 4CC4C 2VMCA 4H88L 2VM9A 3V6ZB 1JNJA 1BOYA 1PD0A 3QD6A 1TREA 4HPGA 4NIYE 2Y1AA 2DJMA 1AGCB 5D1XD 5K3VA 5FLHA 3O1MA 3W9DA 4YIQA 1TQBC 4DP2X 3DO3A 1C8YA 25C8H 3BDYL 4J3OD 3D30A 4E9QA 2VFEA 4QLWA 1EC7A 4P5HA 4Q0PA 4C58B 3OQ3B 2W5PA 2YD2A 5EF2A 4E41B 2ALDA 1Q8VA 5KS9F 4JPWL 5KSBA 2OELA 1VFAA 3KS6A 1AH0A 2A9NH 2BINA 1MI3A 1HXYB 4XN8A 3KCWA 2H0EA 2NQCA 1DGLA 1BTMA 2YZ4A 4HPKB 4RAUB 3BIKA 4WV1A 5FY0A 2FJSA 4ZT1A 1RUSA 4ASMB 3QIWA 5U7SA 5F93C 3TK7A 3BYYA 4AHOA 3ZFGA 4QG9A 4N2FA 5E56A 2I9TA 2ZXWB 2PTZA 1KYUA 4PLJC 5SWSB 2GMMA 3NAVA 3UTSD 4W7UA 2FO4A 4H3WA 3CBJB 1PYWB 1D9KD 1AJ0A 5I1GH 1JAKA 4K3ZA 2PW2A 4NPYB 3OR7B 4XAWL 3B69A 4YUEH 1ECZA 3KWSA 3QIBB 3TC6A 4P9IA 2XG5A 4DERA 1G7YA 1N55A 1XF1A 5GRVL 1KFXL 4C55A 1OAQH 2OMZB 4TSCL 2B08A 1CLOH 3BSZA 3UH8A 4DN4H 4DWDA 1DFXA 2CDEA 2G2RB 1UX6A 4LR4A 2E47A 1HYSD 1EBGA 1T1YA 3TONA 3H4XA 1HKWA 2M83A 2JDUA 5J57B 2YS4A 2YD1A 2BSBA 4HS8L 5HMSA 3VXRB 1ZPUA 2VLKB 1BJMA 2XSBA 5F7LB 1GY2A 4HJ0C 4A3ZA 2Y7SA 1FWTA 3TYZA 3W6MA 1P5UB 4IOFD 4QY8A 3SE8H 4LK7A 1SBSH 4YC2B 3P0WA 1MJ8L 3G8EA 3B05A 3FKUS 4XUGA 1F2JA 5F2LA 4JDOA 3GSVB 2CO7B 1WCDJ 4Z7OE 2Y6TE 4FQIL 3OTTA 3PGFH 1CF8H 4MGXA 3RK8A 5D38A 5LVEA 4Y5YC 3U4BL 1MDLA 5HA7A 2WV3A 1IAIM 2FGLA 3ITOA 1OFRA 3RS6A 3KDMA 3QW3A 3E8UH 5HHME 1H19A 3IK4A 3OAZH 3WN6A 2HTMA 2WT0A 3FB6B 4D9QD 2YFNA 4NGHL 3FPYA 2MJWA 3EAKA 1XGZA 4PEEA 5EEVA 3CMJA 3MXWL 1JUIA 1GVEA 1A0DA 2CMRH 1WW4A 1SN5A 1E5YA 3VHRA 4XZIA 2EABA 5CFDA 1TCMA 4M9OA 4FQQA 3ES6A 2E56A 5BXSA 1MG2C 3EX1A 1RCYA 3E5QA 4D1IA 3O3UN 4YNGA 2OTPA 2EO1A 4B92A 1QW8A 2VABB 1LTDA 4LBUA 4L6DA 3NAAL 4JRLA 4L4TA 3M0XA 5IMMA 4MJ2A 4XCCL 2VXVH 4QQ3A 2HWGA 3PTKA 2HLAA 4HIIB 2ZOKA 2CO2A 1UHVA 2B4CL 4BA0A 3HHSB 3O2DA 3IXAB 3WS3B 2Z9TA 3T0ED 5DJAA 3BKCH 3TKFA 3ATGA 5F2MA 2JELL 3CLEL 4KVNL 2XPJA 1ND3C 3TE9A 2BVQB 3S1VA 4ZENA 3MX0B 3R4DA 4FLSA 1BFTA 2FWOA 3VE0B 4PS4H 4XNUL 4ELMB 3IYLW 3W9EB 2B5IB 5DXXA 2QTEA 3O41A 4HUWB 2WLNA 3PVNA 4PODA 2QHRH 4LKEA 2YN5A 5XINA 3RZKA 2QPSA 1LJYA 1RZGA 1UB6B 1DLHB 1PCSA 5AFBA 1XXFC 4GG8B 5I0ZA 3DUSB 4MGQA 1F31A 4XNZC 4GRMB 1MCQA 1ZRUA 2ABBA 3TS8A 3QW4B 2J8TA 4GJJA 1U58B 1T04A 4X4XA 3QZLA 4L3EB 2J24A 1HXJA 4JR5A 4M8RA 1KO0A 4ZFGL 5JORB 5JOEA 4DF0A 1FSKB 3SCMC 4JG0L 4AZ8B 3VD1A 4QQLA 1KN2L 1CLKA 2CBUA 1KTDA 3BT2L 3NCYP 1CF1A 4MCYB 1QR1A 3ZX7A 2WLHA 1S9WA 2HJPA 2X70A 3QZWG 2VEMA 2C1OB 1YTDA 1OYAA 2OZ3A 4FFTA 1OM3H 4I0PA 3MLUL 4O8AA 4QHRA 4UMSA 5T50A 2CLZA 5IFHL 1PWMA 4QT5B 4YXHH 3TT3H 3WN5A 1FHLA 1NANH 1QO3A 1P7HL 3V2AR 4Z3GA 4DP1X 4G6CA 3MRJB 3RFZB 3NL5A 1OXCA 2IIJA 1QJU2 4XBNA 3WKNA 5I8CA 3QEQD 3TVAA 2RDUA 1B3IA 3WIFB 1YN7B 1OLZA 1J87A 1FWAC 5CBLA 4C6NA 3E6DA 1XGQB 1VCBC 2WXMA 3T08A 3GPEA 3DOHA 5J5RA 3EUDA 4JGYA 1JHTB 2CM6A 2JK2A 2Z7YA 3WMPA 1I1CA 1QGLA 2R56L 3MUJA 2QJIA 5FZ3A 3N34A 3QEGH 2A4CA 1AZDA 3KQ4B 3T07A 2XJLA 4HNCA 3X14A 3ZO9A 3AROA 4PSRA 1V9U3 2JF6A 2VUKA 1NYWA 2Y62A 1WD4A 1V6JA 2ESVE 4XBSA 3HRZB 2Z65C 2P5ED 3DYMA 2VBBA 4JANB 4OQTL 3RB7A 3IVKA 4QHOA 4G6AC 4C56E 1EV2E 4P3WA 1U3ZA 2Z27A 2WKGA 2WA4A 1WDWA 2XYCA 3VI4F 5AAPA 3M5VA 4LAOA 1CGVA 1G9BA 4GO8A 2IVFC 2DI8A 2JK5A 5IB4A 1IILE 1QWUA 4WKHA 4NZRL 4OF7A 4ZBJA 4MXWH 1H2NA 3UPCA 2NZ9A 4N90D 5FMCA 4CDUC 3CQJA 2E28A 4UWDA 3ARBD 4FXJA 3S88L 2E67A 2OLDA 1NX9A 2JIGA 4US5A 3RDIA 4OM1L 3O6FC 1HCYA 4JFYA 3J7NA 2I17A 1TUPA 1UOBA 3L3KA 4WW2F 4DGVL 1U1HA 2EDHA 2X53S 1D8WA 3P4OB 4QPGC 2GMEA 5FFGA 1OD8A 1TNFA 4R5VA 1N7MH 3IARA 5BS0A 4ATWA 4KEZA 2A9ML 4I5BA 1DXFA 1RUKH 2BCKA 4JG5A 1M03A 4LO9A 3MJ9A 2MHAA 3BPSA 2VRAA 3DTDA 5CZXD 3O3RA 4UW4A 3ULVF 4RGMB 2BGSA 5I91A 1ZB5A 2HVJB 5AKQA 4FFFA 3C7HA 2VM8A 4K94H 4BQWA 5CAYB 3WDYA 1C93A 3M3QA 5AB9A 3CVIH 2GHWB 5LBBA 4UOW0 5IP4A 1E4MM 3HO8A 1YQ8A 3SH4A 5DZLA 5AKSA 4LRNH 1A7OL 2A3YA 1T83A 3WV6A 2W66A 2E53A 5K9JH 4KRZA 2XBO3 5JIWA 3A3WA 4E9LA 3LNHA 1U42A 1A4KA 2PO6A 2TAAA 1W6MB 1J8HD 5JXEC 3PU3A 4OGYH 4CP1A 3G6DL 4GSQA 1QLRB 5IXEA 4ZFCA 3NEVA 5LN4A 3WEXA 3D5OA 4PRTA 5E4IA 4ADJA 1FDJA 5LYRA 3K3OA 4BSJA 4XBEL 3DCPA 1TLKA 4MGGA 3SD2A 1SDYA 4EI5D 3PNUA 5CGYC 1M3UA 2DL2A 1W9YA 3L95B 2L7UA 3DARA 2YUZA 4PJIA 2G5BA 2WJZA 1C8QA 1MHHB 2VVEA 4XFCA 5C7VA 1OUXA 1WS8A 1ZM1A 3NZHL 2D2JA 3SBWC 1XF2B 2VRJA 1TME2 2GC7C 4S3JA 2HH0L 3KNBB 2EXIA 1RJRA 4WKXA 4OUMA 1UG9A 4WJ5B 2GFTA 1M05A 1C08A 3WLBA 2F58H 3ZX1A 5F3CA 3WG7B 2X9WA 1T89A 1NC2A 1LP9E 4E2SA 1GSKA 1YG9A 1EDYA 4BK9A 2FVMA 5IESL 1HJBC 2CEQA 4IFOA 1QMLA 2IPKA 1DG6A 1DVTA 1UXMA 3DFTA 3AMLA 4G1EB 4ORFA 2VSCA 3OKDB 1XEUA 1ZBA2 2LFGA 1I1FB 1OP3H 2X4QB 2IQ9L 4XPFL 4N8CL 5A1LA 2ZZ6A 5CD5C 3OZ9L 5LIUX 2HEWF 5DCCA 5LGHH 5HNUA 1IEAB 3VXOB 4RQPA 2Z8SA 2BSRA 2IXIA 2OL3B 1N3OA 3WQ4A 2HT2C 5ESQA 4W9JC 4CD5A 2O56A 2Z35A 2FDFA 1NBVH 4Y88A 3O3AA 4H8QA 4AGRA 4OZ4B 3D18B 2ISDA 3CIHA 4MYXA 3TAYA 5FKPB 4EIBA 1OSZB 3K80A 5CJXC 2VDPL 4WTWA 4Q4X1 3VCNA 2HN7B 3LS5L 1NU5A 3HA0A 3PWUA 5JQIB 1I0DA 1OTTD 3V0AC 3KPTA 1NDMA 2PDGA 3L1OH 4F48A 3KZ4C 3GMLB 5IT2L 1M3JA 4KIEA 4LBRA 4KH2A 1KLFA 2CO6A 4ILDA 5I1AB 5DJ0B 3IPVB 3G1YA 4TUKL 2VMFA 3IE4A 4JFEA 2ZSWA 4FTBA 1E70M 4ISVA 3PSVA 2WC2A 4R9OA 4TTUA 2IF7A 1E51A 1LOGA 3ILNA 4N2YA 1CURA 4IXXA 4BZ4A 2WNEA 3KAOA 1BW8A 2C5DC 4P2QB 1F9CA 2Y06H 3N1AA 2GPZA 2A6DB 2TRHA 3PIQB 1VBD2 1PY9A 2PDHA 3Q94A 1KYOJ 4NBXB 4FHKA 1YUDA 4WHYH 2FQIA 4LRIC 1KBGH 4H6KA 2R7EB 1N1VA 3LHYA 4PGLA 1NFDA 2E7MA 4F0KA 4HKBA 3WFHB 4EN2A 1OA4A 4HCHA 3U25A 1X36A 1NJ9A 2F6BA 3Q8FA 1QACA 2BO0A 4GP8B 2GBTA 3CWHA 3BAWA 2YQ2A 4NT6A 3D3VD 1AD9B 4JPVL 4HN1A 1BX2B 4AVOA 1IKOP 4FFGA 5H91A 4PRPD 3KPNB 1M6UA 4FFVD 4KWWA 3QGVA 3LPPA 2D3NA 1ITCA 5LG1A 1OQDA 3SDAA 3TNNB 3NFPA 4LU0A 4L9ZA 3N12A 4WM7C 4XAAA 2ZKHL 4I30A 4LKXB 5HAOA 3W7DA 3CXHJ 2AABL 1O7AA 1AQKH 3ULSA 4GXLA 3EBGA 3V5OA 1KGUA 5D1QB 5IW3A 1TPH1 4WUIA 2O0OA 5SV3A 1S4IA 1IBFA 3V0EA 3BVUA 4XZHA 5KVFE 3WKML 4AEHL 3MREA 5T5NG 4I0KA 3QBTB 1XR9B 3LSCA 4L8BB 3V35A 4BJHA 1HIML 3Q6FA 1W54A 2BNJA 1QD0A 4DJEC 4EWJA 4KBPA 2F08A 4GRLC 3INPA 3AFKA 3GMNB 4GAJH 5DQDH 43CAA 3L5LA 2R0ZH 3QYMA 3EKZA 4PRAA 1I8LC 3RU8H 4PJGA 1TZIB 2ZYHA 4X8NA 1E2ZA 2MNUA 5J98B 1XIIA 2ZUMA 1BLNB 1F11B 1SFNA 3OGSA 4GQGA 1FL3B 4Y1AD 2QT6A 1UPSA 2AV1B 4P4KC 3V52H 3AT8A 4XE0A 2P7TB 4PFHA 2MKLC 2BVEA 3OF6D 1YJDC 1QFUH 1YJDL 1W8HA 1LOLA 5DJ2B 3T30A 3CH0A 3O06A 2DLFL 2FH6A 2A6LA 1RHFA 2X0UA 1HOCA 2WWKT 1S9YB 1SG3A 4P5KB 3S3SA 1QZNA 4OCXL 3KYMB 4ZNCD 5F89B 1JS4A 5EULV 1W1YA 2GOUA 2XGIA 3NG5A 1ZS8A 4RETB 1UTDA 2NUXA 2LT9A 4QAWA 4F33A 1QNOA 2VXRA 1YDNA 1RUPL 5I8SA 2J42A 2OFQA 3I6SA 1X9UA 4G9FD 2IXQB 4AYSA 4RZBA 4JQVC 4LDOB 5I6KA 1DVZA 2K3HA 1N6QH 4YXGA 3VI3E 5FZOB 1U92A 2I5QA 2IPUG 1UH2A 4G9PA 5I8OH 2X05A 4Q4V3 1QWNA 4GW4B 1OGPA 1AL7A 3M16A 2VIRA 2VX7A 4A8IA 4WW2C 5IVXB 1L7QA 1K8ZA 3L67A 2NQYA 1HKIA 4Z95L 3NQ7A 5TPWH 3SJVB 2BWDA 2FBEA 2BC4A 4PTUB 2DS4A 4Y2DC 5FY4A 3C3NA 1UD3A 2WWDA 4BF7A 5C33A 3MODL 3TBWA 1F97A 5GQBA 2ZOUA 4YE4H 1CFVL 5IJKC 3VKJA 3DHDA 4GUFA 1YPZE 4PULA 5HGBB 4AG4H 3NYKA 3UYCA 4XN4A 3C5JB 4EXKA 4K38A 4R6UA 1AXIB 2C9PA 4K5MA 1B0IA 4JAMB 3ULVL 1TTJA 3VGBA 3W2DH 2UWEE 3IDXL 1L7IL 3O8XD 5DRXB 4HVQA 2YHGA 2Q7NA 1JE6A 4XBKA 1OPGL 3PNWA 4OVUA 3VXME 3PAUA 4B4HA 5FZLA 4YIQB 2ED6A 2YPLD 4PBFA 2Y6KA 1R7AA 1HJUA 1DEEB 3HOJA 1ZA3A 4P46D 4TQEL 5IIEA 5T1DH 2W52A 4RMQA 4KK6D 5DCEA 1HIXA 1IAII 5KSBB 5D03A 3F8UB 1VFAB 2WWCA 2JE9A 5TQ2H 4CVXA 1XLEA 5ADPL 5A6TC 3UWEA 2B9VA 2XUMA 3EDJA 4RPQA 1SLBA 4Z7QB 3VYLA 4ZO8A 2VDLB 2VQ4A 3L8QA 4WV1B 2VNGA 3QIWB 1TZZA 5A95A 2FVLA 1EEYA 3L4CA 5J12B 2ENSA 3ZFGB 5CC3A 2Z0UA 3Q44A 2VQ1A 5CJOL 1JXDA 2QE3A 5F1OB 1THCA 4AZZA 4JY8A 2DTSA 2HBVA 2KLTA 4YVVA 1EWHA 2PW2B 2BWIA 2WXQA 4W9ZA 1PG7H 4GA9A 1E9IA 5C0JB 1SJAA 2X4TB 5FYJU 3DEQA 1JPHA 3H9ZA 4LKDA 1I7TB 3SZ6A 4N7IA 1ASQA 4S3EA 2CDEB 1ULGA 3MJ7A 2G9HA 4MNQE 4W9GC 4S3CA 5H9SA 2J7GA 2EIBA 1Q7MA 4HCFA 3L1EA 1HINL 1DQML 3NXFA 5D5MF 1R75A 1UWXH 4OFCA 2VOTA 1KLZA 5AC8A 3A6CH 4QY8B 1XBRA 3ZE1F 3TVMD 1QIQA 5DJZB 3D51A 4YMZA 5CP7A 1WAPA 1P2CA 1OSGA 1E5NA 1XYFA 2AYHA 1Q6CA 4D9RD 4AY0A 5HDQH 2WNGA 3IPWA 3BTYA 2DGAA 4PMJA 3NIFF 4PD4J 3JVAA 2GJ6E 4N0UE 4Z1AA 2QPDB 4DYEA 1Y4WA 4IJ3C 3B2PA 1MWAH 2CY6A 4B9FA 4MZRA 4JM4L 3PNZA 4BK4A 4NWTL 1GS7A 2CZVA 4JDEA 3M0IA 3C3UA 2ET7A 4PMEA 2EVHA 3OQ8A 3QWOB 1IR1A 4JQ3A 3OUHA 1F74A 2XJTA 2P5WA 1ESWA 4AQ2A 1IGML 2YLKA 2G19A 4UOQA 3PJUA 1NA1B 4I5UA 5CFDB 1IGJA 4BIFA 2EC9U 4PV1C 4YLWA 1UM5L 4FQQB 3ES6B 3PZIA 1ZBCA 1IB5A 1A47A 3V4PB 2P50A 1OLME 3H9SD 1GHFH 5GNXA 3WMCA 3GJFB 4RGKA 3ETTA 8XIMA 4F5CA 1Y43B 4L4TB 2VZRA 5EIVA 2I07A 4DJDA 2HT3C 4JPQA 5IMMB 3GC2A 2CKBA 3MLZL 5EU6E 2HLAB 2ZOKB 1RY7B 5D55A 5FA4A 1S7RB 2GSMB 3T2PA 1UKSA 5DJAB 3UTPD 2CERA 4HBNA 3TJ4A 2NW2A 5ENWB 1GOOA 3HIJA 4